1MF8A

Crystal structure of human calcineurin complexed with cyclosporin a and human cyclophilin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
352
structure length
352
Chain Sequence
AVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT, ALPHA ISOFORM
publication title Crystal Structure of Human Calcineurin Complexed with Cyclosporin a and Human Cyclophilin
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1mf8A00
2AHDA 2O8GA 2WDDA 4MOYA 4MP0A 4TUIA 3E7BA 2BDXA 1SU1A 4O43A 1WAO1 4G9JA 3LL8A 3JYFA 2IE3C 5JPFA 1NNWA 2KKNA 2ZBMA 3HVQA 4LTYA 1HPUA 2WDFA 2Q8UA 4IL1A 3H66A 2QFRA 3TGHA 1G5BA 2O8AA 5IOHA 2YVTA 3ZU0A 1S3MA 3IVEA 2Z72A 4F0ZA 4JA9A 4XPNA 4FBQA 2BQ8X 3DW8C 2WDEA 2BCDA 3AV0A 3IB8A 4IYPC 3RL3A 1QFCA 2NPPC 1II7A 4OR9A 3C5WC 3N5UA 1OIDA 3QFOA 1FJMA 1QHWA 4O4KA 3E7AA 2QJCA 3V4YA 1WARA 1Z2WA 4KKZA 2NXFA 3DSDA 4H1YP 4H2FA 1W24A 1OIEA 4O24A 5J28A 3FGAC 4FBWA 1USHA 4ORAA 4MOVA 2IE4C 3RQZA 4UWQA 2A22A 3ICFA 3H62B 4ORBA 1HO5A 4O5GA 3IB7A 4UT2A 4DSYA 5B8IA 4M0VA 2HY1A 4LU9A 1Z2XA 2HYPA 4DT2A 4H2BA 4TUGA 2GJUA 1V73A 3H67A 3PSOA 3K7WC 4FCXA 1MF8A 1UF3A 3H64A 5GTUA 3QFNA 1OI8A 4KBPA 5EQVA 1S3NA 4J6OA 3H61A 3CK2A 2Z1AA 3H63A 4UT3B 4H2GA 4YKEA 1XM7A 1TCOA 3EGGA 1S95A 3PSNA 4H2IA 1XZWA 3H60A 3GVEA 2WDCA 4HD0A 2Z06A 4V0XA 5HPEA 3RL5A 3ZTVA 4Q7FA 5JJTA 1S3LA 4UT3A 3RL4A 3IVDA 3QG5C 4LACC 4JA7A 3AUZA 1S70A 2P6BA 1IT6A 3P71C 1S8EA 4H1SA 2USHA 3QFKA 2CV9A 2XMOA 3THNA 2R17A 3EGHA 4I5NC 1AUIA 1KBPA 1HP1A 1T71A 1M63A 2QFPA 3C9FA 1T70A 2NYMC 4FBKA 4B2OA 4ZVZA 2NYLC 5F3WA 4DHLA 5INBA 2DFJA 4V0VA 3QFMA 3T1IA 3H69A 1U32A 5C1VA 5JPEA 5DNYA 1JK7A 3DSCA 3KBPA 3THOB 2JOGA 2HYOA 4V0WA 4I5LC 4ORCA 1UTEA 4WWLA 3H68A 3K7VC 2IAEC 4ZX2A 4NZVA
chains in the Genus database with same CATH superfamily
2AHDA 2O8GA 2WDDA 4MOYA 4MP0A 4TUIA 3E7BA 2BDXA 1SU1A 4O43A 1WAO1 4G9JA 3LL8A 3JYFA 2IE3C 5JPFA 1NNWA 2KKNA 2ZBMA 3HVQA 4LTYA 1HPUA 2WDFA 2Q8UA 4IL1A 3H66A 2QFRA 3TGHA 1G5BA 2O8AA 5IOHA 2YVTA 3ZU0A 1S3MA 3IVEA 2Z72A 4F0ZA 4JA9A 4XPNA 4FBQA 2BQ8X 3DW8C 2WDEA 2BCDA 3AV0A 3IB8A 4IYPC 3RL3A 1QFCA 2NPPC 1II7A 4OR9A 3C5WC 3N5UA 1OIDA 3QFOA 1FJMA 1QHWA 4O4KA 3E7AA 2QJCA 3V4YA 1WARA 1Z2WA 4KKZA 2NXFA 3DSDA 4H1YP 4H2FA 1W24A 1OIEA 4O24A 5J28A 3FGAC 4FBWA 1USHA 4ORAA 4MOVA 2IE4C 3RQZA 4UWQA 2A22A 3ICFA 3H62B 4ORBA 1HO5A 4O5GA 3IB7A 4UT2A 4DSYA 5B8IA 2DXLA 4M0VA 2HY1A 4LU9A 1Z2XA 2HYPA 4DT2A 4H2BA 4TUGA 2GJUA 1V73A 3H67A 2YEQA 3K7WC 3PSOA 4FCXA 1MF8A 1UF3A 3H64A 5GTUA 3QFNA 1OI8A 4KBPA 5EQVA 1S3NA 4J6OA 3H61A 3CK2A 2Z1AA 3H63A 4UT3B 4H2GA 4YKEA 1XM7A 1TCOA 3EGGA 1S95A 3PSNA 4H2IA 1XZWA 3H60A 3GVEA 2WDCA 4HD0A 2Z06A 4V0XA 5HPEA 3RL5A 3ZTVA 4Q7FA 2DXNA 5JJTA 1S3LA 4UT3A 3RL4A 3IVDA 3QG5C 4LACC 4JA7A 3AUZA 1S70A 2P6BA 1IT6A 3P71C 1S8EA 4H1SA 2USHA 3QFKA 2CV9A 2XMOA 3THNA 2R17A 3EGHA 4I5NC 1AUIA 1KBPA 1HP1A 1T71A 1M63A 2QFPA 2ZO9B 1T70A 2NYMC 3C9FA 4FBKA 4B2OA 4ZVZA 2NYLC 5F3WA 3FLOA 4DHLA 5INBA 2DFJA 4V0VA 3QFMA 3T1IA 3H69A 1U32A 5C1VA 2ZOAA 5JPEA 5DNYA 1JK7A 3E0JA 3DSCA 3KBPA 3THOB 2JOGA 2HYOA 3D03A 4V0WA 4I5LC 4ORCA 1UTEA 4WWLA 3H68A 3K7VC 2IAEC 4ZX2A 4NZVA
chains in the Genus database with same CATH topology
2AHDA 2O8GA 2WDDA 4MOYA 4MP0A 4TUIA 3E7BA 2BDXA 1SU1A 4O43A 1WAO1 4G9JA 3LL8A 3JYFA 2IE3C 5JPFA 1NNWA 2KKNA 2ZBMA 3HVQA 4LTYA 1HPUA 2WDFA 2Q8UA 4IL1A 3H66A 2QFRA 3TGHA 1G5BA 2O8AA 5IOHA 2YVTA 3ZU0A 1S3MA 3IVEA 2Z72A 4F0ZA 4JA9A 4XPNA 4FBQA 2BQ8X 3DW8C 2WDEA 2BCDA 3AV0A 3IB8A 4IYPC 3RL3A 1QFCA 2NPPC 1II7A 4OR9A 3C5WC 3N5UA 1OIDA 3QFOA 1FJMA 1QHWA 4O4KA 3E7AA 2QJCA 3V4YA 1WARA 1Z2WA 4KKZA 2NXFA 3DSDA 4H1YP 4H2FA 1W24A 1OIEA 4O24A 5J28A 3FGAC 4FBWA 1USHA 4ORAA 4MOVA 2IE4C 3RQZA 4UWQA 2A22A 3ICFA 3H62B 4ORBA 1HO5A 4O5GA 3IB7A 4UT2A 4DSYA 5B8IA 2DXLA 4M0VA 2HY1A 4LU9A 1Z2XA 2HYPA 4DT2A 4H2BA 4TUGA 2GJUA 1V73A 3H67A 2YEQA 3K7WC 3PSOA 4FCXA 1MF8A 1UF3A 3H64A 5GTUA 3QFNA 1OI8A 4KBPA 5EQVA 1S3NA 4J6OA 3H61A 3CK2A 2Z1AA 3H63A 4UT3B 4H2GA 4YKEA 1XM7A 1TCOA 3EGGA 1S95A 3PSNA 4H2IA 1XZWA 3H60A 3GVEA 2WDCA 4HD0A 2Z06A 4V0XA 5HPEA 3RL5A 3ZTVA 4Q7FA 2DXNA 5JJTA 1S3LA 4UT3A 3RL4A 3IVDA 3QG5C 4LACC 4JA7A 3AUZA 1S70A 2P6BA 1IT6A 3P71C 1S8EA 4H1SA 2USHA 3QFKA 2CV9A 2XMOA 3THNA 2R17A 3EGHA 4I5NC 1AUIA 1KBPA 1HP1A 1T71A 1M63A 2QFPA 2ZO9B 1T70A 2NYMC 3C9FA 4FBKA 4B2OA 4ZVZA 2NYLC 5F3WA 3FLOA 4DHLA 5INBA 2DFJA 4V0VA 3QFMA 3T1IA 3H69A 1U32A 5C1VA 2ZOAA 5JPEA 5DNYA 1JK7A 3E0JA 3DSCA 3KBPA 3THOB 2JOGA 2HYOA 3D03A 4V0WA 4I5LC 4ORCA 1UTEA 4WWLA 3H68A 3K7VC 2IAEC 4ZX2A 4NZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHD A;  2O8G A;  2WDD A;  4MOY A;  4MP0 A;  4TUI A;  3E7B A;  2BDX A;  1SU1 A;  4O43 A;  1WAO 1;  4G9J A;  3LL8 A;  3JYF A;  2IE3 C;  5JPF A;  1NNW A;  2KKN A;  2ZBM A;  3HVQ A;  4LTY A;  1HPU A;  2WDF A;  2Q8U A;  4IL1 A;  3H66 A;  2QFR A;  3TGH A;  1G5B A;  2O8A A;  5IOH A;  2YVT A;  3ZU0 A;  1S3M A;  3IVE A;  2Z72 A;  4F0Z A;  4JA9 A;  4XPN A;  4FBQ A;  2BQ8 X;  3DW8 C;  2WDE A;  2BCD A;  3AV0 A;  3IB8 A;  4IYP C;  3RL3 A;  1QFC A;  2NPP C;  1II7 A;  4OR9 A;  3C5W C;  3N5U A;  1OID A;  3QFO A;  1FJM A;  1QHW A;  4O4K A;  3E7A A;  2QJC A;  3V4Y A;  1WAR A;  1Z2W A;  4KKZ A;  2NXF A;  3DSD A;  4H1Y P;  4H2F A;  1W24 A;  1OIE A;  4O24 A;  5J28 A;  3FGA C;  4FBW A;  1USH A;  4ORA A;  4MOV A;  2IE4 C;  3RQZ A;  4UWQ A;  2A22 A;  3ICF A;  3H62 B;  4ORB A;  1HO5 A;  4O5G A;  3IB7 A;  4UT2 A;  4DSY A;  5B8I A;  4M0V A;  2HY1 A;  4LU9 A;  1Z2X A;  2HYP A;  4DT2 A;  4H2B A;  4TUG A;  2GJU A;  1V73 A;  3H67 A;  3PSO A;  3K7W C;  4FCX A;  1MF8 A;  1UF3 A;  3H64 A;  5GTU A;  3QFN A;  1OI8 A;  4KBP A;  5EQV A;  1S3N A;  4J6O A;  3H61 A;  3CK2 A;  2Z1A A;  3H63 A;  4UT3 B;  4H2G A;  4YKE A;  1XM7 A;  1TCO A;  3EGG A;  1S95 A;  3PSN A;  4H2I A;  1XZW A;  3H60 A;  3GVE A;  2WDC A;  4HD0 A;  2Z06 A;  4V0X A;  5HPE A;  3RL5 A;  3ZTV A;  4Q7F A;  5JJT A;  1S3L A;  4UT3 A;  3RL4 A;  3IVD A;  3QG5 C;  4LAC C;  4JA7 A;  3AUZ A;  1S70 A;  2P6B A;  1IT6 A;  3P71 C;  1S8E A;  4H1S A;  2USH A;  3QFK A;  2CV9 A;  2XMO A;  3THN A;  2R17 A;  3EGH A;  4I5N C;  1AUI A;  1KBP A;  1HP1 A;  1T71 A;  1M63 A;  2QFP A;  3C9F A;  1T70 A;  2NYM C;  4FBK A;  4B2O A;  4ZVZ A;  2NYL C;  5F3W A;  4DHL A;  5INB A;  2DFJ A;  4V0V A;  3QFM A;  3T1I A;  3H69 A;  1U32 A;  5C1V A;  5JPE A;  5DNY A;  1JK7 A;  3DSC A;  3KBP A;  3THO B;  2JOG A;  2HYO A;  4V0W A;  4I5L C;  4ORC A;  1UTE A;  4WWL A;  3H68 A;  3K7V C;  2IAE C;  4ZX2 A;  4NZV A; 
#chains in the Genus database with same CATH topology
 2AHD A;  2O8G A;  2WDD A;  4MOY A;  4MP0 A;  4TUI A;  3E7B A;  2BDX A;  1SU1 A;  4O43 A;  1WAO 1;  4G9J A;  3LL8 A;  3JYF A;  2IE3 C;  5JPF A;  1NNW A;  2KKN A;  2ZBM A;  3HVQ A;  4LTY A;  1HPU A;  2WDF A;  2Q8U A;  4IL1 A;  3H66 A;  2QFR A;  3TGH A;  1G5B A;  2O8A A;  5IOH A;  2YVT A;  3ZU0 A;  1S3M A;  3IVE A;  2Z72 A;  4F0Z A;  4JA9 A;  4XPN A;  4FBQ A;  2BQ8 X;  3DW8 C;  2WDE A;  2BCD A;  3AV0 A;  3IB8 A;  4IYP C;  3RL3 A;  1QFC A;  2NPP C;  1II7 A;  4OR9 A;  3C5W C;  3N5U A;  1OID A;  3QFO A;  1FJM A;  1QHW A;  4O4K A;  3E7A A;  2QJC A;  3V4Y A;  1WAR A;  1Z2W A;  4KKZ A;  2NXF A;  3DSD A;  4H1Y P;  4H2F A;  1W24 A;  1OIE A;  4O24 A;  5J28 A;  3FGA C;  4FBW A;  1USH A;  4ORA A;  4MOV A;  2IE4 C;  3RQZ A;  4UWQ A;  2A22 A;  3ICF A;  3H62 B;  4ORB A;  1HO5 A;  4O5G A;  3IB7 A;  4UT2 A;  4DSY A;  5B8I A;  2DXL A;  4M0V A;  2HY1 A;  4LU9 A;  1Z2X A;  2HYP A;  4DT2 A;  4H2B A;  4TUG A;  2GJU A;  1V73 A;  3H67 A;  2YEQ A;  3K7W C;  3PSO A;  4FCX A;  1MF8 A;  1UF3 A;  3H64 A;  5GTU A;  3QFN A;  1OI8 A;  4KBP A;  5EQV A;  1S3N A;  4J6O A;  3H61 A;  3CK2 A;  2Z1A A;  3H63 A;  4UT3 B;  4H2G A;  4YKE A;  1XM7 A;  1TCO A;  3EGG A;  1S95 A;  3PSN A;  4H2I A;  1XZW A;  3H60 A;  3GVE A;  2WDC A;  4HD0 A;  2Z06 A;  4V0X A;  5HPE A;  3RL5 A;  3ZTV A;  4Q7F A;  2DXN A;  5JJT A;  1S3L A;  4UT3 A;  3RL4 A;  3IVD A;  3QG5 C;  4LAC C;  4JA7 A;  3AUZ A;  1S70 A;  2P6B A;  1IT6 A;  3P71 C;  1S8E A;  4H1S A;  2USH A;  3QFK A;  2CV9 A;  2XMO A;  3THN A;  2R17 A;  3EGH A;  4I5N C;  1AUI A;  1KBP A;  1HP1 A;  1T71 A;  1M63 A;  2QFP A;  2ZO9 B;  1T70 A;  2NYM C;  3C9F A;  4FBK A;  4B2O A;  4ZVZ A;  2NYL C;  5F3W A;  3FLO A;  4DHL A;  5INB A;  2DFJ A;  4V0V A;  3QFM A;  3T1I A;  3H69 A;  1U32 A;  5C1V A;  2ZOA A;  5JPE A;  5DNY A;  1JK7 A;  3E0J A;  3DSC A;  3KBP A;  3THO B;  2JOG A;  2HYO A;  3D03 A;  4V0W A;  4I5L C;  4ORC A;  1UTE A;  4WWL A;  3H68 A;  3K7V C;  2IAE C;  4ZX2 A;  4NZV A; 
#chains in the Genus database with same CATH homology
 2AHD A;  2O8G A;  2WDD A;  4MOY A;  4MP0 A;  4TUI A;  3E7B A;  2BDX A;  1SU1 A;  4O43 A;  1WAO 1;  4G9J A;  3LL8 A;  3JYF A;  2IE3 C;  5JPF A;  1NNW A;  2KKN A;  2ZBM A;  3HVQ A;  4LTY A;  1HPU A;  2WDF A;  2Q8U A;  4IL1 A;  3H66 A;  2QFR A;  3TGH A;  1G5B A;  2O8A A;  5IOH A;  2YVT A;  3ZU0 A;  1S3M A;  3IVE A;  2Z72 A;  4F0Z A;  4JA9 A;  4XPN A;  4FBQ A;  2BQ8 X;  3DW8 C;  2WDE A;  2BCD A;  3AV0 A;  3IB8 A;  4IYP C;  3RL3 A;  1QFC A;  2NPP C;  1II7 A;  4OR9 A;  3C5W C;  3N5U A;  1OID A;  3QFO A;  1FJM A;  1QHW A;  4O4K A;  3E7A A;  2QJC A;  3V4Y A;  1WAR A;  1Z2W A;  4KKZ A;  2NXF A;  3DSD A;  4H1Y P;  4H2F A;  1W24 A;  1OIE A;  4O24 A;  5J28 A;  3FGA C;  4FBW A;  1USH A;  4ORA A;  4MOV A;  2IE4 C;  3RQZ A;  4UWQ A;  2A22 A;  3ICF A;  3H62 B;  4ORB A;  1HO5 A;  4O5G A;  3IB7 A;  4UT2 A;  4DSY A;  5B8I A;  2DXL A;  4M0V A;  2HY1 A;  4LU9 A;  1Z2X A;  2HYP A;  4DT2 A;  4H2B A;  4TUG A;  2GJU A;  1V73 A;  3H67 A;  2YEQ A;  3K7W C;  3PSO A;  4FCX A;  1MF8 A;  1UF3 A;  3H64 A;  5GTU A;  3QFN A;  1OI8 A;  4KBP A;  5EQV A;  1S3N A;  4J6O A;  3H61 A;  3CK2 A;  2Z1A A;  3H63 A;  4UT3 B;  4H2G A;  4YKE A;  1XM7 A;  1TCO A;  3EGG A;  1S95 A;  3PSN A;  4H2I A;  1XZW A;  3H60 A;  3GVE A;  2WDC A;  4HD0 A;  2Z06 A;  4V0X A;  5HPE A;  3RL5 A;  3ZTV A;  4Q7F A;  2DXN A;  5JJT A;  1S3L A;  4UT3 A;  3RL4 A;  3IVD A;  3QG5 C;  4LAC C;  4JA7 A;  3AUZ A;  1S70 A;  2P6B A;  1IT6 A;  3P71 C;  1S8E A;  4H1S A;  2USH A;  3QFK A;  2CV9 A;  2XMO A;  3THN A;  2R17 A;  3EGH A;  4I5N C;  1AUI A;  1KBP A;  1HP1 A;  1T71 A;  1M63 A;  2QFP A;  2ZO9 B;  1T70 A;  2NYM C;  3C9F A;  4FBK A;  4B2O A;  4ZVZ A;  2NYL C;  5F3W A;  3FLO A;  4DHL A;  5INB A;  2DFJ A;  4V0V A;  3QFM A;  3T1I A;  3H69 A;  1U32 A;  5C1V A;  2ZOA A;  5JPE A;  5DNY A;  1JK7 A;  3E0J A;  3DSC A;  3KBP A;  3THO B;  2JOG A;  2HYO A;  3D03 A;  4V0W A;  4I5L C;  4ORC A;  1UTE A;  4WWL A;  3H68 A;  3K7V C;  2IAE C;  4ZX2 A;  4NZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...