1MF8A

Crystal structure of human calcineurin complexed with cyclosporin a and human cyclophilin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
352
structure length
352
Chain Sequence
AVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Calcineurin Complexed with Cyclosporin a and Human Cyclophilin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT, ALPHA ISOFORM
total genus 121
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1mf8A00
3DSDA 3QFMA 3E7BA 3H63A 3IVDA 3AV0A 4M0VA 2O8AA 2Z06A 3H68A 1T70A 1XZWA 4JA9A 2HY1A 5J28A 4Q7FA 1T71A 3N5UA 5IOHA 3H61A 4FBKA 2JOGA 1Z2WA 4UT3A 5JPFA 3FGAC 4LACC 1UF3A 1W24A 2YVTA 4MP0A 1U32A 4V0WA 3ICFA 2NPPC 3P71C 2BDXA 4ORBA 4ZX2A 3HVQA 1G5BA 2WDFA 4UT3B 3V4YA 3IVEA 1OIEA 3C5WC 4I5LC 1II7A 2IE4C 1MF8A 3H64A 3RQZA 1IT6A 4ORAA 5INBA 1SU1A 2R17A 2WDDA 4IL1A 4DHLA 4NZVA 2USHA 3PSOA 1WARA 3JYFA 1S70A 3K7WC 2HYOA 2WDCA 4ZVZA 1QHWA 3DW8C 3QFOA 4H2GA 2QFRA 2QJCA 4O4KA 3H69A 2Z72A 2O8GA 4LTYA 4FCXA 4TUGA 2DFJA 3H67A 4H1SA 4V0VA 2ZBMA 4V0XA 4F0ZA 4JA7A 3K7VC 3RL3A 4YKEA 4OR9A 1UTEA 4J6OA 4DSYA 2P6BA 2Q8UA 4XPNA 1AUIA 1XM7A 1S95A 1V73A 3H66A 1HP1A 4KBPA 4H2BA 1KBPA 1S3MA 3T1IA 5EQVA 3ZU0A 4O43A 3AUZA 4TUIA 3RL4A 2GJUA 4FBWA 2XMOA 2Z1AA 5JJTA 3ZTVA 4H2IA 3DSCA 4DT2A 1S8EA 2IAEC 3KBPA 3THNA 1OIDA 3TGHA 3IB7A 1Z2XA 2BQ8X 2NYMC 2NXFA 4I5NC 3H60A 2BCDA 3GVEA 2KKNA 2CV9A 4MOYA 1OI8A 4O24A 3QG5C 2HYPA 2NYLC 2QFPA 3EGGA 3QFNA 2AHDA 4G9JA 4WWLA 4B2OA 5DNYA 1FJMA 3QFKA 5JPEA 3CK2A 3LL8A 1HO5A 4IYPC 4O5GA 3RL5A 1QFCA 4FBQA 1S3LA 1HPUA 2IE3C 3PSNA 4HD0A 3C9FA 1S3NA 1M63A 3E7AA 4MOVA 2A22A 4UT2A 1WAO1 4ORCA 4H2FA 5GTUA 1JK7A 5C1VA 5F3WA 4UWQA 1USHA 3H62B 1NNWA 1TCOA 5B8IA 4H1YP 3THOB 2WDEA 5HPEA 3IB8A 4KKZA 4LU9A 3EGHA
chains in the Genus database with same CATH superfamily
3DSDA 3QFMA 3E0JA 3E7BA 3H63A 3IVDA 3AV0A 4M0VA 2O8AA 2Z06A 3H68A 1T70A 1XZWA 2DXLA 4JA9A 2HY1A 5J28A 4Q7FA 1T71A 3N5UA 5IOHA 3H61A 4FBKA 2JOGA 1Z2WA 4UT3A 5JPFA 3FGAC 4LACC 1UF3A 1W24A 2YVTA 4MP0A 1U32A 4V0WA 3ICFA 2NPPC 3P71C 2BDXA 4ORBA 4ZX2A 3HVQA 1G5BA 2WDFA 4UT3B 3V4YA 3IVEA 1OIEA 3C5WC 4I5LC 1II7A 2IE4C 1MF8A 3H64A 3RQZA 1IT6A 4ORAA 5INBA 1SU1A 2R17A 2WDDA 4IL1A 4DHLA 4NZVA 2USHA 3PSOA 1WARA 3JYFA 1S70A 3K7WC 2HYOA 2WDCA 4ZVZA 1QHWA 3DW8C 3QFOA 4H2GA 2QFRA 2QJCA 4O4KA 3H69A 2Z72A 2O8GA 4LTYA 4FCXA 4TUGA 2DFJA 3H67A 4H1SA 4V0VA 2ZBMA 4V0XA 4F0ZA 4JA7A 2DXNA 3K7VC 3RL3A 4YKEA 4OR9A 1UTEA 4J6OA 4DSYA 2P6BA 2Q8UA 4XPNA 1AUIA 1XM7A 1S95A 1V73A 3H66A 1HP1A 4KBPA 4H2BA 1KBPA 1S3MA 3T1IA 5EQVA 3ZU0A 4O43A 3AUZA 4TUIA 3RL4A 2GJUA 3FLOA 4FBWA 2XMOA 2Z1AA 5JJTA 3ZTVA 4H2IA 3DSCA 4DT2A 1S8EA 2IAEC 3KBPA 3THNA 1OIDA 3TGHA 3IB7A 1Z2XA 2BQ8X 2NYMC 2NXFA 3D03A 4I5NC 3H60A 2BCDA 3GVEA 2KKNA 2CV9A 4MOYA 1OI8A 4O24A 3QG5C 2HYPA 2NYLC 2QFPA 3EGGA 3QFNA 2AHDA 4G9JA 4WWLA 4B2OA 5DNYA 1FJMA 2ZO9B 3QFKA 5JPEA 3CK2A 3LL8A 1HO5A 4IYPC 4O5GA 3RL5A 1QFCA 4FBQA 1S3LA 2YEQA 1HPUA 2IE3C 3PSNA 4HD0A 3C9FA 1S3NA 1M63A 3E7AA 4MOVA 2A22A 4UT2A 1WAO1 4ORCA 4H2FA 5GTUA 1JK7A 5C1VA 5F3WA 2ZOAA 4UWQA 1USHA 3H62B 1NNWA 1TCOA 5B8IA 4H1YP 3THOB 2WDEA 5HPEA 3IB8A 4KKZA 4LU9A 3EGHA
chains in the Genus database with same CATH topology
3DSDA 3QFMA 3E0JA 3E7BA 3H63A 3IVDA 3AV0A 4M0VA 2O8AA 2Z06A 3H68A 1T70A 1XZWA 2DXLA 4JA9A 2HY1A 5J28A 4Q7FA 1T71A 3N5UA 5IOHA 3H61A 4FBKA 2JOGA 1Z2WA 4UT3A 5JPFA 3FGAC 4LACC 1UF3A 1W24A 2YVTA 4MP0A 1U32A 4V0WA 3ICFA 2NPPC 3P71C 2BDXA 4ORBA 4ZX2A 3HVQA 1G5BA 2WDFA 4UT3B 3V4YA 3IVEA 1OIEA 3C5WC 4I5LC 1II7A 2IE4C 1MF8A 3H64A 3RQZA 1IT6A 4ORAA 5INBA 1SU1A 2R17A 2WDDA 4IL1A 4DHLA 4NZVA 2USHA 3PSOA 1WARA 3JYFA 1S70A 3K7WC 2HYOA 2WDCA 4ZVZA 1QHWA 3DW8C 3QFOA 4H2GA 2QFRA 2QJCA 4O4KA 3H69A 2Z72A 2O8GA 4LTYA 4FCXA 4TUGA 2DFJA 3H67A 4H1SA 4V0VA 2ZBMA 4V0XA 4F0ZA 4JA7A 2DXNA 3K7VC 3RL3A 4YKEA 4OR9A 1UTEA 4J6OA 4DSYA 2P6BA 2Q8UA 4XPNA 1AUIA 1XM7A 1S95A 1V73A 3H66A 1HP1A 4KBPA 4H2BA 1KBPA 1S3MA 3T1IA 5EQVA 3ZU0A 4O43A 3AUZA 4TUIA 3RL4A 2GJUA 3FLOA 4FBWA 2XMOA 2Z1AA 5JJTA 3ZTVA 4H2IA 3DSCA 4DT2A 1S8EA 2IAEC 3KBPA 3THNA 1OIDA 3TGHA 3IB7A 1Z2XA 2BQ8X 2NYMC 2NXFA 3D03A 4I5NC 3H60A 2BCDA 3GVEA 2KKNA 2CV9A 4MOYA 1OI8A 4O24A 3QG5C 2HYPA 2NYLC 2QFPA 3EGGA 3QFNA 2AHDA 4G9JA 4WWLA 4B2OA 5DNYA 1FJMA 2ZO9B 3QFKA 5JPEA 3CK2A 3LL8A 1HO5A 4IYPC 4O5GA 3RL5A 1QFCA 4FBQA 1S3LA 2YEQA 1HPUA 2IE3C 3PSNA 4HD0A 3C9FA 1S3NA 1M63A 3E7AA 4MOVA 2A22A 4UT2A 1WAO1 4ORCA 4H2FA 5GTUA 1JK7A 5C1VA 5F3WA 2ZOAA 4UWQA 1USHA 3H62B 1NNWA 1TCOA 5B8IA 4H1YP 3THOB 2WDEA 5HPEA 3IB8A 4KKZA 4LU9A 3EGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSD A;  3QFM A;  3E7B A;  3H63 A;  3IVD A;  3AV0 A;  4M0V A;  2O8A A;  2Z06 A;  3H68 A;  1T70 A;  1XZW A;  4JA9 A;  2HY1 A;  5J28 A;  4Q7F A;  1T71 A;  3N5U A;  5IOH A;  3H61 A;  4FBK A;  2JOG A;  1Z2W A;  4UT3 A;  5JPF A;  3FGA C;  4LAC C;  1UF3 A;  1W24 A;  2YVT A;  4MP0 A;  1U32 A;  4V0W A;  3ICF A;  2NPP C;  3P71 C;  2BDX A;  4ORB A;  4ZX2 A;  3HVQ A;  1G5B A;  2WDF A;  4UT3 B;  3V4Y A;  3IVE A;  1OIE A;  3C5W C;  4I5L C;  1II7 A;  2IE4 C;  1MF8 A;  3H64 A;  3RQZ A;  1IT6 A;  4ORA A;  5INB A;  1SU1 A;  2R17 A;  2WDD A;  4IL1 A;  4DHL A;  4NZV A;  2USH A;  3PSO A;  1WAR A;  3JYF A;  1S70 A;  3K7W C;  2HYO A;  2WDC A;  4ZVZ A;  1QHW A;  3DW8 C;  3QFO A;  4H2G A;  2QFR A;  2QJC A;  4O4K A;  3H69 A;  2Z72 A;  2O8G A;  4LTY A;  4FCX A;  4TUG A;  2DFJ A;  3H67 A;  4H1S A;  4V0V A;  2ZBM A;  4V0X A;  4F0Z A;  4JA7 A;  3K7V C;  3RL3 A;  4YKE A;  4OR9 A;  1UTE A;  4J6O A;  4DSY A;  2P6B A;  2Q8U A;  4XPN A;  1AUI A;  1XM7 A;  1S95 A;  1V73 A;  3H66 A;  1HP1 A;  4KBP A;  4H2B A;  1KBP A;  1S3M A;  3T1I A;  5EQV A;  3ZU0 A;  4O43 A;  3AUZ A;  4TUI A;  3RL4 A;  2GJU A;  4FBW A;  2XMO A;  2Z1A A;  5JJT A;  3ZTV A;  4H2I A;  3DSC A;  4DT2 A;  1S8E A;  2IAE C;  3KBP A;  3THN A;  1OID A;  3TGH A;  3IB7 A;  1Z2X A;  2BQ8 X;  2NYM C;  2NXF A;  4I5N C;  3H60 A;  2BCD A;  3GVE A;  2KKN A;  2CV9 A;  4MOY A;  1OI8 A;  4O24 A;  3QG5 C;  2HYP A;  2NYL C;  2QFP A;  3EGG A;  3QFN A;  2AHD A;  4G9J A;  4WWL A;  4B2O A;  5DNY A;  1FJM A;  3QFK A;  5JPE A;  3CK2 A;  3LL8 A;  1HO5 A;  4IYP C;  4O5G A;  3RL5 A;  1QFC A;  4FBQ A;  1S3L A;  1HPU A;  2IE3 C;  3PSN A;  4HD0 A;  3C9F A;  1S3N A;  1M63 A;  3E7A A;  4MOV A;  2A22 A;  4UT2 A;  1WAO 1;  4ORC A;  4H2F A;  5GTU A;  1JK7 A;  5C1V A;  5F3W A;  4UWQ A;  1USH A;  3H62 B;  1NNW A;  1TCO A;  5B8I A;  4H1Y P;  3THO B;  2WDE A;  5HPE A;  3IB8 A;  4KKZ A;  4LU9 A;  3EGH A; 
#chains in the Genus database with same CATH topology
 3DSD A;  3QFM A;  3E0J A;  3E7B A;  3H63 A;  3IVD A;  3AV0 A;  4M0V A;  2O8A A;  2Z06 A;  3H68 A;  1T70 A;  1XZW A;  2DXL A;  4JA9 A;  2HY1 A;  5J28 A;  4Q7F A;  1T71 A;  3N5U A;  5IOH A;  3H61 A;  4FBK A;  2JOG A;  1Z2W A;  4UT3 A;  5JPF A;  3FGA C;  4LAC C;  1UF3 A;  1W24 A;  2YVT A;  4MP0 A;  1U32 A;  4V0W A;  3ICF A;  2NPP C;  3P71 C;  2BDX A;  4ORB A;  4ZX2 A;  3HVQ A;  1G5B A;  2WDF A;  4UT3 B;  3V4Y A;  3IVE A;  1OIE A;  3C5W C;  4I5L C;  1II7 A;  2IE4 C;  1MF8 A;  3H64 A;  3RQZ A;  1IT6 A;  4ORA A;  5INB A;  1SU1 A;  2R17 A;  2WDD A;  4IL1 A;  4DHL A;  4NZV A;  2USH A;  3PSO A;  1WAR A;  3JYF A;  1S70 A;  3K7W C;  2HYO A;  2WDC A;  4ZVZ A;  1QHW A;  3DW8 C;  3QFO A;  4H2G A;  2QFR A;  2QJC A;  4O4K A;  3H69 A;  2Z72 A;  2O8G A;  4LTY A;  4FCX A;  4TUG A;  2DFJ A;  3H67 A;  4H1S A;  4V0V A;  2ZBM A;  4V0X A;  4F0Z A;  4JA7 A;  2DXN A;  3K7V C;  3RL3 A;  4YKE A;  4OR9 A;  1UTE A;  4J6O A;  4DSY A;  2P6B A;  2Q8U A;  4XPN A;  1AUI A;  1XM7 A;  1S95 A;  1V73 A;  3H66 A;  1HP1 A;  4KBP A;  4H2B A;  1KBP A;  1S3M A;  3T1I A;  5EQV A;  3ZU0 A;  4O43 A;  3AUZ A;  4TUI A;  3RL4 A;  2GJU A;  3FLO A;  4FBW A;  2XMO A;  2Z1A A;  5JJT A;  3ZTV A;  4H2I A;  3DSC A;  4DT2 A;  1S8E A;  2IAE C;  3KBP A;  3THN A;  1OID A;  3TGH A;  3IB7 A;  1Z2X A;  2BQ8 X;  2NYM C;  2NXF A;  3D03 A;  4I5N C;  3H60 A;  2BCD A;  3GVE A;  2KKN A;  2CV9 A;  4MOY A;  1OI8 A;  4O24 A;  3QG5 C;  2HYP A;  2NYL C;  2QFP A;  3EGG A;  3QFN A;  2AHD A;  4G9J A;  4WWL A;  4B2O A;  5DNY A;  1FJM A;  2ZO9 B;  3QFK A;  5JPE A;  3CK2 A;  3LL8 A;  1HO5 A;  4IYP C;  4O5G A;  3RL5 A;  1QFC A;  4FBQ A;  1S3L A;  2YEQ A;  1HPU A;  2IE3 C;  3PSN A;  4HD0 A;  3C9F A;  1S3N A;  1M63 A;  3E7A A;  4MOV A;  2A22 A;  4UT2 A;  1WAO 1;  4ORC A;  4H2F A;  5GTU A;  1JK7 A;  5C1V A;  5F3W A;  2ZOA A;  4UWQ A;  1USH A;  3H62 B;  1NNW A;  1TCO A;  5B8I A;  4H1Y P;  3THO B;  2WDE A;  5HPE A;  3IB8 A;  4KKZ A;  4LU9 A;  3EGH A; 
#chains in the Genus database with same CATH homology
 3DSD A;  3QFM A;  3E0J A;  3E7B A;  3H63 A;  3IVD A;  3AV0 A;  4M0V A;  2O8A A;  2Z06 A;  3H68 A;  1T70 A;  1XZW A;  2DXL A;  4JA9 A;  2HY1 A;  5J28 A;  4Q7F A;  1T71 A;  3N5U A;  5IOH A;  3H61 A;  4FBK A;  2JOG A;  1Z2W A;  4UT3 A;  5JPF A;  3FGA C;  4LAC C;  1UF3 A;  1W24 A;  2YVT A;  4MP0 A;  1U32 A;  4V0W A;  3ICF A;  2NPP C;  3P71 C;  2BDX A;  4ORB A;  4ZX2 A;  3HVQ A;  1G5B A;  2WDF A;  4UT3 B;  3V4Y A;  3IVE A;  1OIE A;  3C5W C;  4I5L C;  1II7 A;  2IE4 C;  1MF8 A;  3H64 A;  3RQZ A;  1IT6 A;  4ORA A;  5INB A;  1SU1 A;  2R17 A;  2WDD A;  4IL1 A;  4DHL A;  4NZV A;  2USH A;  3PSO A;  1WAR A;  3JYF A;  1S70 A;  3K7W C;  2HYO A;  2WDC A;  4ZVZ A;  1QHW A;  3DW8 C;  3QFO A;  4H2G A;  2QFR A;  2QJC A;  4O4K A;  3H69 A;  2Z72 A;  2O8G A;  4LTY A;  4FCX A;  4TUG A;  2DFJ A;  3H67 A;  4H1S A;  4V0V A;  2ZBM A;  4V0X A;  4F0Z A;  4JA7 A;  2DXN A;  3K7V C;  3RL3 A;  4YKE A;  4OR9 A;  1UTE A;  4J6O A;  4DSY A;  2P6B A;  2Q8U A;  4XPN A;  1AUI A;  1XM7 A;  1S95 A;  1V73 A;  3H66 A;  1HP1 A;  4KBP A;  4H2B A;  1KBP A;  1S3M A;  3T1I A;  5EQV A;  3ZU0 A;  4O43 A;  3AUZ A;  4TUI A;  3RL4 A;  2GJU A;  3FLO A;  4FBW A;  2XMO A;  2Z1A A;  5JJT A;  3ZTV A;  4H2I A;  3DSC A;  4DT2 A;  1S8E A;  2IAE C;  3KBP A;  3THN A;  1OID A;  3TGH A;  3IB7 A;  1Z2X A;  2BQ8 X;  2NYM C;  2NXF A;  3D03 A;  4I5N C;  3H60 A;  2BCD A;  3GVE A;  2KKN A;  2CV9 A;  4MOY A;  1OI8 A;  4O24 A;  3QG5 C;  2HYP A;  2NYL C;  2QFP A;  3EGG A;  3QFN A;  2AHD A;  4G9J A;  4WWL A;  4B2O A;  5DNY A;  1FJM A;  2ZO9 B;  3QFK A;  5JPE A;  3CK2 A;  3LL8 A;  1HO5 A;  4IYP C;  4O5G A;  3RL5 A;  1QFC A;  4FBQ A;  1S3L A;  2YEQ A;  1HPU A;  2IE3 C;  3PSN A;  4HD0 A;  3C9F A;  1S3N A;  1M63 A;  3E7A A;  4MOV A;  2A22 A;  4UT2 A;  1WAO 1;  4ORC A;  4H2F A;  5GTU A;  1JK7 A;  5C1V A;  5F3W A;  2ZOA A;  4UWQ A;  1USH A;  3H62 B;  1NNW A;  1TCO A;  5B8I A;  4H1Y P;  3THO B;  2WDE A;  5HPE A;  3IB8 A;  4KKZ A;  4LU9 A;  3EGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...