5DNYA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Recombination/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 107
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5dnyA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5dnyA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5dnyA01
5J28A 3H68A 2NYMC 5C1VA 4UT3B 4KKZA 2DFJA 1FJMA 2Z72A 5JPFA 2Q8UA 3QFMA 4H1YP 4DHLA 4ZX2A 5HPEA 3DSDA 2BQ8X 1XM7A 2KKNA 2HYOA 2XMOA 3H66A 4KBPA 2JOGA 2QJCA 5INBA 3RL5A 4LACC 4UT2A 1QHWA 1SU1A 2WDFA 5DNYA 2O8GA 3H60A 1HP1A 4IYPC 4FBKA 3TGHA 4H2GA 3PSNA 1S3NA 1OI8A 2USHA 3LL8A 5B8IA 4NZVA 1UF3A 1KBPA 1S95A 4B2OA 2P6BA 3RQZA 5IOHA 3QFOA 2QFRA 4LU9A 5GTUA 3EGGA 2A22A 3AV0A 2Z06A 1S8EA 1NNWA 3ICFA 2ZBMA 3K7VC 4FCXA 3K7WC 4O43A 4M0VA 1OIDA 1HPUA 4XPNA 4ZVZA 2WDDA 3QG5C 4O5GA 4V0WA 3DW8C 4LTYA 4Q7FA 2NYLC 2IE4C 4TUGA 1U32A 3THNA 3V4YA 4F0ZA 3JYFA 2NXFA 1S70A 4MOVA 5JPEA 2AHDA 5F3WA 4JA7A 4JA9A 1JK7A 3H69A 2QFPA 4V0XA 1USHA 1M63A 2WDEA 3THOB 3IB7A 1QFCA 2R17A 3DSCA 1II7A 1OIEA 2NPPC 4MOYA 4H2FA 4YKEA 2O8AA 3RL4A 4WWLA 3N5UA 3AUZA 3ZTVA 5JJTA 4G9JA 3EGHA 4I5NC 2BCDA 3C9FA 3RL3A 3H61A 4I5LC 1T70A 3CK2A 3IB8A 3FGAC 2YVTA 4O4KA 3E7BA 3ZU0A 4H2BA 2BDXA 2GJUA 1V73A 3C5WC 2WDCA 1S3LA 4DT2A 1Z2WA 1TCOA 1WARA 1XZWA 1HO5A 3KBPA 4ORCA 1IT6A 1G5BA 3P71C 4H1SA 2HYPA 4J6OA 4UT3A 3IVDA 4O24A 3T1IA 3GVEA 3PSOA 4FBWA 4ORBA 1MF8A 1UTEA 4ORAA 4HD0A 1W24A 2Z1AA 2CV9A 4H2IA 3QFKA 2IAEC 4UWQA 1S3MA 5EQVA 3HVQA 4FBQA 2HY1A 3IVEA 3QFNA 3E7AA 1WAO1 3H64A 4MP0A 4OR9A 1Z2XA 2IE3C 4DSYA 3H67A 1AUIA 3H63A 3H62B 4TUIA 1T71A 4V0VA 4IL1A
chains in the Genus database with same CATH superfamily
2JXNA 1HT2E 3NBXX 1R6BX 5KQDA 3PVSA 2Z72A 2EOXA 4F6NA 4LF6E 2YSOA 1EE8A 3M6AA 2XEPA 2EMXA 4FVMA 4IBGA 2OOBA 2K7IA 3ECRA 2KONA 2VQEE 1GQEA 2EQ3A 2F5PA 1YUBA 5B8IA 1KBPA 1NV8A 2HC5A 2R46A 2CSHA 1QZEA 3CTWB 2R4EA 4MH0E 4FWGA 3IWDA 2LVNC 2LUPB 2ZBMA 3K7VC 5LMNE 1BVSA 3SATA 4M9ZA 2EPNA 1AAYA 2XZFA 5EP1A 2DB2A 4NL4H 4JI2E 4JI7E 1NV9A 2GQFA 1CUKA 4IBDA 4MOYA 4XBOA 3AUZA 5EP4A 1RQ0A 2L33A 2LTSA 1YZ9A 2W82A 2L3CA 2ZOAA 1XMOE 2WDCA 5LMUM 2CPNA 5KL3A 2CUZA 2EL6A 3B7ZA 4R2SA 4P16A 2GLIA 4UWQA 2YRHA 3LCVB 1N36E 3QFNA 4LF7E 3L25A 4GKKM 3J7AG 2R6FA 3UK6A 1IBKM 4OR9A 1DV0A 1N78A 3H67A 1EH7A 1IBLE 1NCSA 1A1LA 1UFZA 3FD9A 4ITQA 1OTRA 3PNYA 2MKNA 1QAOA 2HJJA 1NY5A 4NSRA 3AOEC 2XLJA 4AKIA 3K9OA 4LFAE 4DR7E 1HQCA 2V83A 3BF2A 4AKGA 4GKJM 4OVZA 1G3IA 2EOMA 3HTXA 3A42A 3HZJA 2P6BA 4X65M 1WHNA 5IOHA 2EMHA 2L92A 1QANA 5GTUA 3C3EA 2D7EA 1R4GA 3F92A 1XWIA 4OU7A 2JR1A 3SHFA 3PFIA 4ZVZA 2HWJA 2WDDA 1XMQM 4GIPA 4GHAA 1OFHA 3BIDA 1BBGA 4AG6A 1I4WA 3LQQA 1VEJA 4Q7FA 3FYDA 3W0LB 2A5YB 1QQWA 1V33A 3LLHA 2C5RA 4RH8A 2VRDA 2R17A 2O25A 1T38A 2RSMA 3SASA 1IXSB 1EKZA 1MGTA 4P7DA 3IHPA 4MGHA 3DFZA 2DKLA 2M4IA 4DV4E 3IB8A 4QOSA 4BS9A 3ADLA 4Q28A 1NNUC 5KL7A 3Q8XA 2CFOA 2EPXA 4ORCA 5ITYA 3IVDA 2Q2EB 1G4AE 4ORAA 2R76A 2DWMA 4I81A 1IBMM 1BBOA 3TPZA 3EQ1A 3CF6E 3U60A 5KL5A 1AIPC 2K4VA 1QUSA 1IQSA 1R5LA 3AJIB 4YY3E 3L27A 1IN5A 1AUIA 1OIPA 1A1KA 4JI4E 4JI3M 2QSFX 2V1UA 4V0VA 3FUWA 4DV6E 3H68A 3D03A 2EPZA 1IBKE 2EP3A 5HPEA 1N36M 2EM9A 3GPPA 5ITXA 1E9SA 3HHYA 2L7IA 4R3DA 1UHZA 4GH9A 4H2GA 3FE3A 2F5SA 4FD2A 3M7GA 2WZOA 3LMMA 5JI3E 4B7GA 2VQFE 1NNWA 1E9RA 5IWAM 4M9VC 3AFHA 4ANRA 5KL2A 5IZ7D 2H5XA 2Y21A 1XXHA 3C58A 5AC4A 2E5LM 2L4FA 2UXDE 3UMMA 4DR1E 2DHRA 5F3WA 4LJ5A 2NUGA 1QFCA 2LJHA 4BLCA 1TH4A 1G59A 1IBME 3W0FA 5IWAE 3VDPA 4DR2M 5JJTA 4I5NC 3J81S 3HHXA 3H61A 1D0KA 1T70A 4R2EA 1L2CA 2EL5A 1PRBA 2NABA 3FGAC 1ZU1A 2JY8A 4O4KA 1OAIA 3ZQJA 1G2DC 4LFCE 1Z2WA 2RGOA 3Q8GA 4B3MM 2KNZA 1OFIA 3HJQA 4GC5A 1PJJA 3LMLA 2L2NA 2K0BX 5E6JA 3HPSA 2CHGA 4LF8M 3E0JA 4DV7E 2L3JA 3T6PA 4CGYB 2IE3C 1GVNA 4RF1A 1IN7A 2J7OA 3H63A 2O01F 2WBTA 3ADGA 3QYEA 2KNVA 2Y20A 4KKZA 2M7QA 4LJ8A 5IREB 5KL6A 2B7TA 3DSDA 2V88A 2XMOA 4R7GA 1YUIA 1VG5A 4D82A 3KOWE 1NJGA 3L28A 3H60A 3HGIA 3HU3A 1HP1A 1GL6A 2DSYA 4PDGA 1ZMVA 1ORYB 1YE9A 4LJAA 3SFZA 1T4OA 3I4YA 4JI5M 2XFSA 4RHBB 1TH3A 5EXTA 2K47A 4LF9M 1F2IG 4XPNA 4ZYDA 1MN3A 4DKKA 3BOSA 3VKGA 1IQPA 5BPVA 3I4VA 1F4IA 4X66M 4NXME 3JYFA 1PKPA 3QWLA 3J27B 4DV0M 3T15A 2DRPA 2WDEA 3THOB 4R2DA 1IN4A 4RF0A 3P1XA 2QENA 5AE1A 4KT0F 1ZAEA 1MU5A 3HX3A 3CK2A 2LVHA 1X37A 4CISA 2EMBA 2EMIA 1Q3CA 2LNHC 4L8NA 4DT2A 4B3RE 2YQZA 4K0KM 1ZMUA 3BXWA 2FFJA 5ITRA 2EOEA 1G71A 4GZNC 5KPRA 4X62M 3GPXA 2WSCF 4I5SA 1NY6A 4JN6A 3JU0A 5EXSA 2L6MA 4X8WA 2HAKA 3VK6A 3LVWA 3A98B 1Z6TA 4IL1A 2OQ4A 1N34M 2NYMC 2UUCM 2N35A 1WXQA 1MJGM 5JPFA 1IQOA 4ZX2A 4JI0E 2JY9A 2CV1A 2X8AA 2BQ8X 5H37D 1GABA 5DYGA 3HHWA 4JI8M 1QHWA 2WDFA 4NOOB 1YPNA 2A25A 1IM2A 1UF3A 1S95A 4B2OA 2KNAA 2J7NA 2YU8A 1YLAA 2QFRA 3B7NA 2YTDA 1Z59A 3U6QA 1AUAA 1S8EA 3H4MA 4KWYA 4GEWA 3TWKA 1KFVA 1EH8A 4R8OA 2KDLA 4G4NA 2KHHA 4AW4A 3TQSA 4X64M 3JTZA 2Z8YM 4WSGA 4JA7A 2C99A 4YY3M 3AOGA 1YSYA 4FCTA 3F6HA 2LHCA 4XGIA 1A1GA 3DSCA 4LY6A 2EPAA 2EWLA 4JV5M 4G9JA 1JQJC 4R2CA 1XXHE 2EMYA 2EPMX 1TF6A 1DGBA 4G4OA 2FTXB 2F5NA 5GKNA 2EJ4A 2EPUA 2ELZA 3U61B 3JR4A 2DI0A 4L6V6 5TSEA 4B7HA 3GQ3A 1HNXE 2DGCA 4DV0E 3AOEA 1HO5A 2RPCA 1G5BA 4WP2A 4H1SA 4IBJA 1T3TA 2B3TA 3MSWA 1WJ7A 3FTCA 2N3GA 4WYQB 4DR4E 2Z1AA 2CV9A 2EPCA 4H2IA 1HQYE 1WXRA 4MB7A 4B3SM 5EJCA 4J8ZA 2DXLA 3FYCA 4F1IA 1HNXM 1FNNA 2R4JA 3J7Yp 3LVVA 5LL6R 2EM5A 1T39A 1J7KA 1FJMA 4M30A 2JY7A 4DHLA 4R2PA 1HNZM 1XM7A 2KKNA 1LV7A 3TWLA 4MLVA 1QUTA 2KOUA 1SU1A 3MMPA 2O8GA 1X6HA 1L1TA 4JI6E 4GC9A 3ADJA 3PNVA 3SHGB 4WW0A 2JZ0A 4P78A 5A6AA 2E5LE 2YPNA 2LTUA 4LU9A 3U6PA 4DR7M 1NHGC 1TN9A 3RFWA 3F6GA 3B9PA 3UK3C 1V92A 4GRIA 2ZTDA 3UJNA 1E94E 2L4EA 3THNA 1TR8A 3U6SA 1Q02A 1WGNA 4UN2B 3D8BA 4NRWA 2F5QA 2CTDA 2EM3A 3H69A 3HQ1A 4LJ9A 3SYKA 3EIHA 4F9BB 3CGWA 4AI6A 2EN7A 2XF3A 1KSFX 2M1SA 2MC6A 3N5UA 4IBBA 2UUBE 4JV5E 5LMNM 4I8OA 1XNRE 4B7FA 1UBDC 4CHTB 2I13A 3U6CA 4LZJA 3GVEA 1HR0E 2J7JA 4KHPE 3FTDA 4JYAE 4ORBA 1UTEA 3C9PA 2YRMA 2JZ1A 1TDHA 4LF9E 3SMPA 2EM4A 4MP0A 2Z7JA 3VKHA 3KWRA 4JI5E 3GPYA 3A46A 3J2PB 4BBAA 3KS8A 2JOBA 4LJ6A 3C3DA 1SXJC 3ZC7B 1N32M 1N33M 3FRIA 2H36X 1QDTA 5EXPA 5E26A 4PDIA 1A1JA 1OJLA 2DXIA 3LL8A 2LCEA 2ENCA 5A6BA 3IWBA 4OW0A 1ZR9A 2Y0QA 2G3QA 3FUUA 4DR6E 4M2ZA 2DAIA 2BWBA 2L8TA 4CIZA 1HPUA 1V34A 1PDAA 2CV0A 3T1YM 4F2LA 5ITQA 1WIVA 2EQ0A 2B7VA 2LE2A 3ILKA 1S70A 2EM2A 3K1JA 1GO5A 1NJFA 2BJVA 4LFCM 1M63A 2QP9X 3SAVA 1XMQE 1II7A 4DR3M 3GLHB 2K9DA 1HJPA 2EOJA 5IV8B 1PJIA 2YTFA 3RL3A 4MGZE 2KRUA 4DR3E 2YVTA 2APLA 3LQRA 1OKSA 4OVZB 4G4QA 2EJSA 1SXJA 1LLMC 2JVAA 5AE3A 4LFBM 3C6MA 2HYPA 1I94E 2R62A 2L6OA 4KLNA 4IBEA 5AC5A 4X62E 1VEKA 4G4RA 4QHSA 2GHFA 4LFAM 3DF6A 1DO2A 2O5RA 2EUCA 2BNKA 1S3MA 3JAMC 1YYOA 4FBQA 2FV4B 3KW6A 2D7HA 3RGPA 1WAO1 3SARA 1R2ZA 3VYYA 2JA2A 2Q8UA 4IJFA 4L16A 1C7YA 1IY2A 4QHTA 3MHVC 1JR3D 3T1YE 3VDUA 2EM7A 3HKPA 2QJCA 2HGHA 4LGMA 2ZAMA 4DV2M 4LACC 3TQMA 2YRKA 3GRUA 4HTGA 4DV6M 2USHA 2LUQA 3OTOE 2RTXA 2UXBM 2LRSA 4NXMM 4X66E 3QFOA 1QVRA 3L29A 4WXDA 2Z06A 4IBCA 1OIDA 4HEOA 4DV5E 2YTOA 3FRHA 4LF8E 4O5GA 2RRUA 2EOHA 1J5EM 4DR6M 2DAMA 4M0DA 5AE2A 3GLIE 4DV1M 4JI7M 2DIXA 3H09A 1RC7A 3C6KA 3OTOM 1IN6A 1GLNA 2CRUA 2EMFA 4V0XA 3MHHC 4F9CB 2UUAM 2JP7A 2XGNA 1L1ZA 1BB8A 2BB8A 4YHHE 5IXMB 1HNWE 1Z5BA 2QCUA 5EXXA 2VF1A 3KZZA 1DO0A 5A6BD 3C4BA 4HL4A 2NUFA 1V73A 3C5WC 4JI4M 2ELYA 2Z3XA 3U6DA 2EORA 2EL4A 4DV1E 2E72A 2EOQA 1QDRA 3EIEA 1NEIA 2L2KB 1YUJA 4BHCA 5FTMA 5C18A 2R18A 1W24A 2XFTA 2YTIA 2MR9A 4L5NC 2DWNA 2FOIC 2HHHM 2JPAA 4LCBA 1XC8A 5KPZA 4MLQA 5EQTA 2ZM6M 2UUAE 3E7AA 3T1HM 1JR3E 4Q7JA 4WFTA 2DZOB 4LF4E 4M9SA 2EZ6A 4TUIA 4B3RM 2M60A 4M9XA 1A1FA 2DXNA 4DMIA 1SG9A 2EN3A 4R2AA 4IJDA 2JUJA 3H66A 2I7NA 3M0EA 4LRSA 2WBUA 8CATA 2HL7A 3I01M 4UT2A 3KP1E 1SXJD 4IYPC 1K3WA 1S3NA 3VHTB 2ADRA 1R2YA 3FTEA 4BMJA 2BWEA 1OAOC 2DAKA 1G41A 4RKUF 3HWSA 4OOGC 2DMIA 1DGGA 3QG5C 1PJQA 3KZYA 4AG5A 2EMZA 2LT7A 4B3ME 3VK7A 3FKEA 3BBZA 4PD2A 1JK7A 4KODA 2YU5A 4N4RB 1KJKA 5A69A 4YKEA 4R2QA 1J09A 3GLHE 4WWLA 5BR8M 3EGHA 4GHLA 2YNMD 2HHHE 5FTJA 5ADZA 1X3CA 3EPJA 2EQ1A 2KW0A 1MX0A 3GLFA 3R8FA 2OO9A 3HXLA 5A6JA 4DBGB 3ZCBB 3GQ5A 4O24A 4X64E 3J7AS 4ZYGA 1QYRA 1A5TA 3B7QA 5KO3A 1WHQA 3GRRA 4FK5C 3HJSA 4KHPM 1Z2XA 4DSYA 1YSAC 2UU9E 5LMUE 5EP3A 2EM6A 4L15A 4DV3M 2NA2A 4S12A 2EN2A 4JI1E 3KVWA 1A1IA 3GLGB 2WZJA 4OX9E 3A45A 2DWLA 4LF6M 1QNTA 3VYXA 2YTJA 1XNQM 2DZNB 2HKJA 1OI8A 4AZFA 1DGCA 1NO1A 3HHZA 3U6EA 1LTMA 4DR1M 3RQZA 1XNQE 4DUZE 1TDZA 3GLHA 4F54A 2V8QB 2A22A 5A6KA 4JI8E 3J80S 4M0VA 2DAGA 2EMCA 2BJWA 2JNHA 1DGHB 3U6MA 4LZZA 1U32A 5DFLA 5C1BA 2EOSA 2ZBKB 2CWBA 2AHDA 2JYAA 2XSZA 1FJGM 3U5ZB 2DHYA 2K6BA 4GKJE 2DVWB 2QZ4A 3GLGE 1N77A 1GJSA 4M0WA 3U61A 2BCDA 4I5LC 1ZMWA 3HJ8A 2VF8A 2UUCE 2MJ5B 4IBKA 2GJUA 2Y0TA 2LVAA 1RMDA 3SBJA 5FTLA 2CV2A 2N8XA 3THGA 1IT6A 1D0LA 1PM5A 3PSOA 4WURA 2EOIA 2R1FA 5AASA 5FTNA 2VIIA 4IBFA 2G8LA 3E46A 3QFKA 1GKIA 2R45A 3M99B 1QU6A 3DOAA 2F4VE 1X49A 1H6UA 3FUXA 3SAWA 1T71A 3TWMA 5J28A 4B08A 2AHMA 2VF7A 1XMOM 1PJSA 2DFJA 2LWXA 1DGFA 4DUYE 3VFDA 2R44A 1X5WA 3FUVA 4WSPA 4LFBE 4NHRA 4ZYHA 2LO3A 4LRTA 2EMKA 4FWHA 4LF5M 2F8BA 4GKKE 4W5WA 1C1KA 3T38A 2R65A 4DV7M 3I51A 1P3QQ 1IFYA 4BCAA 1RU3A 1XXHB 3L2AA 4X65E 2JWOA 4IBIA 2KXEA 2FH0A 2EPKX 2XH9A 2MKDA 2QFPA 1USHA 2EN8A 1KYQA 3J81C 2VQEM 3DJWA 2M5ZA 2QBYA 4B3SE 2WSEF 4NRVA 2EN6A 1ZAAC 3KS4A 3E7BA 4R71A 1E32A 2CHVA 3EPHA 1O0WA 1TF0B 3P71C 1MEYC 4J6OA 3MHSC 4FBWA 1TGUA 4L8RC 4X9JA 2LBCA 1TF3A 3FUTA 2IAEC 4YHHM 5EQVA 2YFQA 5A2QS 3RGSA 1W5TA 4LG2A 2EKFA 2GPIA 1WGLA 3H62B 2KZSA 4JXJA 3KFUG 2DENA 4AKHA 1SFEA 4H1YP 2L2DA 4L4UA 3SC3A 5FSWA 2HYOA 2V6ZM 2JOGA 4R2RA 2CHQA 2QQ8A 1S3SA 2MDRA 3NWLA 1YYWA 3KOZE 4FW9A 3MK6A 4FBKA 4NXNE 1TH2A 4F2JC 2EPRA 3MJ5A 1NSFA 2QNJA 3E21A 4XK8F 3FTFA 2V87A 2UXDM 5A2QC 4NXNM 3GPUA 4JI6M 4KO8A 3GRVA 2QPAA 2Z4RA 2OPFA 2WBSA 1DI2A 3K2LA 4DV2E 3LCUA 3ZH9B 2B9DA 3K7WC 1QAMA 2OOAA 1D0MA 2RKOA 4Q35B 4WPYA 1W5SA 4MGYE 4V0WA 5KPTA 2EM8A 4LTYA 2ZAOA 4TUGA 1ZBQA 3AL0C 3IG5A 5IT9S 1Z1BA 1VDLA 4DR5M 1JK2A 4RNAA 2UU9M 4JA9A 5IT9C 4NSOB 5CFFE 2KRKA 2JXPA 4II7A 4Z8XA 2LJUA 1Q3BA 2O8AA 2M9AA 1NHWC 5FLXS 5T6JA 3ZU0A 3C4TA 1TCOA 1WARA 3R9XB 3V76A 3LW5F 1X6FA 1L4SA 3W67A 2B3TB 2FS1A 1DQ3A 1X6EA 2UUBM 3K92A 1P47A 3E9SA 1IY0A 4D81A 2DZLA 2EKKA 3WHKA 2MDGA 1ZQ9A 1IXZA 2V1CA 1EFUB 1X47A 2RS6A 5FLXC 2I9IA 2F4VM 3T1HE 3K8ZA 3RE8A 2DLKA 3QFMA 4QNRA 2XZUA 1T4LB 1EIJA 2WSFF 2LTRA 4DUYM 3EPKA 3BBGA 4HLQA 3HU1A 4IIWA 2RS7A 2MGWA 3I04M 3PSNA 4CJ6A 2LH0A 4AQYE 1KYIA 3K6QA 1JK1A 1XNRM 1GL7A 5ITXE 3AV0A 3HY5A 3DZDA 3KSXA 4BHBA 1HNZE 3U60B 1SR9A 5DYIA 2EPOA 4WXCA 2NXFA 2VE7C 5JPEA 2YTPA 3KXEC 3AKZA 1HT1E 3IB7A 1NNJA 2EOFA 2KEBA 2JP9A 3QYBA 1L2BA 2EOOA 1GTKA 2VQFM 1VEGA 3GLFE 2LVQD 4LJ4A 3L26A 5LLQA 2UXBE 3IECA 1XZWA 4JI3E 2LHGA 1B69A 3KBPA 1YYKA 1OQYA 2EMAA 2YTGA 1A1HA 1YFHA 1OIZA 1MF8A 5KL4A 2DAEA 5ITUA 2EMWA 4F9AB 4OX9M 1WHCA 5FTKA 3GO8A 1N34E 4FCVA 2D9HA 2LBSB 4IJEA 4GEQB 4LF4M 2YTEA 1D2NA 4BBYA 1FKAE 4JI2M 3HU2A 2V85A 1Z5CA 2ENHA 4MGIE 1K3XA 3KOXE 1N75A 4KBPA 2C9CA 4MM3B 5INBA 2C96A 3K9PA 1R7RA 5DNYA 2IHR1 4REZA 1FJGE 3TE6A 2VDBB 1HR0M 3VLFB 2YTNA 3IWCA 2ZTCA 2QBYB 2E1MA 3ICFA 4FCXA 4O43A 1XHBA 2NQ8C 1UM8A 2JOXA 3DW8C 1GZ6A 3ADIA 1JR3A 4LGYA 2IE4C 2P5TA 2Z4SA 3FIGA 4QOZC 1UN6B 2J5YA 1G8PA 2LVOC 4QNMA 2NPPC 4H2FA 5BR8E 2YSPA 4FWDA 4TUWA 3E4RA 3C9FA 2C9OA 2QHOB 4JI1M 2R0IA 1J26A 4IS1C 4GMQA 2ODRC 1S3LA 4MGKE 1IN8A 4UT3A 4DR5E 2CT1A 4ZYEA 2LXEA 1SXJE 4HD0A 3GQ4A 2ERCA 2H1RA 3KOYE 2RSIA 2CEAA 3HVQA 2HY1A 2ZANA 3IVEA 3QAUA 3L00A 1K82A 2UXCE 5KQ8A 4F6MA 4LF5E 1T43A 3H64A 1NVMA 2G7HA 1UILA 4AQYM 3HPZA 4WX9A 2LV2A 5C1VA 2EOYA 1WRJA 1TTEA 4LF7M 2I7PA 4HEIA 1ZBTA 4R03A 4BC7A 1G2FC 1L8QA 2JWSA 3RL5A 4EIWA 3EPLA 4JYAM 2L2MA 2WCC3 3FLOA 2L09A 2KZUA 2YTQA 2EPLX 1IXSA 3U6LA 1XB2B 3OMLA 2NUEA 3GP1A 3EGGA 4G6ZA 3J80C 4FCWA 4JI0M 5ITTA 2NYLC 4Z6YA 3V4YA 2KHXA 4KZSA 1PJTA 3VK8A 4F0ZA 1IBLM 4MOVA 4Y28F 2RGHA 3D8LA 3SYLA 4BC9A 2ZM6E 3GLIA 2XSZD 2YT4A 4LJ7A 1OIEA 3CF2A 1Q39A 1AH5A 3RL4A 2FE8A 2X49A 3ZTVA 2GNOA 1L2DA 3RMPA 1X48A 4L78A 2BDXA 2N3HA 3NBIA 4DV3E 2EN4A 4GITA 2C98A 3KSJA 4A3VB 3T1IA 4D80A 2EM0A 1Y8GA 1VDDA 2FGGA 3DA1A 1SXJB 1T4NA 4DV4M 1HNWM 1J5EE 1N32E 1N33E 2DLQA 3BGHA 4DUZM 1IXRC 3B74A 2FNAA 2CP8A 2JY5A 1Z5AA 1GJTA 3TL4X 1T6OA 1WR1B 2EMGA 7CATA 4P17A 3GLIB 2PRTA 1VQ1A 2JY6B 2KA6B 4UT3B 1PGYA 3JR5A 5EP2A 4DV5M 5JI2E 1JB0F 3GRYA 2YZTA 1QZMA 4K0KE 3TGHA 2EMLA 5L8RF 3U6OA 2MC5A 2D7GA 4NZVA 3H4JA 1DGHA 3KP0E 1QAQA 3UZUA 4ZPXA 2ENAA 4B3TE 3PXGA 2V89A 3SAUA 4DR2E 2YWQA 3KDSE 2BBGA 2LMZA 2YR0A 3W68A 4PT5A 2V86A 2CE7A 2DMYA 2EE8A 4NC6A 2YEQA 2UXCM 2DNAA 3GLGA 2L7HA 1N3GA 2MH8A 4DR4M 2ODRD 3UGJA 4H2BA 2G5GX 2EN1A 3B89A 4BB9A 3J7BA 3ZOQB 3IG8A 1STUA 3CF0A 2EO2A 1IMUA 2EOZA 2EPPA 2ZO9B 1ZV1A 3WHLA 2DWZB 1WJPA 3U5ZA 4G3OA 4B3TM 3JAMS 2MROB 2HCBA 2RQLA 2F5OA 1EH6A 2X4AA 3GLFB 1I94M 2LVPC 4I4LA 2EA0A 3SMSA 1IY1A 4PCZA
chains in the Genus database with same CATH topology
2M60A 1N34M 2RS6A 5FLXC 2F4VM 3T1HE 2NYMC 1HT2E 2UUCM 1R6BX 3K8ZA 4M9XA 1WXQA 3PVSA 3RE8A 5KQDA 2DXNA 2Z72A 4DMIA 5JPFA 3QFMA 4ZX2A 4QNRA 4JI0E 2XZUA 2JY9A 2CV1A 1T4LB 2X8AA 2BQ8X 5H37D 3H66A 4LF6E 2I7NA 3M0EA 1EE8A 3M6AA 4LRSA 2XEPA 5DYGA 8CATA 2HL7A 2LTRA 4FVMA 3HHWA 4IBGA 3KP1E 1SXJD 4DUYM 4JI8M 1QHWA 2WDFA 4UT2A 4NOOB 4HLQA 3HU1A 4IIWA 2KONA 2RS7A 1GQEA 2VQEE 4IYPC 2F5PA 1K3WA 3PSNA 1YUBA 1S3NA 1IM2A 5B8IA 1UF3A 1KBPA 1S95A 4B2OA 2LH0A 4AQYE 2R46A 1R2YA 2J7NA 3FTEA 4BMJA 1KYIA 3K6QA 2QFRA 3CTWB 1XNRM 2R4EA 1Z59A 1G41A 1GL7A 5ITXE 3AV0A 3HWSA 4MH0E 4FWGA 3U6QA 3IWDA 4OOGC 2LUPB 1S8EA 2ZBMA 3K7VC 5LMNE 3DZDA 3H4MA 3KSXA 1HNZE 3U60B 1DGGA 3SATA 3QG5C 3TWKA 1KFVA 4M9ZA 1SR9A 4R8OA 4G4NA 4AW4A 5DYIA 4AG5A 2XZFA 4B3ME 5EP1A 3VK7A 3FKEA 3TQSA 2DB2A 4X64M 4NL4H 3JTZA 2VE7C 4JI2E 2NXFA 4JI7E 5JPEA 4JA7A 2C99A 4YY3M 3AOGA 3KXEC 4PD2A 1YSYA 4FCTA 1JK7A 3AKZA 3F6HA 1HT1E 3IB7A 4KODA 1NNJA 4XGIA 2KEBA 3DSCA 4LY6A 4IBDA 2EWLA 4MOYA 4YKEA 4XBOA 1J09A 1L2BA 3AUZA 4WWLA 4JV5M 5EP4A 1RQ0A 4G9JA 5BR8M 3EGHA 1JQJC 4GHLA 2YNMD 2L33A 2HHHE 1DGBA 4G4OA 5FTJA 2FTXB 2LTSA 2F5NA 5ADZA 1YZ9A 5GKNA 2W82A 2VQFM 3U61B 2L3CA 2ZOAA 1XMOE 3JR4A 4LJ4A 2KW0A 1MX0A 3L26A 3GLFA 2WDCA 3R8FA 2UXBE 4B7HA 3GQ3A 5LMUM 2CPNA 1HNXE 4JI3E 1XZWA 4DV0E 2CUZA 3AOEA 1HO5A 1YYKA 3KBPA 3HXLA 1G5BA 4H1SA 4IBJA 3ZCBB 3GQ5A 4O24A 4X64E 1T3TA 3MSWA 3FTCA 2N3GA 4WYQB 1MF8A 4P16A 5ITUA 4DR4E 2Z1AA 3J7AS 2CV9A 4H2IA 4F9AB 1HQYE 1QYRA 1WXRA 4UWQA 4MB7A 4B3SM 5KO3A 1WHQA 1N36E 4OX9M 3QFNA 4LF7E 3GRRA 5FTKA 3L25A 5EJCA 3GO8A 4GKKM 3J7AG 4J8ZA 4FCVA 1N34E 3UK6A 3HJSA 1IBKM 2LBSB 4KHPM 4OR9A 4IJEA 1Z2XA 2DXLA 4GEQB 4DSYA 3FYCA 4LF4M 1N78A 2UU9E 3H67A 1D2NA 1HNXM 4BBYA 5EP3A 5LMUE 1IBLE 1FNNA 1FKAE 4L15A 4JI2M 3HU2A 2R4JA 4DV3M 2NA2A 3LVVA 3FD9A 2V85A 4ITQA 1Z5CA 5LL6R 4S12A 4JI1E 4MGIE 3KVWA 1J7KA 3PNYA 1FJMA 3GLGB 1K3XA 3KOXE 4M30A 4DHLA 4OX9E 1QAOA 1N75A 1NY5A 1HNZM 1XM7A 2KKNA 4NSRA 2C9CA 4KBPA 1LV7A 3AOEC 2XLJA 3A45A 4MM3B 3TWLA 2DWLA 4LF6M 4AKIA 4LFAE 5INBA 2C96A 4DR7E 1HQCA 1R7RA 2V83A 2KOUA 1SU1A 4AKGA 5DNYA 3VYXA 2IHR1 2O8GA 1L1TA 4REZA 4OVZA 3TE6A 4GKJM 1G3IA 1XNQM 4JI6E 1FJGE 2DZNB 2HKJA 1HR0M 3VLFB 1OI8A 3HTXA 4AZFA 3A42A 4GC9A 3HHZA 3PNVA 3ADJA 3SHGB 4WW0A 4X65M 4DR1M 3U6EA 1WHNA 4P78A 1XNQE 2P6BA 2E5LE 3RQZA 2L92A 3IWCA 4DUZE 4LU9A 1QANA 3GLHA 1TDZA 4F54A 5GTUA 2V8QB 2A22A 2QBYB 3U6PA 2E1MA 4DR7M 3DW8C 1NHGC 4JI8E 3ICFA 2D7EA 4FCXA 3J80S 1XWIA 4OU7A 2JR1A 1XHBA 2NQ8C 3PFIA 3SHFA 1UM8A 4M0VA 4ZVZA 3RFWA 2BJWA 2WDDA 1DGHB 3U6MA 4GIPA 1XMQM 3B9PA 4GHAA 1OFHA 2JOXA 3F6GA 4LZZA 4AG6A 1I4WA 3LQQA 4GRIA 1GZ6A 3ADIA 3UJNA 4Q7FA 1E94E 1JR3A 4LGYA 1U32A 2IE4C 3THNA 3U6SA 2P5TA 5C1BA 2Z4SA 3FIGA 4QOZC 3D8BA 3FYDA 3W0LB 2ZBKB 2A5YB 1QQWA 4NRWA 3LLHA 2AHDA 2XSZA 2F5QA 3H69A 1G8PA 2C5RA 1FJGM 4LJ9A 3HQ1A 3U5ZB 3SYKA 3EIHA 4QNMA 4F9BB 4GKJE 2R17A 4AI6A 2DVWB 2QZ4A 3SASA 1N77A 2RSMA 2NPPC 2XF3A 1IXSB 4H2FA 1EKZA 1KSFX 2M1SA 2MC6A 4P7DA 3N5UA 4IBBA 5BR8E 2UUBE 4FWDA 4M0WA 4MGHA 3DFZA 3U61A 4TUWA 4JV5E 2BCDA 5LMNM 3E4RA 4I8OA 3C9FA 4I5LC 3J7Yp 2C9OA 2M4IA 4DV4E 3HJ8A 2UUCE 1XNRE 4JI1M 3IB8A 4QOSA 1J26A 4BS9A 4B7FA 3ADLA 4IBKA 2GJUA 4Q28A 2Y0TA 1NNUC 4GMQA 3Q8XA 4CHTB 2ODRC 1S3LA 2CFOA 4MGKE 3SBJA 3U6CA 5FTLA 2CV2A 4ORCA 3THGA 1IN8A 1IT6A 5ITYA 4LZJA 4UT3A 3IVDA 4DR5E 3GVEA 1PM5A 1HR0E 3PSOA 4KHPE 3FTDA 4WURA 4JYAE 4ORBA 2LXEA 2Q2EB 1UTEA 1SXJE 1G4AE 5AASA 5FTNA 4HD0A 4ORAA 2VIIA 4IBFA 3GQ4A 2ERCA 2H1RA 2G8LA 3QFKA 1GKIA 2R45A 3KOYE 1TDHA 2DWMA 4I81A 2CEAA 3HVQA 1IBMM 4LF9E 3SMPA 2HY1A 2ZANA 1QU6A 3IVEA 3TPZA 3QAUA 3CF6E 3U60A 1K82A 2UXCE 5KQ8A 2K4VA 4LF5E 3DOAA 3H64A 4MP0A 2Z7JA 2F4VE 3VKHA 3AJIB 1NVMA 3KWRA 3L27A 4YY3E 1IN5A 2G7HA 1UILA 1H6UA 3FUXA 3GPYA 3A46A 4AQYM 1X49A 3HPZA 4JI5E 1AUIA 3SAWA 4JI4E 4JI3M 3J2PB 3TWMA 1T71A 2V1UA 4V0VA 5J28A 3FUWA 4BBAA 4B08A 4DV6E 2AHMA 3KS8A 1IBKE 3D03A 3H68A 5C1VA 1XMOM 2DFJA 4O43A 2LWXA 2JOBA 1DGFA 4DUYE 4LF7M 5HPEA 3VFDA 2I7PA 4LJ6A 1N36M 1ZBTA 4R03A 4BC7A 1SXJC 3ZC7B 3GPPA 1N32M 1N33M 5ITXA 1L8QA 3FUVA 1E9SA 2H36X 4WSPA 3RL5A 4EIWA 5EXPA 5E26A 4JYAM 2L2MA 3HHYA 4PDIA 3FLOA 2L7IA 2L09A 4R3DA 1UHZA 4GH9A 1OJLA 4H2GA 2F5SA 4FD2A 3M7GA 2DXIA 2KZUA 4LFBE 3LL8A 3IWBA 2WZOA 4OW0A 2Y0QA 4LRTA 3LMMA 4FWHA 5JI3E 4LF5M 2F8BA 4GKKE 4W5WA 3FUUA 4B7GA 3OMLA 3U6LA 1C1KA 2VQFE 2NUEA 3GP1A 4DR6E 4M2ZA 3EGGA 4G6ZA 3T38A 3J80C 2R65A 4DV7M 1E9RA 1NNWA 2L8TA 3I51A 5IWAM 1HPUA 4FCWA 3AFHA 4BCAA 1XXHB 2CV0A 4JI0M 3T1YM 5IZ7D 5ITTA 5ITQA 2Y21A 2NYLC 1XXHA 4Z6YA 3V4YA 2KHXA 3C58A 4KZSA 3VK8A 3L2AA 2B7VA 2LE2A 3ILKA 2E5LM 2UXDE 4F0ZA 3UMMA 1IBLM 4X65E 2JWOA 4DR1E 1S70A 2DHRA 4MOVA 5F3WA 2RGHA 4IBIA 2KXEA 3K1JA 4LJ5A 1NJFA 2XH9A 2BJVA 4LFCM 2NUGA 1USHA 1M63A 2QFPA 3D8LA 3SYLA 2QP9X 4BC9A 1QFCA 3J81C 3GLIA 2XSZD 2VQEM 2LJHA 3SAVA 4LJ7A 2YT4A 3DJWA 2ZM6E 1XMQE 1II7A 2M5ZA 4DR3M 2QBYA 1OIEA 4B3SE 4BLCA 1TH4A 3CF2A 1Q39A 3GLHB 3A98B 3RL4A 2FE8A 1G59A 1IBME 2X49A 3W0FA 3VDPA 4DR2M 1PJIA 5IWAE 4I5NC 3ZTVA 5JJTA 3J81S 3HHXA 4NRVA 1L2DA 3H61A 1T70A 4MGZE 3RL3A 3RMPA 2KRUA 4DR3E 1X48A 1L2CA 4L78A 3FGAC 2YVTA 3LQRA 3KS4A 4O4KA 3E7BA 2BDXA 2N3HA 1E32A 2CHVA 4OVZB 4LFCE 4G4QA 3NBIA 4DV3E 1Z2WA 1O0WA 2RGOA 1SXJA 4GITA 2C98A 2JVAA 5AE3A 4LFBM 3KSJA 3P71C 4A3VB 4B3MM 2R62A 1I94E 2L6OA 4KLNA 2HYPA 4J6OA 4IBEA 4X62E 3T1IA 4D80A 1OFIA 3HJQA 1TGUA 4GC5A 1PJJA 3LMLA 4FBWA 1VDDA 4G4RA 4L8RC 2FGGA 3DA1A 4QHSA 2L2NA 1SXJB 1T4NA 5E6JA 4DV4M 1HNWM 4LFAM 3HPSA 1J5EE 1N32E 3DF6A 1N33E 3FUTA 2CHGA 4LF8M 1DO2A 2O5RA 4YHHM 2EUCA 2IAEC 2BNKA 1S3MA 3JAMC 3E0JA 1YYOA 2YFQA 5A2QS 4FBQA 3RGSA 5EQVA 1W5TA 2FV4B 4DV7E 3KW6A 2D7HA 3RGPA 4LG2A 4DUZM 1IXRC 2FNAA 2L3JA 1WAO1 3SARA 1Z5AA 3TL4X 4CGYB 2IE3C 1GVNA 1R2ZA 3VYYA 4RF1A 7CATA 1IN7A 2J7OA 3H63A 3GLIB 3H62B 2JA2A 2KZSA 4JXJA 3KFUG 3ADGA 2KA6B 2Y20A 4AKHA 4UT3B 4KKZA 3JR5A 2M7QA 2Q8UA 4IJFA 4L16A 1IY2A 4LJ8A 4QHTA 5EP2A 5IREB 4H1YP 4L4UA 3MHVC 4DV5M 1JR3D 5JI2E 2B7TA 2V88A 3SC3A 3VDUA 4R7GA 5FSWA 3T1YE 2V6ZM 2HYOA 2JOGA 3HKPA 2QJCA 2CHQA 4LGMA 4D82A 2ZAMA 3GRYA 1S3SA 3KOWE 4DV2M 2MDRA 3NWLA 1NJGA 1QZMA 2YZTA 1YYWA 4LACC 3L28A 3H60A 3HGIA 3HU3A 3KOZE 4FW9A 4K0KE 1GL6A 3MK6A 3GRUA 1HP1A 2DSYA 4NXNE 1TH2A 4FBKA 3TGHA 3THOB 4PDGA 4DV6M 3MJ5A 3U6OA 2MC5A 1ORYB 1YE9A 1NSFA 2D7GA 4LJAA 2LUQA 3SFZA 1T4OA 2USHA 3OTOE 4NZVA 2RTXA 3FTFA 2UXBM 2LRSA 3I4YA 1DGHA 3KP0E 4JI5M 2UXDM 2V87A 2XFSA 4NXMM 1QAQA 3UZUA 4NXNM 4X66E 5A2QC 3QFOA 5IOHA 1QVRA 3GPUA 4JI6M 3L29A 3GRVA 2QPAA 2Z4RA 4KO8A 4ZPXA 2OPFA 1DI2A 3K2LA 4DV2E 4B3TE 3ZH9B 1TH3A 2Z06A 5EXTA 3PXGA 2K47A 4IBCA 2B9DA 4LF9M 3SAUA 2V89A 1OIDA 3K7WC 4XPNA 1QAMA 4DV5E 4DR2E 3KDSE 2RKOA 4LF8E 4WPYA 4DKKA 4O5GA 1W5SA 4MGYE 1J5EM 4DR6M 5KPTA 4V0WA 4M0DA 4LTYA 3BOSA 3VKGA 1IQPA 2ZAOA 5BPVA 3I4VA 4TUGA 5AE2A 2LMZA 1ZBQA 4X66M 3IG5A 3AL0C 4NXME 5IT9S 1PKPA 3JYFA 3QWLA 4DR5M 3J27B 4DV1M 4JI7M 2DIXA 4DV0M 2YR0A 3H09A 1RC7A 3T15A 3OTOM 1IN6A 1GLNA 4RNAA 2UU9M 4JA9A 4V0XA 4PT5A 2V86A 2CE7A 2DMYA 4F9CB 5IT9C 2WDEA 1IN4A 2XGNA 4NSOB 2UUAM 2XMOA 2YEQA 1L1ZA 4RF0A 2UXCM 2KRKA 3P1XA 5CFFE 4II7A 4Z8XA 3GLGA 1Q3BA 2QENA 2O8AA 2L7HA 5AE1A 4YHHE 1HNWE 1Z5BA 1ZAEA 1MU5A 2QCUA 5EXXA 1NHWC 2VF1A 5FLXS 1DO0A 4DR4M 2ODRD 3UGJA 3C4BA 5T6JA 3CK2A 1X37A 4CISA 4HL4A 1Q3CA 2LNHC 4H2BA 3ZU0A 2G5GX 4L8NA 2NUFA 3C4TA 1V73A 4JI4M 3C5WC 4DT2A 2Z3XA 4BB9A 4B3RE 3U6DA 1TCOA 4B3RM 3J7BA 1WARA 4DV1E 3R9XB 3ZOQB 2YQZA 3IG8A 1STUA 3EIEA 2L2KB 3CF0A 2EO2A 2ZO9B 5FTMA 4K0KM 5C18A 2R18A 3WHLA 1W24A 2XFTA 4L5NC 2DWNA 2FOIC 2HHHM 2DWZB 2B3TB 3U5ZA 1DQ3A 2FFJA 3K92A 5ITRA 3E9SA 4LCBA 1XC8A 1IY0A 3JAMS 2UUBM 4B3TM 5KPZA 5EQTA 2HCBA 4D81A 2ZM6M 2UUAE 2F5OA 3E7AA 3T1HM 5KPRA 3WHKA 2X4AA 4X62M 3GPXA 3GLFB 4I5SA 1I94M 1NY6A 4JN6A 4I4LA 3JU0A 2EA0A 4WFTA 1ZQ9A 5EXSA 1IXZA 2V1CA 2DZOB 2L6MA 3SMSA 4M9SA 4LF4E 2EZ6A 4X8WA 3DSDA 1IY1A 3VK6A 4TUIA 3LVWA 1Z6TA 4PCZA 1X47A 4IL1A 2OQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J28 A;  3H68 A;  2NYM C;  5C1V A;  4UT3 B;  4KKZ A;  2DFJ A;  1FJM A;  2Z72 A;  5JPF A;  2Q8U A;  3QFM A;  4H1Y P;  4DHL A;  4ZX2 A;  5HPE A;  3DSD A;  2BQ8 X;  1XM7 A;  2KKN A;  2HYO A;  2XMO A;  3H66 A;  4KBP A;  2JOG A;  2QJC A;  5INB A;  3RL5 A;  4LAC C;  4UT2 A;  1QHW A;  1SU1 A;  2WDF A;  5DNY A;  2O8G A;  3H60 A;  1HP1 A;  4IYP C;  4FBK A;  3TGH A;  4H2G A;  3PSN A;  1S3N A;  1OI8 A;  2USH A;  3LL8 A;  5B8I A;  4NZV A;  1UF3 A;  1KBP A;  1S95 A;  4B2O A;  2P6B A;  3RQZ A;  5IOH A;  3QFO A;  2QFR A;  4LU9 A;  5GTU A;  3EGG A;  2A22 A;  3AV0 A;  2Z06 A;  1S8E A;  1NNW A;  3ICF A;  2ZBM A;  3K7V C;  4FCX A;  3K7W C;  4O43 A;  4M0V A;  1OID A;  1HPU A;  4XPN A;  4ZVZ A;  2WDD A;  3QG5 C;  4O5G A;  4V0W A;  3DW8 C;  4LTY A;  4Q7F A;  2NYL C;  2IE4 C;  4TUG A;  1U32 A;  3THN A;  3V4Y A;  4F0Z A;  3JYF A;  2NXF A;  1S70 A;  4MOV A;  5JPE A;  2AHD A;  5F3W A;  4JA7 A;  4JA9 A;  1JK7 A;  3H69 A;  2QFP A;  4V0X A;  1USH A;  1M63 A;  2WDE A;  3THO B;  3IB7 A;  1QFC A;  2R17 A;  3DSC A;  1II7 A;  1OIE A;  2NPP C;  4MOY A;  4H2F A;  4YKE A;  2O8A A;  3RL4 A;  4WWL A;  3N5U A;  3AUZ A;  3ZTV A;  5JJT A;  4G9J A;  3EGH A;  4I5N C;  2BCD A;  3C9F A;  3RL3 A;  3H61 A;  4I5L C;  1T70 A;  3CK2 A;  3IB8 A;  3FGA C;  2YVT A;  4O4K A;  3E7B A;  3ZU0 A;  4H2B A;  2BDX A;  2GJU A;  1V73 A;  3C5W C;  2WDC A;  1S3L A;  4DT2 A;  1Z2W A;  1TCO A;  1WAR A;  1XZW A;  1HO5 A;  3KBP A;  4ORC A;  1IT6 A;  1G5B A;  3P71 C;  4H1S A;  2HYP A;  4J6O A;  4UT3 A;  3IVD A;  4O24 A;  3T1I A;  3GVE A;  3PSO A;  4FBW A;  4ORB A;  1MF8 A;  1UTE A;  4ORA A;  4HD0 A;  1W24 A;  2Z1A A;  2CV9 A;  4H2I A;  3QFK A;  2IAE C;  4UWQ A;  1S3M A;  5EQV A;  3HVQ A;  4FBQ A;  2HY1 A;  3IVE A;  3QFN A;  3E7A A;  1WAO 1;  3H64 A;  4MP0 A;  4OR9 A;  1Z2X A;  2IE3 C;  4DSY A;  3H67 A;  1AUI A;  3H63 A;  3H62 B;  4TUI A;  1T71 A;  4V0V A;  4IL1 A; 
#chains in the Genus database with same CATH topology
 2JXN A;  1HT2 E;  3NBX X;  1R6B X;  5KQD A;  3PVS A;  2Z72 A;  2EOX A;  4F6N A;  4LF6 E;  2YSO A;  1EE8 A;  3M6A A;  2XEP A;  2EMX A;  4FVM A;  4IBG A;  2OOB A;  2K7I A;  3ECR A;  2KON A;  2VQE E;  1GQE A;  2EQ3 A;  2F5P A;  1YUB A;  5B8I A;  1KBP A;  1NV8 A;  2HC5 A;  2R46 A;  2CSH A;  1QZE A;  3CTW B;  2R4E A;  4MH0 E;  4FWG A;  3IWD A;  2LVN C;  2LUP B;  2ZBM A;  3K7V C;  5LMN E;  1BVS A;  3SAT A;  4M9Z A;  2EPN A;  1AAY A;  2XZF A;  5EP1 A;  2DB2 A;  4NL4 H;  4JI2 E;  4JI7 E;  1NV9 A;  2GQF A;  1CUK A;  4IBD A;  4MOY A;  4XBO A;  3AUZ A;  5EP4 A;  1RQ0 A;  2L33 A;  2LTS A;  1YZ9 A;  2W82 A;  2L3C A;  2ZOA A;  1XMO E;  2WDC A;  5LMU M;  2CPN A;  5KL3 A;  2CUZ A;  2EL6 A;  3B7Z A;  4R2S A;  4P16 A;  2GLI A;  4UWQ A;  2YRH A;  3LCV B;  1N36 E;  3QFN A;  4LF7 E;  3L25 A;  4GKK M;  3J7A G;  2R6F A;  3UK6 A;  1IBK M;  4OR9 A;  1DV0 A;  1N78 A;  3H67 A;  1EH7 A;  1IBL E;  1NCS A;  1A1L A;  1UFZ A;  3FD9 A;  4ITQ A;  1OTR A;  3PNY A;  2MKN A;  1QAO A;  2HJJ A;  1NY5 A;  4NSR A;  3AOE C;  2XLJ A;  4AKI A;  3K9O A;  4LFA E;  4DR7 E;  1HQC A;  2V83 A;  3BF2 A;  4AKG A;  4GKJ M;  4OVZ A;  1G3I A;  2EOM A;  3HTX A;  3A42 A;  3HZJ A;  2P6B A;  4X65 M;  1WHN A;  5IOH A;  2EMH A;  2L92 A;  1QAN A;  5GTU A;  3C3E A;  2D7E A;  1R4G A;  3F92 A;  1XWI A;  4OU7 A;  2JR1 A;  3SHF A;  3PFI A;  4ZVZ A;  2HWJ A;  2WDD A;  1XMQ M;  4GIP A;  4GHA A;  1OFH A;  3BID A;  1BBG A;  4AG6 A;  1I4W A;  3LQQ A;  1VEJ A;  4Q7F A;  3FYD A;  3W0L B;  2A5Y B;  1QQW A;  1V33 A;  3LLH A;  2C5R A;  4RH8 A;  2VRD A;  2R17 A;  2O25 A;  1T38 A;  2RSM A;  3SAS A;  1IXS B;  1EKZ A;  1MGT A;  4P7D A;  3IHP A;  4MGH A;  3DFZ A;  2DKL A;  2M4I A;  4DV4 E;  3IB8 A;  4QOS A;  4BS9 A;  3ADL A;  4Q28 A;  1NNU C;  5KL7 A;  3Q8X A;  2CFO A;  2EPX A;  4ORC A;  5ITY A;  3IVD A;  2Q2E B;  1G4A E;  4ORA A;  2R76 A;  2DWM A;  4I81 A;  1IBM M;  1BBO A;  3TPZ A;  3EQ1 A;  3CF6 E;  3U60 A;  5KL5 A;  1AIP C;  2K4V A;  1QUS A;  1IQS A;  1R5L A;  3AJI B;  4YY3 E;  3L27 A;  1IN5 A;  1AUI A;  1OIP A;  1A1K A;  4JI4 E;  4JI3 M;  2QSF X;  2V1U A;  4V0V A;  3FUW A;  4DV6 E;  3H68 A;  3D03 A;  2EPZ A;  1IBK E;  2EP3 A;  5HPE A;  1N36 M;  2EM9 A;  3GPP A;  5ITX A;  1E9S A;  3HHY A;  2L7I A;  4R3D A;  1UHZ A;  4GH9 A;  4H2G A;  3FE3 A;  2F5S A;  4FD2 A;  3M7G A;  2WZO A;  3LMM A;  5JI3 E;  4B7G A;  2VQF E;  1NNW A;  1E9R A;  5IWA M;  4M9V C;  3AFH A;  4ANR A;  5KL2 A;  5IZ7 D;  2H5X A;  2Y21 A;  1XXH A;  3C58 A;  5AC4 A;  2E5L M;  2L4F A;  2UXD E;  3UMM A;  4DR1 E;  2DHR A;  5F3W A;  4LJ5 A;  2NUG A;  1QFC A;  2LJH A;  4BLC A;  1TH4 A;  1G59 A;  1IBM E;  3W0F A;  5IWA E;  3VDP A;  4DR2 M;  5JJT A;  4I5N C;  3J81 S;  3HHX A;  3H61 A;  1D0K A;  1T70 A;  4R2E A;  1L2C A;  2EL5 A;  1PRB A;  2NAB A;  3FGA C;  1ZU1 A;  2JY8 A;  4O4K A;  1OAI A;  3ZQJ A;  1G2D C;  4LFC E;  1Z2W A;  2RGO A;  3Q8G A;  4B3M M;  2KNZ A;  1OFI A;  3HJQ A;  4GC5 A;  1PJJ A;  3LML A;  2L2N A;  2K0B X;  5E6J A;  3HPS A;  2CHG A;  4LF8 M;  3E0J A;  4DV7 E;  2L3J A;  3T6P A;  4CGY B;  2IE3 C;  1GVN A;  4RF1 A;  1IN7 A;  2J7O A;  3H63 A;  2O01 F;  2WBT A;  3ADG A;  3QYE A;  2KNV A;  2Y20 A;  4KKZ A;  2M7Q A;  4LJ8 A;  5IRE B;  5KL6 A;  2B7T A;  3DSD A;  2V88 A;  2XMO A;  4R7G A;  1YUI A;  1VG5 A;  4D82 A;  3KOW E;  1NJG A;  3L28 A;  3H60 A;  3HGI A;  3HU3 A;  1HP1 A;  1GL6 A;  2DSY A;  4PDG A;  1ZMV A;  1ORY B;  1YE9 A;  4LJA A;  3SFZ A;  1T4O A;  3I4Y A;  4JI5 M;  2XFS A;  4RHB B;  1TH3 A;  5EXT A;  2K47 A;  4LF9 M;  1F2I G;  4XPN A;  4ZYD A;  1MN3 A;  4DKK A;  3BOS A;  3VKG A;  1IQP A;  5BPV A;  3I4V A;  1F4I A;  4X66 M;  4NXM E;  3JYF A;  1PKP A;  3QWL A;  3J27 B;  4DV0 M;  3T15 A;  2DRP A;  2WDE A;  3THO B;  4R2D A;  1IN4 A;  4RF0 A;  3P1X A;  2QEN A;  5AE1 A;  4KT0 F;  1ZAE A;  1MU5 A;  3HX3 A;  3CK2 A;  2LVH A;  1X37 A;  4CIS A;  2EMB A;  2EMI A;  1Q3C A;  2LNH C;  4L8N A;  4DT2 A;  4B3R E;  2YQZ A;  4K0K M;  1ZMU A;  3BXW A;  2FFJ A;  5ITR A;  2EOE A;  1G71 A;  4GZN C;  5KPR A;  4X62 M;  3GPX A;  2WSC F;  4I5S A;  1NY6 A;  4JN6 A;  3JU0 A;  5EXS A;  2L6M A;  4X8W A;  2HAK A;  3VK6 A;  3LVW A;  3A98 B;  1Z6T A;  4IL1 A;  2OQ4 A;  1N34 M;  2NYM C;  2UUC M;  2N35 A;  1WXQ A;  1MJG M;  5JPF A;  1IQO A;  4ZX2 A;  4JI0 E;  2JY9 A;  2CV1 A;  2X8A A;  2BQ8 X;  5H37 D;  1GAB A;  5DYG A;  3HHW A;  4JI8 M;  1QHW A;  2WDF A;  4NOO B;  1YPN A;  2A25 A;  1IM2 A;  1UF3 A;  1S95 A;  4B2O A;  2KNA A;  2J7N A;  2YU8 A;  1YLA A;  2QFR A;  3B7N A;  2YTD A;  1Z59 A;  3U6Q A;  1AUA A;  1S8E A;  3H4M A;  4KWY A;  4GEW A;  3TWK A;  1KFV A;  1EH8 A;  4R8O A;  2KDL A;  4G4N A;  2KHH A;  4AW4 A;  3TQS A;  4X64 M;  3JTZ A;  2Z8Y M;  4WSG A;  4JA7 A;  2C99 A;  4YY3 M;  3AOG A;  1YSY A;  4FCT A;  3F6H A;  2LHC A;  4XGI A;  1A1G A;  3DSC A;  4LY6 A;  2EPA A;  2EWL A;  4JV5 M;  4G9J A;  1JQJ C;  4R2C A;  1XXH E;  2EMY A;  2EPM X;  1TF6 A;  1DGB A;  4G4O A;  2FTX B;  2F5N A;  5GKN A;  2EJ4 A;  2EPU A;  2ELZ A;  3U61 B;  3JR4 A;  2DI0 A;  4L6V 6;  5TSE A;  4B7H A;  3GQ3 A;  1HNX E;  2DGC A;  4DV0 E;  3AOE A;  1HO5 A;  2RPC A;  1G5B A;  4WP2 A;  4H1S A;  4IBJ A;  1T3T A;  2B3T A;  3MSW A;  1WJ7 A;  3FTC A;  2N3G A;  4WYQ B;  4DR4 E;  2Z1A A;  2CV9 A;  2EPC A;  4H2I A;  1HQY E;  1WXR A;  4MB7 A;  4B3S M;  5EJC A;  4J8Z A;  2DXL A;  3FYC A;  4F1I A;  1HNX M;  1FNN A;  2R4J A;  3J7Y p;  3LVV A;  5LL6 R;  2EM5 A;  1T39 A;  1J7K A;  1FJM A;  4M30 A;  2JY7 A;  4DHL A;  4R2P A;  1HNZ M;  1XM7 A;  2KKN A;  1LV7 A;  3TWL A;  4MLV A;  1QUT A;  2KOU A;  1SU1 A;  3MMP A;  2O8G A;  1X6H A;  1L1T A;  4JI6 E;  4GC9 A;  3ADJ A;  3PNV A;  3SHG B;  4WW0 A;  2JZ0 A;  4P78 A;  5A6A A;  2E5L E;  2YPN A;  2LTU A;  4LU9 A;  3U6P A;  4DR7 M;  1NHG C;  1TN9 A;  3RFW A;  3F6G A;  3B9P A;  3UK3 C;  1V92 A;  4GRI A;  2ZTD A;  3UJN A;  1E94 E;  2L4E A;  3THN A;  1TR8 A;  3U6S A;  1Q02 A;  1WGN A;  4UN2 B;  3D8B A;  4NRW A;  2F5Q A;  2CTD A;  2EM3 A;  3H69 A;  3HQ1 A;  4LJ9 A;  3SYK A;  3EIH A;  4F9B B;  3CGW A;  4AI6 A;  2EN7 A;  2XF3 A;  1KSF X;  2M1S A;  2MC6 A;  3N5U A;  4IBB A;  2UUB E;  4JV5 E;  5LMN M;  4I8O A;  1XNR E;  4B7F A;  1UBD C;  4CHT B;  2I13 A;  3U6C A;  4LZJ A;  3GVE A;  1HR0 E;  2J7J A;  4KHP E;  3FTD A;  4JYA E;  4ORB A;  1UTE A;  3C9P A;  2YRM A;  2JZ1 A;  1TDH A;  4LF9 E;  3SMP A;  2EM4 A;  4MP0 A;  2Z7J A;  3VKH A;  3KWR A;  4JI5 E;  3GPY A;  3A46 A;  3J2P B;  4BBA A;  3KS8 A;  2JOB A;  4LJ6 A;  3C3D A;  1SXJ C;  3ZC7 B;  1N32 M;  1N33 M;  3FRI A;  2H36 X;  1QDT A;  5EXP A;  5E26 A;  4PDI A;  1A1J A;  1OJL A;  2DXI A;  3LL8 A;  2LCE A;  2ENC A;  5A6B A;  3IWB A;  4OW0 A;  1ZR9 A;  2Y0Q A;  2G3Q A;  3FUU A;  4DR6 E;  4M2Z A;  2DAI A;  2BWB A;  2L8T A;  4CIZ A;  1HPU A;  1V34 A;  1PDA A;  2CV0 A;  3T1Y M;  4F2L A;  5ITQ A;  1WIV A;  2EQ0 A;  2B7V A;  2LE2 A;  3ILK A;  1S70 A;  2EM2 A;  3K1J A;  1GO5 A;  1NJF A;  2BJV A;  4LFC M;  1M63 A;  2QP9 X;  3SAV A;  1XMQ E;  1II7 A;  4DR3 M;  3GLH B;  2K9D A;  1HJP A;  2EOJ A;  5IV8 B;  1PJI A;  2YTF A;  3RL3 A;  4MGZ E;  2KRU A;  4DR3 E;  2YVT A;  2APL A;  3LQR A;  1OKS A;  4OVZ B;  4G4Q A;  2EJS A;  1SXJ A;  1LLM C;  2JVA A;  5AE3 A;  4LFB M;  3C6M A;  2HYP A;  1I94 E;  2R62 A;  2L6O A;  4KLN A;  4IBE A;  5AC5 A;  4X62 E;  1VEK A;  4G4R A;  4QHS A;  2GHF A;  4LFA M;  3DF6 A;  1DO2 A;  2O5R A;  2EUC A;  2BNK A;  1S3M A;  3JAM C;  1YYO A;  4FBQ A;  2FV4 B;  3KW6 A;  2D7H A;  3RGP A;  1WAO 1;  3SAR A;  1R2Z A;  3VYY A;  2JA2 A;  2Q8U A;  4IJF A;  4L16 A;  1C7Y A;  1IY2 A;  4QHT A;  3MHV C;  1JR3 D;  3T1Y E;  3VDU A;  2EM7 A;  3HKP A;  2QJC A;  2HGH A;  4LGM A;  2ZAM A;  4DV2 M;  4LAC C;  3TQM A;  2YRK A;  3GRU A;  4HTG A;  4DV6 M;  2USH A;  2LUQ A;  3OTO E;  2RTX A;  2UXB M;  2LRS A;  4NXM M;  4X66 E;  3QFO A;  1QVR A;  3L29 A;  4WXD A;  2Z06 A;  4IBC A;  1OID A;  4HEO A;  4DV5 E;  2YTO A;  3FRH A;  4LF8 E;  4O5G A;  2RRU A;  2EOH A;  1J5E M;  4DR6 M;  2DAM A;  4M0D A;  5AE2 A;  3GLI E;  4DV1 M;  4JI7 M;  2DIX A;  3H09 A;  1RC7 A;  3C6K A;  3OTO M;  1IN6 A;  1GLN A;  2CRU A;  2EMF A;  4V0X A;  3MHH C;  4F9C B;  2UUA M;  2JP7 A;  2XGN A;  1L1Z A;  1BB8 A;  2BB8 A;  4YHH E;  5IXM B;  1HNW E;  1Z5B A;  2QCU A;  5EXX A;  2VF1 A;  3KZZ A;  1DO0 A;  5A6B D;  3C4B A;  4HL4 A;  2NUF A;  1V73 A;  3C5W C;  4JI4 M;  2ELY A;  2Z3X A;  3U6D A;  2EOR A;  2EL4 A;  4DV1 E;  2E72 A;  2EOQ A;  1QDR A;  3EIE A;  1NEI A;  2L2K B;  1YUJ A;  4BHC A;  5FTM A;  5C18 A;  2R18 A;  1W24 A;  2XFT A;  2YTI A;  2MR9 A;  4L5N C;  2DWN A;  2FOI C;  2HHH M;  2JPA A;  4LCB A;  1XC8 A;  5KPZ A;  4MLQ A;  5EQT A;  2ZM6 M;  2UUA E;  3E7A A;  3T1H M;  1JR3 E;  4Q7J A;  4WFT A;  2DZO B;  4LF4 E;  4M9S A;  2EZ6 A;  4TUI A;  4B3R M;  2M60 A;  4M9X A;  1A1F A;  2DXN A;  4DMI A;  1SG9 A;  2EN3 A;  4R2A A;  4IJD A;  2JUJ A;  3H66 A;  2I7N A;  3M0E A;  4LRS A;  2WBU A;  8CAT A;  2HL7 A;  3I01 M;  4UT2 A;  3KP1 E;  1SXJ D;  4IYP C;  1K3W A;  1S3N A;  3VHT B;  2ADR A;  1R2Y A;  3FTE A;  4BMJ A;  2BWE A;  1OAO C;  2DAK A;  1G41 A;  4RKU F;  3HWS A;  4OOG C;  2DMI A;  1DGG A;  3QG5 C;  1PJQ A;  3KZY A;  4AG5 A;  2EMZ A;  2LT7 A;  4B3M E;  3VK7 A;  3FKE A;  3BBZ A;  4PD2 A;  1JK7 A;  4KOD A;  2YU5 A;  4N4R B;  1KJK A;  5A69 A;  4YKE A;  4R2Q A;  1J09 A;  3GLH E;  4WWL A;  5BR8 M;  3EGH A;  4GHL A;  2YNM D;  2HHH E;  5FTJ A;  5ADZ A;  1X3C A;  3EPJ A;  2EQ1 A;  2KW0 A;  1MX0 A;  3GLF A;  3R8F A;  2OO9 A;  3HXL A;  5A6J A;  4DBG B;  3ZCB B;  3GQ5 A;  4O24 A;  4X64 E;  3J7A S;  4ZYG A;  1QYR A;  1A5T A;  3B7Q A;  5KO3 A;  1WHQ A;  3GRR A;  4FK5 C;  3HJS A;  4KHP M;  1Z2X A;  4DSY A;  1YSA C;  2UU9 E;  5LMU E;  5EP3 A;  2EM6 A;  4L15 A;  4DV3 M;  2NA2 A;  4S12 A;  2EN2 A;  4JI1 E;  3KVW A;  1A1I A;  3GLG B;  2WZJ A;  4OX9 E;  3A45 A;  2DWL A;  4LF6 M;  1QNT A;  3VYX A;  2YTJ A;  1XNQ M;  2DZN B;  2HKJ A;  1OI8 A;  4AZF A;  1DGC A;  1NO1 A;  3HHZ A;  3U6E A;  1LTM A;  4DR1 M;  3RQZ A;  1XNQ E;  4DUZ E;  1TDZ A;  3GLH A;  4F54 A;  2V8Q B;  2A22 A;  5A6K A;  4JI8 E;  3J80 S;  4M0V A;  2DAG A;  2EMC A;  2BJW A;  2JNH A;  1DGH B;  3U6M A;  4LZZ A;  1U32 A;  5DFL A;  5C1B A;  2EOS A;  2ZBK B;  2CWB A;  2AHD A;  2JYA A;  2XSZ A;  1FJG M;  3U5Z B;  2DHY A;  2K6B A;  4GKJ E;  2DVW B;  2QZ4 A;  3GLG E;  1N77 A;  1GJS A;  4M0W A;  3U61 A;  2BCD A;  4I5L C;  1ZMW A;  3HJ8 A;  2VF8 A;  2UUC E;  2MJ5 B;  4IBK A;  2GJU A;  2Y0T A;  2LVA A;  1RMD A;  3SBJ A;  5FTL A;  2CV2 A;  2N8X A;  3THG A;  1IT6 A;  1D0L A;  1PM5 A;  3PSO A;  4WUR A;  2EOI A;  2R1F A;  5AAS A;  5FTN A;  2VII A;  4IBF A;  2G8L A;  3E46 A;  3QFK A;  1GKI A;  2R45 A;  3M99 B;  1QU6 A;  3DOA A;  2F4V E;  1X49 A;  1H6U A;  3FUX A;  3SAW A;  1T71 A;  3TWM A;  5J28 A;  4B08 A;  2AHM A;  2VF7 A;  1XMO M;  1PJS A;  2DFJ A;  2LWX A;  1DGF A;  4DUY E;  3VFD A;  2R44 A;  1X5W A;  3FUV A;  4WSP A;  4LFB E;  4NHR A;  4ZYH A;  2LO3 A;  4LRT A;  2EMK A;  4FWH A;  4LF5 M;  2F8B A;  4GKK E;  4W5W A;  1C1K A;  3T38 A;  2R65 A;  4DV7 M;  3I51 A;  1P3Q Q;  1IFY A;  4BCA A;  1RU3 A;  1XXH B;  3L2A A;  4X65 E;  2JWO A;  4IBI A;  2KXE A;  2FH0 A;  2EPK X;  2XH9 A;  2MKD A;  2QFP A;  1USH A;  2EN8 A;  1KYQ A;  3J81 C;  2VQE M;  3DJW A;  2M5Z A;  2QBY A;  4B3S E;  2WSE F;  4NRV A;  2EN6 A;  1ZAA C;  3KS4 A;  3E7B A;  4R71 A;  1E32 A;  2CHV A;  3EPH A;  1O0W A;  1TF0 B;  3P71 C;  1MEY C;  4J6O A;  3MHS C;  4FBW A;  1TGU A;  4L8R C;  4X9J A;  2LBC A;  1TF3 A;  3FUT A;  2IAE C;  4YHH M;  5EQV A;  2YFQ A;  5A2Q S;  3RGS A;  1W5T A;  4LG2 A;  2EKF A;  2GPI A;  1WGL A;  3H62 B;  2KZS A;  4JXJ A;  3KFU G;  2DEN A;  4AKH A;  1SFE A;  4H1Y P;  2L2D A;  4L4U A;  3SC3 A;  5FSW A;  2HYO A;  2V6Z M;  2JOG A;  4R2R A;  2CHQ A;  2QQ8 A;  1S3S A;  2MDR A;  3NWL A;  1YYW A;  3KOZ E;  4FW9 A;  3MK6 A;  4FBK A;  4NXN E;  1TH2 A;  4F2J C;  2EPR A;  3MJ5 A;  1NSF A;  2QNJ A;  3E21 A;  4XK8 F;  3FTF A;  2V87 A;  2UXD M;  5A2Q C;  4NXN M;  3GPU A;  4JI6 M;  4KO8 A;  3GRV A;  2QPA A;  2Z4R A;  2OPF A;  2WBS A;  1DI2 A;  3K2L A;  4DV2 E;  3LCU A;  3ZH9 B;  2B9D A;  3K7W C;  1QAM A;  2OOA A;  1D0M A;  2RKO A;  4Q35 B;  4WPY A;  1W5S A;  4MGY E;  4V0W A;  5KPT A;  2EM8 A;  4LTY A;  2ZAO A;  4TUG A;  1ZBQ A;  3AL0 C;  3IG5 A;  5IT9 S;  1Z1B A;  1VDL A;  4DR5 M;  1JK2 A;  4RNA A;  2UU9 M;  4JA9 A;  5IT9 C;  4NSO B;  5CFF E;  2KRK A;  2JXP A;  4II7 A;  4Z8X A;  2LJU A;  1Q3B A;  2O8A A;  2M9A A;  1NHW C;  5FLX S;  5T6J A;  3ZU0 A;  3C4T A;  1TCO A;  1WAR A;  3R9X B;  3V76 A;  3LW5 F;  1X6F A;  1L4S A;  3W67 A;  2B3T B;  2FS1 A;  1DQ3 A;  1X6E A;  2UUB M;  3K92 A;  1P47 A;  3E9S A;  1IY0 A;  4D81 A;  2DZL A;  2EKK A;  3WHK A;  2MDG A;  1ZQ9 A;  1IXZ A;  2V1C A;  1EFU B;  1X47 A;  2RS6 A;  5FLX C;  2I9I A;  2F4V M;  3T1H E;  3K8Z A;  3RE8 A;  2DLK A;  3QFM A;  4QNR A;  2XZU A;  1T4L B;  1EIJ A;  2WSF F;  2LTR A;  4DUY M;  3EPK A;  3BBG A;  4HLQ A;  3HU1 A;  4IIW A;  2RS7 A;  2MGW A;  3I04 M;  3PSN A;  4CJ6 A;  2LH0 A;  4AQY E;  1KYI A;  3K6Q A;  1JK1 A;  1XNR M;  1GL7 A;  5ITX E;  3AV0 A;  3HY5 A;  3DZD A;  3KSX A;  4BHB A;  1HNZ E;  3U60 B;  1SR9 A;  5DYI A;  2EPO A;  4WXC A;  2NXF A;  2VE7 C;  5JPE A;  2YTP A;  3KXE C;  3AKZ A;  1HT1 E;  3IB7 A;  1NNJ A;  2EOF A;  2KEB A;  2JP9 A;  3QYB A;  1L2B A;  2EOO A;  1GTK A;  2VQF M;  1VEG A;  3GLF E;  2LVQ D;  4LJ4 A;  3L26 A;  5LLQ A;  2UXB E;  3IEC A;  1XZW A;  4JI3 E;  2LHG A;  1B69 A;  3KBP A;  1YYK A;  1OQY A;  2EMA A;  2YTG A;  1A1H A;  1YFH A;  1OIZ A;  1MF8 A;  5KL4 A;  2DAE A;  5ITU A;  2EMW A;  4F9A B;  4OX9 M;  1WHC A;  5FTK A;  3GO8 A;  1N34 E;  4FCV A;  2D9H A;  2LBS B;  4IJE A;  4GEQ B;  4LF4 M;  2YTE A;  1D2N A;  4BBY A;  1FKA E;  4JI2 M;  3HU2 A;  2V85 A;  1Z5C A;  2ENH A;  4MGI E;  1K3X A;  3KOX E;  1N75 A;  4KBP A;  2C9C A;  4MM3 B;  5INB A;  2C96 A;  3K9P A;  1R7R A;  5DNY A;  2IHR 1;  4REZ A;  1FJG E;  3TE6 A;  2VDB B;  1HR0 M;  3VLF B;  2YTN A;  3IWC A;  2ZTC A;  2QBY B;  2E1M A;  3ICF A;  4FCX A;  4O43 A;  1XHB A;  2NQ8 C;  1UM8 A;  2JOX A;  3DW8 C;  1GZ6 A;  3ADI A;  1JR3 A;  4LGY A;  2IE4 C;  2P5T A;  2Z4S A;  3FIG A;  4QOZ C;  1UN6 B;  2J5Y A;  1G8P A;  2LVO C;  4QNM A;  2NPP C;  4H2F A;  5BR8 E;  2YSP A;  4FWD A;  4TUW A;  3E4R A;  3C9F A;  2C9O A;  2QHO B;  4JI1 M;  2R0I A;  1J26 A;  4IS1 C;  4GMQ A;  2ODR C;  1S3L A;  4MGK E;  1IN8 A;  4UT3 A;  4DR5 E;  2CT1 A;  4ZYE A;  2LXE A;  1SXJ E;  4HD0 A;  3GQ4 A;  2ERC A;  2H1R A;  3KOY E;  2RSI A;  2CEA A;  3HVQ A;  2HY1 A;  2ZAN A;  3IVE A;  3QAU A;  3L00 A;  1K82 A;  2UXC E;  5KQ8 A;  4F6M A;  4LF5 E;  1T43 A;  3H64 A;  1NVM A;  2G7H A;  1UIL A;  4AQY M;  3HPZ A;  4WX9 A;  2LV2 A;  5C1V A;  2EOY A;  1WRJ A;  1TTE A;  4LF7 M;  2I7P A;  4HEI A;  1ZBT A;  4R03 A;  4BC7 A;  1G2F C;  1L8Q A;  2JWS A;  3RL5 A;  4EIW A;  3EPL A;  4JYA M;  2L2M A;  2WCC 3;  3FLO A;  2L09 A;  2KZU A;  2YTQ A;  2EPL X;  1IXS A;  3U6L A;  1XB2 B;  3OML A;  2NUE A;  3GP1 A;  3EGG A;  4G6Z A;  3J80 C;  4FCW A;  4JI0 M;  5ITT A;  2NYL C;  4Z6Y A;  3V4Y A;  2KHX A;  4KZS A;  1PJT A;  3VK8 A;  4F0Z A;  1IBL M;  4MOV A;  4Y28 F;  2RGH A;  3D8L A;  3SYL A;  4BC9 A;  2ZM6 E;  3GLI A;  2XSZ D;  2YT4 A;  4LJ7 A;  1OIE A;  3CF2 A;  1Q39 A;  1AH5 A;  3RL4 A;  2FE8 A;  2X49 A;  3ZTV A;  2GNO A;  1L2D A;  3RMP A;  1X48 A;  4L78 A;  2BDX A;  2N3H A;  3NBI A;  4DV3 E;  2EN4 A;  4GIT A;  2C98 A;  3KSJ A;  4A3V B;  3T1I A;  4D80 A;  2EM0 A;  1Y8G A;  1VDD A;  2FGG A;  3DA1 A;  1SXJ B;  1T4N A;  4DV4 M;  1HNW M;  1J5E E;  1N32 E;  1N33 E;  2DLQ A;  3BGH A;  4DUZ M;  1IXR C;  3B74 A;  2FNA A;  2CP8 A;  2JY5 A;  1Z5A A;  1GJT A;  3TL4 X;  1T6O A;  1WR1 B;  2EMG A;  7CAT A;  4P17 A;  3GLI B;  2PRT A;  1VQ1 A;  2JY6 B;  2KA6 B;  4UT3 B;  1PGY A;  3JR5 A;  5EP2 A;  4DV5 M;  5JI2 E;  1JB0 F;  3GRY A;  2YZT A;  1QZM A;  4K0K E;  3TGH A;  2EML A;  5L8R F;  3U6O A;  2MC5 A;  2D7G A;  4NZV A;  3H4J A;  1DGH A;  3KP0 E;  1QAQ A;  3UZU A;  4ZPX A;  2ENA A;  4B3T E;  3PXG A;  2V89 A;  3SAU A;  4DR2 E;  2YWQ A;  3KDS E;  2BBG A;  2LMZ A;  2YR0 A;  3W68 A;  4PT5 A;  2V86 A;  2CE7 A;  2DMY A;  2EE8 A;  4NC6 A;  2YEQ A;  2UXC M;  2DNA A;  3GLG A;  2L7H A;  1N3G A;  2MH8 A;  4DR4 M;  2ODR D;  3UGJ A;  4H2B A;  2G5G X;  2EN1 A;  3B89 A;  4BB9 A;  3J7B A;  3ZOQ B;  3IG8 A;  1STU A;  3CF0 A;  2EO2 A;  1IMU A;  2EOZ A;  2EPP A;  2ZO9 B;  1ZV1 A;  3WHL A;  2DWZ B;  1WJP A;  3U5Z A;  4G3O A;  4B3T M;  3JAM S;  2MRO B;  2HCB A;  2RQL A;  2F5O A;  1EH6 A;  2X4A A;  3GLF B;  1I94 M;  2LVP C;  4I4L A;  2EA0 A;  3SMS A;  1IY1 A;  4PCZ A; 
#chains in the Genus database with same CATH homology
 2M60 A;  1N34 M;  2RS6 A;  5FLX C;  2F4V M;  3T1H E;  2NYM C;  1HT2 E;  2UUC M;  1R6B X;  3K8Z A;  4M9X A;  1WXQ A;  3PVS A;  3RE8 A;  5KQD A;  2DXN A;  2Z72 A;  4DMI A;  5JPF A;  3QFM A;  4ZX2 A;  4QNR A;  4JI0 E;  2XZU A;  2JY9 A;  2CV1 A;  1T4L B;  2X8A A;  2BQ8 X;  5H37 D;  3H66 A;  4LF6 E;  2I7N A;  3M0E A;  1EE8 A;  3M6A A;  4LRS A;  2XEP A;  5DYG A;  8CAT A;  2HL7 A;  2LTR A;  4FVM A;  3HHW A;  4IBG A;  3KP1 E;  1SXJ D;  4DUY M;  4JI8 M;  1QHW A;  2WDF A;  4UT2 A;  4NOO B;  4HLQ A;  3HU1 A;  4IIW A;  2KON A;  2RS7 A;  1GQE A;  2VQE E;  4IYP C;  2F5P A;  1K3W A;  3PSN A;  1YUB A;  1S3N A;  1IM2 A;  5B8I A;  1UF3 A;  1KBP A;  1S95 A;  4B2O A;  2LH0 A;  4AQY E;  2R46 A;  1R2Y A;  2J7N A;  3FTE A;  4BMJ A;  1KYI A;  3K6Q A;  2QFR A;  3CTW B;  1XNR M;  2R4E A;  1Z59 A;  1G41 A;  1GL7 A;  5ITX E;  3AV0 A;  3HWS A;  4MH0 E;  4FWG A;  3U6Q A;  3IWD A;  4OOG C;  2LUP B;  1S8E A;  2ZBM A;  3K7V C;  5LMN E;  3DZD A;  3H4M A;  3KSX A;  1HNZ E;  3U60 B;  1DGG A;  3SAT A;  3QG5 C;  3TWK A;  1KFV A;  4M9Z A;  1SR9 A;  4R8O A;  4G4N A;  4AW4 A;  5DYI A;  4AG5 A;  2XZF A;  4B3M E;  5EP1 A;  3VK7 A;  3FKE A;  3TQS A;  2DB2 A;  4X64 M;  4NL4 H;  3JTZ A;  2VE7 C;  4JI2 E;  2NXF A;  4JI7 E;  5JPE A;  4JA7 A;  2C99 A;  4YY3 M;  3AOG A;  3KXE C;  4PD2 A;  1YSY A;  4FCT A;  1JK7 A;  3AKZ A;  3F6H A;  1HT1 E;  3IB7 A;  4KOD A;  1NNJ A;  4XGI A;  2KEB A;  3DSC A;  4LY6 A;  4IBD A;  2EWL A;  4MOY A;  4YKE A;  4XBO A;  1J09 A;  1L2B A;  3AUZ A;  4WWL A;  4JV5 M;  5EP4 A;  1RQ0 A;  4G9J A;  5BR8 M;  3EGH A;  1JQJ C;  4GHL A;  2YNM D;  2L33 A;  2HHH E;  1DGB A;  4G4O A;  5FTJ A;  2FTX B;  2LTS A;  2F5N A;  5ADZ A;  1YZ9 A;  5GKN A;  2W82 A;  2VQF M;  3U61 B;  2L3C A;  2ZOA A;  1XMO E;  3JR4 A;  4LJ4 A;  2KW0 A;  1MX0 A;  3L26 A;  3GLF A;  2WDC A;  3R8F A;  2UXB E;  4B7H A;  3GQ3 A;  5LMU M;  2CPN A;  1HNX E;  4JI3 E;  1XZW A;  4DV0 E;  2CUZ A;  3AOE A;  1HO5 A;  1YYK A;  3KBP A;  3HXL A;  1G5B A;  4H1S A;  4IBJ A;  3ZCB B;  3GQ5 A;  4O24 A;  4X64 E;  1T3T A;  3MSW A;  3FTC A;  2N3G A;  4WYQ B;  1MF8 A;  4P16 A;  5ITU A;  4DR4 E;  2Z1A A;  3J7A S;  2CV9 A;  4H2I A;  4F9A B;  1HQY E;  1QYR A;  1WXR A;  4UWQ A;  4MB7 A;  4B3S M;  5KO3 A;  1WHQ A;  1N36 E;  4OX9 M;  3QFN A;  4LF7 E;  3GRR A;  5FTK A;  3L25 A;  5EJC A;  3GO8 A;  4GKK M;  3J7A G;  4J8Z A;  4FCV A;  1N34 E;  3UK6 A;  3HJS A;  1IBK M;  2LBS B;  4KHP M;  4OR9 A;  4IJE A;  1Z2X A;  2DXL A;  4GEQ B;  4DSY A;  3FYC A;  4LF4 M;  1N78 A;  2UU9 E;  3H67 A;  1D2N A;  1HNX M;  4BBY A;  5EP3 A;  5LMU E;  1IBL E;  1FNN A;  1FKA E;  4L15 A;  4JI2 M;  3HU2 A;  2R4J A;  4DV3 M;  2NA2 A;  3LVV A;  3FD9 A;  2V85 A;  4ITQ A;  1Z5C A;  5LL6 R;  4S12 A;  4JI1 E;  4MGI E;  3KVW A;  1J7K A;  3PNY A;  1FJM A;  3GLG B;  1K3X A;  3KOX E;  4M30 A;  4DHL A;  4OX9 E;  1QAO A;  1N75 A;  1NY5 A;  1HNZ M;  1XM7 A;  2KKN A;  4NSR A;  2C9C A;  4KBP A;  1LV7 A;  3AOE C;  2XLJ A;  3A45 A;  4MM3 B;  3TWL A;  2DWL A;  4LF6 M;  4AKI A;  4LFA E;  5INB A;  2C96 A;  4DR7 E;  1HQC A;  1R7R A;  2V83 A;  2KOU A;  1SU1 A;  4AKG A;  5DNY A;  3VYX A;  2IHR 1;  2O8G A;  1L1T A;  4REZ A;  4OVZ A;  3TE6 A;  4GKJ M;  1G3I A;  1XNQ M;  4JI6 E;  1FJG E;  2DZN B;  2HKJ A;  1HR0 M;  3VLF B;  1OI8 A;  3HTX A;  4AZF A;  3A42 A;  4GC9 A;  3HHZ A;  3PNV A;  3ADJ A;  3SHG B;  4WW0 A;  4X65 M;  4DR1 M;  3U6E A;  1WHN A;  4P78 A;  1XNQ E;  2P6B A;  2E5L E;  3RQZ A;  2L92 A;  3IWC A;  4DUZ E;  4LU9 A;  1QAN A;  3GLH A;  1TDZ A;  4F54 A;  5GTU A;  2V8Q B;  2A22 A;  2QBY B;  3U6P A;  2E1M A;  4DR7 M;  3DW8 C;  1NHG C;  4JI8 E;  3ICF A;  2D7E A;  4FCX A;  3J80 S;  1XWI A;  4OU7 A;  2JR1 A;  1XHB A;  2NQ8 C;  3PFI A;  3SHF A;  1UM8 A;  4M0V A;  4ZVZ A;  3RFW A;  2BJW A;  2WDD A;  1DGH B;  3U6M A;  4GIP A;  1XMQ M;  3B9P A;  4GHA A;  1OFH A;  2JOX A;  3F6G A;  4LZZ A;  4AG6 A;  1I4W A;  3LQQ A;  4GRI A;  1GZ6 A;  3ADI A;  3UJN A;  4Q7F A;  1E94 E;  1JR3 A;  4LGY A;  1U32 A;  2IE4 C;  3THN A;  3U6S A;  2P5T A;  5C1B A;  2Z4S A;  3FIG A;  4QOZ C;  3D8B A;  3FYD A;  3W0L B;  2ZBK B;  2A5Y B;  1QQW A;  4NRW A;  3LLH A;  2AHD A;  2XSZ A;  2F5Q A;  3H69 A;  1G8P A;  2C5R A;  1FJG M;  4LJ9 A;  3HQ1 A;  3U5Z B;  3SYK A;  3EIH A;  4QNM A;  4F9B B;  4GKJ E;  2R17 A;  4AI6 A;  2DVW B;  2QZ4 A;  3SAS A;  1N77 A;  2RSM A;  2NPP C;  2XF3 A;  1IXS B;  4H2F A;  1EKZ A;  1KSF X;  2M1S A;  2MC6 A;  4P7D A;  3N5U A;  4IBB A;  5BR8 E;  2UUB E;  4FWD A;  4M0W A;  4MGH A;  3DFZ A;  3U61 A;  4TUW A;  4JV5 E;  2BCD A;  5LMN M;  3E4R A;  4I8O A;  3C9F A;  4I5L C;  3J7Y p;  2C9O A;  2M4I A;  4DV4 E;  3HJ8 A;  2UUC E;  1XNR E;  4JI1 M;  3IB8 A;  4QOS A;  1J26 A;  4BS9 A;  4B7F A;  3ADL A;  4IBK A;  2GJU A;  4Q28 A;  2Y0T A;  1NNU C;  4GMQ A;  3Q8X A;  4CHT B;  2ODR C;  1S3L A;  2CFO A;  4MGK E;  3SBJ A;  3U6C A;  5FTL A;  2CV2 A;  4ORC A;  3THG A;  1IN8 A;  1IT6 A;  5ITY A;  4LZJ A;  4UT3 A;  3IVD A;  4DR5 E;  3GVE A;  1PM5 A;  1HR0 E;  3PSO A;  4KHP E;  3FTD A;  4WUR A;  4JYA E;  4ORB A;  2LXE A;  2Q2E B;  1UTE A;  1SXJ E;  1G4A E;  5AAS A;  5FTN A;  4HD0 A;  4ORA A;  2VII A;  4IBF A;  3GQ4 A;  2ERC A;  2H1R A;  2G8L A;  3QFK A;  1GKI A;  2R45 A;  3KOY E;  1TDH A;  2DWM A;  4I81 A;  2CEA A;  3HVQ A;  1IBM M;  4LF9 E;  3SMP A;  2HY1 A;  2ZAN A;  1QU6 A;  3IVE A;  3TPZ A;  3QAU A;  3CF6 E;  3U60 A;  1K82 A;  2UXC E;  5KQ8 A;  2K4V A;  4LF5 E;  3DOA A;  3H64 A;  4MP0 A;  2Z7J A;  2F4V E;  3VKH A;  3AJI B;  1NVM A;  3KWR A;  3L27 A;  4YY3 E;  1IN5 A;  2G7H A;  1UIL A;  1H6U A;  3FUX A;  3GPY A;  3A46 A;  4AQY M;  1X49 A;  3HPZ A;  4JI5 E;  1AUI A;  3SAW A;  4JI4 E;  4JI3 M;  3J2P B;  3TWM A;  1T71 A;  2V1U A;  4V0V A;  5J28 A;  3FUW A;  4BBA A;  4B08 A;  4DV6 E;  2AHM A;  3KS8 A;  1IBK E;  3D03 A;  3H68 A;  5C1V A;  1XMO M;  2DFJ A;  4O43 A;  2LWX A;  2JOB A;  1DGF A;  4DUY E;  4LF7 M;  5HPE A;  3VFD A;  2I7P A;  4LJ6 A;  1N36 M;  1ZBT A;  4R03 A;  4BC7 A;  1SXJ C;  3ZC7 B;  3GPP A;  1N32 M;  1N33 M;  5ITX A;  1L8Q A;  3FUV A;  1E9S A;  2H36 X;  4WSP A;  3RL5 A;  4EIW A;  5EXP A;  5E26 A;  4JYA M;  2L2M A;  3HHY A;  4PDI A;  3FLO A;  2L7I A;  2L09 A;  4R3D A;  1UHZ A;  4GH9 A;  1OJL A;  4H2G A;  2F5S A;  4FD2 A;  3M7G A;  2DXI A;  2KZU A;  4LFB E;  3LL8 A;  3IWB A;  2WZO A;  4OW0 A;  2Y0Q A;  4LRT A;  3LMM A;  4FWH A;  5JI3 E;  4LF5 M;  2F8B A;  4GKK E;  4W5W A;  3FUU A;  4B7G A;  3OML A;  3U6L A;  1C1K A;  2VQF E;  2NUE A;  3GP1 A;  4DR6 E;  4M2Z A;  3EGG A;  4G6Z A;  3T38 A;  3J80 C;  2R65 A;  4DV7 M;  1E9R A;  1NNW A;  2L8T A;  3I51 A;  5IWA M;  1HPU A;  4FCW A;  3AFH A;  4BCA A;  1XXH B;  2CV0 A;  4JI0 M;  3T1Y M;  5IZ7 D;  5ITT A;  5ITQ A;  2Y21 A;  2NYL C;  1XXH A;  4Z6Y A;  3V4Y A;  2KHX A;  3C58 A;  4KZS A;  3VK8 A;  3L2A A;  2B7V A;  2LE2 A;  3ILK A;  2E5L M;  2UXD E;  4F0Z A;  3UMM A;  1IBL M;  4X65 E;  2JWO A;  4DR1 E;  1S70 A;  2DHR A;  4MOV A;  5F3W A;  2RGH A;  4IBI A;  2KXE A;  3K1J A;  4LJ5 A;  1NJF A;  2XH9 A;  2BJV A;  4LFC M;  2NUG A;  1USH A;  1M63 A;  2QFP A;  3D8L A;  3SYL A;  2QP9 X;  4BC9 A;  1QFC A;  3J81 C;  3GLI A;  2XSZ D;  2VQE M;  2LJH A;  3SAV A;  4LJ7 A;  2YT4 A;  3DJW A;  2ZM6 E;  1XMQ E;  1II7 A;  2M5Z A;  4DR3 M;  2QBY A;  1OIE A;  4B3S E;  4BLC A;  1TH4 A;  3CF2 A;  1Q39 A;  3GLH B;  3A98 B;  3RL4 A;  2FE8 A;  1G59 A;  1IBM E;  2X49 A;  3W0F A;  3VDP A;  4DR2 M;  1PJI A;  5IWA E;  4I5N C;  3ZTV A;  5JJT A;  3J81 S;  3HHX A;  4NRV A;  1L2D A;  3H61 A;  1T70 A;  4MGZ E;  3RL3 A;  3RMP A;  2KRU A;  4DR3 E;  1X48 A;  1L2C A;  4L78 A;  3FGA C;  2YVT A;  3LQR A;  3KS4 A;  4O4K A;  3E7B A;  2BDX A;  2N3H A;  1E32 A;  2CHV A;  4OVZ B;  4LFC E;  4G4Q A;  3NBI A;  4DV3 E;  1Z2W A;  1O0W A;  2RGO A;  1SXJ A;  4GIT A;  2C98 A;  2JVA A;  5AE3 A;  4LFB M;  3KSJ A;  3P71 C;  4A3V B;  4B3M M;  2R62 A;  1I94 E;  2L6O A;  4KLN A;  2HYP A;  4J6O A;  4IBE A;  4X62 E;  3T1I A;  4D80 A;  1OFI A;  3HJQ A;  1TGU A;  4GC5 A;  1PJJ A;  3LML A;  4FBW A;  1VDD A;  4G4R A;  4L8R C;  2FGG A;  3DA1 A;  4QHS A;  2L2N A;  1SXJ B;  1T4N A;  5E6J A;  4DV4 M;  1HNW M;  4LFA M;  3HPS A;  1J5E E;  1N32 E;  3DF6 A;  1N33 E;  3FUT A;  2CHG A;  4LF8 M;  1DO2 A;  2O5R A;  4YHH M;  2EUC A;  2IAE C;  2BNK A;  1S3M A;  3JAM C;  3E0J A;  1YYO A;  2YFQ A;  5A2Q S;  4FBQ A;  3RGS A;  5EQV A;  1W5T A;  2FV4 B;  4DV7 E;  3KW6 A;  2D7H A;  3RGP A;  4LG2 A;  4DUZ M;  1IXR C;  2FNA A;  2L3J A;  1WAO 1;  3SAR A;  1Z5A A;  3TL4 X;  4CGY B;  2IE3 C;  1GVN A;  1R2Z A;  3VYY A;  4RF1 A;  7CAT A;  1IN7 A;  2J7O A;  3H63 A;  3GLI B;  3H62 B;  2JA2 A;  2KZS A;  4JXJ A;  3KFU G;  3ADG A;  2KA6 B;  2Y20 A;  4AKH A;  4UT3 B;  4KKZ A;  3JR5 A;  2M7Q A;  2Q8U A;  4IJF A;  4L16 A;  1IY2 A;  4LJ8 A;  4QHT A;  5EP2 A;  5IRE B;  4H1Y P;  4L4U A;  3MHV C;  4DV5 M;  1JR3 D;  5JI2 E;  2B7T A;  2V88 A;  3SC3 A;  3VDU A;  4R7G A;  5FSW A;  3T1Y E;  2V6Z M;  2HYO A;  2JOG A;  3HKP A;  2QJC A;  2CHQ A;  4LGM A;  4D82 A;  2ZAM A;  3GRY A;  1S3S A;  3KOW E;  4DV2 M;  2MDR A;  3NWL A;  1NJG A;  1QZM A;  2YZT A;  1YYW A;  4LAC C;  3L28 A;  3H60 A;  3HGI A;  3HU3 A;  3KOZ E;  4FW9 A;  4K0K E;  1GL6 A;  3MK6 A;  3GRU A;  1HP1 A;  2DSY A;  4NXN E;  1TH2 A;  4FBK A;  3TGH A;  3THO B;  4PDG A;  4DV6 M;  3MJ5 A;  3U6O A;  2MC5 A;  1ORY B;  1YE9 A;  1NSF A;  2D7G A;  4LJA A;  2LUQ A;  3SFZ A;  1T4O A;  2USH A;  3OTO E;  4NZV A;  2RTX A;  3FTF A;  2UXB M;  2LRS A;  3I4Y A;  1DGH A;  3KP0 E;  4JI5 M;  2UXD M;  2V87 A;  2XFS A;  4NXM M;  1QAQ A;  3UZU A;  4NXN M;  4X66 E;  5A2Q C;  3QFO A;  5IOH A;  1QVR A;  3GPU A;  4JI6 M;  3L29 A;  3GRV A;  2QPA A;  2Z4R A;  4KO8 A;  4ZPX A;  2OPF A;  1DI2 A;  3K2L A;  4DV2 E;  4B3T E;  3ZH9 B;  1TH3 A;  2Z06 A;  5EXT A;  3PXG A;  2K47 A;  4IBC A;  2B9D A;  4LF9 M;  3SAU A;  2V89 A;  1OID A;  3K7W C;  4XPN A;  1QAM A;  4DV5 E;  4DR2 E;  3KDS E;  2RKO A;  4LF8 E;  4WPY A;  4DKK A;  4O5G A;  1W5S A;  4MGY E;  1J5E M;  4DR6 M;  5KPT A;  4V0W A;  4M0D A;  4LTY A;  3BOS A;  3VKG A;  1IQP A;  2ZAO A;  5BPV A;  3I4V A;  4TUG A;  5AE2 A;  2LMZ A;  1ZBQ A;  4X66 M;  3IG5 A;  3AL0 C;  4NXM E;  5IT9 S;  1PKP A;  3JYF A;  3QWL A;  4DR5 M;  3J27 B;  4DV1 M;  4JI7 M;  2DIX A;  4DV0 M;  2YR0 A;  3H09 A;  1RC7 A;  3T15 A;  3OTO M;  1IN6 A;  1GLN A;  4RNA A;  2UU9 M;  4JA9 A;  4V0X A;  4PT5 A;  2V86 A;  2CE7 A;  2DMY A;  4F9C B;  5IT9 C;  2WDE A;  1IN4 A;  2XGN A;  4NSO B;  2UUA M;  2XMO A;  2YEQ A;  1L1Z A;  4RF0 A;  2UXC M;  2KRK A;  3P1X A;  5CFF E;  4II7 A;  4Z8X A;  3GLG A;  1Q3B A;  2QEN A;  2O8A A;  2L7H A;  5AE1 A;  4YHH E;  1HNW E;  1Z5B A;  1ZAE A;  1MU5 A;  2QCU A;  5EXX A;  1NHW C;  2VF1 A;  5FLX S;  1DO0 A;  4DR4 M;  2ODR D;  3UGJ A;  3C4B A;  5T6J A;  3CK2 A;  1X37 A;  4CIS A;  4HL4 A;  1Q3C A;  2LNH C;  4H2B A;  3ZU0 A;  2G5G X;  4L8N A;  2NUF A;  3C4T A;  1V73 A;  4JI4 M;  3C5W C;  4DT2 A;  2Z3X A;  4BB9 A;  4B3R E;  3U6D A;  1TCO A;  4B3R M;  3J7B A;  1WAR A;  4DV1 E;  3R9X B;  3ZOQ B;  2YQZ A;  3IG8 A;  1STU A;  3EIE A;  2L2K B;  3CF0 A;  2EO2 A;  2ZO9 B;  5FTM A;  4K0K M;  5C18 A;  2R18 A;  3WHL A;  1W24 A;  2XFT A;  4L5N C;  2DWN A;  2FOI C;  2HHH M;  2DWZ B;  2B3T B;  3U5Z A;  1DQ3 A;  2FFJ A;  3K92 A;  5ITR A;  3E9S A;  4LCB A;  1XC8 A;  1IY0 A;  3JAM S;  2UUB M;  4B3T M;  5KPZ A;  5EQT A;  2HCB A;  4D81 A;  2ZM6 M;  2UUA E;  2F5O A;  3E7A A;  3T1H M;  5KPR A;  3WHK A;  2X4A A;  4X62 M;  3GPX A;  3GLF B;  4I5S A;  1I94 M;  1NY6 A;  4JN6 A;  4I4L A;  3JU0 A;  2EA0 A;  4WFT A;  1ZQ9 A;  5EXS A;  1IXZ A;  2V1C A;  2DZO B;  2L6M A;  3SMS A;  4M9S A;  4LF4 E;  2EZ6 A;  4X8W A;  3DSD A;  1IY1 A;  3VK6 A;  4TUI A;  3LVW A;  1Z6T A;  4PCZ A;  1X47 A;  4IL1 A;  2OQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...