1MF8A

Crystal structure of human calcineurin complexed with cyclosporin a and human cyclophilin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
352
structure length
352
Chain Sequence
AVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Calcineurin Complexed with Cyclosporin a and Human Cyclophilin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT, ALPHA ISOFORM
total genus 121
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1mf8A00
3AV0A 3AUZA 4J6OA 4UT2A 2WDCA 1Z2XA 4O5GA 3EGGA 4V0WA 4I5NC 1T70A 4H2FA 4JA7A 5C1VA 4WWLA 3TGHA 3QFMA 3RQZA 1S8EA 4JA9A 2Z06A 1WAO1 5JJTA 3C9FA 3RL4A 4O43A 3PSNA 3THOB 5HPEA 3C5WC 4LTYA 1AUIA 5IOHA 3QFKA 3LL8A 3IVEA 3K7WC 1KBPA 3E7AA 4KKZA 1UF3A 3QFNA 3H63A 1TCOA 1HPUA 2QFRA 4TUGA 1JK7A 1HO5A 2NYLC 2BQ8X 3JYFA 2HYPA 4IL1A 4XPNA 4OR9A 2Z72A 1S95A 1W24A 2IAEC 1MF8A 1U32A 2NXFA 3HVQA 1IT6A 3EGHA 3RL5A 5B8IA 3P71C 2Q8UA 4V0VA 3H60A 1SU1A 5DNYA 4G9JA 2YVTA 3ZU0A 4O24A 3KBPA 2Z1AA 4ORBA 1XM7A 3E7BA 4FBKA 4NZVA 5INBA 2P6BA 3DW8C 3THNA 3ZTVA 4TUIA 4O4KA 4LACC 4F0ZA 2WDEA 2IE4C 2NYMC 4Q7FA 2BCDA 2O8GA 1S3LA 2WDDA 3H66A 1OIEA 5J28A 4IYPC 1T71A 3N5UA 2WDFA 4H1YP 4KBPA 2A22A 4DSYA 5JPEA 1S3NA 3H68A 3K7VC 4ZVZA 3RL3A 3IVDA 2GJUA 4FBWA 3ICFA 4M0VA 2USHA 4ORCA 1Z2WA 1OIDA 2CV9A 5JPFA 4UT3A 2HY1A 1G5BA 1II7A 1QFCA 1UTEA 4MOYA 2JOGA 4V0XA 3CK2A 2O8AA 3H64A 3H67A 4ZX2A 3DSDA 4FBQA 2AHDA 3IB7A 4MP0A 4B2OA 4DHLA 2QJCA 3QG5C 4UWQA 1FJMA 1USHA 3DSCA 1S70A 4H1SA 1XZWA 3FGAC 4LU9A 1HP1A 4UT3B 3PSOA 4FCXA 2HYOA 1OI8A 3V4YA 1NNWA 5EQVA 3T1IA 4YKEA 1V73A 2R17A 4DT2A 4H2GA 1QHWA 2BDXA 4ORAA 3H61A 3GVEA 4I5LC 1M63A 2QFPA 1WARA 3QFOA 2ZBMA 2IE3C 3IB8A 4H2IA 2XMOA 4MOVA 4HD0A 1S3MA 2NPPC 5GTUA 5F3WA 3H69A 2DFJA 3H62B 4H2BA 2KKNA
chains in the Genus database with same CATH superfamily
3AV0A 3AUZA 4J6OA 4UT2A 2ZOAA 2WDCA 1Z2XA 3E0JA 4O5GA 3EGGA 4V0WA 4I5NC 1T70A 4H2FA 4JA7A 5C1VA 4WWLA 2DXLA 3TGHA 3QFMA 3RQZA 1S8EA 4JA9A 2Z06A 1WAO1 5JJTA 2ZO9B 3C9FA 3RL4A 4O43A 3PSNA 3THOB 5HPEA 3C5WC 3D03A 3FLOA 4LTYA 1AUIA 5IOHA 3QFKA 3LL8A 3IVEA 3K7WC 1KBPA 3E7AA 4KKZA 1UF3A 3QFNA 3H63A 1TCOA 1HPUA 2QFRA 4TUGA 1JK7A 1HO5A 2NYLC 2BQ8X 3JYFA 2HYPA 4IL1A 4XPNA 4OR9A 2Z72A 1S95A 1W24A 2IAEC 1MF8A 1U32A 2NXFA 3HVQA 1IT6A 3EGHA 3RL5A 5B8IA 3P71C 2Q8UA 4V0VA 3H60A 1SU1A 5DNYA 4G9JA 2YVTA 3ZU0A 4O24A 3KBPA 2Z1AA 4ORBA 1XM7A 3E7BA 4FBKA 4NZVA 5INBA 2P6BA 3DW8C 3THNA 3ZTVA 4TUIA 4O4KA 4LACC 4F0ZA 2WDEA 2IE4C 2NYMC 4Q7FA 2BCDA 2O8GA 1S3LA 2WDDA 3H66A 1OIEA 5J28A 4IYPC 1T71A 3N5UA 2WDFA 4H1YP 4KBPA 2A22A 4DSYA 5JPEA 1S3NA 3H68A 3K7VC 4ZVZA 3RL3A 3IVDA 2GJUA 4FBWA 3ICFA 4M0VA 2USHA 4ORCA 1Z2WA 1OIDA 2CV9A 5JPFA 4UT3A 2HY1A 1G5BA 1II7A 1QFCA 1UTEA 4MOYA 2DXNA 2JOGA 4V0XA 3CK2A 2O8AA 3H64A 3H67A 4ZX2A 3DSDA 4FBQA 2AHDA 3IB7A 4MP0A 4B2OA 4DHLA 2QJCA 3QG5C 4UWQA 1FJMA 1USHA 3DSCA 1S70A 4H1SA 1XZWA 3FGAC 4LU9A 1HP1A 4UT3B 3PSOA 4FCXA 2HYOA 1OI8A 3V4YA 1NNWA 2YEQA 5EQVA 3T1IA 4YKEA 1V73A 2R17A 4DT2A 4H2GA 1QHWA 2BDXA 4ORAA 3H61A 3GVEA 4I5LC 1M63A 2QFPA 1WARA 3QFOA 2ZBMA 2IE3C 3IB8A 4H2IA 2XMOA 4MOVA 4HD0A 1S3MA 2NPPC 5GTUA 5F3WA 3H69A 2DFJA 3H62B 4H2BA 2KKNA
chains in the Genus database with same CATH topology
3AV0A 3AUZA 4J6OA 4UT2A 2ZOAA 2WDCA 1Z2XA 3E0JA 4O5GA 3EGGA 4V0WA 4I5NC 1T70A 4H2FA 4JA7A 5C1VA 4WWLA 2DXLA 3TGHA 3QFMA 3RQZA 1S8EA 4JA9A 2Z06A 1WAO1 5JJTA 2ZO9B 3C9FA 3RL4A 4O43A 3PSNA 3THOB 5HPEA 3C5WC 3D03A 3FLOA 4LTYA 1AUIA 5IOHA 3QFKA 3LL8A 3IVEA 3K7WC 1KBPA 3E7AA 4KKZA 1UF3A 3QFNA 3H63A 1TCOA 1HPUA 2QFRA 4TUGA 1JK7A 1HO5A 2NYLC 2BQ8X 3JYFA 2HYPA 4IL1A 4XPNA 4OR9A 2Z72A 1S95A 1W24A 2IAEC 1MF8A 1U32A 2NXFA 3HVQA 1IT6A 3EGHA 3RL5A 5B8IA 3P71C 2Q8UA 4V0VA 3H60A 1SU1A 5DNYA 4G9JA 2YVTA 3ZU0A 4O24A 3KBPA 2Z1AA 4ORBA 1XM7A 3E7BA 4FBKA 4NZVA 5INBA 2P6BA 3DW8C 3THNA 3ZTVA 4TUIA 4O4KA 4LACC 4F0ZA 2WDEA 2IE4C 2NYMC 4Q7FA 2BCDA 2O8GA 1S3LA 2WDDA 3H66A 1OIEA 5J28A 4IYPC 1T71A 3N5UA 2WDFA 4H1YP 4KBPA 2A22A 4DSYA 5JPEA 1S3NA 3H68A 3K7VC 4ZVZA 3RL3A 3IVDA 2GJUA 4FBWA 3ICFA 4M0VA 2USHA 4ORCA 1Z2WA 1OIDA 2CV9A 5JPFA 4UT3A 2HY1A 1G5BA 1II7A 1QFCA 1UTEA 4MOYA 2DXNA 2JOGA 4V0XA 3CK2A 2O8AA 3H64A 3H67A 4ZX2A 3DSDA 4FBQA 2AHDA 3IB7A 4MP0A 4B2OA 4DHLA 2QJCA 3QG5C 4UWQA 1FJMA 1USHA 3DSCA 1S70A 4H1SA 1XZWA 3FGAC 4LU9A 1HP1A 4UT3B 3PSOA 4FCXA 2HYOA 1OI8A 3V4YA 1NNWA 2YEQA 5EQVA 3T1IA 4YKEA 1V73A 2R17A 4DT2A 4H2GA 1QHWA 2BDXA 4ORAA 3H61A 3GVEA 4I5LC 1M63A 2QFPA 1WARA 3QFOA 2ZBMA 2IE3C 3IB8A 4H2IA 2XMOA 4MOVA 4HD0A 1S3MA 2NPPC 5GTUA 5F3WA 3H69A 2DFJA 3H62B 4H2BA 2KKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV0 A;  3AUZ A;  4J6O A;  4UT2 A;  2WDC A;  1Z2X A;  4O5G A;  3EGG A;  4V0W A;  4I5N C;  1T70 A;  4H2F A;  4JA7 A;  5C1V A;  4WWL A;  3TGH A;  3QFM A;  3RQZ A;  1S8E A;  4JA9 A;  2Z06 A;  1WAO 1;  5JJT A;  3C9F A;  3RL4 A;  4O43 A;  3PSN A;  3THO B;  5HPE A;  3C5W C;  4LTY A;  1AUI A;  5IOH A;  3QFK A;  3LL8 A;  3IVE A;  3K7W C;  1KBP A;  3E7A A;  4KKZ A;  1UF3 A;  3QFN A;  3H63 A;  1TCO A;  1HPU A;  2QFR A;  4TUG A;  1JK7 A;  1HO5 A;  2NYL C;  2BQ8 X;  3JYF A;  2HYP A;  4IL1 A;  4XPN A;  4OR9 A;  2Z72 A;  1S95 A;  1W24 A;  2IAE C;  1MF8 A;  1U32 A;  2NXF A;  3HVQ A;  1IT6 A;  3EGH A;  3RL5 A;  5B8I A;  3P71 C;  2Q8U A;  4V0V A;  3H60 A;  1SU1 A;  5DNY A;  4G9J A;  2YVT A;  3ZU0 A;  4O24 A;  3KBP A;  2Z1A A;  4ORB A;  1XM7 A;  3E7B A;  4FBK A;  4NZV A;  5INB A;  2P6B A;  3DW8 C;  3THN A;  3ZTV A;  4TUI A;  4O4K A;  4LAC C;  4F0Z A;  2WDE A;  2IE4 C;  2NYM C;  4Q7F A;  2BCD A;  2O8G A;  1S3L A;  2WDD A;  3H66 A;  1OIE A;  5J28 A;  4IYP C;  1T71 A;  3N5U A;  2WDF A;  4H1Y P;  4KBP A;  2A22 A;  4DSY A;  5JPE A;  1S3N A;  3H68 A;  3K7V C;  4ZVZ A;  3RL3 A;  3IVD A;  2GJU A;  4FBW A;  3ICF A;  4M0V A;  2USH A;  4ORC A;  1Z2W A;  1OID A;  2CV9 A;  5JPF A;  4UT3 A;  2HY1 A;  1G5B A;  1II7 A;  1QFC A;  1UTE A;  4MOY A;  2JOG A;  4V0X A;  3CK2 A;  2O8A A;  3H64 A;  3H67 A;  4ZX2 A;  3DSD A;  4FBQ A;  2AHD A;  3IB7 A;  4MP0 A;  4B2O A;  4DHL A;  2QJC A;  3QG5 C;  4UWQ A;  1FJM A;  1USH A;  3DSC A;  1S70 A;  4H1S A;  1XZW A;  3FGA C;  4LU9 A;  1HP1 A;  4UT3 B;  3PSO A;  4FCX A;  2HYO A;  1OI8 A;  3V4Y A;  1NNW A;  5EQV A;  3T1I A;  4YKE A;  1V73 A;  2R17 A;  4DT2 A;  4H2G A;  1QHW A;  2BDX A;  4ORA A;  3H61 A;  3GVE A;  4I5L C;  1M63 A;  2QFP A;  1WAR A;  3QFO A;  2ZBM A;  2IE3 C;  3IB8 A;  4H2I A;  2XMO A;  4MOV A;  4HD0 A;  1S3M A;  2NPP C;  5GTU A;  5F3W A;  3H69 A;  2DFJ A;  3H62 B;  4H2B A;  2KKN A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  3AUZ A;  4J6O A;  4UT2 A;  2ZOA A;  2WDC A;  1Z2X A;  3E0J A;  4O5G A;  3EGG A;  4V0W A;  4I5N C;  1T70 A;  4H2F A;  4JA7 A;  5C1V A;  4WWL A;  2DXL A;  3TGH A;  3QFM A;  3RQZ A;  1S8E A;  4JA9 A;  2Z06 A;  1WAO 1;  5JJT A;  2ZO9 B;  3C9F A;  3RL4 A;  4O43 A;  3PSN A;  3THO B;  5HPE A;  3C5W C;  3D03 A;  3FLO A;  4LTY A;  1AUI A;  5IOH A;  3QFK A;  3LL8 A;  3IVE A;  3K7W C;  1KBP A;  3E7A A;  4KKZ A;  1UF3 A;  3QFN A;  3H63 A;  1TCO A;  1HPU A;  2QFR A;  4TUG A;  1JK7 A;  1HO5 A;  2NYL C;  2BQ8 X;  3JYF A;  2HYP A;  4IL1 A;  4XPN A;  4OR9 A;  2Z72 A;  1S95 A;  1W24 A;  2IAE C;  1MF8 A;  1U32 A;  2NXF A;  3HVQ A;  1IT6 A;  3EGH A;  3RL5 A;  5B8I A;  3P71 C;  2Q8U A;  4V0V A;  3H60 A;  1SU1 A;  5DNY A;  4G9J A;  2YVT A;  3ZU0 A;  4O24 A;  3KBP A;  2Z1A A;  4ORB A;  1XM7 A;  3E7B A;  4FBK A;  4NZV A;  5INB A;  2P6B A;  3DW8 C;  3THN A;  3ZTV A;  4TUI A;  4O4K A;  4LAC C;  4F0Z A;  2WDE A;  2IE4 C;  2NYM C;  4Q7F A;  2BCD A;  2O8G A;  1S3L A;  2WDD A;  3H66 A;  1OIE A;  5J28 A;  4IYP C;  1T71 A;  3N5U A;  2WDF A;  4H1Y P;  4KBP A;  2A22 A;  4DSY A;  5JPE A;  1S3N A;  3H68 A;  3K7V C;  4ZVZ A;  3RL3 A;  3IVD A;  2GJU A;  4FBW A;  3ICF A;  4M0V A;  2USH A;  4ORC A;  1Z2W A;  1OID A;  2CV9 A;  5JPF A;  4UT3 A;  2HY1 A;  1G5B A;  1II7 A;  1QFC A;  1UTE A;  4MOY A;  2DXN A;  2JOG A;  4V0X A;  3CK2 A;  2O8A A;  3H64 A;  3H67 A;  4ZX2 A;  3DSD A;  4FBQ A;  2AHD A;  3IB7 A;  4MP0 A;  4B2O A;  4DHL A;  2QJC A;  3QG5 C;  4UWQ A;  1FJM A;  1USH A;  3DSC A;  1S70 A;  4H1S A;  1XZW A;  3FGA C;  4LU9 A;  1HP1 A;  4UT3 B;  3PSO A;  4FCX A;  2HYO A;  1OI8 A;  3V4Y A;  1NNW A;  2YEQ A;  5EQV A;  3T1I A;  4YKE A;  1V73 A;  2R17 A;  4DT2 A;  4H2G A;  1QHW A;  2BDX A;  4ORA A;  3H61 A;  3GVE A;  4I5L C;  1M63 A;  2QFP A;  1WAR A;  3QFO A;  2ZBM A;  2IE3 C;  3IB8 A;  4H2I A;  2XMO A;  4MOV A;  4HD0 A;  1S3M A;  2NPP C;  5GTU A;  5F3W A;  3H69 A;  2DFJ A;  3H62 B;  4H2B A;  2KKN A; 
#chains in the Genus database with same CATH homology
 3AV0 A;  3AUZ A;  4J6O A;  4UT2 A;  2ZOA A;  2WDC A;  1Z2X A;  3E0J A;  4O5G A;  3EGG A;  4V0W A;  4I5N C;  1T70 A;  4H2F A;  4JA7 A;  5C1V A;  4WWL A;  2DXL A;  3TGH A;  3QFM A;  3RQZ A;  1S8E A;  4JA9 A;  2Z06 A;  1WAO 1;  5JJT A;  2ZO9 B;  3C9F A;  3RL4 A;  4O43 A;  3PSN A;  3THO B;  5HPE A;  3C5W C;  3D03 A;  3FLO A;  4LTY A;  1AUI A;  5IOH A;  3QFK A;  3LL8 A;  3IVE A;  3K7W C;  1KBP A;  3E7A A;  4KKZ A;  1UF3 A;  3QFN A;  3H63 A;  1TCO A;  1HPU A;  2QFR A;  4TUG A;  1JK7 A;  1HO5 A;  2NYL C;  2BQ8 X;  3JYF A;  2HYP A;  4IL1 A;  4XPN A;  4OR9 A;  2Z72 A;  1S95 A;  1W24 A;  2IAE C;  1MF8 A;  1U32 A;  2NXF A;  3HVQ A;  1IT6 A;  3EGH A;  3RL5 A;  5B8I A;  3P71 C;  2Q8U A;  4V0V A;  3H60 A;  1SU1 A;  5DNY A;  4G9J A;  2YVT A;  3ZU0 A;  4O24 A;  3KBP A;  2Z1A A;  4ORB A;  1XM7 A;  3E7B A;  4FBK A;  4NZV A;  5INB A;  2P6B A;  3DW8 C;  3THN A;  3ZTV A;  4TUI A;  4O4K A;  4LAC C;  4F0Z A;  2WDE A;  2IE4 C;  2NYM C;  4Q7F A;  2BCD A;  2O8G A;  1S3L A;  2WDD A;  3H66 A;  1OIE A;  5J28 A;  4IYP C;  1T71 A;  3N5U A;  2WDF A;  4H1Y P;  4KBP A;  2A22 A;  4DSY A;  5JPE A;  1S3N A;  3H68 A;  3K7V C;  4ZVZ A;  3RL3 A;  3IVD A;  2GJU A;  4FBW A;  3ICF A;  4M0V A;  2USH A;  4ORC A;  1Z2W A;  1OID A;  2CV9 A;  5JPF A;  4UT3 A;  2HY1 A;  1G5B A;  1II7 A;  1QFC A;  1UTE A;  4MOY A;  2DXN A;  2JOG A;  4V0X A;  3CK2 A;  2O8A A;  3H64 A;  3H67 A;  4ZX2 A;  3DSD A;  4FBQ A;  2AHD A;  3IB7 A;  4MP0 A;  4B2O A;  4DHL A;  2QJC A;  3QG5 C;  4UWQ A;  1FJM A;  1USH A;  3DSC A;  1S70 A;  4H1S A;  1XZW A;  3FGA C;  4LU9 A;  1HP1 A;  4UT3 B;  3PSO A;  4FCX A;  2HYO A;  1OI8 A;  3V4Y A;  1NNW A;  2YEQ A;  5EQV A;  3T1I A;  4YKE A;  1V73 A;  2R17 A;  4DT2 A;  4H2G A;  1QHW A;  2BDX A;  4ORA A;  3H61 A;  3GVE A;  4I5L C;  1M63 A;  2QFP A;  1WAR A;  3QFO A;  2ZBM A;  2IE3 C;  3IB8 A;  4H2I A;  2XMO A;  4MOV A;  4HD0 A;  1S3M A;  2NPP C;  5GTU A;  5F3W A;  3H69 A;  2DFJ A;  3H62 B;  4H2B A;  2KKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...