5DNYA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
352
Chain Sequence
b'HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Recombination/dna
total genus 107
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5dnyA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5dnyA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5dnyA01
3IB7A 3THOB 5F3WA 2ZBMA 3C9FA 4DHLA 4F0ZA 1USHA 3DSDA 1TCOA 3QFKA 2WDFA 3DSCA 3AUZA 2IE3C 4J6OA 3HVQA 4FBKA 1Z2WA 4WWLA 3H61A 4H1YP 3ZTVA 2NYMC 4ORCA 1KBPA 5EQVA 4H1SA 4LACC 2HYPA 1QHWA 3PSNA 4FBQA 2O8GA 5HPEA 3IVDA 5JPFA 2WDDA 5GTUA 2WDEA 4TUGA 3H62B 2P6BA 2QFPA 3KBPA 4I5LC 3H69A 2AHDA 3QFNA 4O24A 3EGGA 1HO5A 4V0WA 4IL1A 1OIDA 4H2GA 3N5UA 2BQ8X 3H60A 1UTEA 3H66A 5B8IA 4LTYA 5J28A 3ICFA 1S3NA 3E7AA 3AV0A 4FCXA 4H2IA 4KKZA 3LL8A 3FGAC 3CK2A 2BCDA 3QFMA 4UT2A 2HYOA 3C5WC 2CV9A 4ORBA 4M0VA 4MP0A 4UT3A 1WARA 4JA7A 3H64A 2HY1A 3DW8C 4IYPC 3RQZA 3ZU0A 2QJCA 2WDCA 3EGHA 4Q7FA 1T70A 1QFCA 1WAO1 1XZWA 1OIEA 4XPNA 3V4YA 3JYFA 2BDXA 3K7WC 4V0VA 3K7VC 3H67A 1U32A 4OR9A 5JJTA 1MF8A 1OI8A 5JPEA 2KKNA 3PSOA 3THNA 2QFRA 4MOYA 4H2BA 4O43A 2DFJA 2O8AA 3GVEA 3H68A 3TGHA 3IVEA 2NPPC 1II7A 3P71C 1T71A 2XMOA 1G5BA 2Q8UA 1V73A 4MOVA 3RL3A 5DNYA 3IB8A 3H63A 1HPUA 4DSYA 4I5NC 4V0XA 4ZX2A 1S3MA 4KBPA 4FBWA 2A22A 2R17A 4H2FA 4YKEA 3RL5A 2GJUA 3T1IA 4HD0A 2NXFA 5C1VA 4DT2A 2Z06A 3E7BA 4G9JA 1AUIA 1S3LA 2Z1AA 1UF3A 4NZVA 2IAEC 1HP1A 4ORAA 1Z2XA 2NYLC 1NNWA 1FJMA 4B2OA 4O5GA 1W24A 2YVTA 2JOGA 1S8EA 4ZVZA 3QG5C 1XM7A 3QFOA 1M63A 1S70A 2IE4C 1JK7A 1SU1A 4TUIA 4UWQA 4O4KA 5INBA 1S95A 5IOHA 2Z72A 4UT3B 4JA9A 1IT6A 2USHA 4LU9A 3RL4A
chains in the Genus database with same CATH superfamily
1IN5A 3SHGB 4R2QA 1QDTA 1H6UA 1N33M 4GIPA 3HZJA 3HKPA 2F5OA 5IT9S 2ODRD 1A1HA 1VEKA 4DV7M 1NNUC 3C6MA 3BF2A 4AI6A 2LRSA 5KL3A 2V6ZM 4O24A 4WFTA 4R03A 2EN1A 3U61B 2UUBE 1IN4A 3DOAA 2ZBKB 1HR0E 2FS1A 3L25A 3I4YA 4M0VA 1DGHB 2M9AA 2J7JA 1OIEA 2VQEE 4XPNA 4X64M 4FCVA 4GC9A 1QQWA 4M9ZA 2QHOB 4LF8E 1N78A 4DKKA 1OI8A 1IQSA 3L27A 1X6EA 1KFVA 3U6CA 5LMUE 4KLNA 2WBSA 4PDGA 1OAIA 1XMOM 2FNAA 1GQEA 3IB8A 1TF6A 3QYBA 4I5NC 1IXZA 2DXIA 1VEJA 4F6NA 2CTDA 1JQJC 3DJWA 4KT0F 4DR1M 2KW0A 1XMQE 2DWNA 4WSPA 1D0KA 4MGKE 4AQYE 3LVWA 3A42A 4NXMM 2YEQA 3LVVA 2RTXA 1YSYA 4DV3E 2K4VA 2MC5A 2KXEA 4FWHA 3U6MA 3ADGA 3TPZA 4UWQA 1PJIA 4NOOB 3K9OA 1QAMA 3FUUA 2YTOA 2EOQA 2A5YB 1J7KA 3DFZA 2EMYA 3FUVA 5FTJA 2CSHA 2K47A 3RGPA 2DWLA 1UBDC 4H1SA 1QHWA 3C3DA 3J7AG 1N75A 5JPFA 4TUGA 4W5WA 4DR4M 4R71A 4DV4E 3QFNA 4HTGA 2EUCA 4Q7JA 3KP1E 1HO5A 1C1KA 3GQ3A 2FH0A 2L2KB 1CUKA 5B8IA 1X5WA 1OQYA 3EPLA 3E7AA 2UXCE 2EN8A 4I8OA 1QU6A 3RQZA 2J5YA 2GHFA 3HU2A 1XZWA 2XEPA 5KL4A 4G6ZA 4NXNM 1L2CA 1SXJB 2N35A 4BS9A 2K0BX 5JJTA 3HX3A 4G4QA 2E5LE 5ITYA 1ZAAC 2N3GA 2DFJA 3BXWA 4YHHM 2O8AA 2V8QB 1WJ7A 3LW5F 4DV0E 2D7HA 4GKJE 2EM6A 2NUFA 3RL5A 2GJUA 3T1IA 3KVWA 4HD0A 1PM5A 5EP3A 2CPNA 1NVMA 1IBKE 1ZMUA 1YZ9A 3ZC7B 4LJ7A 2DZNB 5EP4A 2RGOA 4JI2E 2LVPC 5KQ8A 1TTEA 1AH5A 4LF6E 1PJTA 2YPNA 2V86A 2CV2A 2VQEM 4TUWA 5AE2A 2MJ5B 3C4BA 4LF8M 2ZBMA 2B9DA 3DSCA 3GPYA 3VHTB 1TF3A 1QVRA 2R18A 4LJ5A 1EH7A 1T43A 2LBCA 4FBKA 4GRIA 1Z2WA 3U6DA 2XZUA 1MN3A 4MH0E 4IS1C 1BB8A 2R62A 1G8PA 4Y28F 4BBAA 4MGYE 4R8OA 4L4UA 1GLNA 2HL7A 4V0WA 2EM5A 5LMNM 2D7EA 2QBYA 4AQYM 5ITRA 4RNAA 1N32E 1Z6TA 1DO0A 2MROB 2BB8A 3PFIA 4PT5A 3HJ8A 1NJGA 4QHSA 3M6AA 2QZ4A 2XFTA 2R46A 4FCXA 3OMLA 1KYIA 2DB2A 2VF7A 3T1YE 3IWCA 3E21A 2EOYA 4Q7FA 1NSFA 3GLHA 1WAO1 4G3OA 1R6BX 1HNZE 4LGMA 2BBGA 2HHHE 2C98A 2QPAA 5EXPA 1HT2E 4GEWA 2EM0A 4DUYM 4BCAA 8CATA 5H37D 2Y21A 4OOGC 2DKLA 1AIPC 1VDLA 1N77A 3EPJA 4DT2A 4F2LA 3JAMC 3C3EA 2ZTCA 4GEQB 3EIEA 2DI0A 2MGWA 2CE7A 1W5SA 4B7FA 2R65A 4JI4M 2MDGA 1DI2A 1N34E 3D03A 3KFUG 4PCZA 2H1RA 1SU1A 4O4KA 2UUCE 2KA6B 4LG2A 1R7RA 2E1MA 3DSDA 4B3TE 1WGNA 1ZMWA 2ZM6M 3GLIA 4GZNC 2CV0A 4M9XA 4LF9E 4M9VC 2UUAE 2HWJA 4DV0M 2UXDE 2O8GA 5KL7A 3ZCBB 3L26A 5GTUA 3H62B 2DAEA 3KBPA 1MU5A 4I81A 1AAYA 5AE3A 3K1JA 2EM7A 4LF7M 2EOJA 1IBMM 1UFZA 2X8AA 2EQ0A 1L4SA 3NBXX 5IV8B 4B7GA 4KHPE 1E32A 3QWLA 2JVAA 4LF6M 4JI1M 4B3RE 2KRUA 4LGYA 2CEAA 2JA2A 2HYOA 4X66M 3KOXE 2XH9A 1NEIA 3GRUA 2DAMA 1SG9A 3CF6E 2WSEF 4LRSA 1ZQ9A 5E6JA 3BIDA 3W0LB 2L4EA 2N3HA 2QCUA 4DR2M 3IECA 2EM9A 2RPCA 4DV2E 3SC3A 2EQ3A 3VDPA 2YTPA 4JYAM 1HPUA 2K6BA 2DLQA 3MHHC 4WX9A 1S3MA 3KZZA 1IY2A 1I4WA 4JN6A 1NJFA 1PJJA 1JR3A 2UU9E 3GLFB 2EM3A 2CWBA 2V83A 2FV4B 1N33E 3EPHA 4REZA 2EMZA 2YTGA 4GKKM 4JI6E 1PGYA 2CV1A 3SFZA 5IOHA 4UT3B 4DV7E 4DV5M 2OO9A 3GPPA 2HHHM 3C9FA 3FRHA 1V92A 2KOUA 2ADRA 2L09A 3EPKA 2M5ZA 2EOOA 2EOZA 5ADZA 4H1YP 3OTOE 2O5RA 3IVDA 1WHCA 2QFPA 2EPRA 3R8FA 3BBGA 1SFEA 1HT1E 1X49A 2XF3A 3N5UA 2DHRA 3IHPA 3H66A 4QOSA 2EWLA 4X64E 2DRPA 1K3WA 3W68A 2GNOA 1PJSA 3DZDA 4NL4H 2V87A 2I7NA 1QZMA 5KPTA 2YTQA 3SATA 2YRMA 4MLVA 1S3NA 3FGAC 1UN6B 3U60A 4AKGA 4UT2A 3JAMS 3CTWB 1QUTA 1V34A 1QFCA 3J80C 2EMKA 4NSRA 1XMOE 2UXBM 4LF5M 4CISA 1DQ3A 3GLGA 2UUAM 1X47A 2KEBA 1XXHA 4DR1E 3TWMA 3THNA 2UXDM 2R0IA 2LWXA 3RE8A 2BWBA 5EXSA 4HL4A 3LQQA 3RL3A 2L2NA 4JV5M 5A2QC 2MC6A 4BMJA 4YKEA 4FBWA 1TH2A 2WZJA 2J7NA 3SMSA 4P17A 4DUZM 3IWBA 3I51A 5EQTA 1PDAA 4KHPM 4DV6E 2EOEA 1LV7A 2B3TA 1IN8A 2MKNA 3JU0A 3FYDA 4HEIA 3FRIA 2CHVA 1NNWA 1V33A 4PDIA 1FJMA 4DR3M 1IM2A 2O01F 4DBGB 4ZVZA 2R45A 2LUQA 2L8TA 2EL4A 2DMYA 4DR4E 4DHLA 1NY6A 4BC7A 2JXNA 3VFDA 2YRKA 3NWLA 3I04M 1TF0B 4F6MA 3QYEA 2EPLX 5FLXC 1QAQA 2EE8A 3KW6A 2KHXA 3PVSA 1JR3E 4LY6A 4MLQA 4KO8A 1DV0A 4LJ4A 1TR8A 2L33A 2R6FA 4I5SA 4I4LA 2RSIA 4NXNE 2V88A 2YU5A 2Y0TA 4JI6M 2JY8A 3C5WC 1WARA 4YHHE 2AHMA 5AE1A 1Y8GA 5LL6R 2DZOB 4IIWA 1YSAC 3ZQJA 3L2AA 1U32A 2L7IA 1J09A 1NO1A 3OTOM 4QNRA 4R2EA 1TGUA 1Q02A 2CHQA 1II7A 1RU3A 5ITUA 2N8XA 2CHGA 1AUIA 3I4VA 2V1CA 4ORAA 2NYLC 2OQ4A 1A5TA 3HJQA 4RKUF 3J2PB 5AC5A 1IY1A 2JYAA 2Z72A 3GLGE 1XXHE 2LT7A 5LLQA 3TQSA 3GRRA 3QFKA 4FK5C 2PRTA 1R2ZA 2R1FA 4HLQA 5LMNE 3KXEC 4CIZA 2R4JA 2NYMC 3J80S 4LACC 1TH3A 2K9DA 1YYOA 2YTJA 3ZOQB 4CJ6A 4ZYDA 4DV6M 4JI5M 5FTKA 2M7QA 3UMMA 4FW9A 2F5SA 2P5TA 5A2QS 5KPRA 5C18A 3VK7A 4F1IA 1IN7A 3T15A 3E46A 5TSEA 3SYLA 3VKHA 3F92A 1Z5CA 4LCBA 4DUYE 3CF0A 3KS8A 3U6PA 3BBZA 2XFSA 3LMMA 4ANRA 3U61A 3V4YA 2RSMA 2O25A 2LV2A 4F9CB 3QAUA 1SR9A 3GQ4A 2L3JA 3A98B 1L2BA 2NPPC 4JXJA 1G5BA 1BVSA 1VG5A 3FKEA 1C7YA 1MJGM 4NRWA 4JI4E 5EXXA 2JOXA 2CFOA 4H2FA 2JNHA 4L6V6 3GPXA 1NCSA 2RS7A 1OFIA 2DMIA 1N36M 2ZTDA 2Z1AA 5FLXS 4DMIA 2DAKA 2QBYB 5IWAE 1WGLA 3HXLA 2ZM6E 1P47A 1Z2XA 3IG5A 2FTXB 2JPAA 3HU1A 5A6BD 3B7QA 2G8LA 4B3ME 4R7GA 2M1SA 3AJIB 4JA9A 1IT6A 2ENCA 3FUXA 4FWDA 3GLHB 2D9HA 4YY3M 2JR1A 2V1UA 2FOIC 1G3IA 4WWLA 4LF7E 1PRBA 3AOEC 2EMCA 1IBME 2LTRA 1QUSA 3E0JA 4J8ZA 2G3QA 5EQVA 4AG5A 5ITXA 3KS4A 4BHBA 1TDHA 3T1HM 3M7GA 2ZO9B 1XNRM 2WDEA 1EH8A 5BPVA 1IN6A 5KL2A 4JI1E 2EPMX 4KZSA 2LE2A 4X66E 4FD2A 1IFYA 3FD9A 3JR5A 1OIDA 2CP8A 3L28A 3IWDA 5FTNA 1EE8A 4XK8F 2E72A 4LTYA 3AL0C 4QOZC 3EQ1A 2YZTA 2LTSA 1QZEA 4X65M 3AV0A 1GL6A 4ZYHA 2CV9A 4MP0A 4DR2E 3EGHA 3FIGA 4JYAE 4OX9E 3JYFA 1T38A 4R2RA 4LF4M 1L1ZA 4OR9A 4RF0A 4L8RC 5JPEA 5A69A 3GLIB 2CT1A 1T4LB 1V73A 5KL5A 1LLMC 4GHAA 4GKKE 3C9PA 2Z06A 2Q2EB 1IY0A 4G9JA 1S3LA 3IG8A 4GHLA 4DV5E 5A6AA 4LFAE 1Z5AA 2QP9X 2WCC3 5A6BA 5FSWA 4B2OA 1E9RA 3RGSA 2KNAA 1A1IA 4WPYA 1JK7A 4M0WA 4GITA 4LZZA 4IJFA 4B7HA 1XC8A 1IQPA 7CATA 4WURA 2LH0A 2L3CA 3D8LA 1STUA 4MGHA 1JR3D 3W0FA 3H61A 1DGCA 3FLOA 2ZAMA 2MR9A 3FTCA 3UK6A 1YUJA 2EN6A 3JR4A 2L7HA 2L2DA 2EPZA 5IWAM 3V76A 2UXBE 1G2DC 4LF5E 2KHHA 2YTNA 3HU3A 4DR6E 2KZSA 4B3MM 3QFMA 2YFQA 3I01M 4ORBA 2ZAOA 3KOZE 1L1TA 3FYCA 4EIWA 2G7HA 3ZU0A 1L2DA 4B3SM 1MX0A 5JI2E 1HNXM 4JV5E 4LFBM 2K7IA 4Z6YA 2DXLA 5ITXE 3U6EA 2OOBA 4DUZE 2QFRA 4H2BA 3VYXA 4BC9A 2EMLA 3F6HA 1WHNA 3E4RA 1T71A 2QENA 4DR3E 4DR5E 1R5LA 2VF1A 2A22A 2R17A 2WSCF 2EPKX 1EKZA 1HNWE 1G71A 2EM4A 5IREB 4S12A 2LCEA 1XHBA 2IAEC 4G4OA 3B7NA 4L5NC 2DNAA 3B7ZA 3U5ZA 1JB0F 1ORYB 2LNHC 1DGFA 1W24A 1VEGA 2JOGA 1M63A 4OX9M 1GJSA 3U60B 3H09A 4TUIA 2LTUA 1P3QQ 1S95A 3ADLA 1D0MA 4LJAA 2EN7A 2DVWB 1VDDA 4UN2B 2EMGA 3GLGB 3UJNA 4MM3B 2LBSB 5CFFE 2KZUA 1YLAA 4XBOA 4PD2A 3T6PA 4WXDA 3C4TA 3F6GA 4I5LC 4IBGA 4IBBA 1GJTA 4JI0M 2EPXA 3AOEA 4M0DA 3J81C 1LTMA 4LFAM 3GRYA 3H60A 3FTEA 3R9XB 1ZMVA 4AKIA 5IZ7D 3RMPA 2KRKA 2YNMD 1O0WA 1UHZA 2EOIA 3ICFA 2B3TB 2BWEA 1EIJA 3K8ZA 1UM8A 1A1JA 1RC7A 3TQMA 2BCDA 1DGGA 4GMQA 2C96A 3GRVA 1NV8A 5GKNA 2V85A 2QJCA 3H4JA 1GVNA 2DGCA 2QSFX 2J7OA 2MH8A 2LVQD 1RMDA 2F4VM 1QANA 3E9SA 2EMFA 2EN3A 2KKNA 4NRVA 4O43A 3KZYA 4IBFA 3B89A 3TGHA 1IXSA 2EA0A 1GABA 4MOVA 3PNYA 1GTKA 5DNYA 3D8BA 2Z7JA 2D7GA 2EN4A 4CGYB 2ELZA 2RRUA 1XWIA 3KDSE 2NUEA 2I13A 4DR6M 2GQFA 1YPNA 3FE3A 1X6FA 1XM7A 2R44A 3KWRA 2X4AA 5INBA 3VLFB 2R4EA 1IBLM 3FUTA 3THOB 1NHGC 2DZLA 2WBTA 2XLJA 2VQFM 3AUZA 1W5TA 4X8WA 1ZV1A 2XZFA 4JI5E 3VDUA 1D0LA 4JI7E 3ECRA 3U6LA 5ITTA 4FBQA 4DR5M 4AZFA 2ERCA 2L6MA 3TWLA 2EORA 1E9SA 1HNWM 5BR8E 1T4NA 4JI8M 4IL1A 4L8NA 3GPUA 1WIVA 4B08A 1NV9A 3HPZA 4WXCA 2V89A 2RGHA 1T6OA 5FTLA 3MJ5A 3A45A 1T3TA 3W67A 2EOSA 2EPCA 1TDZA 1QAOA 2EP3A 4IYPC 1DO2A 4D81A 2M60A 1WJPA 2EOHA 2F5QA 1MF8A 2I9IA 4OVZA 3MSWA 1N36E 2C99A 4KWYA 5A6JA 1J5EM 4MB7A 3H63A 3HHWA 2EPNA 2HC5A 3HHYA 2LVNC 2EPOA 3HHXA 3MK6A 1PJQA 3KP0E 2NXFA 5L8RF 4R2SA 2EPPA 1UF3A 4NZVA 2MDRA 2Z3XA 1SXJC 4YY3E 4JI3E 3FTFA 4QHTA 2H36X 1XNQM 3J81S 3TL4X 1X48A 4BHCA 2W82A 1S70A 5KO3A 2BJWA 3J27B 2ELYA 3T1HE 1XNRE 3L00A 2NUGA 3UGJA 2WDFA 1OTRA 4J6OA 3PNVA 1J26A 4L15A 3MHSC 4FWGA 3K2LA 3ZTVA 1KBPA 4F2JC 1GL7A 2HKJA 2WSFF 4CHTB 1G59A 2ZANA 3PSNA 1OIZA 4FCWA 2YTEA 4NSOB 4X65E 3VK6A 1QDRA 2JWSA 1I94E 1R2YA 1FKAE 1A1FA 2EOXA 2LO3A 4LFCM 2X49A 2EL6A 1UTEA 1Q39A 4LF4E 5EXTA 3KOYE 2VF8A 3CK2A 1KYQA 4GC5A 3GLFE 3K6QA 2LHGA 1WXQA 3DW8C 3VYYA 4D80A 5A6KA 1T70A 3CGWA 4LZJA 3FTDA 2DENA 4LJ6A 3K7WC 3Q8GA 2JY5A 4DV1M 3KOWE 2LJHA 3H67A 2DXNA 1G4AE 4JI7M 2HCBA 3GVEA 2F8BA 3P71C 2XMOA 2OPFA 1OJLA 4R2DA 3SAWA 2LMZA 4Q28A 3HY5A 4V0XA 5KL6A 5BR8M 2YTDA 4DR7M 2VRDA 2ZOAA 1XB2B 2VE7C 4ZYGA 3E7BA 2KNZA 1YUBA 1NNJA 1QYRA 1B69A 1VQ1A 3CF2A 2JZ0A 4L78A 1DGHA 1WR1B 1S8EA 3QFOA 2IE4C 2EOFA 1A1GA 4F9BB 4KODA 2Z8YM 4RHBB 3RFWA 1FJGE 2USHA 1USHA 1SXJD 1TCOA 3M99B 1QNTA 4II7A 1FNNA 4LRTA 4K0KE 4ZPXA 5T6JA 3K9PA 3KSJA 3SHFA 2YTIA 1UILA 3SAUA 5E26A 4X62M 4AG6A 2WDDA 3HQ1A 3LQRA 4RH8A 1E94E 2EJ4A 1RQ0A 3THGA 2DAGA 2XSZD 2KDLA 2L92A 5DYIA 4R2CA 4B3SE 2JWOA 4JI3M 1HNXE 2EZ6A 2LJUA 1YUIA 4LFBE 2EQ1A 2DLKA 2CRUA 3HHZA 2APLA 2LVAA 4P7DA 1Q3CA 4JA7A 3M0EA 1R4GA 1IQOA 1S3SA 2C9CA 3Q8XA 2DIXA 2Y0QA 2DWMA 4QNMA 3GO8A 3L29A 2UUBM 2KNVA 2H5XA 3WHKA 3K7VC 3HWSA 2EM2A 2EKFA 2IHR1 2KONA 1HR0M 2WZOA 3PSOA 2BJVA 2FGGA 4AKHA 1A1LA 1X3CA 2HJJA 4D82A 1I94M 2YT4A 1OIPA 3UZUA 2VDBB 4ZX2A 2RKOA 4HEOA 4KBPA 2JOBA 1Q3BA 2JP7A 1NHWC 2ENAA 3LLHA 5LMUM 3DA1A 1KJKA 2EO2A 4M9SA 1ZBTA 3ILKA 2GLIA 2YVTA 3U6OA 3ZH9B 1KSFX 1OAOC 3J7BA 4GH9A 1XMQM 1YE9A 2HGHA 1SXJA 1GZ6A 5IXMB 4Q35B 3IB7A 5F3WA 2WBUA 2G5GX 2EJSA 4JI0E 2JY9A 2IE3C 2JP9A 2BNKA 4DV3M 4P16A 4ORCA 1NY5A 2EPAA 3J7Yp 4FVMA 1Z5BA 3TWKA 2XSZA 2FFJA 3H69A 2B7TA 3U6QA 5FTMA 3PXGA 3EGGA 2YU8A 1G2FC 5KQDA 4NC6A 2YQZA 3AFHA 1IXRC 1T39A 4BBYA 2DHYA 2F4VE 5J28A 4M2ZA 4IBJA 3LCVB 4F9AB 4H2IA 4M30A 3U5ZB 3JTZA 1HQYE 1ZBQA 3EIHA 4DV4M 1FJGM 2WDCA 4MGZE 2EMXA 2YSPA 1HJPA 2YWQA 3H4MA 1Z1BA 4K0KM 4P78A 4WSGA 2LHCA 5DFLA 2UXCM 2Y20A 4G4RA 3WHLA 3SMPA 3B74A 2EN2A 3H68A 3HTXA 1G41A 2EOMA 2Q8UA 2I7PA 2NABA 2YSOA 2EKKA 2DWZB 2JY6B 4MGIE 1OFHA 3SYKA 2L4FA 2E5LM 1YYKA 3MHVC 4R3DA 1IBLE 1WHQA 2XGNA 3DF6A 1JK1A 4ITQA 1AUAA 1EFUB 1HP1A 2VQFE 3VK8A 4GKJM 2YTFA 1ZAEA 1YYWA 3J7AS 1OKSA 1IBKM 1L8QA 3RL4A 3FUWA 3P1XA 4LJ9A 4XGIA 3LMLA 1N3GA 4JI2M 4X9JA 4ZYEA 3HVQA 4JI8E 1YFHA 3GP1A 3ADIA 3AOGA 4IJEA 1TH4A 3AKZA 2LVOC 3A46A 2P6BA 1IXSB 2AHDA 4IBIA 2GPIA 1Z59A 2EPUA 2LUPB 2L6OA 5KPZA 3SASA 3VKGA 4H2GA 2BQ8X 2EL5A 2QQ8A 4WYQB 2L2MA 4KKZA 1XXHB 3LL8A 1SXJE 1K82A 3TE6A 5EJCA 3H64A 1J5EE 2RQLA 1MEYC 2C5RA 4BLCA 2OOAA 3KSXA 5DYGA 2DAIA 5IT9C 1N32M 4V0VA 4IBDA 2YR0A 3BGHA 1HQCA 4MOYA 1K3XA 4N4RB 2A25A 3C6KA 3T1YM 3GLHE 5AASA 4NHRA 2NA2A 1XNQE 2RS6A 4RF1A 1HNZM 3SBJA 2EMHA 2Z4SA 3HGIA 4R2PA 1F2IG 2JUJA 5C1VA 2CUZA 2JZ1A 5JI3E 1TN9A 2F5PA 3UK3C 2JY7A 2B7VA 2EM8A 2Z4RA 2LXEA 2JXPA 3HJSA 1WRJA 4O5GA 2ODRC 3ADJA 3SARA 2FE8A 2R76A 3U6SA 1X37A 4LU9A 4F0ZA 5AC4A 3MMPA 2QNJA 4L16A 1F4IA 3LCUA 4WP2A 2ENHA 2YRHA 4LFCE 1N34M 1DGBA 2EMIA 4OVZB 2HYPA 2UUCM 5HPEA 2C9OA 4R2AA 2F5NA 1PKPA 1BBOA 1JK2A 3GLIE 4B3TM 4IBCA 4BB9A 3GLFA 3B9PA 4LF9M 4G4NA 3SAVA 4DV1E 4NXME 1WXRA 3GQ5A 1IMUA 4UT3A 2HAKA 2HY1A 1GO5A 2LVHA 5EP1A 2EMAA 1T4OA 4WW0A 1GKIA 5ITQA 2BDXA 4DR7E 1BBGA 3C58A 4B3RM 2EMBA 5C1BA 5EP2A 4F54A 3IVEA 3T38A 2NQ8C 1A1KA 1D2NA 2DSYA 4DSYA 1ZR9A 4IJDA 3HPSA 1ZU1A 4OU7A 2MKDA 4AW4A 2VIIA 4DV2M 3K92A 1EH6A 4IBKA 2EMWA 2M4IA 3QG5C 1X6HA 3NBIA 4FCTA 4LJ8A 4Z8XA 4IBEA 1MGTA 3BOSA 4A3VB 4X62E 2UU9M 4OW0A
chains in the Genus database with same CATH topology
1IN5A 3SHGB 1H6UA 1N33M 4GIPA 3HKPA 2F5OA 5IT9S 2ODRD 4DV7M 1NNUC 4AI6A 2LRSA 2V6ZM 4O24A 4WFTA 4R03A 3U61B 2UUBE 1IN4A 3DOAA 2ZBKB 1HR0E 3L25A 3I4YA 4M0VA 1DGHB 1OIEA 2VQEE 4XPNA 4X64M 4FCVA 4GC9A 1QQWA 4M9ZA 4LF8E 1N78A 4DKKA 1OI8A 3L27A 1KFVA 3U6CA 5LMUE 4KLNA 4PDGA 1XMOM 2FNAA 1GQEA 3IB8A 4I5NC 1IXZA 2DXIA 1JQJC 3DJWA 4DR1M 2KW0A 1XMQE 2DWNA 4WSPA 4MGKE 4AQYE 3LVWA 3A42A 4NXMM 2YEQA 3LVVA 2RTXA 1YSYA 4DV3E 2K4VA 2MC5A 2KXEA 4FWHA 3U6MA 3ADGA 3TPZA 4UWQA 1PJIA 4NOOB 1QAMA 3FUUA 2A5YB 1J7KA 3DFZA 3FUVA 5FTJA 2K47A 3RGPA 2DWLA 4H1SA 1QHWA 3J7AG 1N75A 5JPFA 4TUGA 4W5WA 4DR4M 4DV4E 3QFNA 2EUCA 3KP1E 1HO5A 1C1KA 3GQ3A 2L2KB 5B8IA 3E7AA 2UXCE 4I8OA 1QU6A 3RQZA 1XZWA 3HU2A 2XEPA 4G6ZA 4NXNM 1L2CA 1SXJB 4BS9A 5JJTA 4G4QA 2E5LE 5ITYA 2N3GA 2DFJA 4YHHM 2O8AA 2V8QB 4DV0E 2D7HA 4GKJE 2NUFA 3RL5A 2GJUA 3T1IA 3KVWA 4HD0A 1PM5A 5EP3A 2CPNA 1NVMA 1IBKE 1YZ9A 3ZC7B 4LJ7A 2DZNB 5EP4A 2RGOA 4JI2E 5KQ8A 4LF6E 2V86A 2CV2A 2VQEM 4TUWA 5AE2A 3C4BA 4LF8M 2ZBMA 2B9DA 3DSCA 3GPYA 1QVRA 2R18A 4LJ5A 4FBKA 4GRIA 1Z2WA 3U6DA 2XZUA 4MH0E 2R62A 1G8PA 4BBAA 4MGYE 4R8OA 4L4UA 1GLNA 2HL7A 4V0WA 5LMNM 2D7EA 2QBYA 4AQYM 5ITRA 4RNAA 1N32E 1Z6TA 1DO0A 3PFIA 4PT5A 3HJ8A 1NJGA 4QHSA 3M6AA 2QZ4A 4FCXA 2XFTA 2R46A 3OMLA 1KYIA 2DB2A 3T1YE 3IWCA 4Q7FA 1NSFA 3GLHA 1WAO1 1R6BX 1HNZE 4LGMA 2HHHE 2C98A 2QPAA 5EXPA 1HT2E 4DUYM 4BCAA 8CATA 5H37D 2Y21A 4OOGC 1N77A 4DT2A 3JAMC 4GEQB 3EIEA 2CE7A 1W5SA 4B7FA 2R65A 4JI4M 1DI2A 1N34E 3D03A 3KFUG 4PCZA 2H1RA 1SU1A 2UUCE 4O4KA 2KA6B 4LG2A 1R7RA 2E1MA 3DSDA 4B3TE 2ZM6M 3GLIA 2CV0A 4M9XA 4LF9E 2UUAE 4DV0M 2UXDE 2O8GA 3ZCBB 3L26A 5GTUA 3H62B 3KBPA 1MU5A 4I81A 5AE3A 3K1JA 4LF7M 1IBMM 2X8AA 4B7GA 4KHPE 1E32A 3QWLA 2JVAA 4LF6M 4JI1M 4B3RE 2KRUA 4LGYA 2CEAA 2JA2A 2HYOA 4X66M 3KOXE 2XH9A 3GRUA 3CF6E 4LRSA 1ZQ9A 5E6JA 3W0LB 2N3HA 2QCUA 4DR2M 4DV2E 3SC3A 3VDPA 4JYAM 1HPUA 1S3MA 1IY2A 1I4WA 4JN6A 1NJFA 1PJJA 1JR3A 2UU9E 3GLFB 2V83A 2FV4B 1N33E 4REZA 4GKKM 4JI6E 3SFZA 2CV1A 5IOHA 4UT3B 4DV7E 4DV5M 3GPPA 2HHHM 3C9FA 2KOUA 2L09A 2M5ZA 5ADZA 4H1YP 3OTOE 2O5RA 3IVDA 2QFPA 3R8FA 1HT1E 1X49A 2XF3A 3N5UA 2DHRA 3H66A 4QOSA 2EWLA 4X64E 1K3WA 3DZDA 4NL4H 2V87A 2I7NA 1QZMA 5KPTA 3SATA 1S3NA 3FGAC 3U60A 4AKGA 4UT2A 3JAMS 3CTWB 1QFCA 3J80C 4NSRA 1XMOE 2UXBM 4LF5M 4CISA 1DQ3A 3GLGA 2UUAM 1X47A 2KEBA 1XXHA 4DR1E 3TWMA 3THNA 2UXDM 2LWXA 3RE8A 5EXSA 4HL4A 3LQQA 3RL3A 2L2NA 4JV5M 5A2QC 2MC6A 4BMJA 4YKEA 4FBWA 1TH2A 2J7NA 3SMSA 4DUZM 3IWBA 3I51A 5EQTA 4KHPM 4DV6E 1LV7A 1IN8A 3JU0A 3FYDA 2CHVA 1NNWA 4PDIA 1FJMA 4DR3M 1IM2A 4ZVZA 2R45A 2LUQA 2L8TA 2DMYA 4DR4E 4DHLA 1NY6A 4BC7A 3VFDA 3NWLA 5FLXC 1QAQA 3KW6A 2KHXA 3PVSA 4LY6A 4KO8A 4LJ4A 2L33A 4I5SA 4I4LA 4NXNE 2V88A 2Y0TA 4JI6M 3C5WC 1WARA 4YHHE 2AHMA 5AE1A 5LL6R 2DZOB 4IIWA 3L2AA 1U32A 2L7IA 1J09A 3OTOM 4QNRA 1TGUA 2CHQA 1II7A 5ITUA 2CHGA 1AUIA 3I4VA 2V1CA 4ORAA 2NYLC 2OQ4A 3HJQA 3J2PB 1IY1A 2Z72A 3TQSA 3GRRA 3QFKA 1R2ZA 4HLQA 5LMNE 3KXEC 2R4JA 2NYMC 3J80S 4LACC 1TH3A 1YYOA 3ZOQB 4DV6M 4JI5M 5FTKA 2M7QA 3UMMA 4FW9A 2F5SA 2P5TA 5A2QS 5KPRA 5C18A 3VK7A 1IN7A 3T15A 3SYLA 3VKHA 1Z5CA 4LCBA 4DUYE 3CF0A 3KS8A 3U6PA 2XFSA 3LMMA 3U61A 3V4YA 2RSMA 4F9CB 3QAUA 1SR9A 3GQ4A 2L3JA 3A98B 1L2BA 2NPPC 4JXJA 1G5BA 3FKEA 4NRWA 4JI4E 5EXXA 2JOXA 2CFOA 4H2FA 3GPXA 2RS7A 1OFIA 1N36M 2Z1AA 5FLXS 4DMIA 2QBYB 5IWAE 3HXLA 2ZM6E 1Z2XA 3IG5A 2FTXB 3HU1A 2G8LA 4B3ME 4R7GA 2M1SA 3AJIB 4JA9A 1IT6A 3FUXA 4FWDA 3GLHB 4YY3M 2JR1A 2V1UA 2FOIC 1G3IA 4WWLA 4LF7E 3AOEC 1IBME 2LTRA 3E0JA 4J8ZA 5EQVA 4AG5A 5ITXA 3KS4A 1TDHA 3T1HM 3M7GA 2ZO9B 1XNRM 2WDEA 5BPVA 1IN6A 4JI1E 4KZSA 2LE2A 4X66E 4FD2A 3FD9A 3JR5A 1OIDA 3L28A 3IWDA 5FTNA 1EE8A 4LTYA 3AL0C 4QOZC 2YZTA 2LTSA 4X65M 3AV0A 1GL6A 2CV9A 4MP0A 4DR2E 3EGHA 3FIGA 4JYAE 4OX9E 3JYFA 4LF4M 1L1ZA 4OR9A 4RF0A 4L8RC 5JPEA 3GLIB 1T4LB 1V73A 4GHAA 4GKKE 2Z06A 2Q2EB 1IY0A 4G9JA 1S3LA 3IG8A 4GHLA 4DV5E 4LFAE 1Z5AA 2QP9X 5FSWA 4B2OA 1E9RA 3RGSA 4WPYA 1JK7A 4M0WA 4GITA 4LZZA 4IJFA 4B7HA 1XC8A 1IQPA 7CATA 4WURA 2LH0A 2L3CA 3D8LA 1STUA 4MGHA 1JR3D 3W0FA 3H61A 3FLOA 2ZAMA 3FTCA 3UK6A 3JR4A 2L7HA 5IWAM 2UXBE 4LF5E 3HU3A 4DR6E 2KZSA 4B3MM 3QFMA 2YFQA 4ORBA 2ZAOA 3KOZE 1L1TA 3FYCA 4EIWA 2G7HA 3ZU0A 1L2DA 4B3SM 1MX0A 5JI2E 1HNXM 4JV5E 4LFBM 4Z6YA 2DXLA 5ITXE 3U6EA 4DUZE 2QFRA 4H2BA 3VYXA 4BC9A 3F6HA 1WHNA 3E4RA 1T71A 2QENA 4DR3E 4DR5E 2VF1A 2A22A 2R17A 1EKZA 1HNWE 5IREB 4S12A 1XHBA 2IAEC 4G4OA 4L5NC 3U5ZA 1ORYB 2LNHC 1DGFA 1W24A 2JOGA 1M63A 4OX9M 3H09A 3U60B 4TUIA 1S95A 3ADLA 4LJAA 2DVWB 1VDDA 3GLGB 3UJNA 4MM3B 2LBSB 5CFFE 2KZUA 4XBOA 4PD2A 3C4TA 3F6GA 4I5LC 4IBGA 4IBBA 4JI0M 3AOEA 4M0DA 3J81C 4LFAM 3GRYA 3H60A 3FTEA 3R9XB 4AKIA 5IZ7D 3RMPA 2KRKA 2YNMD 1O0WA 1UHZA 3ICFA 2B3TB 3K8ZA 1UM8A 1RC7A 2BCDA 1DGGA 4GMQA 2C96A 3GRVA 2V85A 5GKNA 2QJCA 1GVNA 2J7OA 2F4VM 1QANA 3E9SA 2KKNA 4NRVA 4O43A 4IBFA 3TGHA 2EA0A 4MOVA 3PNYA 5DNYA 3D8BA 2Z7JA 2D7GA 4CGYB 1XWIA 3KDSE 2NUEA 4DR6M 1XM7A 3KWRA 2X4AA 5INBA 3VLFB 2R4EA 1IBLM 3FUTA 3THOB 1NHGC 2XLJA 2VQFM 3AUZA 1W5TA 4X8WA 2XZFA 4JI5E 3VDUA 4JI7E 3U6LA 5ITTA 4FBQA 4DR5M 4AZFA 2ERCA 2L6MA 3TWLA 1E9SA 1HNWM 5BR8E 4IL1A 4JI8M 1T4NA 4L8NA 3GPUA 4B08A 3HPZA 2V89A 2RGHA 3MJ5A 5FTLA 3A45A 1T3TA 1TDZA 1QAOA 4IYPC 1DO2A 4D81A 2M60A 2F5QA 1MF8A 4OVZA 3MSWA 1N36E 2C99A 1J5EM 4MB7A 3H63A 3HHWA 3HHYA 3HHXA 3MK6A 3KP0E 2NXFA 1UF3A 4NZVA 2MDRA 2Z3XA 1SXJC 4YY3E 4JI3E 3FTFA 4QHTA 2H36X 1XNQM 3J81S 3TL4X 1X48A 2W82A 1S70A 5KO3A 2BJWA 3J27B 3T1HE 1XNRE 2NUGA 3UGJA 2WDFA 4J6OA 3PNVA 1J26A 4L15A 4FWGA 3K2LA 3ZTVA 1KBPA 1GL7A 2HKJA 1G59A 4CHTB 2ZANA 3PSNA 4FCWA 4NSOB 4X65E 3VK6A 1I94E 1R2YA 1FKAE 4LFCM 2X49A 1UTEA 1Q39A 4LF4E 5EXTA 3KOYE 3CK2A 4GC5A 3K6QA 1WXQA 3DW8C 3VYYA 4D80A 1T70A 4LZJA 3FTDA 4LJ6A 3K7WC 4DV1M 3KOWE 2LJHA 3H67A 2DXNA 1G4AE 4JI7M 2HCBA 3GVEA 2F8BA 3P71C 2XMOA 2OPFA 1OJLA 3SAWA 2LMZA 4Q28A 4V0XA 5BR8M 4DR7M 2ZOAA 2VE7C 3E7BA 1YUBA 1NNJA 1QYRA 3CF2A 4L78A 1DGHA 1S8EA 3QFOA 2IE4C 4F9BB 4KODA 3RFWA 1FJGE 2USHA 1USHA 1SXJD 1TCOA 4II7A 1FNNA 4LRTA 4K0KE 4ZPXA 5T6JA 3KSJA 3SHFA 1UILA 3SAUA 5E26A 4X62M 4AG6A 2WDDA 3HQ1A 3LQRA 1E94E 1RQ0A 3THGA 2XSZD 2L92A 5DYIA 4B3SE 2JWOA 4JI3M 1HNXE 2EZ6A 4LFBE 3HHZA 4P7DA 1Q3CA 4JA7A 3M0EA 1S3SA 2C9CA 3Q8XA 2DIXA 2Y0QA 2DWMA 4QNMA 3GO8A 3L29A 2UUBM 3WHKA 3K7VC 3HWSA 2IHR1 2KONA 1HR0M 2WZOA 3PSOA 2BJVA 2FGGA 4AKHA 4D82A 1I94M 2YT4A 3UZUA 4ZX2A 2RKOA 4KBPA 2JOBA 1Q3BA 1NHWC 3LLHA 5LMUM 3DA1A 2EO2A 4M9SA 1ZBTA 3ILKA 2YVTA 3U6OA 3ZH9B 1KSFX 3J7BA 4GH9A 1XMQM 1YE9A 1SXJA 1GZ6A 3IB7A 5F3WA 2G5GX 4JI0E 2JY9A 2IE3C 2BNKA 4DV3M 4P16A 4ORCA 1NY5A 3J7Yp 4FVMA 1Z5BA 3TWKA 2XSZA 2FFJA 3H69A 2B7TA 3U6QA 5FTMA 3PXGA 3EGGA 5KQDA 2YQZA 3AFHA 1IXRC 4BBYA 2F4VE 5J28A 4M2ZA 4IBJA 4F9AB 4H2IA 4M30A 3U5ZB 3JTZA 1HQYE 1ZBQA 3EIHA 4DV4M 1FJGM 2WDCA 4MGZE 3H4MA 4K0KM 4P78A 2UXCM 2Y20A 4G4RA 3WHLA 3SMPA 3H68A 3HTXA 1G41A 2Q8UA 2I7PA 2DWZB 4MGIE 1OFHA 3SYKA 2E5LM 1YYKA 3MHVC 4R3DA 1IBLE 1WHQA 2XGNA 3DF6A 4ITQA 1HP1A 2VQFE 3VK8A 4GKJM 1ZAEA 1YYWA 3J7AS 1IBKM 1L8QA 3RL4A 3FUWA 3P1XA 4LJ9A 4XGIA 3LMLA 4JI2M 3HVQA 4JI8E 3GP1A 3ADIA 3AOGA 4IJEA 1TH4A 3AKZA 3A46A 2P6BA 1IXSB 2AHDA 4IBIA 1Z59A 2LUPB 2L6OA 5KPZA 3SASA 3VKGA 4H2GA 2BQ8X 4WYQB 2L2MA 4KKZA 1XXHB 3LL8A 1SXJE 1K82A 3TE6A 5EJCA 3H64A 1J5EE 2C5RA 4BLCA 5DYGA 3KSXA 5IT9C 1N32M 4V0VA 4IBDA 2YR0A 1HQCA 4MOYA 1K3XA 3T1YM 5AASA 2NA2A 1XNQE 2RS6A 4RF1A 1HNZM 3SBJA 2Z4SA 3HGIA 5C1VA 2CUZA 5JI3E 2F5PA 2B7VA 2Z4RA 2LXEA 3HJSA 4O5GA 2ODRC 3ADJA 3SARA 2FE8A 3U6SA 1X37A 4LU9A 4F0ZA 4L16A 4LFCE 1N34M 1DGBA 4OVZB 2HYPA 2UUCM 5HPEA 2C9OA 2F5NA 1PKPA 4B3TM 4IBCA 4BB9A 3GLFA 3B9PA 4LF9M 4G4NA 3SAVA 4DV1E 4NXME 1WXRA 3GQ5A 4UT3A 2HY1A 5EP1A 1T4OA 4WW0A 1GKIA 5ITQA 2BDXA 4DR7E 3C58A 4B3RM 5C1BA 5EP2A 4F54A 3IVEA 3T38A 2NQ8C 1D2NA 2DSYA 4DSYA 3HPSA 4OU7A 4AW4A 2VIIA 4DV2M 3K92A 4IBKA 2M4IA 3QG5C 3NBIA 4FCTA 4LJ8A 4Z8XA 4IBEA 3BOSA 4A3VB 4X62E 2UU9M 4OW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IB7 A;  3THO B;  5F3W A;  2ZBM A;  3C9F A;  4DHL A;  4F0Z A;  1USH A;  3DSD A;  1TCO A;  3QFK A;  2WDF A;  3DSC A;  3AUZ A;  2IE3 C;  4J6O A;  3HVQ A;  4FBK A;  1Z2W A;  4WWL A;  3H61 A;  4H1Y P;  3ZTV A;  2NYM C;  4ORC A;  1KBP A;  5EQV A;  4H1S A;  4LAC C;  2HYP A;  1QHW A;  3PSN A;  4FBQ A;  2O8G A;  5HPE A;  3IVD A;  5JPF A;  2WDD A;  5GTU A;  2WDE A;  4TUG A;  3H62 B;  2P6B A;  2QFP A;  3KBP A;  4I5L C;  3H69 A;  2AHD A;  3QFN A;  4O24 A;  3EGG A;  1HO5 A;  4V0W A;  4IL1 A;  1OID A;  4H2G A;  3N5U A;  2BQ8 X;  3H60 A;  1UTE A;  3H66 A;  5B8I A;  4LTY A;  5J28 A;  3ICF A;  1S3N A;  3E7A A;  3AV0 A;  4FCX A;  4H2I A;  4KKZ A;  3LL8 A;  3FGA C;  3CK2 A;  2BCD A;  3QFM A;  4UT2 A;  2HYO A;  3C5W C;  2CV9 A;  4ORB A;  4M0V A;  4MP0 A;  4UT3 A;  1WAR A;  4JA7 A;  3H64 A;  2HY1 A;  3DW8 C;  4IYP C;  3RQZ A;  3ZU0 A;  2QJC A;  2WDC A;  3EGH A;  4Q7F A;  1T70 A;  1QFC A;  1WAO 1;  1XZW A;  1OIE A;  4XPN A;  3V4Y A;  3JYF A;  2BDX A;  3K7W C;  4V0V A;  3K7V C;  3H67 A;  1U32 A;  4OR9 A;  5JJT A;  1MF8 A;  1OI8 A;  5JPE A;  2KKN A;  3PSO A;  3THN A;  2QFR A;  4MOY A;  4H2B A;  4O43 A;  2DFJ A;  2O8A A;  3GVE A;  3H68 A;  3TGH A;  3IVE A;  2NPP C;  1II7 A;  3P71 C;  1T71 A;  2XMO A;  1G5B A;  2Q8U A;  1V73 A;  4MOV A;  3RL3 A;  5DNY A;  3IB8 A;  3H63 A;  1HPU A;  4DSY A;  4I5N C;  4V0X A;  4ZX2 A;  1S3M A;  4KBP A;  4FBW A;  2A22 A;  2R17 A;  4H2F A;  4YKE A;  3RL5 A;  2GJU A;  3T1I A;  4HD0 A;  2NXF A;  5C1V A;  4DT2 A;  2Z06 A;  3E7B A;  4G9J A;  1AUI A;  1S3L A;  2Z1A A;  1UF3 A;  4NZV A;  2IAE C;  1HP1 A;  4ORA A;  1Z2X A;  2NYL C;  1NNW A;  1FJM A;  4B2O A;  4O5G A;  1W24 A;  2YVT A;  2JOG A;  1S8E A;  4ZVZ A;  3QG5 C;  1XM7 A;  3QFO A;  1M63 A;  1S70 A;  2IE4 C;  1JK7 A;  1SU1 A;  4TUI A;  4UWQ A;  4O4K A;  5INB A;  1S95 A;  5IOH A;  2Z72 A;  4UT3 B;  4JA9 A;  1IT6 A;  2USH A;  4LU9 A;  3RL4 A; 
#chains in the Genus database with same CATH topology
 1IN5 A;  3SHG B;  4R2Q A;  1QDT A;  1H6U A;  1N33 M;  4GIP A;  3HZJ A;  3HKP A;  2F5O A;  5IT9 S;  2ODR D;  1A1H A;  1VEK A;  4DV7 M;  1NNU C;  3C6M A;  3BF2 A;  4AI6 A;  2LRS A;  5KL3 A;  2V6Z M;  4O24 A;  4WFT A;  4R03 A;  2EN1 A;  3U61 B;  2UUB E;  1IN4 A;  3DOA A;  2ZBK B;  1HR0 E;  2FS1 A;  3L25 A;  3I4Y A;  4M0V A;  1DGH B;  2M9A A;  2J7J A;  1OIE A;  2VQE E;  4XPN A;  4X64 M;  4FCV A;  4GC9 A;  1QQW A;  4M9Z A;  2QHO B;  4LF8 E;  1N78 A;  4DKK A;  1OI8 A;  1IQS A;  3L27 A;  1X6E A;  1KFV A;  3U6C A;  5LMU E;  4KLN A;  2WBS A;  4PDG A;  1OAI A;  1XMO M;  2FNA A;  1GQE A;  3IB8 A;  1TF6 A;  3QYB A;  4I5N C;  1IXZ A;  2DXI A;  1VEJ A;  4F6N A;  2CTD A;  1JQJ C;  3DJW A;  4KT0 F;  4DR1 M;  2KW0 A;  1XMQ E;  2DWN A;  4WSP A;  1D0K A;  4MGK E;  4AQY E;  3LVW A;  3A42 A;  4NXM M;  2YEQ A;  3LVV A;  2RTX A;  1YSY A;  4DV3 E;  2K4V A;  2MC5 A;  2KXE A;  4FWH A;  3U6M A;  3ADG A;  3TPZ A;  4UWQ A;  1PJI A;  4NOO B;  3K9O A;  1QAM A;  3FUU A;  2YTO A;  2EOQ A;  2A5Y B;  1J7K A;  3DFZ A;  2EMY A;  3FUV A;  5FTJ A;  2CSH A;  2K47 A;  3RGP A;  2DWL A;  1UBD C;  4H1S A;  1QHW A;  3C3D A;  3J7A G;  1N75 A;  5JPF A;  4TUG A;  4W5W A;  4DR4 M;  4R71 A;  4DV4 E;  3QFN A;  4HTG A;  2EUC A;  4Q7J A;  3KP1 E;  1HO5 A;  1C1K A;  3GQ3 A;  2FH0 A;  2L2K B;  1CUK A;  5B8I A;  1X5W A;  1OQY A;  3EPL A;  3E7A A;  2UXC E;  2EN8 A;  4I8O A;  1QU6 A;  3RQZ A;  2J5Y A;  2GHF A;  3HU2 A;  1XZW A;  2XEP A;  5KL4 A;  4G6Z A;  4NXN M;  1L2C A;  1SXJ B;  2N35 A;  4BS9 A;  2K0B X;  5JJT A;  3HX3 A;  4G4Q A;  2E5L E;  5ITY A;  1ZAA C;  2N3G A;  2DFJ A;  3BXW A;  4YHH M;  2O8A A;  2V8Q B;  1WJ7 A;  3LW5 F;  4DV0 E;  2D7H A;  4GKJ E;  2EM6 A;  2NUF A;  3RL5 A;  2GJU A;  3T1I A;  3KVW A;  4HD0 A;  1PM5 A;  5EP3 A;  2CPN A;  1NVM A;  1IBK E;  1ZMU A;  1YZ9 A;  3ZC7 B;  4LJ7 A;  2DZN B;  5EP4 A;  2RGO A;  4JI2 E;  2LVP C;  5KQ8 A;  1TTE A;  1AH5 A;  4LF6 E;  1PJT A;  2YPN A;  2V86 A;  2CV2 A;  2VQE M;  4TUW A;  5AE2 A;  2MJ5 B;  3C4B A;  4LF8 M;  2ZBM A;  2B9D A;  3DSC A;  3GPY A;  3VHT B;  1TF3 A;  1QVR A;  2R18 A;  4LJ5 A;  1EH7 A;  1T43 A;  2LBC A;  4FBK A;  4GRI A;  1Z2W A;  3U6D A;  2XZU A;  1MN3 A;  4MH0 E;  4IS1 C;  1BB8 A;  2R62 A;  1G8P A;  4Y28 F;  4BBA A;  4MGY E;  4R8O A;  4L4U A;  1GLN A;  2HL7 A;  4V0W A;  2EM5 A;  5LMN M;  2D7E A;  2QBY A;  4AQY M;  5ITR A;  4RNA A;  1N32 E;  1Z6T A;  1DO0 A;  2MRO B;  2BB8 A;  3PFI A;  4PT5 A;  3HJ8 A;  1NJG A;  4QHS A;  3M6A A;  2QZ4 A;  2XFT A;  2R46 A;  4FCX A;  3OML A;  1KYI A;  2DB2 A;  2VF7 A;  3T1Y E;  3IWC A;  3E21 A;  2EOY A;  4Q7F A;  1NSF A;  3GLH A;  1WAO 1;  4G3O A;  1R6B X;  1HNZ E;  4LGM A;  2BBG A;  2HHH E;  2C98 A;  2QPA A;  5EXP A;  1HT2 E;  4GEW A;  2EM0 A;  4DUY M;  4BCA A;  8CAT A;  5H37 D;  2Y21 A;  4OOG C;  2DKL A;  1AIP C;  1VDL A;  1N77 A;  3EPJ A;  4DT2 A;  4F2L A;  3JAM C;  3C3E A;  2ZTC A;  4GEQ B;  3EIE A;  2DI0 A;  2MGW A;  2CE7 A;  1W5S A;  4B7F A;  2R65 A;  4JI4 M;  2MDG A;  1DI2 A;  1N34 E;  3D03 A;  3KFU G;  4PCZ A;  2H1R A;  1SU1 A;  4O4K A;  2UUC E;  2KA6 B;  4LG2 A;  1R7R A;  2E1M A;  3DSD A;  4B3T E;  1WGN A;  1ZMW A;  2ZM6 M;  3GLI A;  4GZN C;  2CV0 A;  4M9X A;  4LF9 E;  4M9V C;  2UUA E;  2HWJ A;  4DV0 M;  2UXD E;  2O8G A;  5KL7 A;  3ZCB B;  3L26 A;  5GTU A;  3H62 B;  2DAE A;  3KBP A;  1MU5 A;  4I81 A;  1AAY A;  5AE3 A;  3K1J A;  2EM7 A;  4LF7 M;  2EOJ A;  1IBM M;  1UFZ A;  2X8A A;  2EQ0 A;  1L4S A;  3NBX X;  5IV8 B;  4B7G A;  4KHP E;  1E32 A;  3QWL A;  2JVA A;  4LF6 M;  4JI1 M;  4B3R E;  2KRU A;  4LGY A;  2CEA A;  2JA2 A;  2HYO A;  4X66 M;  3KOX E;  2XH9 A;  1NEI A;  3GRU A;  2DAM A;  1SG9 A;  3CF6 E;  2WSE F;  4LRS A;  1ZQ9 A;  5E6J A;  3BID A;  3W0L B;  2L4E A;  2N3H A;  2QCU A;  4DR2 M;  3IEC A;  2EM9 A;  2RPC A;  4DV2 E;  3SC3 A;  2EQ3 A;  3VDP A;  2YTP A;  4JYA M;  1HPU A;  2K6B A;  2DLQ A;  3MHH C;  4WX9 A;  1S3M A;  3KZZ A;  1IY2 A;  1I4W A;  4JN6 A;  1NJF A;  1PJJ A;  1JR3 A;  2UU9 E;  3GLF B;  2EM3 A;  2CWB A;  2V83 A;  2FV4 B;  1N33 E;  3EPH A;  4REZ A;  2EMZ A;  2YTG A;  4GKK M;  4JI6 E;  1PGY A;  2CV1 A;  3SFZ A;  5IOH A;  4UT3 B;  4DV7 E;  4DV5 M;  2OO9 A;  3GPP A;  2HHH M;  3C9F A;  3FRH A;  1V92 A;  2KOU A;  2ADR A;  2L09 A;  3EPK A;  2M5Z A;  2EOO A;  2EOZ A;  5ADZ A;  4H1Y P;  3OTO E;  2O5R A;  3IVD A;  1WHC A;  2QFP A;  2EPR A;  3R8F A;  3BBG A;  1SFE A;  1HT1 E;  1X49 A;  2XF3 A;  3N5U A;  2DHR A;  3IHP A;  3H66 A;  4QOS A;  2EWL A;  4X64 E;  2DRP A;  1K3W A;  3W68 A;  2GNO A;  1PJS A;  3DZD A;  4NL4 H;  2V87 A;  2I7N A;  1QZM A;  5KPT A;  2YTQ A;  3SAT A;  2YRM A;  4MLV A;  1S3N A;  3FGA C;  1UN6 B;  3U60 A;  4AKG A;  4UT2 A;  3JAM S;  3CTW B;  1QUT A;  1V34 A;  1QFC A;  3J80 C;  2EMK A;  4NSR A;  1XMO E;  2UXB M;  4LF5 M;  4CIS A;  1DQ3 A;  3GLG A;  2UUA M;  1X47 A;  2KEB A;  1XXH A;  4DR1 E;  3TWM A;  3THN A;  2UXD M;  2R0I A;  2LWX A;  3RE8 A;  2BWB A;  5EXS A;  4HL4 A;  3LQQ A;  3RL3 A;  2L2N A;  4JV5 M;  5A2Q C;  2MC6 A;  4BMJ A;  4YKE A;  4FBW A;  1TH2 A;  2WZJ A;  2J7N A;  3SMS A;  4P17 A;  4DUZ M;  3IWB A;  3I51 A;  5EQT A;  1PDA A;  4KHP M;  4DV6 E;  2EOE A;  1LV7 A;  2B3T A;  1IN8 A;  2MKN A;  3JU0 A;  3FYD A;  4HEI A;  3FRI A;  2CHV A;  1NNW A;  1V33 A;  4PDI A;  1FJM A;  4DR3 M;  1IM2 A;  2O01 F;  4DBG B;  4ZVZ A;  2R45 A;  2LUQ A;  2L8T A;  2EL4 A;  2DMY A;  4DR4 E;  4DHL A;  1NY6 A;  4BC7 A;  2JXN A;  3VFD A;  2YRK A;  3NWL A;  3I04 M;  1TF0 B;  4F6M A;  3QYE A;  2EPL X;  5FLX C;  1QAQ A;  2EE8 A;  3KW6 A;  2KHX A;  3PVS A;  1JR3 E;  4LY6 A;  4MLQ A;  4KO8 A;  1DV0 A;  4LJ4 A;  1TR8 A;  2L33 A;  2R6F A;  4I5S A;  4I4L A;  2RSI A;  4NXN E;  2V88 A;  2YU5 A;  2Y0T A;  4JI6 M;  2JY8 A;  3C5W C;  1WAR A;  4YHH E;  2AHM A;  5AE1 A;  1Y8G A;  5LL6 R;  2DZO B;  4IIW A;  1YSA C;  3ZQJ A;  3L2A A;  1U32 A;  2L7I A;  1J09 A;  1NO1 A;  3OTO M;  4QNR A;  4R2E A;  1TGU A;  1Q02 A;  2CHQ A;  1II7 A;  1RU3 A;  5ITU A;  2N8X A;  2CHG A;  1AUI A;  3I4V A;  2V1C A;  4ORA A;  2NYL C;  2OQ4 A;  1A5T A;  3HJQ A;  4RKU F;  3J2P B;  5AC5 A;  1IY1 A;  2JYA A;  2Z72 A;  3GLG E;  1XXH E;  2LT7 A;  5LLQ A;  3TQS A;  3GRR A;  3QFK A;  4FK5 C;  2PRT A;  1R2Z A;  2R1F A;  4HLQ A;  5LMN E;  3KXE C;  4CIZ A;  2R4J A;  2NYM C;  3J80 S;  4LAC C;  1TH3 A;  2K9D A;  1YYO A;  2YTJ A;  3ZOQ B;  4CJ6 A;  4ZYD A;  4DV6 M;  4JI5 M;  5FTK A;  2M7Q A;  3UMM A;  4FW9 A;  2F5S A;  2P5T A;  5A2Q S;  5KPR A;  5C18 A;  3VK7 A;  4F1I A;  1IN7 A;  3T15 A;  3E46 A;  5TSE A;  3SYL A;  3VKH A;  3F92 A;  1Z5C A;  4LCB A;  4DUY E;  3CF0 A;  3KS8 A;  3U6P A;  3BBZ A;  2XFS A;  3LMM A;  4ANR A;  3U61 A;  3V4Y A;  2RSM A;  2O25 A;  2LV2 A;  4F9C B;  3QAU A;  1SR9 A;  3GQ4 A;  2L3J A;  3A98 B;  1L2B A;  2NPP C;  4JXJ A;  1G5B A;  1BVS A;  1VG5 A;  3FKE A;  1C7Y A;  1MJG M;  4NRW A;  4JI4 E;  5EXX A;  2JOX A;  2CFO A;  4H2F A;  2JNH A;  4L6V 6;  3GPX A;  1NCS A;  2RS7 A;  1OFI A;  2DMI A;  1N36 M;  2ZTD A;  2Z1A A;  5FLX S;  4DMI A;  2DAK A;  2QBY B;  5IWA E;  1WGL A;  3HXL A;  2ZM6 E;  1P47 A;  1Z2X A;  3IG5 A;  2FTX B;  2JPA A;  3HU1 A;  5A6B D;  3B7Q A;  2G8L A;  4B3M E;  4R7G A;  2M1S A;  3AJI B;  4JA9 A;  1IT6 A;  2ENC A;  3FUX A;  4FWD A;  3GLH B;  2D9H A;  4YY3 M;  2JR1 A;  2V1U A;  2FOI C;  1G3I A;  4WWL A;  4LF7 E;  1PRB A;  3AOE C;  2EMC A;  1IBM E;  2LTR A;  1QUS A;  3E0J A;  4J8Z A;  2G3Q A;  5EQV A;  4AG5 A;  5ITX A;  3KS4 A;  4BHB A;  1TDH A;  3T1H M;  3M7G A;  2ZO9 B;  1XNR M;  2WDE A;  1EH8 A;  5BPV A;  1IN6 A;  5KL2 A;  4JI1 E;  2EPM X;  4KZS A;  2LE2 A;  4X66 E;  4FD2 A;  1IFY A;  3FD9 A;  3JR5 A;  1OID A;  2CP8 A;  3L28 A;  3IWD A;  5FTN A;  1EE8 A;  4XK8 F;  2E72 A;  4LTY A;  3AL0 C;  4QOZ C;  3EQ1 A;  2YZT A;  2LTS A;  1QZE A;  4X65 M;  3AV0 A;  1GL6 A;  4ZYH A;  2CV9 A;  4MP0 A;  4DR2 E;  3EGH A;  3FIG A;  4JYA E;  4OX9 E;  3JYF A;  1T38 A;  4R2R A;  4LF4 M;  1L1Z A;  4OR9 A;  4RF0 A;  4L8R C;  5JPE A;  5A69 A;  3GLI B;  2CT1 A;  1T4L B;  1V73 A;  5KL5 A;  1LLM C;  4GHA A;  4GKK E;  3C9P A;  2Z06 A;  2Q2E B;  1IY0 A;  4G9J A;  1S3L A;  3IG8 A;  4GHL A;  4DV5 E;  5A6A A;  4LFA E;  1Z5A A;  2QP9 X;  2WCC 3;  5A6B A;  5FSW A;  4B2O A;  1E9R A;  3RGS A;  2KNA A;  1A1I A;  4WPY A;  1JK7 A;  4M0W A;  4GIT A;  4LZZ A;  4IJF A;  4B7H A;  1XC8 A;  1IQP A;  7CAT A;  4WUR A;  2LH0 A;  2L3C A;  3D8L A;  1STU A;  4MGH A;  1JR3 D;  3W0F A;  3H61 A;  1DGC A;  3FLO A;  2ZAM A;  2MR9 A;  3FTC A;  3UK6 A;  1YUJ A;  2EN6 A;  3JR4 A;  2L7H A;  2L2D A;  2EPZ A;  5IWA M;  3V76 A;  2UXB E;  1G2D C;  4LF5 E;  2KHH A;  2YTN A;  3HU3 A;  4DR6 E;  2KZS A;  4B3M M;  3QFM A;  2YFQ A;  3I01 M;  4ORB A;  2ZAO A;  3KOZ E;  1L1T A;  3FYC A;  4EIW A;  2G7H A;  3ZU0 A;  1L2D A;  4B3S M;  1MX0 A;  5JI2 E;  1HNX M;  4JV5 E;  4LFB M;  2K7I A;  4Z6Y A;  2DXL A;  5ITX E;  3U6E A;  2OOB A;  4DUZ E;  2QFR A;  4H2B A;  3VYX A;  4BC9 A;  2EML A;  3F6H A;  1WHN A;  3E4R A;  1T71 A;  2QEN A;  4DR3 E;  4DR5 E;  1R5L A;  2VF1 A;  2A22 A;  2R17 A;  2WSC F;  2EPK X;  1EKZ A;  1HNW E;  1G71 A;  2EM4 A;  5IRE B;  4S12 A;  2LCE A;  1XHB A;  2IAE C;  4G4O A;  3B7N A;  4L5N C;  2DNA A;  3B7Z A;  3U5Z A;  1JB0 F;  1ORY B;  2LNH C;  1DGF A;  1W24 A;  1VEG A;  2JOG A;  1M63 A;  4OX9 M;  1GJS A;  3U60 B;  3H09 A;  4TUI A;  2LTU A;  1P3Q Q;  1S95 A;  3ADL A;  1D0M A;  4LJA A;  2EN7 A;  2DVW B;  1VDD A;  4UN2 B;  2EMG A;  3GLG B;  3UJN A;  4MM3 B;  2LBS B;  5CFF E;  2KZU A;  1YLA A;  4XBO A;  4PD2 A;  3T6P A;  4WXD A;  3C4T A;  3F6G A;  4I5L C;  4IBG A;  4IBB A;  1GJT A;  4JI0 M;  2EPX A;  3AOE A;  4M0D A;  3J81 C;  1LTM A;  4LFA M;  3GRY A;  3H60 A;  3FTE A;  3R9X B;  1ZMV A;  4AKI A;  5IZ7 D;  3RMP A;  2KRK A;  2YNM D;  1O0W A;  1UHZ A;  2EOI A;  3ICF A;  2B3T B;  2BWE A;  1EIJ A;  3K8Z A;  1UM8 A;  1A1J A;  1RC7 A;  3TQM A;  2BCD A;  1DGG A;  4GMQ A;  2C96 A;  3GRV A;  1NV8 A;  5GKN A;  2V85 A;  2QJC A;  3H4J A;  1GVN A;  2DGC A;  2QSF X;  2J7O A;  2MH8 A;  2LVQ D;  1RMD A;  2F4V M;  1QAN A;  3E9S A;  2EMF A;  2EN3 A;  2KKN A;  4NRV A;  4O43 A;  3KZY A;  4IBF A;  3B89 A;  3TGH A;  1IXS A;  2EA0 A;  1GAB A;  4MOV A;  3PNY A;  1GTK A;  5DNY A;  3D8B A;  2Z7J A;  2D7G A;  2EN4 A;  4CGY B;  2ELZ A;  2RRU A;  1XWI A;  3KDS E;  2NUE A;  2I13 A;  4DR6 M;  2GQF A;  1YPN A;  3FE3 A;  1X6F A;  1XM7 A;  2R44 A;  3KWR A;  2X4A A;  5INB A;  3VLF B;  2R4E A;  1IBL M;  3FUT A;  3THO B;  1NHG C;  2DZL A;  2WBT A;  2XLJ A;  2VQF M;  3AUZ A;  1W5T A;  4X8W A;  1ZV1 A;  2XZF A;  4JI5 E;  3VDU A;  1D0L A;  4JI7 E;  3ECR A;  3U6L A;  5ITT A;  4FBQ A;  4DR5 M;  4AZF A;  2ERC A;  2L6M A;  3TWL A;  2EOR A;  1E9S A;  1HNW M;  5BR8 E;  1T4N A;  4JI8 M;  4IL1 A;  4L8N A;  3GPU A;  1WIV A;  4B08 A;  1NV9 A;  3HPZ A;  4WXC A;  2V89 A;  2RGH A;  1T6O A;  5FTL A;  3MJ5 A;  3A45 A;  1T3T A;  3W67 A;  2EOS A;  2EPC A;  1TDZ A;  1QAO A;  2EP3 A;  4IYP C;  1DO2 A;  4D81 A;  2M60 A;  1WJP A;  2EOH A;  2F5Q A;  1MF8 A;  2I9I A;  4OVZ A;  3MSW A;  1N36 E;  2C99 A;  4KWY A;  5A6J A;  1J5E M;  4MB7 A;  3H63 A;  3HHW A;  2EPN A;  2HC5 A;  3HHY A;  2LVN C;  2EPO A;  3HHX A;  3MK6 A;  1PJQ A;  3KP0 E;  2NXF A;  5L8R F;  4R2S A;  2EPP A;  1UF3 A;  4NZV A;  2MDR A;  2Z3X A;  1SXJ C;  4YY3 E;  4JI3 E;  3FTF A;  4QHT A;  2H36 X;  1XNQ M;  3J81 S;  3TL4 X;  1X48 A;  4BHC A;  2W82 A;  1S70 A;  5KO3 A;  2BJW A;  3J27 B;  2ELY A;  3T1H E;  1XNR E;  3L00 A;  2NUG A;  3UGJ A;  2WDF A;  1OTR A;  4J6O A;  3PNV A;  1J26 A;  4L15 A;  3MHS C;  4FWG A;  3K2L A;  3ZTV A;  1KBP A;  4F2J C;  1GL7 A;  2HKJ A;  2WSF F;  4CHT B;  1G59 A;  2ZAN A;  3PSN A;  1OIZ A;  4FCW A;  2YTE A;  4NSO B;  4X65 E;  3VK6 A;  1QDR A;  2JWS A;  1I94 E;  1R2Y A;  1FKA E;  1A1F A;  2EOX A;  2LO3 A;  4LFC M;  2X49 A;  2EL6 A;  1UTE A;  1Q39 A;  4LF4 E;  5EXT A;  3KOY E;  2VF8 A;  3CK2 A;  1KYQ A;  4GC5 A;  3GLF E;  3K6Q A;  2LHG A;  1WXQ A;  3DW8 C;  3VYY A;  4D80 A;  5A6K A;  1T70 A;  3CGW A;  4LZJ A;  3FTD A;  2DEN A;  4LJ6 A;  3K7W C;  3Q8G A;  2JY5 A;  4DV1 M;  3KOW E;  2LJH A;  3H67 A;  2DXN A;  1G4A E;  4JI7 M;  2HCB A;  3GVE A;  2F8B A;  3P71 C;  2XMO A;  2OPF A;  1OJL A;  4R2D A;  3SAW A;  2LMZ A;  4Q28 A;  3HY5 A;  4V0X A;  5KL6 A;  5BR8 M;  2YTD A;  4DR7 M;  2VRD A;  2ZOA A;  1XB2 B;  2VE7 C;  4ZYG A;  3E7B A;  2KNZ A;  1YUB A;  1NNJ A;  1QYR A;  1B69 A;  1VQ1 A;  3CF2 A;  2JZ0 A;  4L78 A;  1DGH A;  1WR1 B;  1S8E A;  3QFO A;  2IE4 C;  2EOF A;  1A1G A;  4F9B B;  4KOD A;  2Z8Y M;  4RHB B;  3RFW A;  1FJG E;  2USH A;  1USH A;  1SXJ D;  1TCO A;  3M99 B;  1QNT A;  4II7 A;  1FNN A;  4LRT A;  4K0K E;  4ZPX A;  5T6J A;  3K9P A;  3KSJ A;  3SHF A;  2YTI A;  1UIL A;  3SAU A;  5E26 A;  4X62 M;  4AG6 A;  2WDD A;  3HQ1 A;  3LQR A;  4RH8 A;  1E94 E;  2EJ4 A;  1RQ0 A;  3THG A;  2DAG A;  2XSZ D;  2KDL A;  2L92 A;  5DYI A;  4R2C A;  4B3S E;  2JWO A;  4JI3 M;  1HNX E;  2EZ6 A;  2LJU A;  1YUI A;  4LFB E;  2EQ1 A;  2DLK A;  2CRU A;  3HHZ A;  2APL A;  2LVA A;  4P7D A;  1Q3C A;  4JA7 A;  3M0E A;  1R4G A;  1IQO A;  1S3S A;  2C9C A;  3Q8X A;  2DIX A;  2Y0Q A;  2DWM A;  4QNM A;  3GO8 A;  3L29 A;  2UUB M;  2KNV A;  2H5X A;  3WHK A;  3K7V C;  3HWS A;  2EM2 A;  2EKF A;  2IHR 1;  2KON A;  1HR0 M;  2WZO A;  3PSO A;  2BJV A;  2FGG A;  4AKH A;  1A1L A;  1X3C A;  2HJJ A;  4D82 A;  1I94 M;  2YT4 A;  1OIP A;  3UZU A;  2VDB B;  4ZX2 A;  2RKO A;  4HEO A;  4KBP A;  2JOB A;  1Q3B A;  2JP7 A;  1NHW C;  2ENA A;  3LLH A;  5LMU M;  3DA1 A;  1KJK A;  2EO2 A;  4M9S A;  1ZBT A;  3ILK A;  2GLI A;  2YVT A;  3U6O A;  3ZH9 B;  1KSF X;  1OAO C;  3J7B A;  4GH9 A;  1XMQ M;  1YE9 A;  2HGH A;  1SXJ A;  1GZ6 A;  5IXM B;  4Q35 B;  3IB7 A;  5F3W A;  2WBU A;  2G5G X;  2EJS A;  4JI0 E;  2JY9 A;  2IE3 C;  2JP9 A;  2BNK A;  4DV3 M;  4P16 A;  4ORC A;  1NY5 A;  2EPA A;  3J7Y p;  4FVM A;  1Z5B A;  3TWK A;  2XSZ A;  2FFJ A;  3H69 A;  2B7T A;  3U6Q A;  5FTM A;  3PXG A;  3EGG A;  2YU8 A;  1G2F C;  5KQD A;  4NC6 A;  2YQZ A;  3AFH A;  1IXR C;  1T39 A;  4BBY A;  2DHY A;  2F4V E;  5J28 A;  4M2Z A;  4IBJ A;  3LCV B;  4F9A B;  4H2I A;  4M30 A;  3U5Z B;  3JTZ A;  1HQY E;  1ZBQ A;  3EIH A;  4DV4 M;  1FJG M;  2WDC A;  4MGZ E;  2EMX A;  2YSP A;  1HJP A;  2YWQ A;  3H4M A;  1Z1B A;  4K0K M;  4P78 A;  4WSG A;  2LHC A;  5DFL A;  2UXC M;  2Y20 A;  4G4R A;  3WHL A;  3SMP A;  3B74 A;  2EN2 A;  3H68 A;  3HTX A;  1G41 A;  2EOM A;  2Q8U A;  2I7P A;  2NAB A;  2YSO A;  2EKK A;  2DWZ B;  2JY6 B;  4MGI E;  1OFH A;  3SYK A;  2L4F A;  2E5L M;  1YYK A;  3MHV C;  4R3D A;  1IBL E;  1WHQ A;  2XGN A;  3DF6 A;  1JK1 A;  4ITQ A;  1AUA A;  1EFU B;  1HP1 A;  2VQF E;  3VK8 A;  4GKJ M;  2YTF A;  1ZAE A;  1YYW A;  3J7A S;  1OKS A;  1IBK M;  1L8Q A;  3RL4 A;  3FUW A;  3P1X A;  4LJ9 A;  4XGI A;  3LML A;  1N3G A;  4JI2 M;  4X9J A;  4ZYE A;  3HVQ A;  4JI8 E;  1YFH A;  3GP1 A;  3ADI A;  3AOG A;  4IJE A;  1TH4 A;  3AKZ A;  2LVO C;  3A46 A;  2P6B A;  1IXS B;  2AHD A;  4IBI A;  2GPI A;  1Z59 A;  2EPU A;  2LUP B;  2L6O A;  5KPZ A;  3SAS A;  3VKG A;  4H2G A;  2BQ8 X;  2EL5 A;  2QQ8 A;  4WYQ B;  2L2M A;  4KKZ A;  1XXH B;  3LL8 A;  1SXJ E;  1K82 A;  3TE6 A;  5EJC A;  3H64 A;  1J5E E;  2RQL A;  1MEY C;  2C5R A;  4BLC A;  2OOA A;  3KSX A;  5DYG A;  2DAI A;  5IT9 C;  1N32 M;  4V0V A;  4IBD A;  2YR0 A;  3BGH A;  1HQC A;  4MOY A;  1K3X A;  4N4R B;  2A25 A;  3C6K A;  3T1Y M;  3GLH E;  5AAS A;  4NHR A;  2NA2 A;  1XNQ E;  2RS6 A;  4RF1 A;  1HNZ M;  3SBJ A;  2EMH A;  2Z4S A;  3HGI A;  4R2P A;  1F2I G;  2JUJ A;  5C1V A;  2CUZ A;  2JZ1 A;  5JI3 E;  1TN9 A;  2F5P A;  3UK3 C;  2JY7 A;  2B7V A;  2EM8 A;  2Z4R A;  2LXE A;  2JXP A;  3HJS A;  1WRJ A;  4O5G A;  2ODR C;  3ADJ A;  3SAR A;  2FE8 A;  2R76 A;  3U6S A;  1X37 A;  4LU9 A;  4F0Z A;  5AC4 A;  3MMP A;  2QNJ A;  4L16 A;  1F4I A;  3LCU A;  4WP2 A;  2ENH A;  2YRH A;  4LFC E;  1N34 M;  1DGB A;  2EMI A;  4OVZ B;  2HYP A;  2UUC M;  5HPE A;  2C9O A;  4R2A A;  2F5N A;  1PKP A;  1BBO A;  1JK2 A;  3GLI E;  4B3T M;  4IBC A;  4BB9 A;  3GLF A;  3B9P A;  4LF9 M;  4G4N A;  3SAV A;  4DV1 E;  4NXM E;  1WXR A;  3GQ5 A;  1IMU A;  4UT3 A;  2HAK A;  2HY1 A;  1GO5 A;  2LVH A;  5EP1 A;  2EMA A;  1T4O A;  4WW0 A;  1GKI A;  5ITQ A;  2BDX A;  4DR7 E;  1BBG A;  3C58 A;  4B3R M;  2EMB A;  5C1B A;  5EP2 A;  4F54 A;  3IVE A;  3T38 A;  2NQ8 C;  1A1K A;  1D2N A;  2DSY A;  4DSY A;  1ZR9 A;  4IJD A;  3HPS A;  1ZU1 A;  4OU7 A;  2MKD A;  4AW4 A;  2VII A;  4DV2 M;  3K92 A;  1EH6 A;  4IBK A;  2EMW A;  2M4I A;  3QG5 C;  1X6H A;  3NBI A;  4FCT A;  4LJ8 A;  4Z8X A;  4IBE A;  1MGT A;  3BOS A;  4A3V B;  4X62 E;  2UU9 M;  4OW0 A; 
#chains in the Genus database with same CATH homology
 1IN5 A;  3SHG B;  1H6U A;  1N33 M;  4GIP A;  3HKP A;  2F5O A;  5IT9 S;  2ODR D;  4DV7 M;  1NNU C;  4AI6 A;  2LRS A;  2V6Z M;  4O24 A;  4WFT A;  4R03 A;  3U61 B;  2UUB E;  1IN4 A;  3DOA A;  2ZBK B;  1HR0 E;  3L25 A;  3I4Y A;  4M0V A;  1DGH B;  1OIE A;  2VQE E;  4XPN A;  4X64 M;  4FCV A;  4GC9 A;  1QQW A;  4M9Z A;  4LF8 E;  1N78 A;  4DKK A;  1OI8 A;  3L27 A;  1KFV A;  3U6C A;  5LMU E;  4KLN A;  4PDG A;  1XMO M;  2FNA A;  1GQE A;  3IB8 A;  4I5N C;  1IXZ A;  2DXI A;  1JQJ C;  3DJW A;  4DR1 M;  2KW0 A;  1XMQ E;  2DWN A;  4WSP A;  4MGK E;  4AQY E;  3LVW A;  3A42 A;  4NXM M;  2YEQ A;  3LVV A;  2RTX A;  1YSY A;  4DV3 E;  2K4V A;  2MC5 A;  2KXE A;  4FWH A;  3U6M A;  3ADG A;  3TPZ A;  4UWQ A;  1PJI A;  4NOO B;  1QAM A;  3FUU A;  2A5Y B;  1J7K A;  3DFZ A;  3FUV A;  5FTJ A;  2K47 A;  3RGP A;  2DWL A;  4H1S A;  1QHW A;  3J7A G;  1N75 A;  5JPF A;  4TUG A;  4W5W A;  4DR4 M;  4DV4 E;  3QFN A;  2EUC A;  3KP1 E;  1HO5 A;  1C1K A;  3GQ3 A;  2L2K B;  5B8I A;  3E7A A;  2UXC E;  4I8O A;  1QU6 A;  3RQZ A;  1XZW A;  3HU2 A;  2XEP A;  4G6Z A;  4NXN M;  1L2C A;  1SXJ B;  4BS9 A;  5JJT A;  4G4Q A;  2E5L E;  5ITY A;  2N3G A;  2DFJ A;  4YHH M;  2O8A A;  2V8Q B;  4DV0 E;  2D7H A;  4GKJ E;  2NUF A;  3RL5 A;  2GJU A;  3T1I A;  3KVW A;  4HD0 A;  1PM5 A;  5EP3 A;  2CPN A;  1NVM A;  1IBK E;  1YZ9 A;  3ZC7 B;  4LJ7 A;  2DZN B;  5EP4 A;  2RGO A;  4JI2 E;  5KQ8 A;  4LF6 E;  2V86 A;  2CV2 A;  2VQE M;  4TUW A;  5AE2 A;  3C4B A;  4LF8 M;  2ZBM A;  2B9D A;  3DSC A;  3GPY A;  1QVR A;  2R18 A;  4LJ5 A;  4FBK A;  4GRI A;  1Z2W A;  3U6D A;  2XZU A;  4MH0 E;  2R62 A;  1G8P A;  4BBA A;  4MGY E;  4R8O A;  4L4U A;  1GLN A;  2HL7 A;  4V0W A;  5LMN M;  2D7E A;  2QBY A;  4AQY M;  5ITR A;  4RNA A;  1N32 E;  1Z6T A;  1DO0 A;  3PFI A;  4PT5 A;  3HJ8 A;  1NJG A;  4QHS A;  3M6A A;  2QZ4 A;  4FCX A;  2XFT A;  2R46 A;  3OML A;  1KYI A;  2DB2 A;  3T1Y E;  3IWC A;  4Q7F A;  1NSF A;  3GLH A;  1WAO 1;  1R6B X;  1HNZ E;  4LGM A;  2HHH E;  2C98 A;  2QPA A;  5EXP A;  1HT2 E;  4DUY M;  4BCA A;  8CAT A;  5H37 D;  2Y21 A;  4OOG C;  1N77 A;  4DT2 A;  3JAM C;  4GEQ B;  3EIE A;  2CE7 A;  1W5S A;  4B7F A;  2R65 A;  4JI4 M;  1DI2 A;  1N34 E;  3D03 A;  3KFU G;  4PCZ A;  2H1R A;  1SU1 A;  2UUC E;  4O4K A;  2KA6 B;  4LG2 A;  1R7R A;  2E1M A;  3DSD A;  4B3T E;  2ZM6 M;  3GLI A;  2CV0 A;  4M9X A;  4LF9 E;  2UUA E;  4DV0 M;  2UXD E;  2O8G A;  3ZCB B;  3L26 A;  5GTU A;  3H62 B;  3KBP A;  1MU5 A;  4I81 A;  5AE3 A;  3K1J A;  4LF7 M;  1IBM M;  2X8A A;  4B7G A;  4KHP E;  1E32 A;  3QWL A;  2JVA A;  4LF6 M;  4JI1 M;  4B3R E;  2KRU A;  4LGY A;  2CEA A;  2JA2 A;  2HYO A;  4X66 M;  3KOX E;  2XH9 A;  3GRU A;  3CF6 E;  4LRS A;  1ZQ9 A;  5E6J A;  3W0L B;  2N3H A;  2QCU A;  4DR2 M;  4DV2 E;  3SC3 A;  3VDP A;  4JYA M;  1HPU A;  1S3M A;  1IY2 A;  1I4W A;  4JN6 A;  1NJF A;  1PJJ A;  1JR3 A;  2UU9 E;  3GLF B;  2V83 A;  2FV4 B;  1N33 E;  4REZ A;  4GKK M;  4JI6 E;  3SFZ A;  2CV1 A;  5IOH A;  4UT3 B;  4DV7 E;  4DV5 M;  3GPP A;  2HHH M;  3C9F A;  2KOU A;  2L09 A;  2M5Z A;  5ADZ A;  4H1Y P;  3OTO E;  2O5R A;  3IVD A;  2QFP A;  3R8F A;  1HT1 E;  1X49 A;  2XF3 A;  3N5U A;  2DHR A;  3H66 A;  4QOS A;  2EWL A;  4X64 E;  1K3W A;  3DZD A;  4NL4 H;  2V87 A;  2I7N A;  1QZM A;  5KPT A;  3SAT A;  1S3N A;  3FGA C;  3U60 A;  4AKG A;  4UT2 A;  3JAM S;  3CTW B;  1QFC A;  3J80 C;  4NSR A;  1XMO E;  2UXB M;  4LF5 M;  4CIS A;  1DQ3 A;  3GLG A;  2UUA M;  1X47 A;  2KEB A;  1XXH A;  4DR1 E;  3TWM A;  3THN A;  2UXD M;  2LWX A;  3RE8 A;  5EXS A;  4HL4 A;  3LQQ A;  3RL3 A;  2L2N A;  4JV5 M;  5A2Q C;  2MC6 A;  4BMJ A;  4YKE A;  4FBW A;  1TH2 A;  2J7N A;  3SMS A;  4DUZ M;  3IWB A;  3I51 A;  5EQT A;  4KHP M;  4DV6 E;  1LV7 A;  1IN8 A;  3JU0 A;  3FYD A;  2CHV A;  1NNW A;  4PDI A;  1FJM A;  4DR3 M;  1IM2 A;  4ZVZ A;  2R45 A;  2LUQ A;  2L8T A;  2DMY A;  4DR4 E;  4DHL A;  1NY6 A;  4BC7 A;  3VFD A;  3NWL A;  5FLX C;  1QAQ A;  3KW6 A;  2KHX A;  3PVS A;  4LY6 A;  4KO8 A;  4LJ4 A;  2L33 A;  4I5S A;  4I4L A;  4NXN E;  2V88 A;  2Y0T A;  4JI6 M;  3C5W C;  1WAR A;  4YHH E;  2AHM A;  5AE1 A;  5LL6 R;  2DZO B;  4IIW A;  3L2A A;  1U32 A;  2L7I A;  1J09 A;  3OTO M;  4QNR A;  1TGU A;  2CHQ A;  1II7 A;  5ITU A;  2CHG A;  1AUI A;  3I4V A;  2V1C A;  4ORA A;  2NYL C;  2OQ4 A;  3HJQ A;  3J2P B;  1IY1 A;  2Z72 A;  3TQS A;  3GRR A;  3QFK A;  1R2Z A;  4HLQ A;  5LMN E;  3KXE C;  2R4J A;  2NYM C;  3J80 S;  4LAC C;  1TH3 A;  1YYO A;  3ZOQ B;  4DV6 M;  4JI5 M;  5FTK A;  2M7Q A;  3UMM A;  4FW9 A;  2F5S A;  2P5T A;  5A2Q S;  5KPR A;  5C18 A;  3VK7 A;  1IN7 A;  3T15 A;  3SYL A;  3VKH A;  1Z5C A;  4LCB A;  4DUY E;  3CF0 A;  3KS8 A;  3U6P A;  2XFS A;  3LMM A;  3U61 A;  3V4Y A;  2RSM A;  4F9C B;  3QAU A;  1SR9 A;  3GQ4 A;  2L3J A;  3A98 B;  1L2B A;  2NPP C;  4JXJ A;  1G5B A;  3FKE A;  4NRW A;  4JI4 E;  5EXX A;  2JOX A;  2CFO A;  4H2F A;  3GPX A;  2RS7 A;  1OFI A;  1N36 M;  2Z1A A;  5FLX S;  4DMI A;  2QBY B;  5IWA E;  3HXL A;  2ZM6 E;  1Z2X A;  3IG5 A;  2FTX B;  3HU1 A;  2G8L A;  4B3M E;  4R7G A;  2M1S A;  3AJI B;  4JA9 A;  1IT6 A;  3FUX A;  4FWD A;  3GLH B;  4YY3 M;  2JR1 A;  2V1U A;  2FOI C;  1G3I A;  4WWL A;  4LF7 E;  3AOE C;  1IBM E;  2LTR A;  3E0J A;  4J8Z A;  5EQV A;  4AG5 A;  5ITX A;  3KS4 A;  1TDH A;  3T1H M;  3M7G A;  2ZO9 B;  1XNR M;  2WDE A;  5BPV A;  1IN6 A;  4JI1 E;  4KZS A;  2LE2 A;  4X66 E;  4FD2 A;  3FD9 A;  3JR5 A;  1OID A;  3L28 A;  3IWD A;  5FTN A;  1EE8 A;  4LTY A;  3AL0 C;  4QOZ C;  2YZT A;  2LTS A;  4X65 M;  3AV0 A;  1GL6 A;  2CV9 A;  4MP0 A;  4DR2 E;  3EGH A;  3FIG A;  4JYA E;  4OX9 E;  3JYF A;  4LF4 M;  1L1Z A;  4OR9 A;  4RF0 A;  4L8R C;  5JPE A;  3GLI B;  1T4L B;  1V73 A;  4GHA A;  4GKK E;  2Z06 A;  2Q2E B;  1IY0 A;  4G9J A;  1S3L A;  3IG8 A;  4GHL A;  4DV5 E;  4LFA E;  1Z5A A;  2QP9 X;  5FSW A;  4B2O A;  1E9R A;  3RGS A;  4WPY A;  1JK7 A;  4M0W A;  4GIT A;  4LZZ A;  4IJF A;  4B7H A;  1XC8 A;  1IQP A;  7CAT A;  4WUR A;  2LH0 A;  2L3C A;  3D8L A;  1STU A;  4MGH A;  1JR3 D;  3W0F A;  3H61 A;  3FLO A;  2ZAM A;  3FTC A;  3UK6 A;  3JR4 A;  2L7H A;  5IWA M;  2UXB E;  4LF5 E;  3HU3 A;  4DR6 E;  2KZS A;  4B3M M;  3QFM A;  2YFQ A;  4ORB A;  2ZAO A;  3KOZ E;  1L1T A;  3FYC A;  4EIW A;  2G7H A;  3ZU0 A;  1L2D A;  4B3S M;  1MX0 A;  5JI2 E;  1HNX M;  4JV5 E;  4LFB M;  4Z6Y A;  2DXL A;  5ITX E;  3U6E A;  4DUZ E;  2QFR A;  4H2B A;  3VYX A;  4BC9 A;  3F6H A;  1WHN A;  3E4R A;  1T71 A;  2QEN A;  4DR3 E;  4DR5 E;  2VF1 A;  2A22 A;  2R17 A;  1EKZ A;  1HNW E;  5IRE B;  4S12 A;  1XHB A;  2IAE C;  4G4O A;  4L5N C;  3U5Z A;  1ORY B;  2LNH C;  1DGF A;  1W24 A;  2JOG A;  1M63 A;  4OX9 M;  3H09 A;  3U60 B;  4TUI A;  1S95 A;  3ADL A;  4LJA A;  2DVW B;  1VDD A;  3GLG B;  3UJN A;  4MM3 B;  2LBS B;  5CFF E;  2KZU A;  4XBO A;  4PD2 A;  3C4T A;  3F6G A;  4I5L C;  4IBG A;  4IBB A;  4JI0 M;  3AOE A;  4M0D A;  3J81 C;  4LFA M;  3GRY A;  3H60 A;  3FTE A;  3R9X B;  4AKI A;  5IZ7 D;  3RMP A;  2KRK A;  2YNM D;  1O0W A;  1UHZ A;  3ICF A;  2B3T B;  3K8Z A;  1UM8 A;  1RC7 A;  2BCD A;  1DGG A;  4GMQ A;  2C96 A;  3GRV A;  2V85 A;  5GKN A;  2QJC A;  1GVN A;  2J7O A;  2F4V M;  1QAN A;  3E9S A;  2KKN A;  4NRV A;  4O43 A;  4IBF A;  3TGH A;  2EA0 A;  4MOV A;  3PNY A;  5DNY A;  3D8B A;  2Z7J A;  2D7G A;  4CGY B;  1XWI A;  3KDS E;  2NUE A;  4DR6 M;  1XM7 A;  3KWR A;  2X4A A;  5INB A;  3VLF B;  2R4E A;  1IBL M;  3FUT A;  3THO B;  1NHG C;  2XLJ A;  2VQF M;  3AUZ A;  1W5T A;  4X8W A;  2XZF A;  4JI5 E;  3VDU A;  4JI7 E;  3U6L A;  5ITT A;  4FBQ A;  4DR5 M;  4AZF A;  2ERC A;  2L6M A;  3TWL A;  1E9S A;  1HNW M;  5BR8 E;  4IL1 A;  4JI8 M;  1T4N A;  4L8N A;  3GPU A;  4B08 A;  3HPZ A;  2V89 A;  2RGH A;  3MJ5 A;  5FTL A;  3A45 A;  1T3T A;  1TDZ A;  1QAO A;  4IYP C;  1DO2 A;  4D81 A;  2M60 A;  2F5Q A;  1MF8 A;  4OVZ A;  3MSW A;  1N36 E;  2C99 A;  1J5E M;  4MB7 A;  3H63 A;  3HHW A;  3HHY A;  3HHX A;  3MK6 A;  3KP0 E;  2NXF A;  1UF3 A;  4NZV A;  2MDR A;  2Z3X A;  1SXJ C;  4YY3 E;  4JI3 E;  3FTF A;  4QHT A;  2H36 X;  1XNQ M;  3J81 S;  3TL4 X;  1X48 A;  2W82 A;  1S70 A;  5KO3 A;  2BJW A;  3J27 B;  3T1H E;  1XNR E;  2NUG A;  3UGJ A;  2WDF A;  4J6O A;  3PNV A;  1J26 A;  4L15 A;  4FWG A;  3K2L A;  3ZTV A;  1KBP A;  1GL7 A;  2HKJ A;  1G59 A;  4CHT B;  2ZAN A;  3PSN A;  4FCW A;  4NSO B;  4X65 E;  3VK6 A;  1I94 E;  1R2Y A;  1FKA E;  4LFC M;  2X49 A;  1UTE A;  1Q39 A;  4LF4 E;  5EXT A;  3KOY E;  3CK2 A;  4GC5 A;  3K6Q A;  1WXQ A;  3DW8 C;  3VYY A;  4D80 A;  1T70 A;  4LZJ A;  3FTD A;  4LJ6 A;  3K7W C;  4DV1 M;  3KOW E;  2LJH A;  3H67 A;  2DXN A;  1G4A E;  4JI7 M;  2HCB A;  3GVE A;  2F8B A;  3P71 C;  2XMO A;  2OPF A;  1OJL A;  3SAW A;  2LMZ A;  4Q28 A;  4V0X A;  5BR8 M;  4DR7 M;  2ZOA A;  2VE7 C;  3E7B A;  1YUB A;  1NNJ A;  1QYR A;  3CF2 A;  4L78 A;  1DGH A;  1S8E A;  3QFO A;  2IE4 C;  4F9B B;  4KOD A;  3RFW A;  1FJG E;  2USH A;  1USH A;  1SXJ D;  1TCO A;  4II7 A;  1FNN A;  4LRT A;  4K0K E;  4ZPX A;  5T6J A;  3KSJ A;  3SHF A;  1UIL A;  3SAU A;  5E26 A;  4X62 M;  4AG6 A;  2WDD A;  3HQ1 A;  3LQR A;  1E94 E;  1RQ0 A;  3THG A;  2XSZ D;  2L92 A;  5DYI A;  4B3S E;  2JWO A;  4JI3 M;  1HNX E;  2EZ6 A;  4LFB E;  3HHZ A;  4P7D A;  1Q3C A;  4JA7 A;  3M0E A;  1S3S A;  2C9C A;  3Q8X A;  2DIX A;  2Y0Q A;  2DWM A;  4QNM A;  3GO8 A;  3L29 A;  2UUB M;  3WHK A;  3K7V C;  3HWS A;  2IHR 1;  2KON A;  1HR0 M;  2WZO A;  3PSO A;  2BJV A;  2FGG A;  4AKH A;  4D82 A;  1I94 M;  2YT4 A;  3UZU A;  4ZX2 A;  2RKO A;  4KBP A;  2JOB A;  1Q3B A;  1NHW C;  3LLH A;  5LMU M;  3DA1 A;  2EO2 A;  4M9S A;  1ZBT A;  3ILK A;  2YVT A;  3U6O A;  3ZH9 B;  1KSF X;  3J7B A;  4GH9 A;  1XMQ M;  1YE9 A;  1SXJ A;  1GZ6 A;  3IB7 A;  5F3W A;  2G5G X;  4JI0 E;  2JY9 A;  2IE3 C;  2BNK A;  4DV3 M;  4P16 A;  4ORC A;  1NY5 A;  3J7Y p;  4FVM A;  1Z5B A;  3TWK A;  2XSZ A;  2FFJ A;  3H69 A;  2B7T A;  3U6Q A;  5FTM A;  3PXG A;  3EGG A;  5KQD A;  2YQZ A;  3AFH A;  1IXR C;  4BBY A;  2F4V E;  5J28 A;  4M2Z A;  4IBJ A;  4F9A B;  4H2I A;  4M30 A;  3U5Z B;  3JTZ A;  1HQY E;  1ZBQ A;  3EIH A;  4DV4 M;  1FJG M;  2WDC A;  4MGZ E;  3H4M A;  4K0K M;  4P78 A;  2UXC M;  2Y20 A;  4G4R A;  3WHL A;  3SMP A;  3H68 A;  3HTX A;  1G41 A;  2Q8U A;  2I7P A;  2DWZ B;  4MGI E;  1OFH A;  3SYK A;  2E5L M;  1YYK A;  3MHV C;  4R3D A;  1IBL E;  1WHQ A;  2XGN A;  3DF6 A;  4ITQ A;  1HP1 A;  2VQF E;  3VK8 A;  4GKJ M;  1ZAE A;  1YYW A;  3J7A S;  1IBK M;  1L8Q A;  3RL4 A;  3FUW A;  3P1X A;  4LJ9 A;  4XGI A;  3LML A;  4JI2 M;  3HVQ A;  4JI8 E;  3GP1 A;  3ADI A;  3AOG A;  4IJE A;  1TH4 A;  3AKZ A;  3A46 A;  2P6B A;  1IXS B;  2AHD A;  4IBI A;  1Z59 A;  2LUP B;  2L6O A;  5KPZ A;  3SAS A;  3VKG A;  4H2G A;  2BQ8 X;  4WYQ B;  2L2M A;  4KKZ A;  1XXH B;  3LL8 A;  1SXJ E;  1K82 A;  3TE6 A;  5EJC A;  3H64 A;  1J5E E;  2C5R A;  4BLC A;  5DYG A;  3KSX A;  5IT9 C;  1N32 M;  4V0V A;  4IBD A;  2YR0 A;  1HQC A;  4MOY A;  1K3X A;  3T1Y M;  5AAS A;  2NA2 A;  1XNQ E;  2RS6 A;  4RF1 A;  1HNZ M;  3SBJ A;  2Z4S A;  3HGI A;  5C1V A;  2CUZ A;  5JI3 E;  2F5P A;  2B7V A;  2Z4R A;  2LXE A;  3HJS A;  4O5G A;  2ODR C;  3ADJ A;  3SAR A;  2FE8 A;  3U6S A;  1X37 A;  4LU9 A;  4F0Z A;  4L16 A;  4LFC E;  1N34 M;  1DGB A;  4OVZ B;  2HYP A;  2UUC M;  5HPE A;  2C9O A;  2F5N A;  1PKP A;  4B3T M;  4IBC A;  4BB9 A;  3GLF A;  3B9P A;  4LF9 M;  4G4N A;  3SAV A;  4DV1 E;  4NXM E;  1WXR A;  3GQ5 A;  4UT3 A;  2HY1 A;  5EP1 A;  1T4O A;  4WW0 A;  1GKI A;  5ITQ A;  2BDX A;  4DR7 E;  3C58 A;  4B3R M;  5C1B A;  5EP2 A;  4F54 A;  3IVE A;  3T38 A;  2NQ8 C;  1D2N A;  2DSY A;  4DSY A;  3HPS A;  4OU7 A;  4AW4 A;  2VII A;  4DV2 M;  3K92 A;  4IBK A;  2M4I A;  3QG5 C;  3NBI A;  4FCT A;  4LJ8 A;  4Z8X A;  4IBE A;  3BOS A;  4A3V B;  4X62 E;  2UU9 M;  4OW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...