5DNYA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Recombination/dna
total genus 107
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5dnyA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5dnyA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5dnyA01
5HPEA 2AHDA 4I5NC 4LACC 1Z2WA 1S3NA 4O24A 4ZVZA 4F0ZA 3QG5C 3V4YA 3ZTVA 4JA7A 1HPUA 4IYPC 1KBPA 2NYLC 4MOVA 3H69A 1TCOA 2HYPA 3FGAC 3QFNA 1Z2XA 4V0WA 3T1IA 4UWQA 1FJMA 1JK7A 4FCXA 4KKZA 1WAO1 3H68A 1OI8A 3H63A 3QFMA 3DW8C 4I5LC 4JA9A 1WARA 3QFOA 4LTYA 3EGGA 4IL1A 2Z72A 2IE4C 3H67A 3KBPA 4Q7FA 5GTUA 4MOYA 2WDEA 4ZX2A 4O4KA 2Z06A 3C9FA 4UT3B 1S3LA 4DT2A 1II7A 5JPFA 1S3MA 4WWLA 4TUIA 2BDXA 2JOGA 1G5BA 2QJCA 3H60A 2NXFA 2YVTA 4FBKA 4DHLA 3THNA 2WDCA 3PSOA 4UT3A 2GJUA 3H61A 3ZU0A 1HP1A 4H2BA 1U32A 4FBWA 2KKNA 1QHWA 1S8EA 4H1YP 1HO5A 2IE3C 4O43A 3H62B 3RQZA 3DSCA 3EGHA 2ZBMA 4H1SA 4H2GA 3PSNA 2IAEC 4DSYA 1XM7A 2O8AA 1AUIA 1NNWA 1S70A 1S95A 2DFJA 3CK2A 3C5WC 1T71A 4TUGA 2HYOA 4ORBA 2XMOA 2P6BA 3H66A 1UTEA 5INBA 1UF3A 5IOHA 3P71C 2QFPA 5B8IA 1T70A 1USHA 4H2FA 4G9JA 1V73A 1W24A 4FBQA 4MP0A 2WDDA 2QFRA 3H64A 3AUZA 2O8GA 2NYMC 4H2IA 5F3WA 4HD0A 4V0VA 3LL8A 4LU9A 3GVEA 3ICFA 2CV9A 4KBPA 4OR9A 2BQ8X 3IVDA 2R17A 4V0XA 3DSDA 3IB7A 4B2OA 3E7BA 5JPEA 1QFCA 5C1VA 1XZWA 5JJTA 3K7WC 2Q8UA 2BCDA 3TGHA 3THOB 3RL3A 3JYFA 3IB8A 4UT2A 3E7AA 5J28A 2NPPC 4NZVA 3QFKA 3RL5A 5EQVA 4O5GA 4XPNA 1OIDA 4M0VA 2Z1AA 3N5UA 4YKEA 2USHA 1OIEA 3HVQA 2HY1A 3RL4A 4J6OA 3AV0A 1IT6A 4ORCA 1SU1A 3IVEA 3K7VC 1M63A 5DNYA 4ORAA 2WDFA 1MF8A 2A22A
chains in the Genus database with same CATH superfamily
4XK8F 1TF0B 1LLMC 5A6KA 2EN3A 3C3DA 3FD9A 2YTEA 2JOXA 2JVAA 3I4VA 2EPRA 2EQ3A 4DUYM 4PDGA 1BBOA 2UUCE 3W0LB 1Q3CA 1TH3A 2Z72A 3R9XB 2H5XA 2EM0A 1X5WA 4UT3B 2EJ4A 5AASA 3Q8XA 3BGHA 3I51A 5E26A 3TWLA 2GJUA 5H37D 1N33M 1N34M 3MMPA 1G8PA 2IHR1 1Z1BA 4B7HA 4F2LA 2ZAOA 2DHYA 2MKDA 2DI0A 5FLXC 2EA0A 3C5WC 2M9AA 2EM3A 1PJIA 2LTSA 3CF6E 5KL3A 2XMOA 3B7NA 4AI6A 1BBGA 4LF9E 4LFBE 3J7AG 4MP0A 1A1HA 2EM6A 1IMUA 3W0FA 2DZNB 2WBUA 5FTNA 2YQZA 3QYBA 4GKJE 4DV7E 3V76A 3VK8A 1C1KA 1SG9A 4BBAA 2OOAA 4JI3E 4B2OA 1NCSA 2E1MA 4F9BB 2R18A 3B7QA 3IWBA 4DR3E 1WXRA 4IBBA 3VYYA 3UGJA 2FOIC 4RH8A 3PVSA 5AE3A 3SFZA 4GEQB 3GLIE 4LJ7A 3RGSA 1MX0A 4GH9A 1EFUB 4P17A 3HTXA 1SXJC 3KZZA 1Q02A 4J8ZA 2ODRC 3GRYA 5ADZA 3B7ZA 4DUZE 2DGCA 3CF2A 4JI2E 1NNUC 1IXZA 1JB0F 4F0ZA 4M9ZA 1HPUA 4DBGB 3PFIA 4PDIA 2E5LE 1TGUA 2J5YA 2LCEA 2F8BA 4UWQA 1TR8A 2EKFA 3H63A 1T6OA 1MN3A 2EOXA 4KODA 4B3SM 3MSWA 2LBSB 1A1GA 1B69A 2L6OA 2KRKA 4UT3A 1KYIA 3MHHC 2JWOA 3Q8GA 3BXWA 1IM2A 4IBDA 5IWAE 2N3GA 2JXNA 2YEQA 3RMPA 2XEPA 2G7HA 5BR8E 3SMPA 4GKKM 1YUIA 2P6BA 5INBA 2EQ1A 4OW0A 5CFFE 5ITYA 4IJDA 2FGGA 1USHA 1GQEA 2RPCA 4GEWA 1IBLE 2UUAE 3P1XA 1HT2E 1A5TA 2BBGA 2YTIA 1S3SA 3HPSA 2RKOA 5KL7A 4M9XA 3T1YE 1H6UA 4HEOA 5ITXE 3K7WC 1NY6A 2NUFA 3LW5F 1I94M 3VKGA 2I9IA 2YU8A 2XGNA 2LRSA 3U6DA 2UXCM 2LNHC 1ZBTA 1X49A 1HQYE 1HNWE 4LG2A 3QYEA 2DWNA 2EOHA 3ZCBB 3ZC7B 2F4VE 3HJSA 4CJ6A 4DV4E 4JA7A 4IYPC 5KL4A 2QPAA 4DV6E 4DR6E 3GPYA 3U6QA 4DR1M 2EUCA 2CPNA 3GQ3A 1IXSB 2XF3A 5KL2A 3KBPA 4LJ4A 4LF5M 4WYQB 4ZX2A 1G71A 2YSPA 4DT2A 5JPFA 2VIIA 4L5NC 1WHNA 1TH4A 1YFHA 2V89A 2NXFA 2L2KB 2WDCA 1N32E 3ZU0A 3HZJA 2APLA 4X64E 2EQ0A 2YTNA 2IE3C 5DYIA 3RE8A 1IBKE 4H2GA 5TSEA 2J7JA 2DHRA 3HHWA 2DFJA 2J7OA 4GITA 1OFHA 4CIZA 1WGLA 5DFLA 5EXPA 1T4OA 4PD2A 4ORBA 4G4NA 3VYXA 3EPLA 5IOHA 4OOGC 2R65A 2NYMC 3F92A 1N36M 4R2AA 1Y8GA 2EPPA 4ZYEA 2JA2A 1GL6A 1P3QQ 2O25A 2DAKA 2CV2A 4X9JA 1DGGA 4G3OA 7CATA 1N33E 3RL3A 4IS1C 3HX3A 3U5ZB 1DGFA 2ERCA 3RFWA 4IBGA 4MB7A 3JAMS 3KVWA 3N5UA 4Q28A 1L2DA 2XFTA 1PJJA 4IBFA 2FNAA 1VQ1A 1W5SA 3AOEA 2UUCM 1Z2WA 2BB8A 2DNAA 1NSFA 5E6JA 1DGBA 2D7EA 3D8BA 4FWDA 4KWYA 2N8XA 1R4GA 2L2NA 2NYLC 4MOVA 5L8RF 1OTRA 3FGAC 1UN6B 2CHGA 1SXJB 3T1HM 4B3TE 4HLQA 4JA9A 2YTPA 4MGHA 3H67A 2N3HA 3C9FA 2JWSA 1UHZA 1YSAC 1DQ3A 1IXSA 1NV9A 2QJCA 1RC7A 5A2QS 4FBKA 2HGHA 2VF8A 2B9DA 3U60B 1G3IA 2R76A 2EMZA 2BWBA 4HL4A 3UJNA 4GHLA 3CTWB 4JN6A 4NRVA 2V87A 2HYOA 3GLGB 1QUSA 2VRDA 4LRTA 4AKGA 4PT5A 2WBTA 2L33A 4DR3M 1DGCA 2X8AA 4IBKA 3M6AA 1NVMA 3LL8A 2XLJA 5FTKA 2UU9E 3FUTA 4IJFA 1XWIA 3DSDA 2YSOA 2CEAA 4DV3E 1STUA 3L28A 4B3SE 2B3TB 4LRSA 1KJKA 2R0IA 4NL4H 2OO9A 3TGHA 3THOB 2F5NA 2R4JA 4FCWA 3HQ1A 4JI2M 1N77A 3TPZA 3BBGA 2YRMA 3DFZA 2E5LM 3U5ZA 4IIWA 3NBXX 1X3CA 4J6OA 1KYQA 1XMQE 3IVEA 3UZUA 2FS1A 2EKKA 3HHXA 4GKKE 2MGWA 4DR7E 3UK6A 2MR9A 1MGTA 2B7VA 4R03A 3L29A 1D0KA 1NJFA 2EMXA 2ZO9B 3E21A 4MLVA 1GVNA 1FJGE 4KKZA 2ELZA 4BS9A 4WFTA 1A1KA 3HHYA 2NABA 1MEYC 1K3WA 4JI1M 1SXJA 2H1RA 2YWQA 2KDLA 2V1UA 1II7A 3PNYA 8CATA 2EPZA 1ZAEA 2EL5A 2LMZA 4JYAE 2EOIA 4I5SA 5BR8M 3DA1A 4H2BA 3HWSA 3LVWA 1U32A 3LQRA 2KKNA 3JAMC 2V6ZM 4MM3B 3DOAA 2R62A 3AKZA 2EOZA 3FTCA 4AW4A 2B7TA 2UUAM 1XM7A 2EN2A 3U60A 3UK3C 2O5RA 2EMFA 1DO0A 2EOSA 2R45A 3GLHB 1UTEA 2JOBA 2KRUA 3T1YM 4M2ZA 2F5OA 3P71C 5B8IA 3SAUA 3AUZA 4HD0A 3I04M 3GVEA 1WJ7A 4FD2A 4LF5E 2DWMA 2RRUA 3IG8A 4R2CA 4GC5A 3ADJA 1QFCA 3L00A 2EMWA 1T4LB 2EM4A 4AKIA 3THGA 2WZOA 2MKNA 2DAGA 3CF0A 4M30A 2HL7A 1UBDC 2B3TA 4B3RE 3SARA 2F4VM 2UXBM 4GZNC 1Z5CA 4YKEA 3HGIA 5ITTA 2HY1A 4GRIA 2EOFA 4DR6M 2KA6B 5HPEA 1AH5A 4NOOB 4FWGA 1L2CA 3QG5C 5A6AA 2EMHA 4QHTA 3C3EA 3AL0C 1XMOE 4JI0E 2DZOB 4M9SA 1YPNA 3K92A 1FJMA 4AG5A 1IY2A 1N32M 2QZ4A 4M9VC 2R1FA 3EPHA 4JI7E 1XHBA 5IZ7D 4IL1A 1D0LA 3VLFB 2JP7A 1IBKM 3PNVA 3THNA 3PSOA 3I4YA 2G3QA 3FRHA 5JI3E 3J27B 4R2EA 1A1IA 3DSCA 4L8RC 2LT7A 1S95A 5LLQA 1T71A 1G4AE 5ITUA 1ORYB 2JNHA 2J7NA 4LJAA 2C96A 3H66A 3HPZA 2FH0A 2EN8A 5IT9C 4FBQA 3T1HE 4JI6M 2EM8A 3GLHA 3K2LA 3A45A 2LO3A 2K9DA 2LVQD 4P16A 2RSMA 1T3TA 4B3MM 4JV5M 5KL6A 2FV4B 1A1JA 2EMLA 2OQ4A 4GIPA 3K1JA 5LMUE 3SAVA 2VE7C 3U61A 2EOEA 1OIDA 3IWDA 1E94E 3HVQA 2EOMA 2DXIA 1IT6A 1D0MA 4ORCA 3J7AS 2F5SA 1EE8A 5KPRA 3AFHA 2JYAA 5ITRA 2WDFA 3GLGE 3J81C 2A22A 4B3TM 1DO2A 1X6HA 1P47A 2RS6A 2CHQA 4LCBA 5IXMB 2Y0QA 1OKSA 4R2SA 2ADRA 1EIJA 3KFUG 1K3XA 1OIPA 3QFMA 2AHMA 2CUZA 5DYGA 3LCUA 1Z59A 4LF4E 4R2QA 4MGYE 2EN4A 3LMMA 2LXEA 3GO8A 4DR5E 3U6EA 1V33A 5KQDA 3PXGA 3K8ZA 1TF3A 2QSFX 2M1SA 3FKEA 3CK2A 3TWMA 5A6JA 1AUIA 2HKJA 1OFIA 1G2DC 2UU9M 1E9RA 4YY3E 3U6MA 4LJ9A 2EZ6A 4IBCA 1OJLA 1Z5AA 4DV3M 2ZBKB 4IBIA 2Z4SA 1V92A 3GQ5A 1ZU1A 4F9AB 3QAUA 1ZMWA 2DLKA 3KDSE 3QWLA 3L2AA 2LBCA 1OQYA 2Z8YM 2N35A 1WR1B 2L4EA 3ICFA 4FCVA 4JI1E 4KT0F 2VF7A 1ZAAC 1IXRC 1XB2B 3IB7A 2YFQA 1XMQM 4FWHA 5EP1A 3HY5A 3D8LA 4L15A 2LVPC 2EPOA 2YNMD 4DR7M 4BHBA 3FTFA 5EQVA 5FTJA 4WSPA 3J80C 4WXCA 1WXQA 4XGIA 4HEIA 5EJCA 4IJEA 3AV0A 1LV7A 1M63A 4LF7E 3B74A 1FJGM 3J7BA 1VDDA 2AHDA 4I5NC 1IN7A 4QOSA 4BMJA 1PJSA 2XH9A 3OTOM 3KOZE 3KS8A 1WHQA 2HYPA 2EPMX 1YYOA 5A69A 4JYAM 1IN8A 2GNOA 1XNQE 1IN5A 1O0WA 2MC5A 2JR1A 3DW8C 3FTEA 4NC6A 3KOXE 1JR3D 4LTYA 2JY5A 3IG5A 2WDEA 2Z06A 3E46A 3FUXA 5ITQA 3F6HA 1PM5A 2PRTA 2UXBE 2I7NA 4GMQA 2EMKA 1HP1A 4H1YP 3TE6A 5FSWA 1NNWA 4BCAA 2KHXA 2A5YB 3VDPA 5KQ8A 1T39A 2EMIA 2ZAMA 3H4JA 1TTEA 1PKPA 2JP9A 1G2FC 4NRWA 3GRUA 2NA2A 4LU9A 2KNAA 3JR4A 4B3RM 3FLOA 3IVDA 4KO8A 4RNAA 2L8TA 3M7GA 2L92A 3E7BA 4WP2A 5C1VA 4LGYA 5JJTA 4WW0A 2DB2A 4DV0E 2F5QA 4JI8M 2GHFA 1QAQA 2MC6A 1GL7A 2Z1AA 2DKLA 1IY0A 1XMOM 4JI0M 4ORAA 4LFCE 2EMBA 4YHHE 1J09A 2HJJA 4JI7M 4AKHA 2YPNA 1HJPA 4JI6E 3U6PA 3KS4A 1R2YA 3H69A 2M60A 3VDUA 1IY1A 1JK7A 1VEJA 3ZOQB 1IQPA 4B3ME 2K7IA 3ADGA 4JV5E 1MU5A 4QNMA 1WIVA 3EGGA 2EMGA 4DMIA 1DI2A 1R2ZA 1YUBA 2VF1A 1K82A 2M7QA 5FTLA 2YTQA 3H61A 4DV5E 3K9OA 1QHWA 1HO5A 3H62B 2VQEE 1NNJA 4Y28F 3FTDA 3SMSA 2OOBA 3LCVB 1HNXE 2EM9A 2LUQA 2ENCA 2R44A 4FW9A 3W68A 2C98A 1UF3A 3HXLA 4R8OA 4OVZB 2CTDA 2GQFA 4H2IA 1SR9A 5LL6R 4MGZE 1HR0E 5LMUM 4NXNE 2YTDA 4B7FA 2BQ8X 3H4MA 4LZZA 2R17A 1NO1A 2L09A 1T4NA 2MROB 3HHZA 2DAIA 2QCUA 5EXTA 1R7RA 3HU1A 1XXHA 1PDAA 2EPXA 1JQJC 3B9PA 1NV8A 3E7AA 1QAMA 2C5RA 5AC5A 2EJSA 2Y0TA 4KHPE 4DR2E 2V8QB 4R2RA 3KP1E 2EM2A 4W5WA 1X47A 1QYRA 5DNYA 2EMYA 1X48A 3ILKA 2ZM6E 2O01F 4LF4M 1I4WA 4I8OA 2HHHM 4KZSA 3GQ4A 2XZUA 4V0WA 1IBME 4A3VB 2DVWB 4LF8E 3GLIB 4AQYM 4DR5M 2YTFA 2HCBA 3E0JA 4FK5C 5GTUA 1GTKA 1S3LA 2ZTDA 4WWLA 3HU3A 3A46A 4TUIA 2JOGA 3KSXA 2DAMA 3KZYA 4OX9M 2YTJA 3J7Yp 1GABA 4ZPXA 4YY3M 3FYCA 1PJQA 1AIPC 1L2BA 5IT9S 4KLNA 3EGHA 3GPUA 3C4BA 3LMLA 2ZBMA 1F4IA 2IAEC 2KW0A 1Q39A 5EP3A 1HQCA 3OTOE 2WCC3 1PGYA 3KSJA 3FUWA 3GPPA 2UXDM 2EMCA 1WGNA 1ZV1A 3R8FA 1ZBQA 4OVZA 1PRBA 2KNZA 3UMMA 3W67A 4BLCA 3HU2A 4EIWA 2NUEA 2X49A 1GO5A 3J81S 4LF7M 2FTXB 1F2IG 2KZSA 2H36X 2KEBA 3QFKA 2M5ZA 1GZ6A 2RTXA 5EQTA 5EXXA 4REZA 1YYWA 3KP0E 1IN6A 1NHGC 1NY5A 2XSZD 3KXEC 1XNQM 2L2DA 3AJIB 4N4RB 1Z6TA 4ZYGA 1GKIA 2R46A 3U61B 4X66M 1FNNA 4G4RA 2MDRA 4LJ5A 2EP3A 1TDHA 4L6V6 2E72A 1WAO1 2K0BX 1OI8A 1T43A 1WARA 4MGIE 3T38A 1HNZM 1VEKA 3L26A 4JI8E 4O4KA 3GLIA 2CSHA 3TL4X 2EL6A 2WSEF 3JTZA 3ZQJA 1QZMA 3SC3A 2Z7JA 2DIXA 2M4IA 3CGWA 2DWZB 4Q7JA 1G59A 3B89A 5C18A 2MDGA 2CT1A 4L16A 1S70A 2HWJA 3GRVA 4DV2E 3J2PB 2JY7A 2LE2A 2ENHA 2EOOA 4DV0M 4TUWA 1QDRA 3ECRA 2O8GA 1EKZA 2RGHA 3J80S 4F6NA 2V86A 2EM5A 4OR9A 1QUTA 4D81A 1IQOA 1KSFX 5KO3A 1YLAA 5FTMA 2K6BA 2LH0A 1DV0A 4LFCM 4YHHM 4JI4E 2R4EA 1SXJE 4RHBB 1OIZA 3HKPA 4R3DA 2W82A 4I81A 2NUGA 2RQLA 2K4VA 1SU1A 2EORA 3VHTB 4ZYDA 4UN2B 4XBOA 3U6SA 1OAIA 2KOUA 4O24A 4II7A 4FCTA 2F5PA 3C6KA 4BC9A 2EPCA 3V4YA 2KHHA 4F9CB 3QFNA 1L4SA 4BBYA 4Z6YA 5ITXA 3K6QA 3ADIA 3C6MA 4DV5M 1FKAE 5GKNA 4DR4M 1X6FA 3GLFB 4MOYA 2VQEM 1C7YA 1HNXM 2CWBA 3L27A 5JI2E 3H60A 1NEIA 1G41A 1X37A 3VK6A 4LZJA 3EIHA 1S8EA 4ITQA 2EE8A 4F6MA 1N75A 2LVHA 3PSNA 4DV1E 2JY9A 3BF2A 4F1IA 3F6GA 1HR0M 4NXNM 1OAOC 2HHHE 4NXMM 2D7HA 1W5TA 2P5TA 2WSFF 1GJSA 2JPAA 2XFSA 2LTRA 1T70A 2I7PA 2L6MA 2XZFA 1NJGA 3NBIA 1W24A 3EQ1A 3TQSA 4AQYE 4L4UA 3H64A 4MH0E 3C58A 5EXSA 5A6BD 1YE9A 4KHPM 4P7DA 4DR2M 1BB8A 4M0DA 1D2NA 2CV1A 3RGPA 5AE1A 3IHPA 4OX9E 3BIDA 1YZ9A 2V85A 2LTUA 2BCDA 1GJTA 2NQ8C 3JYFA 4LF6M 4UT2A 1KFVA 4K0KE 2ZM6M 1R6BX 4XPNA 3SHGB 2KONA 2VDBB 3FYDA 4R71A 2DXLA 3I01M 1IBMM 4BHCA 4LF8M 4P78A 2UXDE 1MF8A 3IWCA 2DZLA 3T15A 4MGKE 2LVNC 4ZVZA 3SATA 2EN7A 5C1BA 2KZUA 2QQ8A 4B08A 2WSCF 1YSYA 2EWLA 2LHCA 1UILA 4R2PA 1XNRM 2ENAA 2D7GA 2V1CA 1PJTA 1BVSA 3SYKA 2JXPA 2EMAA 4WXDA 2CP8A 4IBEA 5A6BA 2EN6A 3GLHE 3OMLA 2Z3XA 2JY8A 4D80A 2BDXA 1G5BA 5KPTA 3GLFA 1DGHB 4FBWA 2UUBM 2CRUA 4IBJA 1A1FA 2D9HA 2C99A 3KWRA 1AUAA 4WPYA 1IFYA 2V88A 4TUGA 1J7KA 3MHSC 2L4FA 4X66E 1GLNA 4LJ6A 1WRJA 2YU5A 2WDDA 2QFRA 3K9PA 1E9SA 3T6PA 1HNZE 3EPJA 4NSRA 1J5EE 4X65E 4G6ZA 2HC5A 1EH8A 2BJVA 2KNVA 4V0XA 2GPIA 5JPEA 2C9CA 2YRHA 4X62E 2EOJA 1EH6A 3JU0A 2DAEA 2DLQA 2WZJA 3SAWA 3BBZA 2EOYA 2FFJA 2EN1A 3KW6A 4LFAM 1QVRA 1QNTA 2GLIA 2VQFM 3EPKA 1XXHB 4NSOB 1L1TA 1IN4A 2RGOA 2CHVA 4LY6A 4ANRA 2YRKA 1JR3A 3KOYE 3A42A 2YR0A 3FIGA 3KOWE 3ADLA 5KPZA 2QHOB 1KBPA 2EO2A 1N78A 3T1IA 5LMNE 3JR5A 2LJHA 4I5LC 1TH2A 3TQMA 3EIEA 2IE4C 2EPAA 4G4QA 4I4LA 1YYKA 4JI5M 3D03A 4DUYE 4DHLA 4DV2M 4GHAA 2K47A 2A25A 2L7HA 3RQZA 3FE3A 4H1SA 1DGHA 5AE2A 3U6OA 1EH7A 1SFEA 2MH8A 3HJQA 1N34E 1QQWA 1UFZA 2JY6B 1MJGM 2LUPB 3FRIA 4JI4M 2CV0A 4RKUF 4L8NA 4DR4E 1T38A 2YT4A 2CV9A 2EM7A 4F2JC 3GLFE 4JXJA 5AC4A 3TWKA 1TDZA 3LVVA 1N3GA 2LJUA 1L1ZA 2G8LA 3VFDA 4HTGA 1QDTA 2EPNA 3ZH9B 5T6JA 5IV8B 3MK6A 2ZANA 2DMIA 1E32A 2ZOAA 1VEGA 3RL4A 3SBJA 2BJWA 3K7VC 4NXME 2EPKX 2C9OA 4R7GA 1CUKA 2KXEA 4AG6A 1TF6A 4G4OA 2QNJA 2LVOC 4CISA 2QBYB 2CFOA 4NHRA 1Z2XA 4LF9M 2YTGA 4LFBM 2V83A 3H68A 3FUVA 4OU7A 3M99B 1X6EA 3QFOA 1WHCA 1UM8A 4GKJM 4DV7M 4ZYHA 1NHWC 2LWXA 4LF6E 1RQ0A 4GC9A 4JI3M 2DENA 4DV1M 2YZTA 4S12A 5EP2A 3AOGA 2YVTA 2JZ1A 2QENA 2DWLA 3WHLA 5EP4A 2EOQA 1JK2A 2I13A 2Y21A 4O43A 1SXJD 1JR3E 4WX9A 2ODRD 1QZEA 2BNKA 3SHFA 5IREB 4L78A 4DUZM 1XNRE 4WURA 4M0WA 2QFPA 2YTOA 4QHSA 4BC7A 3IECA 2JZ0A 2HAKA 5F3WA 4AZFA 4K0KM 1LTMA 3DF6A 4KBPA 3L25A 3C4TA 3VKHA 3DJWA 3NWLA 1HT1E 1XZWA 1ZMUA 3IB8A 1TN9A 3GPXA 2FE8A 3LQQA 4NZVA 2UUBE 3RL5A 3M0EA 2L2MA 4M0VA 2WBSA 3FUUA 2USHA 4Q35B 1OIEA 1XC8A 1QANA 3C9PA 5FLXS 4LACC 3GRRA 5IWAM 1I94E 1S3NA 1JK1A 1QU6A 3SYLA 2DMYA 2UXCE 3ZTVA 3BOSA 2L3CA 1TCOA 4FCXA 2Z4RA 3LLHA 2OPFA 4DKKA 2Q2EB 3MJ5A 1IBLM 4FVMA 2QBYA 2DRPA 1AAYA 4MLQA 4Z8XA 1VG5A 1IQSA 4LGMA 4Q7FA 1RU3A 4PCZA 2QP9X 2L7IA 2ZTCA 1S3MA 2DXNA 2R6FA 1A1LA 2DSYA 3WHKA 2EPLX 1ZQ9A 4LFAE 4DR1E 3GLGA 5KL5A 3U6LA 4LJ8A 1ZR9A 2VQFE 4CHTB 1XXHE 1RMDA 4QNRA 1R5LA 1VDLA 1Q3BA 4DSYA 2O8AA 2Y20A 4CGYB 1J5EM 4X65M 1HNWM 4X8WA 5A2QC 2MJ5B 1WJPA 2JUJA 4X62M 1ZMVA 2G5GX 2CE7A 3DZDA 2EL4A 2RSIA 2LHGA 4H2FA 4G9JA 1V73A 2EPUA 3GP1A 4V0VA 4DV4M 2BWEA 4D82A 2L3JA 4B7GA 4DV6M 3AOEC 4QOZC 3E4RA 3U6CA 1Z5BA 4JI5E 2LVAA 5BPVA 2ELYA 3HJ8A 2Q8UA 1V34A 3MHVC 2XSZA 3VK7A 1N36E 1YUJA 3SASA 3E9SA 5J28A 4F54A 2NPPC 2X4AA 1J26A 3A98B 4O5GA 3H09A 4WSGA 4R2DA 1QAOA 4X64M 2RS7A 4RF0A 1L8QA 4BB9A 5LMNM 2LV2A 4RF1A
chains in the Genus database with same CATH topology
3FD9A 2JOXA 2JVAA 3I4VA 4DUYM 4PDGA 2UUCE 3W0LB 1Q3CA 1TH3A 2Z72A 3R9XB 4UT3B 5AASA 3Q8XA 3I51A 5E26A 3TWLA 2GJUA 5H37D 1N33M 1N34M 1G8PA 2IHR1 4B7HA 2ZAOA 5FLXC 2EA0A 3C5WC 1PJIA 2LTSA 3CF6E 2XMOA 4AI6A 4LF9E 4LFBE 3J7AG 4MP0A 3W0FA 2DZNB 5FTNA 2YQZA 4GKJE 4DV7E 3VK8A 1C1KA 4JI3E 4BBAA 4B2OA 2E1MA 4F9BB 2R18A 3IWBA 4DR3E 1WXRA 4IBBA 3VYYA 3UGJA 2FOIC 3PVSA 5AE3A 3SFZA 4GEQB 4LJ7A 3RGSA 1MX0A 4GH9A 3HTXA 1SXJC 4J8ZA 2ODRC 3GRYA 5ADZA 4DUZE 3CF2A 4JI2E 1NNUC 1IXZA 4F0ZA 4M9ZA 1HPUA 3PFIA 4PDIA 2E5LE 1TGUA 2F8BA 4UWQA 3H63A 4KODA 4B3SM 3MSWA 2LBSB 2L6OA 2KRKA 4UT3A 1KYIA 2JWOA 1IM2A 4IBDA 5IWAE 2N3GA 2YEQA 3RMPA 2XEPA 2G7HA 5BR8E 3SMPA 4GKKM 2P6BA 5INBA 4OW0A 5CFFE 5ITYA 2FGGA 1USHA 1GQEA 1IBLE 2UUAE 3P1XA 1HT2E 1S3SA 3HPSA 2RKOA 4M9XA 3T1YE 1H6UA 5ITXE 3K7WC 1NY6A 2NUFA 1I94M 3VKGA 2XGNA 2LRSA 3U6DA 2UXCM 2LNHC 1ZBTA 1X49A 1HQYE 1HNWE 4LG2A 2DWNA 3ZCBB 3ZC7B 2F4VE 3HJSA 4DV4E 4JA7A 4IYPC 2QPAA 4DV6E 4DR6E 3GPYA 3U6QA 4DR1M 2EUCA 2CPNA 3GQ3A 1IXSB 2XF3A 3KBPA 4LJ4A 4LF5M 4WYQB 4ZX2A 4DT2A 5JPFA 2VIIA 4L5NC 1WHNA 1TH4A 2V89A 2NXFA 2L2KB 2WDCA 1N32E 3ZU0A 4X64E 2IE3C 5DYIA 3RE8A 1IBKE 4H2GA 2DHRA 3HHWA 2DFJA 2J7OA 4GITA 1OFHA 5EXPA 1T4OA 4PD2A 4ORBA 4G4NA 3VYXA 5IOHA 4OOGC 2R65A 2NYMC 1N36M 2JA2A 1GL6A 2CV2A 1DGGA 7CATA 1N33E 3RL3A 3U5ZB 1DGFA 2ERCA 3RFWA 4IBGA 4MB7A 3JAMS 3KVWA 3N5UA 4Q28A 1L2DA 2XFTA 1PJJA 4IBFA 2FNAA 1W5SA 3AOEA 2UUCM 1Z2WA 1NSFA 5E6JA 1DGBA 2D7EA 3D8BA 4FWDA 2L2NA 2NYLC 4MOVA 3FGAC 2CHGA 1SXJB 3T1HM 4B3TE 4HLQA 4JA9A 4MGHA 3H67A 2N3HA 3C9FA 1UHZA 1DQ3A 2QJCA 1RC7A 5A2QS 4FBKA 2B9DA 3U60B 1G3IA 4HL4A 3UJNA 4GHLA 3CTWB 4JN6A 4NRVA 2V87A 2HYOA 3GLGB 4LRTA 4AKGA 4PT5A 2L33A 4DR3M 2X8AA 4IBKA 3M6AA 1NVMA 3LL8A 2XLJA 5FTKA 2UU9E 3FUTA 4IJFA 1XWIA 3DSDA 2CEAA 4DV3E 1STUA 3L28A 4B3SE 2B3TB 4LRSA 4NL4H 3TGHA 3THOB 2F5NA 2R4JA 4FCWA 3HQ1A 4JI2M 1N77A 3TPZA 3DFZA 2E5LM 3U5ZA 4IIWA 4J6OA 1XMQE 3IVEA 3UZUA 3HHXA 4GKKE 4DR7E 3UK6A 2B7VA 4R03A 3L29A 1NJFA 2ZO9B 1GVNA 1FJGE 4KKZA 4BS9A 4WFTA 3HHYA 1K3WA 4JI1M 1SXJA 2H1RA 2V1UA 1II7A 3PNYA 8CATA 1ZAEA 2LMZA 4JYAE 4I5SA 5BR8M 3DA1A 4H2BA 3HWSA 3LVWA 1U32A 3LQRA 2KKNA 3JAMC 2V6ZM 4MM3B 3DOAA 2R62A 3AKZA 3FTCA 4AW4A 2B7TA 2UUAM 1XM7A 3U60A 2O5RA 1DO0A 2R45A 3GLHB 1UTEA 2JOBA 2KRUA 3T1YM 4M2ZA 2F5OA 3P71C 5B8IA 3SAUA 3AUZA 4HD0A 3GVEA 4FD2A 4LF5E 2DWMA 3IG8A 4GC5A 3ADJA 1QFCA 1T4LB 2WZOA 4AKIA 3THGA 3CF0A 4M30A 2HL7A 4B3RE 3SARA 2F4VM 2UXBM 1Z5CA 4YKEA 3HGIA 5ITTA 2HY1A 4GRIA 4DR6M 2KA6B 5HPEA 4NOOB 4FWGA 1L2CA 3QG5C 4QHTA 3AL0C 1XMOE 4JI0E 2DZOB 4M9SA 3K92A 1FJMA 4AG5A 1IY2A 1N32M 2QZ4A 4JI7E 1XHBA 5IZ7D 4IL1A 3VLFB 1IBKM 3PNVA 3THNA 3PSOA 3I4YA 5JI3E 3J27B 3DSCA 4L8RC 1S95A 1T71A 1G4AE 5ITUA 1ORYB 2J7NA 4LJAA 2C96A 3H66A 3HPZA 5IT9C 4FBQA 3T1HE 4JI6M 3GLHA 3K2LA 3A45A 2RSMA 4P16A 1T3TA 4B3MM 4JV5M 2FV4B 2OQ4A 4GIPA 3K1JA 5LMUE 3SAVA 2VE7C 3U61A 1OIDA 3IWDA 1E94E 3HVQA 2DXIA 1IT6A 4ORCA 3J7AS 2F5SA 1EE8A 5KPRA 3AFHA 5ITRA 2WDFA 3J81C 2A22A 4B3TM 1DO2A 2RS6A 2CHQA 4LCBA 2Y0QA 3KFUG 1K3XA 3QFMA 2AHMA 2CUZA 5DYGA 1Z59A 4LF4E 4MGYE 3LMMA 2LXEA 3GO8A 4DR5E 3U6EA 5KQDA 3PXGA 3K8ZA 2M1SA 3FKEA 3CK2A 3TWMA 1AUIA 2HKJA 1OFIA 2UU9M 1E9RA 4YY3E 3U6MA 4LJ9A 2EZ6A 4IBCA 1OJLA 1Z5AA 4DV3M 2ZBKB 4IBIA 2Z4SA 3GQ5A 4F9AB 3QAUA 3KDSE 3QWLA 3L2AA 3ICFA 4FCVA 4JI1E 1IXRC 3IB7A 2YFQA 1XMQM 4FWHA 5EP1A 3D8LA 4L15A 2YNMD 4DR7M 3FTFA 5EQVA 5FTJA 4WSPA 3J80C 1WXQA 4XGIA 5EJCA 4IJEA 3AV0A 1LV7A 1M63A 4LF7E 1FJGM 3J7BA 1VDDA 2AHDA 4I5NC 1IN7A 4QOSA 4BMJA 2XH9A 3OTOM 3KOZE 3KS8A 1WHQA 2HYPA 1YYOA 4JYAM 1IN8A 1XNQE 1IN5A 1O0WA 2MC5A 2JR1A 3DW8C 3FTEA 3KOXE 1JR3D 4LTYA 3IG5A 2WDEA 2Z06A 3FUXA 5ITQA 3F6HA 1PM5A 2UXBE 2I7NA 4GMQA 1HP1A 4H1YP 3TE6A 5FSWA 1NNWA 4BCAA 2KHXA 2A5YB 3VDPA 5KQ8A 2ZAMA 1PKPA 4NRWA 3GRUA 2NA2A 4LU9A 3JR4A 4B3RM 3FLOA 3IVDA 4KO8A 4RNAA 2L8TA 3M7GA 2L92A 3E7BA 5C1VA 4LGYA 5JJTA 4WW0A 2DB2A 4DV0E 2F5QA 4JI8M 1QAQA 2MC6A 1GL7A 2Z1AA 1IY0A 1XMOM 4JI0M 4ORAA 4LFCE 4YHHE 1J09A 4JI7M 4AKHA 4JI6E 3U6PA 3KS4A 1R2YA 3H69A 2M60A 3VDUA 1IY1A 1JK7A 3ZOQB 1IQPA 4B3ME 3ADGA 4JV5E 1MU5A 4QNMA 3EGGA 4DMIA 1DI2A 1R2ZA 1YUBA 2VF1A 1K82A 2M7QA 5FTLA 3H61A 4DV5E 1QHWA 1HO5A 3H62B 2VQEE 1NNJA 3FTDA 3SMSA 1HNXE 2LUQA 4FW9A 2C98A 1UF3A 3HXLA 4R8OA 4OVZB 4H2IA 1SR9A 5LL6R 4MGZE 1HR0E 5LMUM 4NXNE 4B7FA 2BQ8X 3H4MA 4LZZA 2R17A 2L09A 1T4NA 3HHZA 2QCUA 5EXTA 1R7RA 3HU1A 1XXHA 1JQJC 3B9PA 3E7AA 1QAMA 2C5RA 2Y0TA 4KHPE 4DR2E 2V8QB 3KP1E 4W5WA 1X47A 1QYRA 5DNYA 1X48A 3ILKA 2ZM6E 4LF4M 1I4WA 4I8OA 2HHHM 4KZSA 3GQ4A 2XZUA 4V0WA 1IBME 4A3VB 2DVWB 4LF8E 3GLIB 4AQYM 4DR5M 2HCBA 3E0JA 5GTUA 1S3LA 4WWLA 3HU3A 3A46A 4TUIA 2JOGA 3KSXA 4OX9M 3J7Yp 4ZPXA 4YY3M 3FYCA 1L2BA 5IT9S 4KLNA 3EGHA 3GPUA 3C4BA 3LMLA 2ZBMA 2IAEC 2KW0A 1Q39A 5EP3A 1HQCA 3OTOE 3KSJA 3FUWA 3GPPA 2UXDM 3R8FA 1ZBQA 4OVZA 3UMMA 4BLCA 3HU2A 4EIWA 2NUEA 2X49A 3J81S 4LF7M 2FTXB 2KZSA 2H36X 2KEBA 3QFKA 2M5ZA 1GZ6A 2RTXA 5EQTA 5EXXA 4REZA 1YYWA 3KP0E 1IN6A 1NHGC 1NY5A 2XSZD 3KXEC 1XNQM 3AJIB 1Z6TA 1GKIA 2R46A 3U61B 4X66M 1FNNA 4G4RA 2MDRA 4LJ5A 1TDHA 1WAO1 1OI8A 1WARA 4MGIE 3T38A 1HNZM 3L26A 4JI8E 4O4KA 3GLIA 3TL4X 3JTZA 1QZMA 3SC3A 2Z7JA 2DIXA 2M4IA 2DWZB 1G59A 5C18A 4L16A 1S70A 3GRVA 4DV2E 3J2PB 2LE2A 4DV0M 4TUWA 2O8GA 1EKZA 2RGHA 3J80S 2V86A 4OR9A 4D81A 1KSFX 5KO3A 5FTMA 2LH0A 4LFCM 4YHHM 4JI4E 2R4EA 1SXJE 3HKPA 4R3DA 2W82A 4I81A 2NUGA 2K4VA 1SU1A 4XBOA 3U6SA 2KOUA 4O24A 4II7A 4FCTA 2F5PA 4BC9A 3V4YA 4F9CB 3QFNA 4BBYA 4Z6YA 5ITXA 3K6QA 3ADIA 4DV5M 1FKAE 5GKNA 4DR4M 3GLFB 4MOYA 2VQEM 1HNXM 3L27A 5JI2E 3H60A 1G41A 1X37A 3VK6A 4LZJA 3EIHA 1S8EA 4ITQA 1N75A 3PSNA 4DV1E 2JY9A 3F6GA 1HR0M 4NXNM 2HHHE 4NXMM 2D7HA 1W5TA 2P5TA 2XFSA 2LTRA 1T70A 2I7PA 2L6MA 2XZFA 1NJGA 3NBIA 1W24A 4AQYE 3TQSA 4L4UA 3H64A 4MH0E 3C58A 5EXSA 1YE9A 4KHPM 4P7DA 4DR2M 4M0DA 1D2NA 2CV1A 3RGPA 5AE1A 4OX9E 1YZ9A 2V85A 2BCDA 2NQ8C 4UT2A 4LF6M 3JYFA 1KFVA 4K0KE 2ZM6M 1R6BX 4XPNA 3SHGB 2KONA 3FYDA 2DXLA 1IBMM 4P78A 1MF8A 4LF8M 2UXDE 3IWCA 3T15A 4MGKE 4ZVZA 3SATA 5C1BA 2KZUA 4B08A 1YSYA 2EWLA 1UILA 1XNRM 2D7GA 2V1CA 3SYKA 4IBEA 3OMLA 2Z3XA 4D80A 2BDXA 1G5BA 5KPTA 3GLFA 1DGHB 4FBWA 2UUBM 4IBJA 2C99A 3KWRA 4WPYA 2V88A 4TUGA 1J7KA 4X66E 1GLNA 4LJ6A 2WDDA 2QFRA 1E9SA 1HNZE 4NSRA 1J5EE 4X65E 4G6ZA 2BJVA 4V0XA 5JPEA 2C9CA 4X62E 3JU0A 3SAWA 2FFJA 3KW6A 4LFAM 1QVRA 2VQFM 1XXHB 4NSOB 1L1TA 1IN4A 2RGOA 2CHVA 4LY6A 1JR3A 3KOYE 3A42A 2YR0A 3FIGA 3KOWE 3ADLA 5KPZA 1KBPA 2EO2A 1N78A 3T1IA 5LMNE 3JR5A 2LJHA 4I5LC 1TH2A 3EIEA 2IE4C 4G4QA 4I4LA 1YYKA 4JI5M 3D03A 4DUYE 4DHLA 4DV2M 4GHAA 2K47A 2L7HA 3RQZA 4H1SA 1DGHA 5AE2A 3U6OA 3HJQA 1N34E 1QQWA 2LUPB 4JI4M 2CV0A 4L8NA 4DR4E 2YT4A 2CV9A 4JXJA 3TWKA 1TDZA 3LVVA 1L1ZA 2G8LA 3VFDA 3ZH9B 5T6JA 3MK6A 2ZANA 1E32A 2ZOAA 3RL4A 3SBJA 2BJWA 3K7VC 4NXME 2C9OA 4R7GA 2KXEA 4AG6A 4G4OA 4CISA 2QBYB 2CFOA 1Z2XA 4LF9M 4LFBM 2V83A 3H68A 3FUVA 4OU7A 3QFOA 1UM8A 4GKJM 4DV7M 1NHWC 2LWXA 4LF6E 1RQ0A 4GC9A 4JI3M 4DV1M 2YZTA 4S12A 5EP2A 3AOGA 2YVTA 2QENA 2DWLA 3WHLA 5EP4A 2Y21A 4O43A 1SXJD 2ODRD 2BNKA 3SHFA 5IREB 4L78A 4DUZM 1XNRE 4WURA 4M0WA 2QFPA 4QHSA 4BC7A 5F3WA 4AZFA 4K0KM 3DF6A 4KBPA 3L25A 3C4TA 3VKHA 3DJWA 3NWLA 1HT1E 1XZWA 3IB8A 3GPXA 2FE8A 3LQQA 2UUBE 4NZVA 3RL5A 3M0EA 2L2MA 4M0VA 3FUUA 2USHA 1OIEA 1XC8A 1QANA 5FLXS 4LACC 3GRRA 5IWAM 1I94E 1S3NA 1QU6A 3SYLA 2DMYA 2UXCE 3ZTVA 3BOSA 2L3CA 1TCOA 4FCXA 2Z4RA 3LLHA 2OPFA 4DKKA 2Q2EB 3MJ5A 1IBLM 4FVMA 2QBYA 4Z8XA 4LGMA 4Q7FA 4PCZA 2QP9X 2L7IA 1S3MA 2DXNA 2DSYA 3WHKA 1ZQ9A 4LFAE 4DR1E 3GLGA 3U6LA 4LJ8A 2VQFE 4CHTB 4QNRA 1Q3BA 4DSYA 2O8AA 2Y20A 4CGYB 1J5EM 4X65M 1HNWM 4X8WA 5A2QC 4X62M 2G5GX 2CE7A 3DZDA 4H2FA 4G9JA 1V73A 3GP1A 4V0VA 4DV4M 4D82A 2L3JA 4B7GA 4DV6M 3AOEC 4QOZC 3E4RA 3U6CA 1Z5BA 4JI5E 5BPVA 3HJ8A 2Q8UA 3MHVC 2XSZA 3VK7A 1N36E 3SASA 3E9SA 5J28A 4F54A 2NPPC 2X4AA 1J26A 3A98B 4O5GA 3H09A 1QAOA 4X64M 2RS7A 4RF0A 1L8QA 4BB9A 5LMNM 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPE A;  2AHD A;  4I5N C;  4LAC C;  1Z2W A;  1S3N A;  4O24 A;  4ZVZ A;  4F0Z A;  3QG5 C;  3V4Y A;  3ZTV A;  4JA7 A;  1HPU A;  4IYP C;  1KBP A;  2NYL C;  4MOV A;  3H69 A;  1TCO A;  2HYP A;  3FGA C;  3QFN A;  1Z2X A;  4V0W A;  3T1I A;  4UWQ A;  1FJM A;  1JK7 A;  4FCX A;  4KKZ A;  1WAO 1;  3H68 A;  1OI8 A;  3H63 A;  3QFM A;  3DW8 C;  4I5L C;  4JA9 A;  1WAR A;  3QFO A;  4LTY A;  3EGG A;  4IL1 A;  2Z72 A;  2IE4 C;  3H67 A;  3KBP A;  4Q7F A;  5GTU A;  4MOY A;  2WDE A;  4ZX2 A;  4O4K A;  2Z06 A;  3C9F A;  4UT3 B;  1S3L A;  4DT2 A;  1II7 A;  5JPF A;  1S3M A;  4WWL A;  4TUI A;  2BDX A;  2JOG A;  1G5B A;  2QJC A;  3H60 A;  2NXF A;  2YVT A;  4FBK A;  4DHL A;  3THN A;  2WDC A;  3PSO A;  4UT3 A;  2GJU A;  3H61 A;  3ZU0 A;  1HP1 A;  4H2B A;  1U32 A;  4FBW A;  2KKN A;  1QHW A;  1S8E A;  4H1Y P;  1HO5 A;  2IE3 C;  4O43 A;  3H62 B;  3RQZ A;  3DSC A;  3EGH A;  2ZBM A;  4H1S A;  4H2G A;  3PSN A;  2IAE C;  4DSY A;  1XM7 A;  2O8A A;  1AUI A;  1NNW A;  1S70 A;  1S95 A;  2DFJ A;  3CK2 A;  3C5W C;  1T71 A;  4TUG A;  2HYO A;  4ORB A;  2XMO A;  2P6B A;  3H66 A;  1UTE A;  5INB A;  1UF3 A;  5IOH A;  3P71 C;  2QFP A;  5B8I A;  1T70 A;  1USH A;  4H2F A;  4G9J A;  1V73 A;  1W24 A;  4FBQ A;  4MP0 A;  2WDD A;  2QFR A;  3H64 A;  3AUZ A;  2O8G A;  2NYM C;  4H2I A;  5F3W A;  4HD0 A;  4V0V A;  3LL8 A;  4LU9 A;  3GVE A;  3ICF A;  2CV9 A;  4KBP A;  4OR9 A;  2BQ8 X;  3IVD A;  2R17 A;  4V0X A;  3DSD A;  3IB7 A;  4B2O A;  3E7B A;  5JPE A;  1QFC A;  5C1V A;  1XZW A;  5JJT A;  3K7W C;  2Q8U A;  2BCD A;  3TGH A;  3THO B;  3RL3 A;  3JYF A;  3IB8 A;  4UT2 A;  3E7A A;  5J28 A;  2NPP C;  4NZV A;  3QFK A;  3RL5 A;  5EQV A;  4O5G A;  4XPN A;  1OID A;  4M0V A;  2Z1A A;  3N5U A;  4YKE A;  2USH A;  1OIE A;  3HVQ A;  2HY1 A;  3RL4 A;  4J6O A;  3AV0 A;  1IT6 A;  4ORC A;  1SU1 A;  3IVE A;  3K7V C;  1M63 A;  5DNY A;  4ORA A;  2WDF A;  1MF8 A;  2A22 A; 
#chains in the Genus database with same CATH topology
 4XK8 F;  1TF0 B;  1LLM C;  5A6K A;  2EN3 A;  3C3D A;  3FD9 A;  2YTE A;  2JOX A;  2JVA A;  3I4V A;  2EPR A;  2EQ3 A;  4DUY M;  4PDG A;  1BBO A;  2UUC E;  3W0L B;  1Q3C A;  1TH3 A;  2Z72 A;  3R9X B;  2H5X A;  2EM0 A;  1X5W A;  4UT3 B;  2EJ4 A;  5AAS A;  3Q8X A;  3BGH A;  3I51 A;  5E26 A;  3TWL A;  2GJU A;  5H37 D;  1N33 M;  1N34 M;  3MMP A;  1G8P A;  2IHR 1;  1Z1B A;  4B7H A;  4F2L A;  2ZAO A;  2DHY A;  2MKD A;  2DI0 A;  5FLX C;  2EA0 A;  3C5W C;  2M9A A;  2EM3 A;  1PJI A;  2LTS A;  3CF6 E;  5KL3 A;  2XMO A;  3B7N A;  4AI6 A;  1BBG A;  4LF9 E;  4LFB E;  3J7A G;  4MP0 A;  1A1H A;  2EM6 A;  1IMU A;  3W0F A;  2DZN B;  2WBU A;  5FTN A;  2YQZ A;  3QYB A;  4GKJ E;  4DV7 E;  3V76 A;  3VK8 A;  1C1K A;  1SG9 A;  4BBA A;  2OOA A;  4JI3 E;  4B2O A;  1NCS A;  2E1M A;  4F9B B;  2R18 A;  3B7Q A;  3IWB A;  4DR3 E;  1WXR A;  4IBB A;  3VYY A;  3UGJ A;  2FOI C;  4RH8 A;  3PVS A;  5AE3 A;  3SFZ A;  4GEQ B;  3GLI E;  4LJ7 A;  3RGS A;  1MX0 A;  4GH9 A;  1EFU B;  4P17 A;  3HTX A;  1SXJ C;  3KZZ A;  1Q02 A;  4J8Z A;  2ODR C;  3GRY A;  5ADZ A;  3B7Z A;  4DUZ E;  2DGC A;  3CF2 A;  4JI2 E;  1NNU C;  1IXZ A;  1JB0 F;  4F0Z A;  4M9Z A;  1HPU A;  4DBG B;  3PFI A;  4PDI A;  2E5L E;  1TGU A;  2J5Y A;  2LCE A;  2F8B A;  4UWQ A;  1TR8 A;  2EKF A;  3H63 A;  1T6O A;  1MN3 A;  2EOX A;  4KOD A;  4B3S M;  3MSW A;  2LBS B;  1A1G A;  1B69 A;  2L6O A;  2KRK A;  4UT3 A;  1KYI A;  3MHH C;  2JWO A;  3Q8G A;  3BXW A;  1IM2 A;  4IBD A;  5IWA E;  2N3G A;  2JXN A;  2YEQ A;  3RMP A;  2XEP A;  2G7H A;  5BR8 E;  3SMP A;  4GKK M;  1YUI A;  2P6B A;  5INB A;  2EQ1 A;  4OW0 A;  5CFF E;  5ITY A;  4IJD A;  2FGG A;  1USH A;  1GQE A;  2RPC A;  4GEW A;  1IBL E;  2UUA E;  3P1X A;  1HT2 E;  1A5T A;  2BBG A;  2YTI A;  1S3S A;  3HPS A;  2RKO A;  5KL7 A;  4M9X A;  3T1Y E;  1H6U A;  4HEO A;  5ITX E;  3K7W C;  1NY6 A;  2NUF A;  3LW5 F;  1I94 M;  3VKG A;  2I9I A;  2YU8 A;  2XGN A;  2LRS A;  3U6D A;  2UXC M;  2LNH C;  1ZBT A;  1X49 A;  1HQY E;  1HNW E;  4LG2 A;  3QYE A;  2DWN A;  2EOH A;  3ZCB B;  3ZC7 B;  2F4V E;  3HJS A;  4CJ6 A;  4DV4 E;  4JA7 A;  4IYP C;  5KL4 A;  2QPA A;  4DV6 E;  4DR6 E;  3GPY A;  3U6Q A;  4DR1 M;  2EUC A;  2CPN A;  3GQ3 A;  1IXS B;  2XF3 A;  5KL2 A;  3KBP A;  4LJ4 A;  4LF5 M;  4WYQ B;  4ZX2 A;  1G71 A;  2YSP A;  4DT2 A;  5JPF A;  2VII A;  4L5N C;  1WHN A;  1TH4 A;  1YFH A;  2V89 A;  2NXF A;  2L2K B;  2WDC A;  1N32 E;  3ZU0 A;  3HZJ A;  2APL A;  4X64 E;  2EQ0 A;  2YTN A;  2IE3 C;  5DYI A;  3RE8 A;  1IBK E;  4H2G A;  5TSE A;  2J7J A;  2DHR A;  3HHW A;  2DFJ A;  2J7O A;  4GIT A;  1OFH A;  4CIZ A;  1WGL A;  5DFL A;  5EXP A;  1T4O A;  4PD2 A;  4ORB A;  4G4N A;  3VYX A;  3EPL A;  5IOH A;  4OOG C;  2R65 A;  2NYM C;  3F92 A;  1N36 M;  4R2A A;  1Y8G A;  2EPP A;  4ZYE A;  2JA2 A;  1GL6 A;  1P3Q Q;  2O25 A;  2DAK A;  2CV2 A;  4X9J A;  1DGG A;  4G3O A;  7CAT A;  1N33 E;  3RL3 A;  4IS1 C;  3HX3 A;  3U5Z B;  1DGF A;  2ERC A;  3RFW A;  4IBG A;  4MB7 A;  3JAM S;  3KVW A;  3N5U A;  4Q28 A;  1L2D A;  2XFT A;  1PJJ A;  4IBF A;  2FNA A;  1VQ1 A;  1W5S A;  3AOE A;  2UUC M;  1Z2W A;  2BB8 A;  2DNA A;  1NSF A;  5E6J A;  1DGB A;  2D7E A;  3D8B A;  4FWD A;  4KWY A;  2N8X A;  1R4G A;  2L2N A;  2NYL C;  4MOV A;  5L8R F;  1OTR A;  3FGA C;  1UN6 B;  2CHG A;  1SXJ B;  3T1H M;  4B3T E;  4HLQ A;  4JA9 A;  2YTP A;  4MGH A;  3H67 A;  2N3H A;  3C9F A;  2JWS A;  1UHZ A;  1YSA C;  1DQ3 A;  1IXS A;  1NV9 A;  2QJC A;  1RC7 A;  5A2Q S;  4FBK A;  2HGH A;  2VF8 A;  2B9D A;  3U60 B;  1G3I A;  2R76 A;  2EMZ A;  2BWB A;  4HL4 A;  3UJN A;  4GHL A;  3CTW B;  4JN6 A;  4NRV A;  2V87 A;  2HYO A;  3GLG B;  1QUS A;  2VRD A;  4LRT A;  4AKG A;  4PT5 A;  2WBT A;  2L33 A;  4DR3 M;  1DGC A;  2X8A A;  4IBK A;  3M6A A;  1NVM A;  3LL8 A;  2XLJ A;  5FTK A;  2UU9 E;  3FUT A;  4IJF A;  1XWI A;  3DSD A;  2YSO A;  2CEA A;  4DV3 E;  1STU A;  3L28 A;  4B3S E;  2B3T B;  4LRS A;  1KJK A;  2R0I A;  4NL4 H;  2OO9 A;  3TGH A;  3THO B;  2F5N A;  2R4J A;  4FCW A;  3HQ1 A;  4JI2 M;  1N77 A;  3TPZ A;  3BBG A;  2YRM A;  3DFZ A;  2E5L M;  3U5Z A;  4IIW A;  3NBX X;  1X3C A;  4J6O A;  1KYQ A;  1XMQ E;  3IVE A;  3UZU A;  2FS1 A;  2EKK A;  3HHX A;  4GKK E;  2MGW A;  4DR7 E;  3UK6 A;  2MR9 A;  1MGT A;  2B7V A;  4R03 A;  3L29 A;  1D0K A;  1NJF A;  2EMX A;  2ZO9 B;  3E21 A;  4MLV A;  1GVN A;  1FJG E;  4KKZ A;  2ELZ A;  4BS9 A;  4WFT A;  1A1K A;  3HHY A;  2NAB A;  1MEY C;  1K3W A;  4JI1 M;  1SXJ A;  2H1R A;  2YWQ A;  2KDL A;  2V1U A;  1II7 A;  3PNY A;  8CAT A;  2EPZ A;  1ZAE A;  2EL5 A;  2LMZ A;  4JYA E;  2EOI A;  4I5S A;  5BR8 M;  3DA1 A;  4H2B A;  3HWS A;  3LVW A;  1U32 A;  3LQR A;  2KKN A;  3JAM C;  2V6Z M;  4MM3 B;  3DOA A;  2R62 A;  3AKZ A;  2EOZ A;  3FTC A;  4AW4 A;  2B7T A;  2UUA M;  1XM7 A;  2EN2 A;  3U60 A;  3UK3 C;  2O5R A;  2EMF A;  1DO0 A;  2EOS A;  2R45 A;  3GLH B;  1UTE A;  2JOB A;  2KRU A;  3T1Y M;  4M2Z A;  2F5O A;  3P71 C;  5B8I A;  3SAU A;  3AUZ A;  4HD0 A;  3I04 M;  3GVE A;  1WJ7 A;  4FD2 A;  4LF5 E;  2DWM A;  2RRU A;  3IG8 A;  4R2C A;  4GC5 A;  3ADJ A;  1QFC A;  3L00 A;  2EMW A;  1T4L B;  2EM4 A;  4AKI A;  3THG A;  2WZO A;  2MKN A;  2DAG A;  3CF0 A;  4M30 A;  2HL7 A;  1UBD C;  2B3T A;  4B3R E;  3SAR A;  2F4V M;  2UXB M;  4GZN C;  1Z5C A;  4YKE A;  3HGI A;  5ITT A;  2HY1 A;  4GRI A;  2EOF A;  4DR6 M;  2KA6 B;  5HPE A;  1AH5 A;  4NOO B;  4FWG A;  1L2C A;  3QG5 C;  5A6A A;  2EMH A;  4QHT A;  3C3E A;  3AL0 C;  1XMO E;  4JI0 E;  2DZO B;  4M9S A;  1YPN A;  3K92 A;  1FJM A;  4AG5 A;  1IY2 A;  1N32 M;  2QZ4 A;  4M9V C;  2R1F A;  3EPH A;  4JI7 E;  1XHB A;  5IZ7 D;  4IL1 A;  1D0L A;  3VLF B;  2JP7 A;  1IBK M;  3PNV A;  3THN A;  3PSO A;  3I4Y A;  2G3Q A;  3FRH A;  5JI3 E;  3J27 B;  4R2E A;  1A1I A;  3DSC A;  4L8R C;  2LT7 A;  1S95 A;  5LLQ A;  1T71 A;  1G4A E;  5ITU A;  1ORY B;  2JNH A;  2J7N A;  4LJA A;  2C96 A;  3H66 A;  3HPZ A;  2FH0 A;  2EN8 A;  5IT9 C;  4FBQ A;  3T1H E;  4JI6 M;  2EM8 A;  3GLH A;  3K2L A;  3A45 A;  2LO3 A;  2K9D A;  2LVQ D;  4P16 A;  2RSM A;  1T3T A;  4B3M M;  4JV5 M;  5KL6 A;  2FV4 B;  1A1J A;  2EML A;  2OQ4 A;  4GIP A;  3K1J A;  5LMU E;  3SAV A;  2VE7 C;  3U61 A;  2EOE A;  1OID A;  3IWD A;  1E94 E;  3HVQ A;  2EOM A;  2DXI A;  1IT6 A;  1D0M A;  4ORC A;  3J7A S;  2F5S A;  1EE8 A;  5KPR A;  3AFH A;  2JYA A;  5ITR A;  2WDF A;  3GLG E;  3J81 C;  2A22 A;  4B3T M;  1DO2 A;  1X6H A;  1P47 A;  2RS6 A;  2CHQ A;  4LCB A;  5IXM B;  2Y0Q A;  1OKS A;  4R2S A;  2ADR A;  1EIJ A;  3KFU G;  1K3X A;  1OIP A;  3QFM A;  2AHM A;  2CUZ A;  5DYG A;  3LCU A;  1Z59 A;  4LF4 E;  4R2Q A;  4MGY E;  2EN4 A;  3LMM A;  2LXE A;  3GO8 A;  4DR5 E;  3U6E A;  1V33 A;  5KQD A;  3PXG A;  3K8Z A;  1TF3 A;  2QSF X;  2M1S A;  3FKE A;  3CK2 A;  3TWM A;  5A6J A;  1AUI A;  2HKJ A;  1OFI A;  1G2D C;  2UU9 M;  1E9R A;  4YY3 E;  3U6M A;  4LJ9 A;  2EZ6 A;  4IBC A;  1OJL A;  1Z5A A;  4DV3 M;  2ZBK B;  4IBI A;  2Z4S A;  1V92 A;  3GQ5 A;  1ZU1 A;  4F9A B;  3QAU A;  1ZMW A;  2DLK A;  3KDS E;  3QWL A;  3L2A A;  2LBC A;  1OQY A;  2Z8Y M;  2N35 A;  1WR1 B;  2L4E A;  3ICF A;  4FCV A;  4JI1 E;  4KT0 F;  2VF7 A;  1ZAA C;  1IXR C;  1XB2 B;  3IB7 A;  2YFQ A;  1XMQ M;  4FWH A;  5EP1 A;  3HY5 A;  3D8L A;  4L15 A;  2LVP C;  2EPO A;  2YNM D;  4DR7 M;  4BHB A;  3FTF A;  5EQV A;  5FTJ A;  4WSP A;  3J80 C;  4WXC A;  1WXQ A;  4XGI A;  4HEI A;  5EJC A;  4IJE A;  3AV0 A;  1LV7 A;  1M63 A;  4LF7 E;  3B74 A;  1FJG M;  3J7B A;  1VDD A;  2AHD A;  4I5N C;  1IN7 A;  4QOS A;  4BMJ A;  1PJS A;  2XH9 A;  3OTO M;  3KOZ E;  3KS8 A;  1WHQ A;  2HYP A;  2EPM X;  1YYO A;  5A69 A;  4JYA M;  1IN8 A;  2GNO A;  1XNQ E;  1IN5 A;  1O0W A;  2MC5 A;  2JR1 A;  3DW8 C;  3FTE A;  4NC6 A;  3KOX E;  1JR3 D;  4LTY A;  2JY5 A;  3IG5 A;  2WDE A;  2Z06 A;  3E46 A;  3FUX A;  5ITQ A;  3F6H A;  1PM5 A;  2PRT A;  2UXB E;  2I7N A;  4GMQ A;  2EMK A;  1HP1 A;  4H1Y P;  3TE6 A;  5FSW A;  1NNW A;  4BCA A;  2KHX A;  2A5Y B;  3VDP A;  5KQ8 A;  1T39 A;  2EMI A;  2ZAM A;  3H4J A;  1TTE A;  1PKP A;  2JP9 A;  1G2F C;  4NRW A;  3GRU A;  2NA2 A;  4LU9 A;  2KNA A;  3JR4 A;  4B3R M;  3FLO A;  3IVD A;  4KO8 A;  4RNA A;  2L8T A;  3M7G A;  2L92 A;  3E7B A;  4WP2 A;  5C1V A;  4LGY A;  5JJT A;  4WW0 A;  2DB2 A;  4DV0 E;  2F5Q A;  4JI8 M;  2GHF A;  1QAQ A;  2MC6 A;  1GL7 A;  2Z1A A;  2DKL A;  1IY0 A;  1XMO M;  4JI0 M;  4ORA A;  4LFC E;  2EMB A;  4YHH E;  1J09 A;  2HJJ A;  4JI7 M;  4AKH A;  2YPN A;  1HJP A;  4JI6 E;  3U6P A;  3KS4 A;  1R2Y A;  3H69 A;  2M60 A;  3VDU A;  1IY1 A;  1JK7 A;  1VEJ A;  3ZOQ B;  1IQP A;  4B3M E;  2K7I A;  3ADG A;  4JV5 E;  1MU5 A;  4QNM A;  1WIV A;  3EGG A;  2EMG A;  4DMI A;  1DI2 A;  1R2Z A;  1YUB A;  2VF1 A;  1K82 A;  2M7Q A;  5FTL A;  2YTQ A;  3H61 A;  4DV5 E;  3K9O A;  1QHW A;  1HO5 A;  3H62 B;  2VQE E;  1NNJ A;  4Y28 F;  3FTD A;  3SMS A;  2OOB A;  3LCV B;  1HNX E;  2EM9 A;  2LUQ A;  2ENC A;  2R44 A;  4FW9 A;  3W68 A;  2C98 A;  1UF3 A;  3HXL A;  4R8O A;  4OVZ B;  2CTD A;  2GQF A;  4H2I A;  1SR9 A;  5LL6 R;  4MGZ E;  1HR0 E;  5LMU M;  4NXN E;  2YTD A;  4B7F A;  2BQ8 X;  3H4M A;  4LZZ A;  2R17 A;  1NO1 A;  2L09 A;  1T4N A;  2MRO B;  3HHZ A;  2DAI A;  2QCU A;  5EXT A;  1R7R A;  3HU1 A;  1XXH A;  1PDA A;  2EPX A;  1JQJ C;  3B9P A;  1NV8 A;  3E7A A;  1QAM A;  2C5R A;  5AC5 A;  2EJS A;  2Y0T A;  4KHP E;  4DR2 E;  2V8Q B;  4R2R A;  3KP1 E;  2EM2 A;  4W5W A;  1X47 A;  1QYR A;  5DNY A;  2EMY A;  1X48 A;  3ILK A;  2ZM6 E;  2O01 F;  4LF4 M;  1I4W A;  4I8O A;  2HHH M;  4KZS A;  3GQ4 A;  2XZU A;  4V0W A;  1IBM E;  4A3V B;  2DVW B;  4LF8 E;  3GLI B;  4AQY M;  4DR5 M;  2YTF A;  2HCB A;  3E0J A;  4FK5 C;  5GTU A;  1GTK A;  1S3L A;  2ZTD A;  4WWL A;  3HU3 A;  3A46 A;  4TUI A;  2JOG A;  3KSX A;  2DAM A;  3KZY A;  4OX9 M;  2YTJ A;  3J7Y p;  1GAB A;  4ZPX A;  4YY3 M;  3FYC A;  1PJQ A;  1AIP C;  1L2B A;  5IT9 S;  4KLN A;  3EGH A;  3GPU A;  3C4B A;  3LML A;  2ZBM A;  1F4I A;  2IAE C;  2KW0 A;  1Q39 A;  5EP3 A;  1HQC A;  3OTO E;  2WCC 3;  1PGY A;  3KSJ A;  3FUW A;  3GPP A;  2UXD M;  2EMC A;  1WGN A;  1ZV1 A;  3R8F A;  1ZBQ A;  4OVZ A;  1PRB A;  2KNZ A;  3UMM A;  3W67 A;  4BLC A;  3HU2 A;  4EIW A;  2NUE A;  2X49 A;  1GO5 A;  3J81 S;  4LF7 M;  2FTX B;  1F2I G;  2KZS A;  2H36 X;  2KEB A;  3QFK A;  2M5Z A;  1GZ6 A;  2RTX A;  5EQT A;  5EXX A;  4REZ A;  1YYW A;  3KP0 E;  1IN6 A;  1NHG C;  1NY5 A;  2XSZ D;  3KXE C;  1XNQ M;  2L2D A;  3AJI B;  4N4R B;  1Z6T A;  4ZYG A;  1GKI A;  2R46 A;  3U61 B;  4X66 M;  1FNN A;  4G4R A;  2MDR A;  4LJ5 A;  2EP3 A;  1TDH A;  4L6V 6;  2E72 A;  1WAO 1;  2K0B X;  1OI8 A;  1T43 A;  1WAR A;  4MGI E;  3T38 A;  1HNZ M;  1VEK A;  3L26 A;  4JI8 E;  4O4K A;  3GLI A;  2CSH A;  3TL4 X;  2EL6 A;  2WSE F;  3JTZ A;  3ZQJ A;  1QZM A;  3SC3 A;  2Z7J A;  2DIX A;  2M4I A;  3CGW A;  2DWZ B;  4Q7J A;  1G59 A;  3B89 A;  5C18 A;  2MDG A;  2CT1 A;  4L16 A;  1S70 A;  2HWJ A;  3GRV A;  4DV2 E;  3J2P B;  2JY7 A;  2LE2 A;  2ENH A;  2EOO A;  4DV0 M;  4TUW A;  1QDR A;  3ECR A;  2O8G A;  1EKZ A;  2RGH A;  3J80 S;  4F6N A;  2V86 A;  2EM5 A;  4OR9 A;  1QUT A;  4D81 A;  1IQO A;  1KSF X;  5KO3 A;  1YLA A;  5FTM A;  2K6B A;  2LH0 A;  1DV0 A;  4LFC M;  4YHH M;  4JI4 E;  2R4E A;  1SXJ E;  4RHB B;  1OIZ A;  3HKP A;  4R3D A;  2W82 A;  4I81 A;  2NUG A;  2RQL A;  2K4V A;  1SU1 A;  2EOR A;  3VHT B;  4ZYD A;  4UN2 B;  4XBO A;  3U6S A;  1OAI A;  2KOU A;  4O24 A;  4II7 A;  4FCT A;  2F5P A;  3C6K A;  4BC9 A;  2EPC A;  3V4Y A;  2KHH A;  4F9C B;  3QFN A;  1L4S A;  4BBY A;  4Z6Y A;  5ITX A;  3K6Q A;  3ADI A;  3C6M A;  4DV5 M;  1FKA E;  5GKN A;  4DR4 M;  1X6F A;  3GLF B;  4MOY A;  2VQE M;  1C7Y A;  1HNX M;  2CWB A;  3L27 A;  5JI2 E;  3H60 A;  1NEI A;  1G41 A;  1X37 A;  3VK6 A;  4LZJ A;  3EIH A;  1S8E A;  4ITQ A;  2EE8 A;  4F6M A;  1N75 A;  2LVH A;  3PSN A;  4DV1 E;  2JY9 A;  3BF2 A;  4F1I A;  3F6G A;  1HR0 M;  4NXN M;  1OAO C;  2HHH E;  4NXM M;  2D7H A;  1W5T A;  2P5T A;  2WSF F;  1GJS A;  2JPA A;  2XFS A;  2LTR A;  1T70 A;  2I7P A;  2L6M A;  2XZF A;  1NJG A;  3NBI A;  1W24 A;  3EQ1 A;  3TQS A;  4AQY E;  4L4U A;  3H64 A;  4MH0 E;  3C58 A;  5EXS A;  5A6B D;  1YE9 A;  4KHP M;  4P7D A;  4DR2 M;  1BB8 A;  4M0D A;  1D2N A;  2CV1 A;  3RGP A;  5AE1 A;  3IHP A;  4OX9 E;  3BID A;  1YZ9 A;  2V85 A;  2LTU A;  2BCD A;  1GJT A;  2NQ8 C;  3JYF A;  4LF6 M;  4UT2 A;  1KFV A;  4K0K E;  2ZM6 M;  1R6B X;  4XPN A;  3SHG B;  2KON A;  2VDB B;  3FYD A;  4R71 A;  2DXL A;  3I01 M;  1IBM M;  4BHC A;  4LF8 M;  4P78 A;  2UXD E;  1MF8 A;  3IWC A;  2DZL A;  3T15 A;  4MGK E;  2LVN C;  4ZVZ A;  3SAT A;  2EN7 A;  5C1B A;  2KZU A;  2QQ8 A;  4B08 A;  2WSC F;  1YSY A;  2EWL A;  2LHC A;  1UIL A;  4R2P A;  1XNR M;  2ENA A;  2D7G A;  2V1C A;  1PJT A;  1BVS A;  3SYK A;  2JXP A;  2EMA A;  4WXD A;  2CP8 A;  4IBE A;  5A6B A;  2EN6 A;  3GLH E;  3OML A;  2Z3X A;  2JY8 A;  4D80 A;  2BDX A;  1G5B A;  5KPT A;  3GLF A;  1DGH B;  4FBW A;  2UUB M;  2CRU A;  4IBJ A;  1A1F A;  2D9H A;  2C99 A;  3KWR A;  1AUA A;  4WPY A;  1IFY A;  2V88 A;  4TUG A;  1J7K A;  3MHS C;  2L4F A;  4X66 E;  1GLN A;  4LJ6 A;  1WRJ A;  2YU5 A;  2WDD A;  2QFR A;  3K9P A;  1E9S A;  3T6P A;  1HNZ E;  3EPJ A;  4NSR A;  1J5E E;  4X65 E;  4G6Z A;  2HC5 A;  1EH8 A;  2BJV A;  2KNV A;  4V0X A;  2GPI A;  5JPE A;  2C9C A;  2YRH A;  4X62 E;  2EOJ A;  1EH6 A;  3JU0 A;  2DAE A;  2DLQ A;  2WZJ A;  3SAW A;  3BBZ A;  2EOY A;  2FFJ A;  2EN1 A;  3KW6 A;  4LFA M;  1QVR A;  1QNT A;  2GLI A;  2VQF M;  3EPK A;  1XXH B;  4NSO B;  1L1T A;  1IN4 A;  2RGO A;  2CHV A;  4LY6 A;  4ANR A;  2YRK A;  1JR3 A;  3KOY E;  3A42 A;  2YR0 A;  3FIG A;  3KOW E;  3ADL A;  5KPZ A;  2QHO B;  1KBP A;  2EO2 A;  1N78 A;  3T1I A;  5LMN E;  3JR5 A;  2LJH A;  4I5L C;  1TH2 A;  3TQM A;  3EIE A;  2IE4 C;  2EPA A;  4G4Q A;  4I4L A;  1YYK A;  4JI5 M;  3D03 A;  4DUY E;  4DHL A;  4DV2 M;  4GHA A;  2K47 A;  2A25 A;  2L7H A;  3RQZ A;  3FE3 A;  4H1S A;  1DGH A;  5AE2 A;  3U6O A;  1EH7 A;  1SFE A;  2MH8 A;  3HJQ A;  1N34 E;  1QQW A;  1UFZ A;  2JY6 B;  1MJG M;  2LUP B;  3FRI A;  4JI4 M;  2CV0 A;  4RKU F;  4L8N A;  4DR4 E;  1T38 A;  2YT4 A;  2CV9 A;  2EM7 A;  4F2J C;  3GLF E;  4JXJ A;  5AC4 A;  3TWK A;  1TDZ A;  3LVV A;  1N3G A;  2LJU A;  1L1Z A;  2G8L A;  3VFD A;  4HTG A;  1QDT A;  2EPN A;  3ZH9 B;  5T6J A;  5IV8 B;  3MK6 A;  2ZAN A;  2DMI A;  1E32 A;  2ZOA A;  1VEG A;  3RL4 A;  3SBJ A;  2BJW A;  3K7V C;  4NXM E;  2EPK X;  2C9O A;  4R7G A;  1CUK A;  2KXE A;  4AG6 A;  1TF6 A;  4G4O A;  2QNJ A;  2LVO C;  4CIS A;  2QBY B;  2CFO A;  4NHR A;  1Z2X A;  4LF9 M;  2YTG A;  4LFB M;  2V83 A;  3H68 A;  3FUV A;  4OU7 A;  3M99 B;  1X6E A;  3QFO A;  1WHC A;  1UM8 A;  4GKJ M;  4DV7 M;  4ZYH A;  1NHW C;  2LWX A;  4LF6 E;  1RQ0 A;  4GC9 A;  4JI3 M;  2DEN A;  4DV1 M;  2YZT A;  4S12 A;  5EP2 A;  3AOG A;  2YVT A;  2JZ1 A;  2QEN A;  2DWL A;  3WHL A;  5EP4 A;  2EOQ A;  1JK2 A;  2I13 A;  2Y21 A;  4O43 A;  1SXJ D;  1JR3 E;  4WX9 A;  2ODR D;  1QZE A;  2BNK A;  3SHF A;  5IRE B;  4L78 A;  4DUZ M;  1XNR E;  4WUR A;  4M0W A;  2QFP A;  2YTO A;  4QHS A;  4BC7 A;  3IEC A;  2JZ0 A;  2HAK A;  5F3W A;  4AZF A;  4K0K M;  1LTM A;  3DF6 A;  4KBP A;  3L25 A;  3C4T A;  3VKH A;  3DJW A;  3NWL A;  1HT1 E;  1XZW A;  1ZMU A;  3IB8 A;  1TN9 A;  3GPX A;  2FE8 A;  3LQQ A;  4NZV A;  2UUB E;  3RL5 A;  3M0E A;  2L2M A;  4M0V A;  2WBS A;  3FUU A;  2USH A;  4Q35 B;  1OIE A;  1XC8 A;  1QAN A;  3C9P A;  5FLX S;  4LAC C;  3GRR A;  5IWA M;  1I94 E;  1S3N A;  1JK1 A;  1QU6 A;  3SYL A;  2DMY A;  2UXC E;  3ZTV A;  3BOS A;  2L3C A;  1TCO A;  4FCX A;  2Z4R A;  3LLH A;  2OPF A;  4DKK A;  2Q2E B;  3MJ5 A;  1IBL M;  4FVM A;  2QBY A;  2DRP A;  1AAY A;  4MLQ A;  4Z8X A;  1VG5 A;  1IQS A;  4LGM A;  4Q7F A;  1RU3 A;  4PCZ A;  2QP9 X;  2L7I A;  2ZTC A;  1S3M A;  2DXN A;  2R6F A;  1A1L A;  2DSY A;  3WHK A;  2EPL X;  1ZQ9 A;  4LFA E;  4DR1 E;  3GLG A;  5KL5 A;  3U6L A;  4LJ8 A;  1ZR9 A;  2VQF E;  4CHT B;  1XXH E;  1RMD A;  4QNR A;  1R5L A;  1VDL A;  1Q3B A;  4DSY A;  2O8A A;  2Y20 A;  4CGY B;  1J5E M;  4X65 M;  1HNW M;  4X8W A;  5A2Q C;  2MJ5 B;  1WJP A;  2JUJ A;  4X62 M;  1ZMV A;  2G5G X;  2CE7 A;  3DZD A;  2EL4 A;  2RSI A;  2LHG A;  4H2F A;  4G9J A;  1V73 A;  2EPU A;  3GP1 A;  4V0V A;  4DV4 M;  2BWE A;  4D82 A;  2L3J A;  4B7G A;  4DV6 M;  3AOE C;  4QOZ C;  3E4R A;  3U6C A;  1Z5B A;  4JI5 E;  2LVA A;  5BPV A;  2ELY A;  3HJ8 A;  2Q8U A;  1V34 A;  3MHV C;  2XSZ A;  3VK7 A;  1N36 E;  1YUJ A;  3SAS A;  3E9S A;  5J28 A;  4F54 A;  2NPP C;  2X4A A;  1J26 A;  3A98 B;  4O5G A;  3H09 A;  4WSG A;  4R2D A;  1QAO A;  4X64 M;  2RS7 A;  4RF0 A;  1L8Q A;  4BB9 A;  5LMN M;  2LV2 A;  4RF1 A; 
#chains in the Genus database with same CATH homology
 3FD9 A;  2JOX A;  2JVA A;  3I4V A;  4DUY M;  4PDG A;  2UUC E;  3W0L B;  1Q3C A;  1TH3 A;  2Z72 A;  3R9X B;  4UT3 B;  5AAS A;  3Q8X A;  3I51 A;  5E26 A;  3TWL A;  2GJU A;  5H37 D;  1N33 M;  1N34 M;  1G8P A;  2IHR 1;  4B7H A;  2ZAO A;  5FLX C;  2EA0 A;  3C5W C;  1PJI A;  2LTS A;  3CF6 E;  2XMO A;  4AI6 A;  4LF9 E;  4LFB E;  3J7A G;  4MP0 A;  3W0F A;  2DZN B;  5FTN A;  2YQZ A;  4GKJ E;  4DV7 E;  3VK8 A;  1C1K A;  4JI3 E;  4BBA A;  4B2O A;  2E1M A;  4F9B B;  2R18 A;  3IWB A;  4DR3 E;  1WXR A;  4IBB A;  3VYY A;  3UGJ A;  2FOI C;  3PVS A;  5AE3 A;  3SFZ A;  4GEQ B;  4LJ7 A;  3RGS A;  1MX0 A;  4GH9 A;  3HTX A;  1SXJ C;  4J8Z A;  2ODR C;  3GRY A;  5ADZ A;  4DUZ E;  3CF2 A;  4JI2 E;  1NNU C;  1IXZ A;  4F0Z A;  4M9Z A;  1HPU A;  3PFI A;  4PDI A;  2E5L E;  1TGU A;  2F8B A;  4UWQ A;  3H63 A;  4KOD A;  4B3S M;  3MSW A;  2LBS B;  2L6O A;  2KRK A;  4UT3 A;  1KYI A;  2JWO A;  1IM2 A;  4IBD A;  5IWA E;  2N3G A;  2YEQ A;  3RMP A;  2XEP A;  2G7H A;  5BR8 E;  3SMP A;  4GKK M;  2P6B A;  5INB A;  4OW0 A;  5CFF E;  5ITY A;  2FGG A;  1USH A;  1GQE A;  1IBL E;  2UUA E;  3P1X A;  1HT2 E;  1S3S A;  3HPS A;  2RKO A;  4M9X A;  3T1Y E;  1H6U A;  5ITX E;  3K7W C;  1NY6 A;  2NUF A;  1I94 M;  3VKG A;  2XGN A;  2LRS A;  3U6D A;  2UXC M;  2LNH C;  1ZBT A;  1X49 A;  1HQY E;  1HNW E;  4LG2 A;  2DWN A;  3ZCB B;  3ZC7 B;  2F4V E;  3HJS A;  4DV4 E;  4JA7 A;  4IYP C;  2QPA A;  4DV6 E;  4DR6 E;  3GPY A;  3U6Q A;  4DR1 M;  2EUC A;  2CPN A;  3GQ3 A;  1IXS B;  2XF3 A;  3KBP A;  4LJ4 A;  4LF5 M;  4WYQ B;  4ZX2 A;  4DT2 A;  5JPF A;  2VII A;  4L5N C;  1WHN A;  1TH4 A;  2V89 A;  2NXF A;  2L2K B;  2WDC A;  1N32 E;  3ZU0 A;  4X64 E;  2IE3 C;  5DYI A;  3RE8 A;  1IBK E;  4H2G A;  2DHR A;  3HHW A;  2DFJ A;  2J7O A;  4GIT A;  1OFH A;  5EXP A;  1T4O A;  4PD2 A;  4ORB A;  4G4N A;  3VYX A;  5IOH A;  4OOG C;  2R65 A;  2NYM C;  1N36 M;  2JA2 A;  1GL6 A;  2CV2 A;  1DGG A;  7CAT A;  1N33 E;  3RL3 A;  3U5Z B;  1DGF A;  2ERC A;  3RFW A;  4IBG A;  4MB7 A;  3JAM S;  3KVW A;  3N5U A;  4Q28 A;  1L2D A;  2XFT A;  1PJJ A;  4IBF A;  2FNA A;  1W5S A;  3AOE A;  2UUC M;  1Z2W A;  1NSF A;  5E6J A;  1DGB A;  2D7E A;  3D8B A;  4FWD A;  2L2N A;  2NYL C;  4MOV A;  3FGA C;  2CHG A;  1SXJ B;  3T1H M;  4B3T E;  4HLQ A;  4JA9 A;  4MGH A;  3H67 A;  2N3H A;  3C9F A;  1UHZ A;  1DQ3 A;  2QJC A;  1RC7 A;  5A2Q S;  4FBK A;  2B9D A;  3U60 B;  1G3I A;  4HL4 A;  3UJN A;  4GHL A;  3CTW B;  4JN6 A;  4NRV A;  2V87 A;  2HYO A;  3GLG B;  4LRT A;  4AKG A;  4PT5 A;  2L33 A;  4DR3 M;  2X8A A;  4IBK A;  3M6A A;  1NVM A;  3LL8 A;  2XLJ A;  5FTK A;  2UU9 E;  3FUT A;  4IJF A;  1XWI A;  3DSD A;  2CEA A;  4DV3 E;  1STU A;  3L28 A;  4B3S E;  2B3T B;  4LRS A;  4NL4 H;  3TGH A;  3THO B;  2F5N A;  2R4J A;  4FCW A;  3HQ1 A;  4JI2 M;  1N77 A;  3TPZ A;  3DFZ A;  2E5L M;  3U5Z A;  4IIW A;  4J6O A;  1XMQ E;  3IVE A;  3UZU A;  3HHX A;  4GKK E;  4DR7 E;  3UK6 A;  2B7V A;  4R03 A;  3L29 A;  1NJF A;  2ZO9 B;  1GVN A;  1FJG E;  4KKZ A;  4BS9 A;  4WFT A;  3HHY A;  1K3W A;  4JI1 M;  1SXJ A;  2H1R A;  2V1U A;  1II7 A;  3PNY A;  8CAT A;  1ZAE A;  2LMZ A;  4JYA E;  4I5S A;  5BR8 M;  3DA1 A;  4H2B A;  3HWS A;  3LVW A;  1U32 A;  3LQR A;  2KKN A;  3JAM C;  2V6Z M;  4MM3 B;  3DOA A;  2R62 A;  3AKZ A;  3FTC A;  4AW4 A;  2B7T A;  2UUA M;  1XM7 A;  3U60 A;  2O5R A;  1DO0 A;  2R45 A;  3GLH B;  1UTE A;  2JOB A;  2KRU A;  3T1Y M;  4M2Z A;  2F5O A;  3P71 C;  5B8I A;  3SAU A;  3AUZ A;  4HD0 A;  3GVE A;  4FD2 A;  4LF5 E;  2DWM A;  3IG8 A;  4GC5 A;  3ADJ A;  1QFC A;  1T4L B;  2WZO A;  4AKI A;  3THG A;  3CF0 A;  4M30 A;  2HL7 A;  4B3R E;  3SAR A;  2F4V M;  2UXB M;  1Z5C A;  4YKE A;  3HGI A;  5ITT A;  2HY1 A;  4GRI A;  4DR6 M;  2KA6 B;  5HPE A;  4NOO B;  4FWG A;  1L2C A;  3QG5 C;  4QHT A;  3AL0 C;  1XMO E;  4JI0 E;  2DZO B;  4M9S A;  3K92 A;  1FJM A;  4AG5 A;  1IY2 A;  1N32 M;  2QZ4 A;  4JI7 E;  1XHB A;  5IZ7 D;  4IL1 A;  3VLF B;  1IBK M;  3PNV A;  3THN A;  3PSO A;  3I4Y A;  5JI3 E;  3J27 B;  3DSC A;  4L8R C;  1S95 A;  1T71 A;  1G4A E;  5ITU A;  1ORY B;  2J7N A;  4LJA A;  2C96 A;  3H66 A;  3HPZ A;  5IT9 C;  4FBQ A;  3T1H E;  4JI6 M;  3GLH A;  3K2L A;  3A45 A;  2RSM A;  4P16 A;  1T3T A;  4B3M M;  4JV5 M;  2FV4 B;  2OQ4 A;  4GIP A;  3K1J A;  5LMU E;  3SAV A;  2VE7 C;  3U61 A;  1OID A;  3IWD A;  1E94 E;  3HVQ A;  2DXI A;  1IT6 A;  4ORC A;  3J7A S;  2F5S A;  1EE8 A;  5KPR A;  3AFH A;  5ITR A;  2WDF A;  3J81 C;  2A22 A;  4B3T M;  1DO2 A;  2RS6 A;  2CHQ A;  4LCB A;  2Y0Q A;  3KFU G;  1K3X A;  3QFM A;  2AHM A;  2CUZ A;  5DYG A;  1Z59 A;  4LF4 E;  4MGY E;  3LMM A;  2LXE A;  3GO8 A;  4DR5 E;  3U6E A;  5KQD A;  3PXG A;  3K8Z A;  2M1S A;  3FKE A;  3CK2 A;  3TWM A;  1AUI A;  2HKJ A;  1OFI A;  2UU9 M;  1E9R A;  4YY3 E;  3U6M A;  4LJ9 A;  2EZ6 A;  4IBC A;  1OJL A;  1Z5A A;  4DV3 M;  2ZBK B;  4IBI A;  2Z4S A;  3GQ5 A;  4F9A B;  3QAU A;  3KDS E;  3QWL A;  3L2A A;  3ICF A;  4FCV A;  4JI1 E;  1IXR C;  3IB7 A;  2YFQ A;  1XMQ M;  4FWH A;  5EP1 A;  3D8L A;  4L15 A;  2YNM D;  4DR7 M;  3FTF A;  5EQV A;  5FTJ A;  4WSP A;  3J80 C;  1WXQ A;  4XGI A;  5EJC A;  4IJE A;  3AV0 A;  1LV7 A;  1M63 A;  4LF7 E;  1FJG M;  3J7B A;  1VDD A;  2AHD A;  4I5N C;  1IN7 A;  4QOS A;  4BMJ A;  2XH9 A;  3OTO M;  3KOZ E;  3KS8 A;  1WHQ A;  2HYP A;  1YYO A;  4JYA M;  1IN8 A;  1XNQ E;  1IN5 A;  1O0W A;  2MC5 A;  2JR1 A;  3DW8 C;  3FTE A;  3KOX E;  1JR3 D;  4LTY A;  3IG5 A;  2WDE A;  2Z06 A;  3FUX A;  5ITQ A;  3F6H A;  1PM5 A;  2UXB E;  2I7N A;  4GMQ A;  1HP1 A;  4H1Y P;  3TE6 A;  5FSW A;  1NNW A;  4BCA A;  2KHX A;  2A5Y B;  3VDP A;  5KQ8 A;  2ZAM A;  1PKP A;  4NRW A;  3GRU A;  2NA2 A;  4LU9 A;  3JR4 A;  4B3R M;  3FLO A;  3IVD A;  4KO8 A;  4RNA A;  2L8T A;  3M7G A;  2L92 A;  3E7B A;  5C1V A;  4LGY A;  5JJT A;  4WW0 A;  2DB2 A;  4DV0 E;  2F5Q A;  4JI8 M;  1QAQ A;  2MC6 A;  1GL7 A;  2Z1A A;  1IY0 A;  1XMO M;  4JI0 M;  4ORA A;  4LFC E;  4YHH E;  1J09 A;  4JI7 M;  4AKH A;  4JI6 E;  3U6P A;  3KS4 A;  1R2Y A;  3H69 A;  2M60 A;  3VDU A;  1IY1 A;  1JK7 A;  3ZOQ B;  1IQP A;  4B3M E;  3ADG A;  4JV5 E;  1MU5 A;  4QNM A;  3EGG A;  4DMI A;  1DI2 A;  1R2Z A;  1YUB A;  2VF1 A;  1K82 A;  2M7Q A;  5FTL A;  3H61 A;  4DV5 E;  1QHW A;  1HO5 A;  3H62 B;  2VQE E;  1NNJ A;  3FTD A;  3SMS A;  1HNX E;  2LUQ A;  4FW9 A;  2C98 A;  1UF3 A;  3HXL A;  4R8O A;  4OVZ B;  4H2I A;  1SR9 A;  5LL6 R;  4MGZ E;  1HR0 E;  5LMU M;  4NXN E;  4B7F A;  2BQ8 X;  3H4M A;  4LZZ A;  2R17 A;  2L09 A;  1T4N A;  3HHZ A;  2QCU A;  5EXT A;  1R7R A;  3HU1 A;  1XXH A;  1JQJ C;  3B9P A;  3E7A A;  1QAM A;  2C5R A;  2Y0T A;  4KHP E;  4DR2 E;  2V8Q B;  3KP1 E;  4W5W A;  1X47 A;  1QYR A;  5DNY A;  1X48 A;  3ILK A;  2ZM6 E;  4LF4 M;  1I4W A;  4I8O A;  2HHH M;  4KZS A;  3GQ4 A;  2XZU A;  4V0W A;  1IBM E;  4A3V B;  2DVW B;  4LF8 E;  3GLI B;  4AQY M;  4DR5 M;  2HCB A;  3E0J A;  5GTU A;  1S3L A;  4WWL A;  3HU3 A;  3A46 A;  4TUI A;  2JOG A;  3KSX A;  4OX9 M;  3J7Y p;  4ZPX A;  4YY3 M;  3FYC A;  1L2B A;  5IT9 S;  4KLN A;  3EGH A;  3GPU A;  3C4B A;  3LML A;  2ZBM A;  2IAE C;  2KW0 A;  1Q39 A;  5EP3 A;  1HQC A;  3OTO E;  3KSJ A;  3FUW A;  3GPP A;  2UXD M;  3R8F A;  1ZBQ A;  4OVZ A;  3UMM A;  4BLC A;  3HU2 A;  4EIW A;  2NUE A;  2X49 A;  3J81 S;  4LF7 M;  2FTX B;  2KZS A;  2H36 X;  2KEB A;  3QFK A;  2M5Z A;  1GZ6 A;  2RTX A;  5EQT A;  5EXX A;  4REZ A;  1YYW A;  3KP0 E;  1IN6 A;  1NHG C;  1NY5 A;  2XSZ D;  3KXE C;  1XNQ M;  3AJI B;  1Z6T A;  1GKI A;  2R46 A;  3U61 B;  4X66 M;  1FNN A;  4G4R A;  2MDR A;  4LJ5 A;  1TDH A;  1WAO 1;  1OI8 A;  1WAR A;  4MGI E;  3T38 A;  1HNZ M;  3L26 A;  4JI8 E;  4O4K A;  3GLI A;  3TL4 X;  3JTZ A;  1QZM A;  3SC3 A;  2Z7J A;  2DIX A;  2M4I A;  2DWZ B;  1G59 A;  5C18 A;  4L16 A;  1S70 A;  3GRV A;  4DV2 E;  3J2P B;  2LE2 A;  4DV0 M;  4TUW A;  2O8G A;  1EKZ A;  2RGH A;  3J80 S;  2V86 A;  4OR9 A;  4D81 A;  1KSF X;  5KO3 A;  5FTM A;  2LH0 A;  4LFC M;  4YHH M;  4JI4 E;  2R4E A;  1SXJ E;  3HKP A;  4R3D A;  2W82 A;  4I81 A;  2NUG A;  2K4V A;  1SU1 A;  4XBO A;  3U6S A;  2KOU A;  4O24 A;  4II7 A;  4FCT A;  2F5P A;  4BC9 A;  3V4Y A;  4F9C B;  3QFN A;  4BBY A;  4Z6Y A;  5ITX A;  3K6Q A;  3ADI A;  4DV5 M;  1FKA E;  5GKN A;  4DR4 M;  3GLF B;  4MOY A;  2VQE M;  1HNX M;  3L27 A;  5JI2 E;  3H60 A;  1G41 A;  1X37 A;  3VK6 A;  4LZJ A;  3EIH A;  1S8E A;  4ITQ A;  1N75 A;  3PSN A;  4DV1 E;  2JY9 A;  3F6G A;  1HR0 M;  4NXN M;  2HHH E;  4NXM M;  2D7H A;  1W5T A;  2P5T A;  2XFS A;  2LTR A;  1T70 A;  2I7P A;  2L6M A;  2XZF A;  1NJG A;  3NBI A;  1W24 A;  4AQY E;  3TQS A;  4L4U A;  3H64 A;  4MH0 E;  3C58 A;  5EXS A;  1YE9 A;  4KHP M;  4P7D A;  4DR2 M;  4M0D A;  1D2N A;  2CV1 A;  3RGP A;  5AE1 A;  4OX9 E;  1YZ9 A;  2V85 A;  2BCD A;  2NQ8 C;  4UT2 A;  4LF6 M;  3JYF A;  1KFV A;  4K0K E;  2ZM6 M;  1R6B X;  4XPN A;  3SHG B;  2KON A;  3FYD A;  2DXL A;  1IBM M;  4P78 A;  1MF8 A;  4LF8 M;  2UXD E;  3IWC A;  3T15 A;  4MGK E;  4ZVZ A;  3SAT A;  5C1B A;  2KZU A;  4B08 A;  1YSY A;  2EWL A;  1UIL A;  1XNR M;  2D7G A;  2V1C A;  3SYK A;  4IBE A;  3OML A;  2Z3X A;  4D80 A;  2BDX A;  1G5B A;  5KPT A;  3GLF A;  1DGH B;  4FBW A;  2UUB M;  4IBJ A;  2C99 A;  3KWR A;  4WPY A;  2V88 A;  4TUG A;  1J7K A;  4X66 E;  1GLN A;  4LJ6 A;  2WDD A;  2QFR A;  1E9S A;  1HNZ E;  4NSR A;  1J5E E;  4X65 E;  4G6Z A;  2BJV A;  4V0X A;  5JPE A;  2C9C A;  4X62 E;  3JU0 A;  3SAW A;  2FFJ A;  3KW6 A;  4LFA M;  1QVR A;  2VQF M;  1XXH B;  4NSO B;  1L1T A;  1IN4 A;  2RGO A;  2CHV A;  4LY6 A;  1JR3 A;  3KOY E;  3A42 A;  2YR0 A;  3FIG A;  3KOW E;  3ADL A;  5KPZ A;  1KBP A;  2EO2 A;  1N78 A;  3T1I A;  5LMN E;  3JR5 A;  2LJH A;  4I5L C;  1TH2 A;  3EIE A;  2IE4 C;  4G4Q A;  4I4L A;  1YYK A;  4JI5 M;  3D03 A;  4DUY E;  4DHL A;  4DV2 M;  4GHA A;  2K47 A;  2L7H A;  3RQZ A;  4H1S A;  1DGH A;  5AE2 A;  3U6O A;  3HJQ A;  1N34 E;  1QQW A;  2LUP B;  4JI4 M;  2CV0 A;  4L8N A;  4DR4 E;  2YT4 A;  2CV9 A;  4JXJ A;  3TWK A;  1TDZ A;  3LVV A;  1L1Z A;  2G8L A;  3VFD A;  3ZH9 B;  5T6J A;  3MK6 A;  2ZAN A;  1E32 A;  2ZOA A;  3RL4 A;  3SBJ A;  2BJW A;  3K7V C;  4NXM E;  2C9O A;  4R7G A;  2KXE A;  4AG6 A;  4G4O A;  4CIS A;  2QBY B;  2CFO A;  1Z2X A;  4LF9 M;  4LFB M;  2V83 A;  3H68 A;  3FUV A;  4OU7 A;  3QFO A;  1UM8 A;  4GKJ M;  4DV7 M;  1NHW C;  2LWX A;  4LF6 E;  1RQ0 A;  4GC9 A;  4JI3 M;  4DV1 M;  2YZT A;  4S12 A;  5EP2 A;  3AOG A;  2YVT A;  2QEN A;  2DWL A;  3WHL A;  5EP4 A;  2Y21 A;  4O43 A;  1SXJ D;  2ODR D;  2BNK A;  3SHF A;  5IRE B;  4L78 A;  4DUZ M;  1XNR E;  4WUR A;  4M0W A;  2QFP A;  4QHS A;  4BC7 A;  5F3W A;  4AZF A;  4K0K M;  3DF6 A;  4KBP A;  3L25 A;  3C4T A;  3VKH A;  3DJW A;  3NWL A;  1HT1 E;  1XZW A;  3IB8 A;  3GPX A;  2FE8 A;  3LQQ A;  2UUB E;  4NZV A;  3RL5 A;  3M0E A;  2L2M A;  4M0V A;  3FUU A;  2USH A;  1OIE A;  1XC8 A;  1QAN A;  5FLX S;  4LAC C;  3GRR A;  5IWA M;  1I94 E;  1S3N A;  1QU6 A;  3SYL A;  2DMY A;  2UXC E;  3ZTV A;  3BOS A;  2L3C A;  1TCO A;  4FCX A;  2Z4R A;  3LLH A;  2OPF A;  4DKK A;  2Q2E B;  3MJ5 A;  1IBL M;  4FVM A;  2QBY A;  4Z8X A;  4LGM A;  4Q7F A;  4PCZ A;  2QP9 X;  2L7I A;  1S3M A;  2DXN A;  2DSY A;  3WHK A;  1ZQ9 A;  4LFA E;  4DR1 E;  3GLG A;  3U6L A;  4LJ8 A;  2VQF E;  4CHT B;  4QNR A;  1Q3B A;  4DSY A;  2O8A A;  2Y20 A;  4CGY B;  1J5E M;  4X65 M;  1HNW M;  4X8W A;  5A2Q C;  4X62 M;  2G5G X;  2CE7 A;  3DZD A;  4H2F A;  4G9J A;  1V73 A;  3GP1 A;  4V0V A;  4DV4 M;  4D82 A;  2L3J A;  4B7G A;  4DV6 M;  3AOE C;  4QOZ C;  3E4R A;  3U6C A;  1Z5B A;  4JI5 E;  5BPV A;  3HJ8 A;  2Q8U A;  3MHV C;  2XSZ A;  3VK7 A;  1N36 E;  3SAS A;  3E9S A;  5J28 A;  4F54 A;  2NPP C;  2X4A A;  1J26 A;  3A98 B;  4O5G A;  3H09 A;  1QAO A;  4X64 M;  2RS7 A;  4RF0 A;  1L8Q A;  4BB9 A;  5LMN M;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...