5DNYA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 107
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5dnyA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5dnyA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5dnyA01
2BDXA 5JJTA 1UTEA 1QHWA 4M0VA 1S70A 4MP0A 2WDCA 4JA7A 2XMOA 1OIDA 4KBPA 3V4YA 5IOHA 5DNYA 2A22A 3QFNA 1G5BA 1T70A 5B8IA 3C5WC 3CK2A 5JPEA 4Q7FA 2HYOA 4O43A 3H66A 2O8AA 4H1SA 4UT2A 2AHDA 3QG5C 3PSOA 4DHLA 3ICFA 2ZBMA 1S3LA 4DT2A 4B2OA 4LACC 4H2FA 2IE3C 2NPPC 4F0ZA 4XPNA 1HP1A 4FBKA 2HY1A 1QFCA 3RL4A 3H69A 4ZX2A 2WDEA 4IL1A 1XM7A 2Z1AA 4H2GA 2R17A 4DSYA 4H2BA 4UT3A 2IE4C 2QFPA 2CV9A 1OIEA 3EGHA 1T71A 2Z06A 2BQ8X 3GVEA 5J28A 2BCDA 4FBWA 3DSCA 1KBPA 4O24A 4IYPC 3TGHA 2P6BA 3RL5A 1NNWA 2WDDA 1S3NA 4I5LC 3DSDA 3E7AA 4WWLA 1UF3A 3T1IA 1XZWA 2HYPA 4V0WA 1II7A 3DW8C 1JK7A 4TUIA 5INBA 3ZTVA 5GTUA 1HPUA 1Z2WA 2QJCA 1HO5A 1USHA 1IT6A 3IVDA 3IB7A 3HVQA 3H63A 1V73A 3H61A 1OI8A 3THOB 4MOYA 2KKNA 3H62B 3RQZA 2O8GA 4NZVA 1WARA 4O4KA 4FBQA 4G9JA 3THNA 1U32A 5JPFA 3C9FA 3K7WC 4LU9A 2NYMC 1TCOA 4YKEA 4ORBA 1WAO1 3H60A 3QFMA 4FCXA 4J6OA 2USHA 1Z2XA 4LTYA 4V0XA 3RL3A 3N5UA 4MOVA 3JYFA 5F3WA 5HPEA 3K7VC 3AV0A 3H64A 1S3MA 1S95A 2YVTA 4H1YP 3FGAC 2JOGA 3KBPA 3P71C 3AUZA 1MF8A 3ZU0A 3PSNA 2WDFA 1W24A 4JA9A 5EQVA 1M63A 1AUIA 4HD0A 4ORAA 2NXFA 4TUGA 3QFOA 4V0VA 4H2IA 3QFKA 3H68A 4UWQA 3IB8A 5C1VA 2Z72A 4OR9A 4I5NC 2IAEC 2GJUA 4O5GA 2DFJA 1S8EA 3H67A 2NYLC 3LL8A 4KKZA 4UT3B 1FJMA 2QFRA 3EGGA 3IVEA 1SU1A 3E7BA 4ORCA 2Q8UA 4ZVZA
chains in the Genus database with same CATH superfamily
2XFTA 4DV5M 1OAIA 2CV1A 5A2QS 1B69A 1IFYA 3P1XA 1EE8A 1V34A 3V4YA 1WXQA 5IOHA 4GIPA 1IY0A 4M2ZA 5BPVA 3QG5C 2EPCA 1OFIA 2R4EA 5FSWA 3ILKA 2HL7A 4AZFA 5KL7A 2R76A 1UM8A 4GC5A 2HWJA 3EPJA 4MGZE 2JWSA 1IBKM 1D0MA 2EPAA 1YSYA 2G5GX 4WPYA 2CV9A 2EMWA 2EOHA 2EOJA 2WDDA 4IIWA 2EM2A 2FV4B 2FNAA 2DMIA 4WSPA 4V0WA 1YE9A 1JB0F 4JI1E 4DR6E 1II7A 1YUBA 2VQEM 5IWAE 1HPUA 4Q35B 3SFZA 5AC5A 5AASA 3IVDA 4OX9E 1VDDA 2ELZA 3KOZE 2J7OA 4AI6A 3GQ3A 3ZQJA 2YTGA 2EMBA 3HKPA 5EXPA 1GZ6A 4JI5M 4YKEA 4ORBA 4FCXA 4LTYA 2UXDM 1MN3A 3AKZA 3NBXX 1IM2A 4IBDA 5AE3A 4JI6M 4R2CA 4FK5C 3K9OA 2MJ5B 3LCUA 4B7FA 3RFWA 3QFOA 1X48A 2EMCA 2DAEA 3J7Yp 3AJIB 5E6JA 4FCWA 1J7KA 2IAEC 2JA2A 1F4IA 4R03A 2EN4A 2V88A 3UGJA 4DR7M 2DHYA 2YU5A 3QAUA 4F6MA 1FJMA 3RE8A 3I4YA 4DUYE 3T38A 2EA0A 3FD9A 4PDGA 4G4NA 3GLFA 2UUAE 2CHQA 3GLIA 3J7AS 1L4SA 4L5NC 2C9CA 2LTUA 3HPSA 4MM3B 1YSAC 1XNQE 2V85A 2VQFM 2I9IA 4DT2A 2YTNA 2KRKA 2WZJA 4XPNA 2DGCA 4WXDA 2DWNA 2UUCE 2LMZA 4R2PA 4DV4E 4G3OA 2EN8A 2EUCA 2RKOA 4MGHA 1WJ7A 2BCDA 2N3GA 1N78A 4LF5E 4KHPM 3EPKA 3T1IA 1XZWA 4J8ZA 3D8LA 4JI7E 2B7TA 1NHGC 2N35A 1USHA 1IT6A 2N3HA 2DAGA 3A46A 2XF3A 1K3WA 2CE7A 3FTCA 2O8GA 3JTZA 1HR0M 2OQ4A 1PJJA 3THGA 1WAO1 3C6MA 4V0XA 4GC9A 2CUZA 3H64A 1S95A 2YVTA 2KHXA 4LZZA 1N34E 3FRIA 1OFHA 4K0KM 5FTKA 4L8NA 4L78A 2JY8A 1WIVA 4NXNM 4X64E 2JYAA 3KS8A 2OO9A 4BHBA 1I94E 3JR5A 3KZYA 4R2QA 3HGIA 1PM5A 2EZ6A 2J7NA 4GRIA 1S70A 4DV0E 3H62B 5A6JA 1FJGM 2LBSB 1NY6A 2XMOA 3KOYE 3VKGA 4M9ZA 1T70A 1SG9A 1IN7A 4P7DA 1DGHB 1NJGA 2AHMA 3IG5A 2EPLX 2O8AA 1DI2A 3L25A 1YFHA 4R2RA 2EMIA 1S3LA 5LLQA 2EPNA 3U6QA 1W5TA 4NL4H 3HQ1A 1UBDC 2M4IA 3PNVA 3LVWA 1S3SA 3MJ5A 2DRPA 1UN6B 3T15A 3MK6A 1D0KA 4AW4A 1G71A 5TSEA 5EP3A 2A25A 2XZUA 5DYGA 2RGOA 5GTUA 1HQCA 4F6NA 1D2NA 2VF1A 2CP8A 3DF6A 5JI3E 4IJDA 2EOXA 3THOB 2UUBE 4X66M 4IBCA 1WARA 4LCBA 2JPAA 1VEKA 2YT4A 4AQYE 2EOMA 4RNAA 1OKSA 1X3CA 1O0WA 2B9DA 3AV0A 3D03A 3GPXA 1KFVA 1V92A 4Z8XA 2DB2A 1W24A 2CHGA 4JN6A 2MKNA 5ITYA 4JXJA 2XZFA 3H67A 3HTXA 3LL8A 4KKZA 1XNRE 2YTOA 4DR6M 5JJTA 5C18A 4F9CB 5IWAM 1PGYA 2CFOA 4OX9M 2JOBA 3EIEA 3HJQA 4BBAA 1YLAA 2QBYB 2HCBA 1PJIA 3MMPA 2LH0A 2ERCA 5EQTA 3GRYA 2EMYA 2EPKX 3ICFA 3HX3A 1LV7A 3CF0A 4LACC 3U6OA 2EMAA 2EPUA 4ZYEA 2EOOA 2QFPA 3HU2A 4IBBA 2YRHA 2X49A 1R7RA 1LTMA 2MKDA 1GL7A 1YYWA 2EMLA 3D8BA 2CT1A 4B7GA 4QHTA 3KWRA 5INBA 3I4VA 2YRMA 3HVQA 3QWLA 2K9DA 1OI8A 3U6DA 4WSGA 2VDBB 1YUIA 4NXME 3LLHA 1JK1A 5JPFA 2L92A 2D7HA 2XSZA 2UUAM 2QENA 2ZM6E 5A6BA 3A42A 2JXPA 1TH4A 2USHA 2EN1A 1A1GA 1QVRA 2JXNA 2JNHA 3U5ZB 3TE6A 2EM5A 1DGHA 4PD2A 1I4WA 2D9HA 2Y20A 1R5LA 5A2QC 4Z6YA 2EOYA 1XNQM 1QUSA 1MF8A 2EM8A 2LVOC 5ITXE 3H09A 5KL2A 5EQVA 7CATA 1M63A 4HD0A 2LVHA 3K6QA 2KW0A 3PXGA 4WYQB 1EKZA 3QFKA 2UUCM 3VKHA 4DV4M 1MU5A 2O5RA 4X9JA 4FD2A 4LF5M 3R8FA 3FYDA 1XC8A 1DV0A 4RHBB 2LTSA 4NSOB 3K7WC 1UTEA 2JY9A 4M9VC 4JI7M 2LTRA 2JP9A 2CTDA 2MH8A 3C4TA 4JA7A 1KJKA 3GRRA 1PKPA 2JY5A 4RH8A 3J7AG 1IN5A 1IXZA 4HEIA 3RMPA 3SBJA 4DUZE 2DIXA 4O43A 4XGIA 2NUGA 1A1IA 4F2LA 3BIDA 4CISA 4NC6A 2LVQD 2R0IA 4Q7JA 3T6PA 2OPFA 1N34M 3B7ZA 2KZUA 3KP0E 4FWHA 4WFTA 1X6HA 3FKEA 1DGBA 5T6JA 4IJFA 4X64M 5JI2E 1TR8A 4LRTA 1A1JA 2ENAA 2GNOA 1EIJA 1I94M 1C1KA 3CTWB 2QZ4A 2KNZA 2L2KB 1AIPC 1QNTA 3U6SA 5KL3A 3TQSA 4LF8E 4DV0M 3VDUA 4G9JA 2KONA 1T4OA 1SXJB 3K8ZA 2D7GA 2NQ8C 4GHLA 2WSFF 1HJPA 2EO2A 1FKAE 3W67A 2L7HA 1Z2XA 2BWEA 3N5UA 4KO8A 2QBYA 1EH6A 3GLFB 4R2DA 1WHCA 3E9SA 3FYCA 3HZJA 2MDRA 3P71C 2F5QA 2D7EA 3M0EA 3ECRA 5H37D 3GQ4A 3T1YE 4H2IA 2NUEA 2RS7A 3C6KA 2Z72A 4LGYA 2MR9A 3FE3A 4AG5A 5ADZA 3W0LB 2EP3A 2C5RA 3IVEA 4NSRA 3TPZA 3AOEA 1QZMA 1Y8GA 4LG2A 1ZQ9A 1ZV1A 2LHGA 2DAIA 2UUBM 1OJLA 4KT0F 4M30A 4P78A 3GLIE 2MROB 1ORYB 1T4LB 2R65A 4AQYM 5ITRA 1IBLM 2RSMA 2L4EA 1PJQA 2YSPA 4LJ4A 3HHYA 3U5ZA 3CGWA 2FE8A 4KZSA 1JR3A 3DSCA 4DBGB 3KDSE 3KVWA 1Z5CA 1IBMM 4IBFA 5A69A 3HWSA 4G4QA 4KLNA 3MHSC 1NV8A 1KYQA 1QDRA 1N32E 4GMQA 3EPHA 5ITQA 2Z3XA 1A1FA 3J27B 3E4RA 4JI2E 2YTQA 1HQYE 3C4BA 1XNRM 2DLQA 1AUAA 3HJ8A 2KRUA 3THNA 1U32A 2YFQA 1R4GA 2WCC3 2NYMC 2Z4SA 1TCOA 3J2PB 2VF7A 4LF6E 1NNJA 4LJ8A 2HKJA 2I7NA 3JYFA 4LFBE 1S3MA 4H1YP 4B3TE 1W5SA 2JWOA 2K7IA 3KBPA 5AE1A 3DOAA 4B08A 4JA9A 5KQDA 2HHHE 4UWQA 1G41A 5FTJA 2YR0A 1R6BX 1ZR9A 3PFIA 1IQOA 1MJGM 2BWBA 4QOSA 2BDXA 3KSJA 3U61A 4X62E 1F2IG 4MP0A 4M9SA 5IREB 4N4RB 3EQ1A 4NXMM 3ZC7B 2G8LA 1V33A 4RKUF 3H66A 2LRSA 2ZTDA 2M1SA 3GLHA 1R2YA 1A1HA 1G2FC 3U60B 4B2OA 2EMGA 1TN9A 1SXJA 2ZM6M 2F5PA 1NY5A 1OTRA 4F2JC 3H69A 1PJTA 3R9XB 2LCEA 2IE4C 4MB7A 1RMDA 1E94E 3FUTA 3IWBA 2A5YB 5J28A 3I04M 1KBPA 3LVVA 4IJEA 5EP4A 1S3NA 4G6ZA 2B3TA 1TF0B 2LVNC 4LF9E 5BR8E 4YHHE 3A45A 5AE2A 1GVNA 1BBOA 4GKKE 4IBGA 1PRBA 2YEQA 2RQLA 4MOYA 3SYLA 5KQ8A 2V1UA 3H4JA 3UJNA 4NZVA 5EXXA 1A1KA 1EH8A 2EN3A 3HHWA 3C58A 4B3ME 1GO5A 2R62A 4DUZM 5HPEA 3C9PA 3HJSA 2RGHA 3F92A 3HXLA 3BF2A 2Y0TA 3U6LA 4R8OA 4JI3E 4DV6E 4MLVA 3FLOA 4CGYB 1XXHB 2EMZA 1QAMA 2DI0A 4ZVZA 1TF6A 1QHWA 4DV7E 2KNAA 2L8TA 3RGPA 4JI8E 2CV2A 2GPIA 4OOGC 3T1HE 5B8IA 4LY6A 4P17A 3CK2A 4DR2E 2HYOA 2C99A 5FTMA 4LF8M 1QZEA 1T4NA 4PDIA 3KS4A 3FRHA 1A1LA 2ZBMA 3FTEA 3A98B 4JV5E 1ZBTA 2EL4A 4LZJA 2BBGA 4H2GA 4JI0M 4LF7E 1N3GA 1DO0A 2K0BX 3GVEA 4FBWA 3GLGB 4KWYA 1QAOA 4HEOA 2QP9X 2F5OA 2O01F 3T1YM 4GEWA 2QPAA 3NWLA 3DW8C 2LUQA 1IQPA 3SAUA 2QJCA 2HC5A 3HPZA 1HNWE 2M7QA 2E5LE 1C7YA 4FBQA 3KSXA 1RC7A 3L26A 2H1RA 2LVAA 3FTFA 1GQEA 1G2DC 3L2AA 1IXRC 4I5SA 4DR5E 2MDGA 3GPPA 1FNNA 2HAKA 3U60A 5IZ7D 1XB2B 3Q8GA 3K92A 3C3EA 2YZTA 4L6V6 1GL6A 4OR9A 4JI4E 2L4FA 4QOZC 2Z7JA 1XWIA 1VQ1A 4F9BB 1IMUA 2EM3A 2V6ZM 2EPMX 1GTKA 1WRJA 1YYOA 2UU9E 3ADGA 4CJ6A 1YPNA 2YU8A 4KBPA 2L6OA 4JI2M 2A22A 3C5WC 4Q7FA 4GEQB 1VEJA 4DV5E 3TL4X 2EM7A 3ADJA 4H2FA 3GQ5A 4Q28A 3RL4A 4JI1M 1XM7A 4MGYE 2KOUA 2OOAA 4DV2E 1SR9A 3SC3A 3EGHA 2UXBE 2CWBA 2ZAMA 4ANRA 2EM0A 2RPCA 3TGHA 4IYPC 4B3SE 4AKGA 2JP7A 3GPUA 2DNAA 2K6BA 2OOBA 3WHKA 2YRKA 2WBTA 2R45A 2L3CA 2DWLA 1IBKE 1Q3BA 1HO5A 1OIPA 1XMOE 1XXHA 2LJHA 3OTOE 5FTLA 4GKJE 4FWGA 3RGSA 4X62M 2L33A 4GITA 4PCZA 1UILA 1STUA 4BC9A 2B7VA 2KEBA 2XEPA 2MGWA 1N33E 4M9XA 2YTDA 3AL0C 5KPZA 3VK6A 3AUZA 1J5EE 4BC7A 2ODRD 4DUYM 2KHHA 3M99B 1Z1BA 4F54A 2QHOB 2EMFA 2LE2A 2RS6A 3VFDA 3GLGA 4IS1C 1NJFA 4LF9M 2Q8UA 1N36E 4YHHM 2JUJA 4IBJA 4GKKM 2EJ4A 1L2CA 4FCTA 4R2SA 5AC4A 4IBKA 5DNYA 4DR3E 2EKFA 4M0DA 1BBGA 3JU0A 4H1SA 2WBSA 1IY1A 1NNUC 4B3MM 2EN6A 2CV0A 2DHRA 2EN2A 3VK7A 2ZBKB 4UT3A 1Q3CA 2C9OA 1OIEA 2Z06A 3U6PA 4QNMA 1JR3E 2UXCE 3SYKA 2JVAA 2HYPA 1HT2E 3SAVA 1X5WA 2J5YA 4JI3M 4DV6M 2ENHA 2DLKA 3OMLA 1WJPA 2EL5A 3H63A 1V73A 3DA1A 2J7JA 2ZO9B 3W68A 4YY3E 4R2EA 1Q39A 1E9SA 4DV7M 5FLXC 4HL4A 2LUPB 1L8QA 4JI8M 1XMQE 3ZH9B 2M60A 4LJ7A 5KPRA 5EXTA 8CATA 2EE8A 3T1HM 4R2AA 4DR2M 2DENA 3U61B 4NOOB 3V76A 2CHVA 3SAWA 3FGAC 2JOGA 4JV5M 2C96A 5L8RF 3FUVA 4NRVA 4MH0E 3GLHB 2GLIA 1OIZA 4LF7M 1Q02A 4I5NC 2GJUA 3MHHC 2FFJA 3KP1E 4AKHA 2MC6A 3VLFB 1EH7A 2F5SA 4ORCA 1GABA 4NXNE 4BHCA 3EPLA 3U6CA 2B3TB 3JR4A 3Q8XA 2YTEA 1QQWA 1HNWM 1VEGA 3JAMS 1QDTA 5JPEA 3ADIA 2E5LM 1WR1B 4UT2A 3E0JA 3B74A 3UK3C 1ZMVA 3TQMA 5DYIA 2IE3C 2YTPA 3GLHE 3F6GA 2G7HA 1SXJE 4REZA 2Z1AA 2R18A 4BB9A 2XFSA 2YSOA 2DAMA 4DR5M 3M7GA 3J81S 3GLFE 3RL5A 2BB8A 3E7AA 4WWLA 2V1CA 1UF3A 2N8XA 4BMJA 4FWDA 2DWMA 2EORA 4DKKA 5LMNE 4TUIA 3VHTB 3AFHA 4JI4M 3H4MA 3M6AA 4L16A 2KNVA 3BBZA 1T43A 4LF4E 1HNXE 2C98A 1TDHA 2V83A 2EOEA 2WSEF 1SXJD 5LMUE 2UU9M 2QNJA 3LQQA 4LJ5A 4IBEA 2EQ3A 3RL3A 1TF3A 1HT1E 2DXLA 2YQZA 4NHRA 2P5TA 5KPTA 1QANA 1N77A 2XH9A 2YWQA 2CEAA 1AAYA 4ORAA 4MGIE 3PNYA 4DV2M 3H68A 5ITTA 2MC5A 5C1VA 1ZAAC 4R71A 2UXBM 3KW6A 4I81A 4B3SM 1LLMC 1IN6A 2QFRA 2KZSA 3EGGA 4S12A 1E32A 5KL5A 1XMOM 1MGTA 2DVWB 2LV2A 1G5BA 3U6MA 3OTOM 4GKJM 2EN7A 4NRWA 1NHWC 3DJWA 1Z5AA 1Z6TA 2KA6B 3K1JA 5FLXS 2KDLA 3DFZA 5DFLA 4L15A 1UHZA 2HJJA 1YZ9A 1HP1A 3MHVC 2LNHC 2ELYA 2EMHA 4KODA 1N33M 2EOIA 4OU7A 2BJVA 1T71A 3DZDA 1IY2A 2BQ8X 1J5EM 2JY6B 4LRSA 2L2MA 1BB8A 3SARA 4XK8F 1QU6A 3IB7A 2JY7A 1TTEA 1HNZE 2HGHA 1RU3A 2LHCA 3I01M 2R6FA 2FTXB 4DMIA 3K9PA 1IQSA 5KL4A 3IHPA 1G3IA 1N36M 3SATA 2H36X 3C9FA 4LU9A 2K47A 1X6FA 2EOFA 2RSIA 4DR3M 2JR1A 3H60A 4J6OA 3W0FA 2EPXA 2FS1A 4DR4E 3K7VC 2Y21A 4OVZB 2R4JA 1P47A 2L6MA 2JOXA 5FTNA 1OQYA 2NABA 2GHFA 2VRDA 4R3DA 4PT5A 4HTGA 1A5TA 2NYLC 2UXCM 1E9RA 4W5WA 4WXCA 1G4AE 2EPZA 4M0VA 2ZANA 1OIDA 2WZOA 2ODRC 2EWLA 2NUFA 3KOWE 3J80S 3IWDA 4YY3M 4LFCE 2BJWA 2AHDA 2DZOB 2DXIA 3VDPA 2M5ZA 4LFAE 4ZYHA 2I13A 3UZUA 1XMQM 2F4VE 4FBKA 4JYAE 1K82A 4ZX2A 2WDEA 4IL1A 2O25A 2DZNB 4DR1E 4ZYGA 4O24A 5EP1A 2EL6A 2ZTCA 1WHNA 4D80A 1XHBA 2FH0A 4A3VB 4WX9A 1T39A 4WW0A 1T38A 2RTXA 3VYYA 4LJ6A 1JQJC 3CF2A 4DV1E 1MX0A 1YUJA 2LO3A 1XXHE 3J7BA 3L00A 1NSFA 1L1ZA 1DGGA 4FW9A 1MEYC 2YTFA 2E72A 4LJAA 3AOEC 2V87A 2H5XA 4L8RC 4ZPXA 4QHSA 1Z59A 4TUWA 1WXRA 3ZU0A 3HU1A 2NXFA 2L09A 1N75A 3KXEC 2NA2A 4O5GA 2DFJA 1TDZA 3BXWA 3FUUA 4GH9A 4X65E 4UT3B 2RRUA 2LWXA 2EQ0A 3GLGE 3ZCBB 3LMLA 5LMNM 1D0LA 3HY5A 1NVMA 4DV3E 1QAQA 3GRVA 1DQ3A 3QYBA 1WGNA 2VF8A 1T3TA 2W82A 2X4AA 4LF4M 1HNXM 4I8OA 3KZZA 4RF1A 3L29A 5LMUM 2CRUA 2NPPC 2Y0QA 3C3DA 4HLQA 3SHFA 2XSZD 2PRTA 3GPYA 4DSYA 1N32M 1X49A 2FGGA 5A6BD 3KFUG 2R44A 3I51A 4MGKE 2GQFA 1DGFA 4OVZA 5EXSA 3UK6A 1IBLE 4D82A 1TGUA 4FVMA 4RF0A 1NEIA 2F5NA 4B3RE 5A6AA 1PDAA 1JK7A 5E26A 1K3XA 4BS9A 1DGCA 2VIIA 4LF6M 2EOSA 3H61A 2LJUA 3ZOQB 1ZBQA 2KXEA 1BVSA 1IBME 2KKNA 1TH3A 2ZAOA 4LFBM 2LT7A 4B3TM 4O4KA 3FUWA 3B7QA 1QYRA 2K4VA 1J09A 4UN2B 3U6EA 3BBGA 1JK2A 2YNMD 4AG6A 1T6OA 2Z8YM 4OW0A 5F3WA 4QNRA 2HHHM 3FUXA 3TWLA 3PVSA 4EIWA 3VK8A 3AOGA 1Z5BA 3SMPA 2IHR1 5IT9C 2FOIC 4CHTB 1ZMWA 4B7HA 4MLQA 3PSNA 3JAMC 1AUIA 1G8PA 2JZ1A 1IXSB 2EOQA 3ADLA 2R1FA 1SXJC 3IB8A 2VQEE 2E1MA 3K2LA 4WURA 2EMXA 1VDLA 2R46A 4I4LA 3WHLA 5EJCA 4LGMA 2EMKA 1RQ0A 5A6KA 1SU1A 3QYEA 2G3QA 5KL6A 3VYXA 3J81C 1L2BA 4X8WA 2WDCA 2V86A 4JI5E 1HNZM 1AH5A 3QFNA 2CPNA 2UXDE 1GKIA 3E21A 2EKKA 3PSOA 5IXMB 4DHLA 1UFZA 4G4OA 1GLNA 1QUTA 4JI6E 4F0ZA 5C1BA 2L7IA 4CIZA 2XGNA 3HHXA 2DMYA 2ENCA 1QFCA 4II7A 5BR8M 4ITQA 4F1IA 4BBYA 2DKLA 2L3JA 4DR4M 4IBIA 2VE7C 4FCVA 1H6UA 2EM4A 1R2ZA 1NNWA 3DSDA 3NBIA 2APLA 2LXEA 3FTDA 1IN8A 2YPNA 4DR7E 2EPPA 1WHQA 2V8QB 2QQ8A 2V89A 4F9AB 3IG8A 4ZYDA 2DXNA 1EFUB 1YYKA 1G59A 3RQZA 4L4UA 4R7GA 1ZU1A 2VQFE 3GRUA 2EOZA 2YTIA 4D81A 2EM6A 2F8BA 1NV9A 5ITUA 4LFCM 4LFAM 1J26A 5IV8B 2F4VM 3L28A 4KHPE 2WDFA 4JYAM 4Y28F 4DR1M 2YTJA 1TH2A 1KSFX 3B7NA 3LCVB 1NCSA 3IWCA 3SMSA 1S8EA 1WGLA 2XLJA 1JR3D 3E7BA 2EPOA 4P16A 4DV1M 1HR0E 4GHAA 2ZOAA 1ZAEA 2DAKA 3B89A 2LBCA 1X37A 3BGHA 4BCAA 5LL6R 2EJSA 1CUKA 2WSCF 3LMMA 2EPRA 4XBOA 4K0KE 5GKNA 2HY1A 1IN4A 1L1TA 1KYIA 2R17A 4LJ9A 3BOSA 4H2BA 3GO8A 2Z4RA 4AKIA 1GJSA 5IT9S 2P6BA 2LVPC 4I5LC 3KOXE 1SFEA 1X6EA 2M9AA 3LW5F 2CSHA 2DWZB 4BLCA 1IXSA 3B9PA 3MSWA 4G4RA 4JI0E 5EP2A 3TWKA 1FJGE 3ZTVA 1Z2WA 4WP2A 4M0WA 1GJTA 3GLIB 2I7PA 1P3QQ 3IECA 4X65M 3F6HA 2L2NA 5CFFE 1X47A 1VG5A 4DV3M 5KO3A 1OAOC 3EIHA 2DZLA 1PJSA 3L27A 2Q2EB 3QFMA 4MOVA 3HHZA 1ZMUA 2L2DA 2QCUA 2X8AA 2ADRA 5ITXA 3FIGA 3J80C 1NO1A 4TUGA 2DSYA 4V0VA 2EQ1A 3SHGB 3UMMA 3GP1A 3TWMA 3HU3A 3CF6E 2BNKA 2JZ0A 4GZNC 2QSFX 1DO2A 3SASA 3LQRA 4X66E 1L2DA 4B3RM 2WBUA 2EM9A 3E46A
chains in the Genus database with same CATH topology
2XFTA 4DV5M 2CV1A 5A2QS 3P1XA 1EE8A 3V4YA 1WXQA 5IOHA 4GIPA 1IY0A 4M2ZA 5BPVA 3QG5C 1OFIA 2R4EA 5FSWA 3ILKA 2HL7A 4AZFA 1UM8A 4GC5A 4MGZE 1IBKM 4WPYA 1YSYA 2G5GX 2CV9A 2WDDA 4IIWA 2FV4B 2FNAA 4WSPA 4V0WA 1YE9A 1II7A 4JI1E 4DR6E 1YUBA 2VQEM 5IWAE 1HPUA 3SFZA 5AASA 3IVDA 4OX9E 1VDDA 3KOZE 2J7OA 4AI6A 3GQ3A 3HKPA 5EXPA 1GZ6A 4JI5M 4YKEA 4ORBA 4FCXA 4LTYA 2UXDM 3AKZA 1IM2A 4IBDA 5AE3A 4JI6M 4B7FA 3RFWA 3QFOA 1X48A 3J7Yp 3AJIB 5E6JA 4FCWA 1J7KA 2IAEC 2JA2A 4R03A 2V88A 3UGJA 4DR7M 3QAUA 1FJMA 3RE8A 3I4YA 4DUYE 3T38A 2EA0A 3FD9A 4PDGA 4G4NA 3GLFA 2UUAE 2CHQA 3GLIA 3J7AS 4L5NC 2C9CA 3HPSA 4MM3B 1XNQE 2V85A 2VQFM 4DT2A 2KRKA 4XPNA 2DWNA 2UUCE 2LMZA 4DV4E 2EUCA 2RKOA 4MGHA 2BCDA 2N3GA 1N78A 4LF5E 4KHPM 3T1IA 1XZWA 4J8ZA 3D8LA 4JI7E 2B7TA 1NHGC 1USHA 1IT6A 2N3HA 3A46A 2XF3A 1K3WA 2CE7A 3FTCA 2O8GA 3JTZA 1HR0M 2OQ4A 1PJJA 3THGA 1WAO1 4V0XA 4GC9A 2CUZA 3H64A 1S95A 2YVTA 2KHXA 4LZZA 1N34E 1OFHA 4K0KM 5FTKA 4L8NA 4L78A 4NXNM 4X64E 3KS8A 1I94E 3JR5A 3HGIA 1PM5A 2EZ6A 2J7NA 4GRIA 1S70A 4DV0E 3H62B 1FJGM 2LBSB 1NY6A 2XMOA 3KOYE 3VKGA 4M9ZA 1T70A 1IN7A 4P7DA 1DGHB 1NJGA 2AHMA 3IG5A 2O8AA 1DI2A 3L25A 1S3LA 3U6QA 1W5TA 4NL4H 3HQ1A 2M4IA 3PNVA 3LVWA 1S3SA 3MJ5A 3T15A 3MK6A 4AW4A 5EP3A 2XZUA 5DYGA 2RGOA 5GTUA 1HQCA 1D2NA 2VF1A 3DF6A 5JI3E 3THOB 2UUBE 4X66M 4IBCA 1WARA 4LCBA 2YT4A 4AQYE 4RNAA 1O0WA 2B9DA 3AV0A 3D03A 3GPXA 1KFVA 4Z8XA 2DB2A 1W24A 2CHGA 4JN6A 5ITYA 4JXJA 2XZFA 3H67A 3HTXA 3LL8A 4KKZA 1XNRE 4DR6M 5JJTA 5C18A 4F9CB 5IWAM 2CFOA 4OX9M 2JOBA 3EIEA 3HJQA 4BBAA 2QBYB 2HCBA 1PJIA 5EQTA 2LH0A 2ERCA 3GRYA 3ICFA 1LV7A 3CF0A 4LACC 3U6OA 2QFPA 3HU2A 4IBBA 2X49A 1R7RA 1GL7A 1YYWA 3D8BA 4B7GA 4QHTA 3KWRA 5INBA 3I4VA 3HVQA 3QWLA 1OI8A 3U6DA 4NXME 3LLHA 5JPFA 2L92A 2D7HA 2XSZA 2UUAM 2QENA 2ZM6E 3A42A 1TH4A 2USHA 1QVRA 3U5ZB 3TE6A 1DGHA 4PD2A 1I4WA 5A2QC 2Y20A 4Z6YA 1XNQM 1MF8A 3H09A 5ITXE 5EQVA 7CATA 1M63A 4HD0A 3K6QA 2KW0A 3PXGA 4WYQB 1EKZA 3QFKA 2UUCM 3VKHA 4DV4M 1MU5A 2O5RA 4FD2A 4LF5M 3R8FA 3FYDA 1XC8A 2LTSA 3K7WC 4NSOB 1UTEA 2JY9A 4JI7M 2LTRA 3C4TA 4JA7A 3GRRA 1PKPA 3J7AG 1IN5A 1IXZA 3RMPA 3SBJA 4DUZE 2DIXA 4O43A 4XGIA 2NUGA 4CISA 2OPFA 1N34M 2KZUA 3KP0E 4FWHA 4WFTA 3FKEA 1DGBA 5T6JA 4IJFA 4X64M 5JI2E 4LRTA 1I94M 1C1KA 3CTWB 2QZ4A 2L2KB 3U6SA 3TQSA 4LF8E 4DV0M 3VDUA 4G9JA 2KONA 1T4OA 1SXJB 3K8ZA 2D7GA 2NQ8C 4GHLA 2EO2A 1FKAE 2L7HA 1Z2XA 3N5UA 4KO8A 2QBYA 3GLFB 3E9SA 3FYCA 2MDRA 3P71C 2F5QA 2D7EA 3M0EA 5H37D 3GQ4A 3T1YE 4H2IA 2NUEA 2RS7A 2Z72A 4LGYA 4AG5A 5ADZA 3W0LB 2C5RA 3IVEA 4NSRA 3TPZA 3AOEA 1QZMA 4LG2A 1ZQ9A 2UUBM 1OJLA 4M30A 4P78A 1ORYB 1T4LB 2R65A 4AQYM 5ITRA 1IBLM 2RSMA 4LJ4A 3HHYA 3U5ZA 2FE8A 4KZSA 1JR3A 3DSCA 3KDSE 3KVWA 1Z5CA 1IBMM 4IBFA 3HWSA 4G4QA 4KLNA 1N32E 4GMQA 5ITQA 2Z3XA 3J27B 3E4RA 4JI2E 1HQYE 3C4BA 1XNRM 3HJ8A 2KRUA 1U32A 3THNA 2YFQA 2NYMC 2Z4SA 1TCOA 3J2PB 4LF6E 1NNJA 4LJ8A 2HKJA 2I7NA 3JYFA 4LFBE 1S3MA 4H1YP 4B3TE 1W5SA 2JWOA 3KBPA 5AE1A 3DOAA 4B08A 4JA9A 5KQDA 2HHHE 4UWQA 1G41A 5FTJA 2YR0A 1R6BX 3PFIA 4QOSA 2BDXA 3KSJA 3U61A 4X62E 4MP0A 4M9SA 5IREB 4NXMM 3ZC7B 2G8LA 3H66A 2LRSA 2M1SA 3GLHA 1R2YA 3U60B 4B2OA 1SXJA 2ZM6M 2F5PA 1NY5A 3H69A 3R9XB 2IE4C 4MB7A 1E94E 3FUTA 3IWBA 2A5YB 5J28A 1KBPA 3LVVA 4IJEA 5EP4A 1S3NA 4G6ZA 4LF9E 5BR8E 4YHHE 3A45A 5AE2A 1GVNA 4GKKE 4IBGA 2YEQA 4MOYA 3SYLA 5KQ8A 2V1UA 4NZVA 3UJNA 5EXXA 3HHWA 3C58A 4B3ME 2R62A 4DUZM 5HPEA 3HJSA 2RGHA 3HXLA 2Y0TA 3U6LA 4R8OA 4JI3E 4DV6E 3FLOA 4CGYB 1XXHB 1QAMA 4ZVZA 1QHWA 4DV7E 2L8TA 3RGPA 4JI8E 2CV2A 4OOGC 3T1HE 5B8IA 4LY6A 3CK2A 4DR2E 2HYOA 2C99A 5FTMA 4LF8M 1T4NA 4PDIA 3KS4A 2ZBMA 3FTEA 3A98B 4JV5E 1ZBTA 4LZJA 4H2GA 4JI0M 4LF7E 1DO0A 3GVEA 4FBWA 3GLGB 1QAOA 2QP9X 2F5OA 3T1YM 2QPAA 3NWLA 3DW8C 2LUQA 1IQPA 3SAUA 2QJCA 3HPZA 1HNWE 2M7QA 2E5LE 4FBQA 3KSXA 1RC7A 3L26A 2H1RA 3FTFA 1GQEA 3L2AA 1IXRC 4I5SA 4DR5E 3GPPA 1FNNA 3U60A 5IZ7D 3K92A 2YZTA 1GL6A 4OR9A 4JI4E 4QOZC 2Z7JA 1XWIA 4F9BB 2V6ZM 1YYOA 2UU9E 3ADGA 4KBPA 2L6OA 4JI2M 2A22A 3C5WC 4Q7FA 4GEQB 4DV5E 3TL4X 3ADJA 4H2FA 3GQ5A 4Q28A 3RL4A 4JI1M 1XM7A 4MGYE 2KOUA 4DV2E 1SR9A 3SC3A 3EGHA 2UXBE 2ZAMA 3TGHA 4IYPC 4B3SE 4AKGA 3GPUA 3WHKA 2L3CA 2R45A 2DWLA 1IBKE 1Q3BA 1HO5A 1XMOE 1XXHA 2LJHA 3OTOE 5FTLA 4GKJE 4FWGA 3RGSA 4X62M 2L33A 4GITA 4PCZA 1UILA 1STUA 4BC9A 2B7VA 2KEBA 2XEPA 1N33E 4M9XA 3AL0C 5KPZA 3VK6A 3AUZA 1J5EE 4BC7A 2ODRD 4DUYM 4F54A 2LE2A 2RS6A 3VFDA 3GLGA 1NJFA 4LF9M 2Q8UA 1N36E 4YHHM 4IBJA 4GKKM 1L2CA 4FCTA 4IBKA 5DNYA 4DR3E 4M0DA 3JU0A 4H1SA 1IY1A 1NNUC 4B3MM 2CV0A 2DHRA 3VK7A 2ZBKB 4UT3A 1Q3CA 2C9OA 1OIEA 2Z06A 3U6PA 4QNMA 2UXCE 3SYKA 2JVAA 2HYPA 1HT2E 3SAVA 4JI3M 4DV6M 3OMLA 3H63A 1V73A 3DA1A 2ZO9B 4YY3E 1Q39A 1E9SA 4DV7M 5FLXC 4HL4A 2LUPB 1L8QA 4JI8M 1XMQE 3ZH9B 2M60A 4LJ7A 5KPRA 5EXTA 8CATA 3T1HM 4DR2M 3U61B 4NOOB 2CHVA 3SAWA 3FGAC 2JOGA 4JV5M 2C96A 3FUVA 4NRVA 4MH0E 3GLHB 4LF7M 4I5NC 2GJUA 2FFJA 3KP1E 4AKHA 2MC6A 3VLFB 2F5SA 4ORCA 4NXNE 3U6CA 2B3TB 3JR4A 3Q8XA 1QQWA 1HNWM 3JAMS 5JPEA 3ADIA 2E5LM 4UT2A 3E0JA 5DYIA 2IE3C 3F6GA 2G7HA 1SXJE 4REZA 2Z1AA 2R18A 4BB9A 2XFSA 4DR5M 3M7GA 3J81S 3RL5A 3E7AA 4WWLA 2V1CA 1UF3A 4BMJA 4FWDA 2DWMA 4DKKA 5LMNE 4TUIA 3AFHA 4JI4M 3H4MA 3M6AA 4L16A 4LF4E 1HNXE 2C98A 1TDHA 2V83A 1SXJD 5LMUE 2UU9M 3LQQA 4LJ5A 4IBEA 3RL3A 1HT1E 2DXLA 2YQZA 2P5TA 5KPTA 1QANA 1N77A 2XH9A 2CEAA 4ORAA 4MGIE 3PNYA 4DV2M 3H68A 5ITTA 2MC5A 5C1VA 2UXBM 3KW6A 4I81A 4B3SM 1IN6A 2QFRA 2KZSA 3EGGA 4S12A 1E32A 1XMOM 2DVWB 1G5BA 3U6MA 3OTOM 4GKJM 4NRWA 1NHWC 3DJWA 1Z5AA 1Z6TA 2KA6B 3K1JA 5FLXS 3DFZA 4L15A 1UHZA 1YZ9A 1HP1A 3MHVC 2LNHC 4KODA 1N33M 4OU7A 2BJVA 1T71A 3DZDA 1IY2A 2BQ8X 1J5EM 4LRSA 2L2MA 3SARA 1QU6A 3IB7A 1HNZE 2FTXB 4DMIA 1G3IA 1N36M 3SATA 2H36X 3C9FA 4LU9A 2K47A 4DR3M 2JR1A 3H60A 4J6OA 3W0FA 4DR4E 3K7VC 2Y21A 4OVZB 2R4JA 2L6MA 2JOXA 5FTNA 4R3DA 4PT5A 2NYLC 2UXCM 1E9RA 4W5WA 1G4AE 4M0VA 2ZANA 1OIDA 2WZOA 2ODRC 2EWLA 2NUFA 3KOWE 3J80S 3IWDA 4YY3M 4LFCE 2BJWA 2AHDA 2DZOB 2DXIA 3VDPA 2M5ZA 4LFAE 3UZUA 1XMQM 2F4VE 4FBKA 4JYAE 1K82A 4ZX2A 2WDEA 4IL1A 2DZNB 4DR1E 4O24A 5EP1A 1WHNA 4D80A 1XHBA 4A3VB 4WW0A 4DV1E 2RTXA 4LJ6A 1JQJC 3CF2A 3VYYA 1MX0A 3J7BA 1NSFA 1L1ZA 1DGGA 4FW9A 4LJAA 3AOEC 2V87A 4L8RC 4ZPXA 4QHSA 1Z59A 4TUWA 1WXRA 3ZU0A 3HU1A 2NXFA 2L09A 1N75A 3KXEC 2NA2A 4O5GA 2DFJA 1TDZA 3FUUA 4GH9A 4X65E 4UT3B 2LWXA 3ZCBB 3LMLA 5LMNM 1NVMA 4DV3E 1QAQA 3GRVA 1DQ3A 1T3TA 2W82A 2X4AA 4LF4M 1HNXM 4I8OA 4RF1A 3L29A 5LMUM 2NPPC 2Y0QA 4HLQA 3SHFA 2XSZD 3GPYA 4DSYA 1N32M 1X49A 2FGGA 3KFUG 3I51A 4MGKE 1DGFA 4OVZA 5EXSA 3UK6A 1IBLE 4D82A 1TGUA 4FVMA 4RF0A 4B3RE 2F5NA 1JK7A 5E26A 1K3XA 4BS9A 2VIIA 4LF6M 3H61A 3ZOQB 1ZBQA 2KXEA 1IBME 2KKNA 1TH3A 2ZAOA 4LFBM 4B3TM 4O4KA 3FUWA 1QYRA 2K4VA 1J09A 3U6EA 2YNMD 4AG6A 4OW0A 5F3WA 4QNRA 2HHHM 3FUXA 3TWLA 3PVSA 4EIWA 3VK8A 3AOGA 1Z5BA 3SMPA 2IHR1 5IT9C 2FOIC 4CHTB 4B7HA 3PSNA 3JAMC 1AUIA 1G8PA 1IXSB 3ADLA 1SXJC 3IB8A 2VQEE 2E1MA 3K2LA 4WURA 2R46A 4I4LA 3WHLA 5EJCA 4LGMA 1RQ0A 1SU1A 3VYXA 3J81C 1L2BA 4X8WA 2WDCA 2V86A 4JI5E 1HNZM 3QFNA 2CPNA 2UXDE 1GKIA 3PSOA 4DHLA 4G4OA 1GLNA 4JI6E 4F0ZA 5C1BA 2L7IA 2XGNA 3HHXA 2DMYA 1QFCA 4II7A 5BR8M 4ITQA 4BBYA 2L3JA 4DR4M 4IBIA 2VE7C 4FCVA 1H6UA 1R2ZA 1NNWA 3DSDA 3NBIA 2LXEA 3FTDA 1IN8A 4DR7E 1WHQA 2V8QB 2V89A 4F9AB 3IG8A 2DXNA 1YYKA 1G59A 3RQZA 4L4UA 4R7GA 2VQFE 3GRUA 4D81A 2F8BA 5ITUA 4LFCM 4LFAM 1J26A 2F4VM 3L28A 4KHPE 2WDFA 4JYAM 4DR1M 1TH2A 1KSFX 3IWCA 3SMSA 1S8EA 2XLJA 1JR3D 3E7BA 4P16A 4DV1M 1HR0E 4GHAA 2ZOAA 1ZAEA 1X37A 4BCAA 5LL6R 3LMMA 4XBOA 4K0KE 5GKNA 2HY1A 1IN4A 1L1TA 1KYIA 2R17A 4LJ9A 3BOSA 4H2BA 3GO8A 2Z4RA 4AKIA 5IT9S 2P6BA 4I5LC 3KOXE 2DWZB 4BLCA 3B9PA 3MSWA 4G4RA 4JI0E 5EP2A 3TWKA 1FJGE 3ZTVA 1Z2WA 4M0WA 3GLIB 2I7PA 4X65M 3F6HA 2L2NA 5CFFE 1X47A 4DV3M 5KO3A 3EIHA 3L27A 2Q2EB 3QFMA 4MOVA 3HHZA 2QCUA 2X8AA 5ITXA 3FIGA 3J80C 4TUGA 2DSYA 4V0VA 3SHGB 3UMMA 3GP1A 3TWMA 3HU3A 3CF6E 2BNKA 1DO2A 3SASA 3LQRA 4X66E 1L2DA 4B3RM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDX A;  5JJT A;  1UTE A;  1QHW A;  4M0V A;  1S70 A;  4MP0 A;  2WDC A;  4JA7 A;  2XMO A;  1OID A;  4KBP A;  3V4Y A;  5IOH A;  5DNY A;  2A22 A;  3QFN A;  1G5B A;  1T70 A;  5B8I A;  3C5W C;  3CK2 A;  5JPE A;  4Q7F A;  2HYO A;  4O43 A;  3H66 A;  2O8A A;  4H1S A;  4UT2 A;  2AHD A;  3QG5 C;  3PSO A;  4DHL A;  3ICF A;  2ZBM A;  1S3L A;  4DT2 A;  4B2O A;  4LAC C;  4H2F A;  2IE3 C;  2NPP C;  4F0Z A;  4XPN A;  1HP1 A;  4FBK A;  2HY1 A;  1QFC A;  3RL4 A;  3H69 A;  4ZX2 A;  2WDE A;  4IL1 A;  1XM7 A;  2Z1A A;  4H2G A;  2R17 A;  4DSY A;  4H2B A;  4UT3 A;  2IE4 C;  2QFP A;  2CV9 A;  1OIE A;  3EGH A;  1T71 A;  2Z06 A;  2BQ8 X;  3GVE A;  5J28 A;  2BCD A;  4FBW A;  3DSC A;  1KBP A;  4O24 A;  4IYP C;  3TGH A;  2P6B A;  3RL5 A;  1NNW A;  2WDD A;  1S3N A;  4I5L C;  3DSD A;  3E7A A;  4WWL A;  1UF3 A;  3T1I A;  1XZW A;  2HYP A;  4V0W A;  1II7 A;  3DW8 C;  1JK7 A;  4TUI A;  5INB A;  3ZTV A;  5GTU A;  1HPU A;  1Z2W A;  2QJC A;  1HO5 A;  1USH A;  1IT6 A;  3IVD A;  3IB7 A;  3HVQ A;  3H63 A;  1V73 A;  3H61 A;  1OI8 A;  3THO B;  4MOY A;  2KKN A;  3H62 B;  3RQZ A;  2O8G A;  4NZV A;  1WAR A;  4O4K A;  4FBQ A;  4G9J A;  3THN A;  1U32 A;  5JPF A;  3C9F A;  3K7W C;  4LU9 A;  2NYM C;  1TCO A;  4YKE A;  4ORB A;  1WAO 1;  3H60 A;  3QFM A;  4FCX A;  4J6O A;  2USH A;  1Z2X A;  4LTY A;  4V0X A;  3RL3 A;  3N5U A;  4MOV A;  3JYF A;  5F3W A;  5HPE A;  3K7V C;  3AV0 A;  3H64 A;  1S3M A;  1S95 A;  2YVT A;  4H1Y P;  3FGA C;  2JOG A;  3KBP A;  3P71 C;  3AUZ A;  1MF8 A;  3ZU0 A;  3PSN A;  2WDF A;  1W24 A;  4JA9 A;  5EQV A;  1M63 A;  1AUI A;  4HD0 A;  4ORA A;  2NXF A;  4TUG A;  3QFO A;  4V0V A;  4H2I A;  3QFK A;  3H68 A;  4UWQ A;  3IB8 A;  5C1V A;  2Z72 A;  4OR9 A;  4I5N C;  2IAE C;  2GJU A;  4O5G A;  2DFJ A;  1S8E A;  3H67 A;  2NYL C;  3LL8 A;  4KKZ A;  4UT3 B;  1FJM A;  2QFR A;  3EGG A;  3IVE A;  1SU1 A;  3E7B A;  4ORC A;  2Q8U A;  4ZVZ A; 
#chains in the Genus database with same CATH topology
 2XFT A;  4DV5 M;  1OAI A;  2CV1 A;  5A2Q S;  1B69 A;  1IFY A;  3P1X A;  1EE8 A;  1V34 A;  3V4Y A;  1WXQ A;  5IOH A;  4GIP A;  1IY0 A;  4M2Z A;  5BPV A;  3QG5 C;  2EPC A;  1OFI A;  2R4E A;  5FSW A;  3ILK A;  2HL7 A;  4AZF A;  5KL7 A;  2R76 A;  1UM8 A;  4GC5 A;  2HWJ A;  3EPJ A;  4MGZ E;  2JWS A;  1IBK M;  1D0M A;  2EPA A;  1YSY A;  2G5G X;  4WPY A;  2CV9 A;  2EMW A;  2EOH A;  2EOJ A;  2WDD A;  4IIW A;  2EM2 A;  2FV4 B;  2FNA A;  2DMI A;  4WSP A;  4V0W A;  1YE9 A;  1JB0 F;  4JI1 E;  4DR6 E;  1II7 A;  1YUB A;  2VQE M;  5IWA E;  1HPU A;  4Q35 B;  3SFZ A;  5AC5 A;  5AAS A;  3IVD A;  4OX9 E;  1VDD A;  2ELZ A;  3KOZ E;  2J7O A;  4AI6 A;  3GQ3 A;  3ZQJ A;  2YTG A;  2EMB A;  3HKP A;  5EXP A;  1GZ6 A;  4JI5 M;  4YKE A;  4ORB A;  4FCX A;  4LTY A;  2UXD M;  1MN3 A;  3AKZ A;  3NBX X;  1IM2 A;  4IBD A;  5AE3 A;  4JI6 M;  4R2C A;  4FK5 C;  3K9O A;  2MJ5 B;  3LCU A;  4B7F A;  3RFW A;  3QFO A;  1X48 A;  2EMC A;  2DAE A;  3J7Y p;  3AJI B;  5E6J A;  4FCW A;  1J7K A;  2IAE C;  2JA2 A;  1F4I A;  4R03 A;  2EN4 A;  2V88 A;  3UGJ A;  4DR7 M;  2DHY A;  2YU5 A;  3QAU A;  4F6M A;  1FJM A;  3RE8 A;  3I4Y A;  4DUY E;  3T38 A;  2EA0 A;  3FD9 A;  4PDG A;  4G4N A;  3GLF A;  2UUA E;  2CHQ A;  3GLI A;  3J7A S;  1L4S A;  4L5N C;  2C9C A;  2LTU A;  3HPS A;  4MM3 B;  1YSA C;  1XNQ E;  2V85 A;  2VQF M;  2I9I A;  4DT2 A;  2YTN A;  2KRK A;  2WZJ A;  4XPN A;  2DGC A;  4WXD A;  2DWN A;  2UUC E;  2LMZ A;  4R2P A;  4DV4 E;  4G3O A;  2EN8 A;  2EUC A;  2RKO A;  4MGH A;  1WJ7 A;  2BCD A;  2N3G A;  1N78 A;  4LF5 E;  4KHP M;  3EPK A;  3T1I A;  1XZW A;  4J8Z A;  3D8L A;  4JI7 E;  2B7T A;  1NHG C;  2N35 A;  1USH A;  1IT6 A;  2N3H A;  2DAG A;  3A46 A;  2XF3 A;  1K3W A;  2CE7 A;  3FTC A;  2O8G A;  3JTZ A;  1HR0 M;  2OQ4 A;  1PJJ A;  3THG A;  1WAO 1;  3C6M A;  4V0X A;  4GC9 A;  2CUZ A;  3H64 A;  1S95 A;  2YVT A;  2KHX A;  4LZZ A;  1N34 E;  3FRI A;  1OFH A;  4K0K M;  5FTK A;  4L8N A;  4L78 A;  2JY8 A;  1WIV A;  4NXN M;  4X64 E;  2JYA A;  3KS8 A;  2OO9 A;  4BHB A;  1I94 E;  3JR5 A;  3KZY A;  4R2Q A;  3HGI A;  1PM5 A;  2EZ6 A;  2J7N A;  4GRI A;  1S70 A;  4DV0 E;  3H62 B;  5A6J A;  1FJG M;  2LBS B;  1NY6 A;  2XMO A;  3KOY E;  3VKG A;  4M9Z A;  1T70 A;  1SG9 A;  1IN7 A;  4P7D A;  1DGH B;  1NJG A;  2AHM A;  3IG5 A;  2EPL X;  2O8A A;  1DI2 A;  3L25 A;  1YFH A;  4R2R A;  2EMI A;  1S3L A;  5LLQ A;  2EPN A;  3U6Q A;  1W5T A;  4NL4 H;  3HQ1 A;  1UBD C;  2M4I A;  3PNV A;  3LVW A;  1S3S A;  3MJ5 A;  2DRP A;  1UN6 B;  3T15 A;  3MK6 A;  1D0K A;  4AW4 A;  1G71 A;  5TSE A;  5EP3 A;  2A25 A;  2XZU A;  5DYG A;  2RGO A;  5GTU A;  1HQC A;  4F6N A;  1D2N A;  2VF1 A;  2CP8 A;  3DF6 A;  5JI3 E;  4IJD A;  2EOX A;  3THO B;  2UUB E;  4X66 M;  4IBC A;  1WAR A;  4LCB A;  2JPA A;  1VEK A;  2YT4 A;  4AQY E;  2EOM A;  4RNA A;  1OKS A;  1X3C A;  1O0W A;  2B9D A;  3AV0 A;  3D03 A;  3GPX A;  1KFV A;  1V92 A;  4Z8X A;  2DB2 A;  1W24 A;  2CHG A;  4JN6 A;  2MKN A;  5ITY A;  4JXJ A;  2XZF A;  3H67 A;  3HTX A;  3LL8 A;  4KKZ A;  1XNR E;  2YTO A;  4DR6 M;  5JJT A;  5C18 A;  4F9C B;  5IWA M;  1PGY A;  2CFO A;  4OX9 M;  2JOB A;  3EIE A;  3HJQ A;  4BBA A;  1YLA A;  2QBY B;  2HCB A;  1PJI A;  3MMP A;  2LH0 A;  2ERC A;  5EQT A;  3GRY A;  2EMY A;  2EPK X;  3ICF A;  3HX3 A;  1LV7 A;  3CF0 A;  4LAC C;  3U6O A;  2EMA A;  2EPU A;  4ZYE A;  2EOO A;  2QFP A;  3HU2 A;  4IBB A;  2YRH A;  2X49 A;  1R7R A;  1LTM A;  2MKD A;  1GL7 A;  1YYW A;  2EML A;  3D8B A;  2CT1 A;  4B7G A;  4QHT A;  3KWR A;  5INB A;  3I4V A;  2YRM A;  3HVQ A;  3QWL A;  2K9D A;  1OI8 A;  3U6D A;  4WSG A;  2VDB B;  1YUI A;  4NXM E;  3LLH A;  1JK1 A;  5JPF A;  2L92 A;  2D7H A;  2XSZ A;  2UUA M;  2QEN A;  2ZM6 E;  5A6B A;  3A42 A;  2JXP A;  1TH4 A;  2USH A;  2EN1 A;  1A1G A;  1QVR A;  2JXN A;  2JNH A;  3U5Z B;  3TE6 A;  2EM5 A;  1DGH A;  4PD2 A;  1I4W A;  2D9H A;  2Y20 A;  1R5L A;  5A2Q C;  4Z6Y A;  2EOY A;  1XNQ M;  1QUS A;  1MF8 A;  2EM8 A;  2LVO C;  5ITX E;  3H09 A;  5KL2 A;  5EQV A;  7CAT A;  1M63 A;  4HD0 A;  2LVH A;  3K6Q A;  2KW0 A;  3PXG A;  4WYQ B;  1EKZ A;  3QFK A;  2UUC M;  3VKH A;  4DV4 M;  1MU5 A;  2O5R A;  4X9J A;  4FD2 A;  4LF5 M;  3R8F A;  3FYD A;  1XC8 A;  1DV0 A;  4RHB B;  2LTS A;  4NSO B;  3K7W C;  1UTE A;  2JY9 A;  4M9V C;  4JI7 M;  2LTR A;  2JP9 A;  2CTD A;  2MH8 A;  3C4T A;  4JA7 A;  1KJK A;  3GRR A;  1PKP A;  2JY5 A;  4RH8 A;  3J7A G;  1IN5 A;  1IXZ A;  4HEI A;  3RMP A;  3SBJ A;  4DUZ E;  2DIX A;  4O43 A;  4XGI A;  2NUG A;  1A1I A;  4F2L A;  3BID A;  4CIS A;  4NC6 A;  2LVQ D;  2R0I A;  4Q7J A;  3T6P A;  2OPF A;  1N34 M;  3B7Z A;  2KZU A;  3KP0 E;  4FWH A;  4WFT A;  1X6H A;  3FKE A;  1DGB A;  5T6J A;  4IJF A;  4X64 M;  5JI2 E;  1TR8 A;  4LRT A;  1A1J A;  2ENA A;  2GNO A;  1EIJ A;  1I94 M;  1C1K A;  3CTW B;  2QZ4 A;  2KNZ A;  2L2K B;  1AIP C;  1QNT A;  3U6S A;  5KL3 A;  3TQS A;  4LF8 E;  4DV0 M;  3VDU A;  4G9J A;  2KON A;  1T4O A;  1SXJ B;  3K8Z A;  2D7G A;  2NQ8 C;  4GHL A;  2WSF F;  1HJP A;  2EO2 A;  1FKA E;  3W67 A;  2L7H A;  1Z2X A;  2BWE A;  3N5U A;  4KO8 A;  2QBY A;  1EH6 A;  3GLF B;  4R2D A;  1WHC A;  3E9S A;  3FYC A;  3HZJ A;  2MDR A;  3P71 C;  2F5Q A;  2D7E A;  3M0E A;  3ECR A;  5H37 D;  3GQ4 A;  3T1Y E;  4H2I A;  2NUE A;  2RS7 A;  3C6K A;  2Z72 A;  4LGY A;  2MR9 A;  3FE3 A;  4AG5 A;  5ADZ A;  3W0L B;  2EP3 A;  2C5R A;  3IVE A;  4NSR A;  3TPZ A;  3AOE A;  1QZM A;  1Y8G A;  4LG2 A;  1ZQ9 A;  1ZV1 A;  2LHG A;  2DAI A;  2UUB M;  1OJL A;  4KT0 F;  4M30 A;  4P78 A;  3GLI E;  2MRO B;  1ORY B;  1T4L B;  2R65 A;  4AQY M;  5ITR A;  1IBL M;  2RSM A;  2L4E A;  1PJQ A;  2YSP A;  4LJ4 A;  3HHY A;  3U5Z A;  3CGW A;  2FE8 A;  4KZS A;  1JR3 A;  3DSC A;  4DBG B;  3KDS E;  3KVW A;  1Z5C A;  1IBM M;  4IBF A;  5A69 A;  3HWS A;  4G4Q A;  4KLN A;  3MHS C;  1NV8 A;  1KYQ A;  1QDR A;  1N32 E;  4GMQ A;  3EPH A;  5ITQ A;  2Z3X A;  1A1F A;  3J27 B;  3E4R A;  4JI2 E;  2YTQ A;  1HQY E;  3C4B A;  1XNR M;  2DLQ A;  1AUA A;  3HJ8 A;  2KRU A;  3THN A;  1U32 A;  2YFQ A;  1R4G A;  2WCC 3;  2NYM C;  2Z4S A;  1TCO A;  3J2P B;  2VF7 A;  4LF6 E;  1NNJ A;  4LJ8 A;  2HKJ A;  2I7N A;  3JYF A;  4LFB E;  1S3M A;  4H1Y P;  4B3T E;  1W5S A;  2JWO A;  2K7I A;  3KBP A;  5AE1 A;  3DOA A;  4B08 A;  4JA9 A;  5KQD A;  2HHH E;  4UWQ A;  1G41 A;  5FTJ A;  2YR0 A;  1R6B X;  1ZR9 A;  3PFI A;  1IQO A;  1MJG M;  2BWB A;  4QOS A;  2BDX A;  3KSJ A;  3U61 A;  4X62 E;  1F2I G;  4MP0 A;  4M9S A;  5IRE B;  4N4R B;  3EQ1 A;  4NXM M;  3ZC7 B;  2G8L A;  1V33 A;  4RKU F;  3H66 A;  2LRS A;  2ZTD A;  2M1S A;  3GLH A;  1R2Y A;  1A1H A;  1G2F C;  3U60 B;  4B2O A;  2EMG A;  1TN9 A;  1SXJ A;  2ZM6 M;  2F5P A;  1NY5 A;  1OTR A;  4F2J C;  3H69 A;  1PJT A;  3R9X B;  2LCE A;  2IE4 C;  4MB7 A;  1RMD A;  1E94 E;  3FUT A;  3IWB A;  2A5Y B;  5J28 A;  3I04 M;  1KBP A;  3LVV A;  4IJE A;  5EP4 A;  1S3N A;  4G6Z A;  2B3T A;  1TF0 B;  2LVN C;  4LF9 E;  5BR8 E;  4YHH E;  3A45 A;  5AE2 A;  1GVN A;  1BBO A;  4GKK E;  4IBG A;  1PRB A;  2YEQ A;  2RQL A;  4MOY A;  3SYL A;  5KQ8 A;  2V1U A;  3H4J A;  3UJN A;  4NZV A;  5EXX A;  1A1K A;  1EH8 A;  2EN3 A;  3HHW A;  3C58 A;  4B3M E;  1GO5 A;  2R62 A;  4DUZ M;  5HPE A;  3C9P A;  3HJS A;  2RGH A;  3F92 A;  3HXL A;  3BF2 A;  2Y0T A;  3U6L A;  4R8O A;  4JI3 E;  4DV6 E;  4MLV A;  3FLO A;  4CGY B;  1XXH B;  2EMZ A;  1QAM A;  2DI0 A;  4ZVZ A;  1TF6 A;  1QHW A;  4DV7 E;  2KNA A;  2L8T A;  3RGP A;  4JI8 E;  2CV2 A;  2GPI A;  4OOG C;  3T1H E;  5B8I A;  4LY6 A;  4P17 A;  3CK2 A;  4DR2 E;  2HYO A;  2C99 A;  5FTM A;  4LF8 M;  1QZE A;  1T4N A;  4PDI A;  3KS4 A;  3FRH A;  1A1L A;  2ZBM A;  3FTE A;  3A98 B;  4JV5 E;  1ZBT A;  2EL4 A;  4LZJ A;  2BBG A;  4H2G A;  4JI0 M;  4LF7 E;  1N3G A;  1DO0 A;  2K0B X;  3GVE A;  4FBW A;  3GLG B;  4KWY A;  1QAO A;  4HEO A;  2QP9 X;  2F5O A;  2O01 F;  3T1Y M;  4GEW A;  2QPA A;  3NWL A;  3DW8 C;  2LUQ A;  1IQP A;  3SAU A;  2QJC A;  2HC5 A;  3HPZ A;  1HNW E;  2M7Q A;  2E5L E;  1C7Y A;  4FBQ A;  3KSX A;  1RC7 A;  3L26 A;  2H1R A;  2LVA A;  3FTF A;  1GQE A;  1G2D C;  3L2A A;  1IXR C;  4I5S A;  4DR5 E;  2MDG A;  3GPP A;  1FNN A;  2HAK A;  3U60 A;  5IZ7 D;  1XB2 B;  3Q8G A;  3K92 A;  3C3E A;  2YZT A;  4L6V 6;  1GL6 A;  4OR9 A;  4JI4 E;  2L4F A;  4QOZ C;  2Z7J A;  1XWI A;  1VQ1 A;  4F9B B;  1IMU A;  2EM3 A;  2V6Z M;  2EPM X;  1GTK A;  1WRJ A;  1YYO A;  2UU9 E;  3ADG A;  4CJ6 A;  1YPN A;  2YU8 A;  4KBP A;  2L6O A;  4JI2 M;  2A22 A;  3C5W C;  4Q7F A;  4GEQ B;  1VEJ A;  4DV5 E;  3TL4 X;  2EM7 A;  3ADJ A;  4H2F A;  3GQ5 A;  4Q28 A;  3RL4 A;  4JI1 M;  1XM7 A;  4MGY E;  2KOU A;  2OOA A;  4DV2 E;  1SR9 A;  3SC3 A;  3EGH A;  2UXB E;  2CWB A;  2ZAM A;  4ANR A;  2EM0 A;  2RPC A;  3TGH A;  4IYP C;  4B3S E;  4AKG A;  2JP7 A;  3GPU A;  2DNA A;  2K6B A;  2OOB A;  3WHK A;  2YRK A;  2WBT A;  2R45 A;  2L3C A;  2DWL A;  1IBK E;  1Q3B A;  1HO5 A;  1OIP A;  1XMO E;  1XXH A;  2LJH A;  3OTO E;  5FTL A;  4GKJ E;  4FWG A;  3RGS A;  4X62 M;  2L33 A;  4GIT A;  4PCZ A;  1UIL A;  1STU A;  4BC9 A;  2B7V A;  2KEB A;  2XEP A;  2MGW A;  1N33 E;  4M9X A;  2YTD A;  3AL0 C;  5KPZ A;  3VK6 A;  3AUZ A;  1J5E E;  4BC7 A;  2ODR D;  4DUY M;  2KHH A;  3M99 B;  1Z1B A;  4F54 A;  2QHO B;  2EMF A;  2LE2 A;  2RS6 A;  3VFD A;  3GLG A;  4IS1 C;  1NJF A;  4LF9 M;  2Q8U A;  1N36 E;  4YHH M;  2JUJ A;  4IBJ A;  4GKK M;  2EJ4 A;  1L2C A;  4FCT A;  4R2S A;  5AC4 A;  4IBK A;  5DNY A;  4DR3 E;  2EKF A;  4M0D A;  1BBG A;  3JU0 A;  4H1S A;  2WBS A;  1IY1 A;  1NNU C;  4B3M M;  2EN6 A;  2CV0 A;  2DHR A;  2EN2 A;  3VK7 A;  2ZBK B;  4UT3 A;  1Q3C A;  2C9O A;  1OIE A;  2Z06 A;  3U6P A;  4QNM A;  1JR3 E;  2UXC E;  3SYK A;  2JVA A;  2HYP A;  1HT2 E;  3SAV A;  1X5W A;  2J5Y A;  4JI3 M;  4DV6 M;  2ENH A;  2DLK A;  3OML A;  1WJP A;  2EL5 A;  3H63 A;  1V73 A;  3DA1 A;  2J7J A;  2ZO9 B;  3W68 A;  4YY3 E;  4R2E A;  1Q39 A;  1E9S A;  4DV7 M;  5FLX C;  4HL4 A;  2LUP B;  1L8Q A;  4JI8 M;  1XMQ E;  3ZH9 B;  2M60 A;  4LJ7 A;  5KPR A;  5EXT A;  8CAT A;  2EE8 A;  3T1H M;  4R2A A;  4DR2 M;  2DEN A;  3U61 B;  4NOO B;  3V76 A;  2CHV A;  3SAW A;  3FGA C;  2JOG A;  4JV5 M;  2C96 A;  5L8R F;  3FUV A;  4NRV A;  4MH0 E;  3GLH B;  2GLI A;  1OIZ A;  4LF7 M;  1Q02 A;  4I5N C;  2GJU A;  3MHH C;  2FFJ A;  3KP1 E;  4AKH A;  2MC6 A;  3VLF B;  1EH7 A;  2F5S A;  4ORC A;  1GAB A;  4NXN E;  4BHC A;  3EPL A;  3U6C A;  2B3T B;  3JR4 A;  3Q8X A;  2YTE A;  1QQW A;  1HNW M;  1VEG A;  3JAM S;  1QDT A;  5JPE A;  3ADI A;  2E5L M;  1WR1 B;  4UT2 A;  3E0J A;  3B74 A;  3UK3 C;  1ZMV A;  3TQM A;  5DYI A;  2IE3 C;  2YTP A;  3GLH E;  3F6G A;  2G7H A;  1SXJ E;  4REZ A;  2Z1A A;  2R18 A;  4BB9 A;  2XFS A;  2YSO A;  2DAM A;  4DR5 M;  3M7G A;  3J81 S;  3GLF E;  3RL5 A;  2BB8 A;  3E7A A;  4WWL A;  2V1C A;  1UF3 A;  2N8X A;  4BMJ A;  4FWD A;  2DWM A;  2EOR A;  4DKK A;  5LMN E;  4TUI A;  3VHT B;  3AFH A;  4JI4 M;  3H4M A;  3M6A A;  4L16 A;  2KNV A;  3BBZ A;  1T43 A;  4LF4 E;  1HNX E;  2C98 A;  1TDH A;  2V83 A;  2EOE A;  2WSE F;  1SXJ D;  5LMU E;  2UU9 M;  2QNJ A;  3LQQ A;  4LJ5 A;  4IBE A;  2EQ3 A;  3RL3 A;  1TF3 A;  1HT1 E;  2DXL A;  2YQZ A;  4NHR A;  2P5T A;  5KPT A;  1QAN A;  1N77 A;  2XH9 A;  2YWQ A;  2CEA A;  1AAY A;  4ORA A;  4MGI E;  3PNY A;  4DV2 M;  3H68 A;  5ITT A;  2MC5 A;  5C1V A;  1ZAA C;  4R71 A;  2UXB M;  3KW6 A;  4I81 A;  4B3S M;  1LLM C;  1IN6 A;  2QFR A;  2KZS A;  3EGG A;  4S12 A;  1E32 A;  5KL5 A;  1XMO M;  1MGT A;  2DVW B;  2LV2 A;  1G5B A;  3U6M A;  3OTO M;  4GKJ M;  2EN7 A;  4NRW A;  1NHW C;  3DJW A;  1Z5A A;  1Z6T A;  2KA6 B;  3K1J A;  5FLX S;  2KDL A;  3DFZ A;  5DFL A;  4L15 A;  1UHZ A;  2HJJ A;  1YZ9 A;  1HP1 A;  3MHV C;  2LNH C;  2ELY A;  2EMH A;  4KOD A;  1N33 M;  2EOI A;  4OU7 A;  2BJV A;  1T71 A;  3DZD A;  1IY2 A;  2BQ8 X;  1J5E M;  2JY6 B;  4LRS A;  2L2M A;  1BB8 A;  3SAR A;  4XK8 F;  1QU6 A;  3IB7 A;  2JY7 A;  1TTE A;  1HNZ E;  2HGH A;  1RU3 A;  2LHC A;  3I01 M;  2R6F A;  2FTX B;  4DMI A;  3K9P A;  1IQS A;  5KL4 A;  3IHP A;  1G3I A;  1N36 M;  3SAT A;  2H36 X;  3C9F A;  4LU9 A;  2K47 A;  1X6F A;  2EOF A;  2RSI A;  4DR3 M;  2JR1 A;  3H60 A;  4J6O A;  3W0F A;  2EPX A;  2FS1 A;  4DR4 E;  3K7V C;  2Y21 A;  4OVZ B;  2R4J A;  1P47 A;  2L6M A;  2JOX A;  5FTN A;  1OQY A;  2NAB A;  2GHF A;  2VRD A;  4R3D A;  4PT5 A;  4HTG A;  1A5T A;  2NYL C;  2UXC M;  1E9R A;  4W5W A;  4WXC A;  1G4A E;  2EPZ A;  4M0V A;  2ZAN A;  1OID A;  2WZO A;  2ODR C;  2EWL A;  2NUF A;  3KOW E;  3J80 S;  3IWD A;  4YY3 M;  4LFC E;  2BJW A;  2AHD A;  2DZO B;  2DXI A;  3VDP A;  2M5Z A;  4LFA E;  4ZYH A;  2I13 A;  3UZU A;  1XMQ M;  2F4V E;  4FBK A;  4JYA E;  1K82 A;  4ZX2 A;  2WDE A;  4IL1 A;  2O25 A;  2DZN B;  4DR1 E;  4ZYG A;  4O24 A;  5EP1 A;  2EL6 A;  2ZTC A;  1WHN A;  4D80 A;  1XHB A;  2FH0 A;  4A3V B;  4WX9 A;  1T39 A;  4WW0 A;  1T38 A;  2RTX A;  3VYY A;  4LJ6 A;  1JQJ C;  3CF2 A;  4DV1 E;  1MX0 A;  1YUJ A;  2LO3 A;  1XXH E;  3J7B A;  3L00 A;  1NSF A;  1L1Z A;  1DGG A;  4FW9 A;  1MEY C;  2YTF A;  2E72 A;  4LJA A;  3AOE C;  2V87 A;  2H5X A;  4L8R C;  4ZPX A;  4QHS A;  1Z59 A;  4TUW A;  1WXR A;  3ZU0 A;  3HU1 A;  2NXF A;  2L09 A;  1N75 A;  3KXE C;  2NA2 A;  4O5G A;  2DFJ A;  1TDZ A;  3BXW A;  3FUU A;  4GH9 A;  4X65 E;  4UT3 B;  2RRU A;  2LWX A;  2EQ0 A;  3GLG E;  3ZCB B;  3LML A;  5LMN M;  1D0L A;  3HY5 A;  1NVM A;  4DV3 E;  1QAQ A;  3GRV A;  1DQ3 A;  3QYB A;  1WGN A;  2VF8 A;  1T3T A;  2W82 A;  2X4A A;  4LF4 M;  1HNX M;  4I8O A;  3KZZ A;  4RF1 A;  3L29 A;  5LMU M;  2CRU A;  2NPP C;  2Y0Q A;  3C3D A;  4HLQ A;  3SHF A;  2XSZ D;  2PRT A;  3GPY A;  4DSY A;  1N32 M;  1X49 A;  2FGG A;  5A6B D;  3KFU G;  2R44 A;  3I51 A;  4MGK E;  2GQF A;  1DGF A;  4OVZ A;  5EXS A;  3UK6 A;  1IBL E;  4D82 A;  1TGU A;  4FVM A;  4RF0 A;  1NEI A;  2F5N A;  4B3R E;  5A6A A;  1PDA A;  1JK7 A;  5E26 A;  1K3X A;  4BS9 A;  1DGC A;  2VII A;  4LF6 M;  2EOS A;  3H61 A;  2LJU A;  3ZOQ B;  1ZBQ A;  2KXE A;  1BVS A;  1IBM E;  2KKN A;  1TH3 A;  2ZAO A;  4LFB M;  2LT7 A;  4B3T M;  4O4K A;  3FUW A;  3B7Q A;  1QYR A;  2K4V A;  1J09 A;  4UN2 B;  3U6E A;  3BBG A;  1JK2 A;  2YNM D;  4AG6 A;  1T6O A;  2Z8Y M;  4OW0 A;  5F3W A;  4QNR A;  2HHH M;  3FUX A;  3TWL A;  3PVS A;  4EIW A;  3VK8 A;  3AOG A;  1Z5B A;  3SMP A;  2IHR 1;  5IT9 C;  2FOI C;  4CHT B;  1ZMW A;  4B7H A;  4MLQ A;  3PSN A;  3JAM C;  1AUI A;  1G8P A;  2JZ1 A;  1IXS B;  2EOQ A;  3ADL A;  2R1F A;  1SXJ C;  3IB8 A;  2VQE E;  2E1M A;  3K2L A;  4WUR A;  2EMX A;  1VDL A;  2R46 A;  4I4L A;  3WHL A;  5EJC A;  4LGM A;  2EMK A;  1RQ0 A;  5A6K A;  1SU1 A;  3QYE A;  2G3Q A;  5KL6 A;  3VYX A;  3J81 C;  1L2B A;  4X8W A;  2WDC A;  2V86 A;  4JI5 E;  1HNZ M;  1AH5 A;  3QFN A;  2CPN A;  2UXD E;  1GKI A;  3E21 A;  2EKK A;  3PSO A;  5IXM B;  4DHL A;  1UFZ A;  4G4O A;  1GLN A;  1QUT A;  4JI6 E;  4F0Z A;  5C1B A;  2L7I A;  4CIZ A;  2XGN A;  3HHX A;  2DMY A;  2ENC A;  1QFC A;  4II7 A;  5BR8 M;  4ITQ A;  4F1I A;  4BBY A;  2DKL A;  2L3J A;  4DR4 M;  4IBI A;  2VE7 C;  4FCV A;  1H6U A;  2EM4 A;  1R2Z A;  1NNW A;  3DSD A;  3NBI A;  2APL A;  2LXE A;  3FTD A;  1IN8 A;  2YPN A;  4DR7 E;  2EPP A;  1WHQ A;  2V8Q B;  2QQ8 A;  2V89 A;  4F9A B;  3IG8 A;  4ZYD A;  2DXN A;  1EFU B;  1YYK A;  1G59 A;  3RQZ A;  4L4U A;  4R7G A;  1ZU1 A;  2VQF E;  3GRU A;  2EOZ A;  2YTI A;  4D81 A;  2EM6 A;  2F8B A;  1NV9 A;  5ITU A;  4LFC M;  4LFA M;  1J26 A;  5IV8 B;  2F4V M;  3L28 A;  4KHP E;  2WDF A;  4JYA M;  4Y28 F;  4DR1 M;  2YTJ A;  1TH2 A;  1KSF X;  3B7N A;  3LCV B;  1NCS A;  3IWC A;  3SMS A;  1S8E A;  1WGL A;  2XLJ A;  1JR3 D;  3E7B A;  2EPO A;  4P16 A;  4DV1 M;  1HR0 E;  4GHA A;  2ZOA A;  1ZAE A;  2DAK A;  3B89 A;  2LBC A;  1X37 A;  3BGH A;  4BCA A;  5LL6 R;  2EJS A;  1CUK A;  2WSC F;  3LMM A;  2EPR A;  4XBO A;  4K0K E;  5GKN A;  2HY1 A;  1IN4 A;  1L1T A;  1KYI A;  2R17 A;  4LJ9 A;  3BOS A;  4H2B A;  3GO8 A;  2Z4R A;  4AKI A;  1GJS A;  5IT9 S;  2P6B A;  2LVP C;  4I5L C;  3KOX E;  1SFE A;  1X6E A;  2M9A A;  3LW5 F;  2CSH A;  2DWZ B;  4BLC A;  1IXS A;  3B9P A;  3MSW A;  4G4R A;  4JI0 E;  5EP2 A;  3TWK A;  1FJG E;  3ZTV A;  1Z2W A;  4WP2 A;  4M0W A;  1GJT A;  3GLI B;  2I7P A;  1P3Q Q;  3IEC A;  4X65 M;  3F6H A;  2L2N A;  5CFF E;  1X47 A;  1VG5 A;  4DV3 M;  5KO3 A;  1OAO C;  3EIH A;  2DZL A;  1PJS A;  3L27 A;  2Q2E B;  3QFM A;  4MOV A;  3HHZ A;  1ZMU A;  2L2D A;  2QCU A;  2X8A A;  2ADR A;  5ITX A;  3FIG A;  3J80 C;  1NO1 A;  4TUG A;  2DSY A;  4V0V A;  2EQ1 A;  3SHG B;  3UMM A;  3GP1 A;  3TWM A;  3HU3 A;  3CF6 E;  2BNK A;  2JZ0 A;  4GZN C;  2QSF X;  1DO2 A;  3SAS A;  3LQR A;  4X66 E;  1L2D A;  4B3R M;  2WBU A;  2EM9 A;  3E46 A; 
#chains in the Genus database with same CATH homology
 2XFT A;  4DV5 M;  2CV1 A;  5A2Q S;  3P1X A;  1EE8 A;  3V4Y A;  1WXQ A;  5IOH A;  4GIP A;  1IY0 A;  4M2Z A;  5BPV A;  3QG5 C;  1OFI A;  2R4E A;  5FSW A;  3ILK A;  2HL7 A;  4AZF A;  1UM8 A;  4GC5 A;  4MGZ E;  1IBK M;  4WPY A;  1YSY A;  2G5G X;  2CV9 A;  2WDD A;  4IIW A;  2FV4 B;  2FNA A;  4WSP A;  4V0W A;  1YE9 A;  1II7 A;  4JI1 E;  4DR6 E;  1YUB A;  2VQE M;  5IWA E;  1HPU A;  3SFZ A;  5AAS A;  3IVD A;  4OX9 E;  1VDD A;  3KOZ E;  2J7O A;  4AI6 A;  3GQ3 A;  3HKP A;  5EXP A;  1GZ6 A;  4JI5 M;  4YKE A;  4ORB A;  4FCX A;  4LTY A;  2UXD M;  3AKZ A;  1IM2 A;  4IBD A;  5AE3 A;  4JI6 M;  4B7F A;  3RFW A;  3QFO A;  1X48 A;  3J7Y p;  3AJI B;  5E6J A;  4FCW A;  1J7K A;  2IAE C;  2JA2 A;  4R03 A;  2V88 A;  3UGJ A;  4DR7 M;  3QAU A;  1FJM A;  3RE8 A;  3I4Y A;  4DUY E;  3T38 A;  2EA0 A;  3FD9 A;  4PDG A;  4G4N A;  3GLF A;  2UUA E;  2CHQ A;  3GLI A;  3J7A S;  4L5N C;  2C9C A;  3HPS A;  4MM3 B;  1XNQ E;  2V85 A;  2VQF M;  4DT2 A;  2KRK A;  4XPN A;  2DWN A;  2UUC E;  2LMZ A;  4DV4 E;  2EUC A;  2RKO A;  4MGH A;  2BCD A;  2N3G A;  1N78 A;  4LF5 E;  4KHP M;  3T1I A;  1XZW A;  4J8Z A;  3D8L A;  4JI7 E;  2B7T A;  1NHG C;  1USH A;  1IT6 A;  2N3H A;  3A46 A;  2XF3 A;  1K3W A;  2CE7 A;  3FTC A;  2O8G A;  3JTZ A;  1HR0 M;  2OQ4 A;  1PJJ A;  3THG A;  1WAO 1;  4V0X A;  4GC9 A;  2CUZ A;  3H64 A;  1S95 A;  2YVT A;  2KHX A;  4LZZ A;  1N34 E;  1OFH A;  4K0K M;  5FTK A;  4L8N A;  4L78 A;  4NXN M;  4X64 E;  3KS8 A;  1I94 E;  3JR5 A;  3HGI A;  1PM5 A;  2EZ6 A;  2J7N A;  4GRI A;  1S70 A;  4DV0 E;  3H62 B;  1FJG M;  2LBS B;  1NY6 A;  2XMO A;  3KOY E;  3VKG A;  4M9Z A;  1T70 A;  1IN7 A;  4P7D A;  1DGH B;  1NJG A;  2AHM A;  3IG5 A;  2O8A A;  1DI2 A;  3L25 A;  1S3L A;  3U6Q A;  1W5T A;  4NL4 H;  3HQ1 A;  2M4I A;  3PNV A;  3LVW A;  1S3S A;  3MJ5 A;  3T15 A;  3MK6 A;  4AW4 A;  5EP3 A;  2XZU A;  5DYG A;  2RGO A;  5GTU A;  1HQC A;  1D2N A;  2VF1 A;  3DF6 A;  5JI3 E;  3THO B;  2UUB E;  4X66 M;  4IBC A;  1WAR A;  4LCB A;  2YT4 A;  4AQY E;  4RNA A;  1O0W A;  2B9D A;  3AV0 A;  3D03 A;  3GPX A;  1KFV A;  4Z8X A;  2DB2 A;  1W24 A;  2CHG A;  4JN6 A;  5ITY A;  4JXJ A;  2XZF A;  3H67 A;  3HTX A;  3LL8 A;  4KKZ A;  1XNR E;  4DR6 M;  5JJT A;  5C18 A;  4F9C B;  5IWA M;  2CFO A;  4OX9 M;  2JOB A;  3EIE A;  3HJQ A;  4BBA A;  2QBY B;  2HCB A;  1PJI A;  5EQT A;  2LH0 A;  2ERC A;  3GRY A;  3ICF A;  1LV7 A;  3CF0 A;  4LAC C;  3U6O A;  2QFP A;  3HU2 A;  4IBB A;  2X49 A;  1R7R A;  1GL7 A;  1YYW A;  3D8B A;  4B7G A;  4QHT A;  3KWR A;  5INB A;  3I4V A;  3HVQ A;  3QWL A;  1OI8 A;  3U6D A;  4NXM E;  3LLH A;  5JPF A;  2L92 A;  2D7H A;  2XSZ A;  2UUA M;  2QEN A;  2ZM6 E;  3A42 A;  1TH4 A;  2USH A;  1QVR A;  3U5Z B;  3TE6 A;  1DGH A;  4PD2 A;  1I4W A;  5A2Q C;  2Y20 A;  4Z6Y A;  1XNQ M;  1MF8 A;  3H09 A;  5ITX E;  5EQV A;  7CAT A;  1M63 A;  4HD0 A;  3K6Q A;  2KW0 A;  3PXG A;  4WYQ B;  1EKZ A;  3QFK A;  2UUC M;  3VKH A;  4DV4 M;  1MU5 A;  2O5R A;  4FD2 A;  4LF5 M;  3R8F A;  3FYD A;  1XC8 A;  2LTS A;  3K7W C;  4NSO B;  1UTE A;  2JY9 A;  4JI7 M;  2LTR A;  3C4T A;  4JA7 A;  3GRR A;  1PKP A;  3J7A G;  1IN5 A;  1IXZ A;  3RMP A;  3SBJ A;  4DUZ E;  2DIX A;  4O43 A;  4XGI A;  2NUG A;  4CIS A;  2OPF A;  1N34 M;  2KZU A;  3KP0 E;  4FWH A;  4WFT A;  3FKE A;  1DGB A;  5T6J A;  4IJF A;  4X64 M;  5JI2 E;  4LRT A;  1I94 M;  1C1K A;  3CTW B;  2QZ4 A;  2L2K B;  3U6S A;  3TQS A;  4LF8 E;  4DV0 M;  3VDU A;  4G9J A;  2KON A;  1T4O A;  1SXJ B;  3K8Z A;  2D7G A;  2NQ8 C;  4GHL A;  2EO2 A;  1FKA E;  2L7H A;  1Z2X A;  3N5U A;  4KO8 A;  2QBY A;  3GLF B;  3E9S A;  3FYC A;  2MDR A;  3P71 C;  2F5Q A;  2D7E A;  3M0E A;  5H37 D;  3GQ4 A;  3T1Y E;  4H2I A;  2NUE A;  2RS7 A;  2Z72 A;  4LGY A;  4AG5 A;  5ADZ A;  3W0L B;  2C5R A;  3IVE A;  4NSR A;  3TPZ A;  3AOE A;  1QZM A;  4LG2 A;  1ZQ9 A;  2UUB M;  1OJL A;  4M30 A;  4P78 A;  1ORY B;  1T4L B;  2R65 A;  4AQY M;  5ITR A;  1IBL M;  2RSM A;  4LJ4 A;  3HHY A;  3U5Z A;  2FE8 A;  4KZS A;  1JR3 A;  3DSC A;  3KDS E;  3KVW A;  1Z5C A;  1IBM M;  4IBF A;  3HWS A;  4G4Q A;  4KLN A;  1N32 E;  4GMQ A;  5ITQ A;  2Z3X A;  3J27 B;  3E4R A;  4JI2 E;  1HQY E;  3C4B A;  1XNR M;  3HJ8 A;  2KRU A;  1U32 A;  3THN A;  2YFQ A;  2NYM C;  2Z4S A;  1TCO A;  3J2P B;  4LF6 E;  1NNJ A;  4LJ8 A;  2HKJ A;  2I7N A;  3JYF A;  4LFB E;  1S3M A;  4H1Y P;  4B3T E;  1W5S A;  2JWO A;  3KBP A;  5AE1 A;  3DOA A;  4B08 A;  4JA9 A;  5KQD A;  2HHH E;  4UWQ A;  1G41 A;  5FTJ A;  2YR0 A;  1R6B X;  3PFI A;  4QOS A;  2BDX A;  3KSJ A;  3U61 A;  4X62 E;  4MP0 A;  4M9S A;  5IRE B;  4NXM M;  3ZC7 B;  2G8L A;  3H66 A;  2LRS A;  2M1S A;  3GLH A;  1R2Y A;  3U60 B;  4B2O A;  1SXJ A;  2ZM6 M;  2F5P A;  1NY5 A;  3H69 A;  3R9X B;  2IE4 C;  4MB7 A;  1E94 E;  3FUT A;  3IWB A;  2A5Y B;  5J28 A;  1KBP A;  3LVV A;  4IJE A;  5EP4 A;  1S3N A;  4G6Z A;  4LF9 E;  5BR8 E;  4YHH E;  3A45 A;  5AE2 A;  1GVN A;  4GKK E;  4IBG A;  2YEQ A;  4MOY A;  3SYL A;  5KQ8 A;  2V1U A;  4NZV A;  3UJN A;  5EXX A;  3HHW A;  3C58 A;  4B3M E;  2R62 A;  4DUZ M;  5HPE A;  3HJS A;  2RGH A;  3HXL A;  2Y0T A;  3U6L A;  4R8O A;  4JI3 E;  4DV6 E;  3FLO A;  4CGY B;  1XXH B;  1QAM A;  4ZVZ A;  1QHW A;  4DV7 E;  2L8T A;  3RGP A;  4JI8 E;  2CV2 A;  4OOG C;  3T1H E;  5B8I A;  4LY6 A;  3CK2 A;  4DR2 E;  2HYO A;  2C99 A;  5FTM A;  4LF8 M;  1T4N A;  4PDI A;  3KS4 A;  2ZBM A;  3FTE A;  3A98 B;  4JV5 E;  1ZBT A;  4LZJ A;  4H2G A;  4JI0 M;  4LF7 E;  1DO0 A;  3GVE A;  4FBW A;  3GLG B;  1QAO A;  2QP9 X;  2F5O A;  3T1Y M;  2QPA A;  3NWL A;  3DW8 C;  2LUQ A;  1IQP A;  3SAU A;  2QJC A;  3HPZ A;  1HNW E;  2M7Q A;  2E5L E;  4FBQ A;  3KSX A;  1RC7 A;  3L26 A;  2H1R A;  3FTF A;  1GQE A;  3L2A A;  1IXR C;  4I5S A;  4DR5 E;  3GPP A;  1FNN A;  3U60 A;  5IZ7 D;  3K92 A;  2YZT A;  1GL6 A;  4OR9 A;  4JI4 E;  4QOZ C;  2Z7J A;  1XWI A;  4F9B B;  2V6Z M;  1YYO A;  2UU9 E;  3ADG A;  4KBP A;  2L6O A;  4JI2 M;  2A22 A;  3C5W C;  4Q7F A;  4GEQ B;  4DV5 E;  3TL4 X;  3ADJ A;  4H2F A;  3GQ5 A;  4Q28 A;  3RL4 A;  4JI1 M;  1XM7 A;  4MGY E;  2KOU A;  4DV2 E;  1SR9 A;  3SC3 A;  3EGH A;  2UXB E;  2ZAM A;  3TGH A;  4IYP C;  4B3S E;  4AKG A;  3GPU A;  3WHK A;  2L3C A;  2R45 A;  2DWL A;  1IBK E;  1Q3B A;  1HO5 A;  1XMO E;  1XXH A;  2LJH A;  3OTO E;  5FTL A;  4GKJ E;  4FWG A;  3RGS A;  4X62 M;  2L33 A;  4GIT A;  4PCZ A;  1UIL A;  1STU A;  4BC9 A;  2B7V A;  2KEB A;  2XEP A;  1N33 E;  4M9X A;  3AL0 C;  5KPZ A;  3VK6 A;  3AUZ A;  1J5E E;  4BC7 A;  2ODR D;  4DUY M;  4F54 A;  2LE2 A;  2RS6 A;  3VFD A;  3GLG A;  1NJF A;  4LF9 M;  2Q8U A;  1N36 E;  4YHH M;  4IBJ A;  4GKK M;  1L2C A;  4FCT A;  4IBK A;  5DNY A;  4DR3 E;  4M0D A;  3JU0 A;  4H1S A;  1IY1 A;  1NNU C;  4B3M M;  2CV0 A;  2DHR A;  3VK7 A;  2ZBK B;  4UT3 A;  1Q3C A;  2C9O A;  1OIE A;  2Z06 A;  3U6P A;  4QNM A;  2UXC E;  3SYK A;  2JVA A;  2HYP A;  1HT2 E;  3SAV A;  4JI3 M;  4DV6 M;  3OML A;  3H63 A;  1V73 A;  3DA1 A;  2ZO9 B;  4YY3 E;  1Q39 A;  1E9S A;  4DV7 M;  5FLX C;  4HL4 A;  2LUP B;  1L8Q A;  4JI8 M;  1XMQ E;  3ZH9 B;  2M60 A;  4LJ7 A;  5KPR A;  5EXT A;  8CAT A;  3T1H M;  4DR2 M;  3U61 B;  4NOO B;  2CHV A;  3SAW A;  3FGA C;  2JOG A;  4JV5 M;  2C96 A;  3FUV A;  4NRV A;  4MH0 E;  3GLH B;  4LF7 M;  4I5N C;  2GJU A;  2FFJ A;  3KP1 E;  4AKH A;  2MC6 A;  3VLF B;  2F5S A;  4ORC A;  4NXN E;  3U6C A;  2B3T B;  3JR4 A;  3Q8X A;  1QQW A;  1HNW M;  3JAM S;  5JPE A;  3ADI A;  2E5L M;  4UT2 A;  3E0J A;  5DYI A;  2IE3 C;  3F6G A;  2G7H A;  1SXJ E;  4REZ A;  2Z1A A;  2R18 A;  4BB9 A;  2XFS A;  4DR5 M;  3M7G A;  3J81 S;  3RL5 A;  3E7A A;  4WWL A;  2V1C A;  1UF3 A;  4BMJ A;  4FWD A;  2DWM A;  4DKK A;  5LMN E;  4TUI A;  3AFH A;  4JI4 M;  3H4M A;  3M6A A;  4L16 A;  4LF4 E;  1HNX E;  2C98 A;  1TDH A;  2V83 A;  1SXJ D;  5LMU E;  2UU9 M;  3LQQ A;  4LJ5 A;  4IBE A;  3RL3 A;  1HT1 E;  2DXL A;  2YQZ A;  2P5T A;  5KPT A;  1QAN A;  1N77 A;  2XH9 A;  2CEA A;  4ORA A;  4MGI E;  3PNY A;  4DV2 M;  3H68 A;  5ITT A;  2MC5 A;  5C1V A;  2UXB M;  3KW6 A;  4I81 A;  4B3S M;  1IN6 A;  2QFR A;  2KZS A;  3EGG A;  4S12 A;  1E32 A;  1XMO M;  2DVW B;  1G5B A;  3U6M A;  3OTO M;  4GKJ M;  4NRW A;  1NHW C;  3DJW A;  1Z5A A;  1Z6T A;  2KA6 B;  3K1J A;  5FLX S;  3DFZ A;  4L15 A;  1UHZ A;  1YZ9 A;  1HP1 A;  3MHV C;  2LNH C;  4KOD A;  1N33 M;  4OU7 A;  2BJV A;  1T71 A;  3DZD A;  1IY2 A;  2BQ8 X;  1J5E M;  4LRS A;  2L2M A;  3SAR A;  1QU6 A;  3IB7 A;  1HNZ E;  2FTX B;  4DMI A;  1G3I A;  1N36 M;  3SAT A;  2H36 X;  3C9F A;  4LU9 A;  2K47 A;  4DR3 M;  2JR1 A;  3H60 A;  4J6O A;  3W0F A;  4DR4 E;  3K7V C;  2Y21 A;  4OVZ B;  2R4J A;  2L6M A;  2JOX A;  5FTN A;  4R3D A;  4PT5 A;  2NYL C;  2UXC M;  1E9R A;  4W5W A;  1G4A E;  4M0V A;  2ZAN A;  1OID A;  2WZO A;  2ODR C;  2EWL A;  2NUF A;  3KOW E;  3J80 S;  3IWD A;  4YY3 M;  4LFC E;  2BJW A;  2AHD A;  2DZO B;  2DXI A;  3VDP A;  2M5Z A;  4LFA E;  3UZU A;  1XMQ M;  2F4V E;  4FBK A;  4JYA E;  1K82 A;  4ZX2 A;  2WDE A;  4IL1 A;  2DZN B;  4DR1 E;  4O24 A;  5EP1 A;  1WHN A;  4D80 A;  1XHB A;  4A3V B;  4WW0 A;  4DV1 E;  2RTX A;  4LJ6 A;  1JQJ C;  3CF2 A;  3VYY A;  1MX0 A;  3J7B A;  1NSF A;  1L1Z A;  1DGG A;  4FW9 A;  4LJA A;  3AOE C;  2V87 A;  4L8R C;  4ZPX A;  4QHS A;  1Z59 A;  4TUW A;  1WXR A;  3ZU0 A;  3HU1 A;  2NXF A;  2L09 A;  1N75 A;  3KXE C;  2NA2 A;  4O5G A;  2DFJ A;  1TDZ A;  3FUU A;  4GH9 A;  4X65 E;  4UT3 B;  2LWX A;  3ZCB B;  3LML A;  5LMN M;  1NVM A;  4DV3 E;  1QAQ A;  3GRV A;  1DQ3 A;  1T3T A;  2W82 A;  2X4A A;  4LF4 M;  1HNX M;  4I8O A;  4RF1 A;  3L29 A;  5LMU M;  2NPP C;  2Y0Q A;  4HLQ A;  3SHF A;  2XSZ D;  3GPY A;  4DSY A;  1N32 M;  1X49 A;  2FGG A;  3KFU G;  3I51 A;  4MGK E;  1DGF A;  4OVZ A;  5EXS A;  3UK6 A;  1IBL E;  4D82 A;  1TGU A;  4FVM A;  4RF0 A;  4B3R E;  2F5N A;  1JK7 A;  5E26 A;  1K3X A;  4BS9 A;  2VII A;  4LF6 M;  3H61 A;  3ZOQ B;  1ZBQ A;  2KXE A;  1IBM E;  2KKN A;  1TH3 A;  2ZAO A;  4LFB M;  4B3T M;  4O4K A;  3FUW A;  1QYR A;  2K4V A;  1J09 A;  3U6E A;  2YNM D;  4AG6 A;  4OW0 A;  5F3W A;  4QNR A;  2HHH M;  3FUX A;  3TWL A;  3PVS A;  4EIW A;  3VK8 A;  3AOG A;  1Z5B A;  3SMP A;  2IHR 1;  5IT9 C;  2FOI C;  4CHT B;  4B7H A;  3PSN A;  3JAM C;  1AUI A;  1G8P A;  1IXS B;  3ADL A;  1SXJ C;  3IB8 A;  2VQE E;  2E1M A;  3K2L A;  4WUR A;  2R46 A;  4I4L A;  3WHL A;  5EJC A;  4LGM A;  1RQ0 A;  1SU1 A;  3VYX A;  3J81 C;  1L2B A;  4X8W A;  2WDC A;  2V86 A;  4JI5 E;  1HNZ M;  3QFN A;  2CPN A;  2UXD E;  1GKI A;  3PSO A;  4DHL A;  4G4O A;  1GLN A;  4JI6 E;  4F0Z A;  5C1B A;  2L7I A;  2XGN A;  3HHX A;  2DMY A;  1QFC A;  4II7 A;  5BR8 M;  4ITQ A;  4BBY A;  2L3J A;  4DR4 M;  4IBI A;  2VE7 C;  4FCV A;  1H6U A;  1R2Z A;  1NNW A;  3DSD A;  3NBI A;  2LXE A;  3FTD A;  1IN8 A;  4DR7 E;  1WHQ A;  2V8Q B;  2V89 A;  4F9A B;  3IG8 A;  2DXN A;  1YYK A;  1G59 A;  3RQZ A;  4L4U A;  4R7G A;  2VQF E;  3GRU A;  4D81 A;  2F8B A;  5ITU A;  4LFC M;  4LFA M;  1J26 A;  2F4V M;  3L28 A;  4KHP E;  2WDF A;  4JYA M;  4DR1 M;  1TH2 A;  1KSF X;  3IWC A;  3SMS A;  1S8E A;  2XLJ A;  1JR3 D;  3E7B A;  4P16 A;  4DV1 M;  1HR0 E;  4GHA A;  2ZOA A;  1ZAE A;  1X37 A;  4BCA A;  5LL6 R;  3LMM A;  4XBO A;  4K0K E;  5GKN A;  2HY1 A;  1IN4 A;  1L1T A;  1KYI A;  2R17 A;  4LJ9 A;  3BOS A;  4H2B A;  3GO8 A;  2Z4R A;  4AKI A;  5IT9 S;  2P6B A;  4I5L C;  3KOX E;  2DWZ B;  4BLC A;  3B9P A;  3MSW A;  4G4R A;  4JI0 E;  5EP2 A;  3TWK A;  1FJG E;  3ZTV A;  1Z2W A;  4M0W A;  3GLI B;  2I7P A;  4X65 M;  3F6H A;  2L2N A;  5CFF E;  1X47 A;  4DV3 M;  5KO3 A;  3EIH A;  3L27 A;  2Q2E B;  3QFM A;  4MOV A;  3HHZ A;  2QCU A;  2X8A A;  5ITX A;  3FIG A;  3J80 C;  4TUG A;  2DSY A;  4V0V A;  3SHG B;  3UMM A;  3GP1 A;  3TWM A;  3HU3 A;  3CF6 E;  2BNK A;  1DO2 A;  3SAS A;  3LQR A;  4X66 E;  1L2D A;  4B3R M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...