5DNYA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Recombination/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 107
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5dnyA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5dnyA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5dnyA01
5JPEA 1WAO1 2NYMC 2Z06A 3P71C 3H64A 3E7AA 3QFNA 4FBQA 1HO5A 1U32A 3K7WC 2CV9A 1UF3A 3GVEA 2GJUA 2BDXA 5DNYA 1W24A 2NYLC 3FGAC 5INBA 2WDFA 3HVQA 5C1VA 1OIDA 2YVTA 1II7A 4FBKA 2USHA 3QG5C 3H66A 4H1YP 4UT3B 3AUZA 1IT6A 4FBWA 1V73A 2BQ8X 5EQVA 2Q8UA 3ZU0A 4NZVA 2IE3C 2ZBMA 4ORCA 1T71A 1S70A 3EGHA 3RL4A 2O8AA 1JK7A 2BCDA 3H68A 3IB8A 4MOVA 4H2GA 3DSDA 4UT2A 1Z2XA 4H2FA 5GTUA 1S95A 1QFCA 1S3MA 1S3LA 2NXFA 2Z72A 5JJTA 4I5NC 1S8EA 2IE4C 3T1IA 3CK2A 1OI8A 4DT2A 1S3NA 3PSOA 1M63A 3C9FA 2HY1A 3QFOA 1SU1A 2AHDA 4JA7A 2QFRA 4XPNA 3N5UA 3IVDA 1WARA 4I5LC 4MP0A 2WDCA 4O5GA 4V0VA 4IYPC 4H2IA 4ORAA 3H63A 2A22A 4O43A 4KKZA 4HD0A 4UWQA 3ICFA 3H69A 3H61A 2IAEC 1QHWA 3IVEA 4V0WA 4YKEA 4LTYA 1FJMA 4OR9A 3V4YA 1HPUA 4DHLA 1MF8A 2WDDA 1TCOA 1AUIA 3C5WC 2HYOA 4V0XA 1G5BA 3QFMA 4J6OA 4KBPA 2DFJA 4IL1A 4ORBA 4MOYA 5IOHA 2KKNA 4LACC 1XZWA 4LU9A 4O24A 4TUGA 3TGHA 4H1SA 4WWLA 3THNA 5F3WA 2NPPC 4M0VA 2WDEA 3PSNA 3JYFA 5JPFA 1USHA 4FCXA 4G9JA 2R17A 4DSYA 4ZVZA 3RL5A 3KBPA 4UT3A 3K7VC 2HYPA 3H62B 1KBPA 1UTEA 1T70A 4F0ZA 2Z1AA 1NNWA 3THOB 3AV0A 3H67A 1XM7A 3EGGA 1Z2WA 3RQZA 3RL3A 3ZTVA 3E7BA 4B2OA 4ZX2A 5J28A 3QFKA 4TUIA 2XMOA 5HPEA 2QFPA 3DSCA 4O4KA 2O8GA 4H2BA 4JA9A 2QJCA 5B8IA 3H60A 4Q7FA 1HP1A 1OIEA 3LL8A 3IB7A 2JOGA 3DW8C 2P6BA
chains in the Genus database with same CATH superfamily
4DV7M 2VF7A 4B3SM 4F9CB 3P71C 3LCVB 1HNZE 4KT0F 1GZ6A 3GVEA 1YUBA 5EXPA 2BDXA 4DKKA 2JY6B 4AQYE 2MR9A 4Q7JA 3QG5C 5L8RF 3VLFB 1HJPA 2BQ8X 2L3JA 2BNKA 2QENA 2XFTA 2JUJA 3T1HE 1JK7A 4RF1A 2XH9A 3HJQA 1Z2XA 5GTUA 2NXFA 4K0KM 2RPCA 1QZMA 3OTOM 3CK2A 1ZBTA 1JR3A 5A6JA 4LF8M 2HHHE 2QFRA 3IVDA 5DFLA 3QYBA 3C6MA 4H2IA 1PGYA 4IBIA 3RMPA 2FOIC 2MROB 2ERCA 2LH0A 3U61A 4YKEA 2F4VE 3J7BA 3PXGA 4F1IA 4RH8A 2YTJA 1DGGA 4LF4E 1IBLE 1MJGM 2K47A 4LCBA 5LLQA 5AE3A 1QAMA 3A46A 2L3CA 4IL1A 4DR7E 2KW0A 3ADJA 2QBYB 4LU9A 3GLIB 3TGHA 1GTKA 2EMFA 3THNA 2CT1A 4BBAA 1RMDA 2CPNA 5A6AA 1PJJA 2EM9A 1SR9A 5GKNA 3H09A 4XK8F 3DA1A 3MHHC 2XMOA 5ITXE 3J81S 5A6KA 4X66E 2L33A 4MLVA 3C3EA 3HGIA 1N77A 2LO3A 2V85A 3PNVA 2JYAA 5JPEA 1WGNA 1B69A 2NYMC 4FCWA 2EN4A 3JU0A 1W24A 2NYLC 3GLFA 1JR3E 4DV7E 3BBZA 2LHCA 5JI2E 3U6OA 1N33E 2EM6A 2XSZD 4G4RA 3KP0E 1QZEA 3J80C 3GLFB 1GL7A 1L1TA 1S95A 1QFCA 4QHSA 1XXHE 1WHCA 1YLAA 2DI0A 1IY0A 1XXHB 4FD2A 2ZO9B 1TH2A 3VKHA 2LV2A 2ZBKB 1A5TA 5A6BD 4R7GA 1EH7A 2EOOA 2YQZA 3ZCBB 2GQFA 3H61A 3TQSA 2WBUA 2NUFA 3V4YA 2QBYA 2EL4A 2KZUA 1ZR9A 2YRKA 2M1SA 4OOGC 2ODRD 4LJ9A 3C5WC 1R4GA 4L6V6 3EPKA 1G5BA 3D8BA 3L27A 2R1FA 4OX9E 2BJWA 1NHWC 4YY3M 4DUYM 1XZWA 3FRIA 3PNYA 5EP1A 4FCTA 4LJ7A 2WBTA 5KL5A 5JPFA 3HKPA 2EJ4A 2R17A 3KBPA 2E1MA 4P78A 2LTRA 3L00A 2EMIA 1G8PA 5IT9C 1XM7A 5KQ8A 1TH4A 2HGHA 3EIEA 1ZAEA 5HPEA 3U5ZA 4P16A 1QVRA 5LMUM 4H2BA 4JI5M 3IB7A 1TDHA 4FBQA 4OW0A 3EPJA 2LXEA 1E9RA 2DWMA 1ZMVA 4LJ5A 2KHXA 2MKNA 5DNYA 2QHOB 3I4YA 2DXLA 2EN7A 1D0MA 2V88A 3B7QA 2CEAA 2I9IA 2YTOA 2GHFA 3JTZA 3SHFA 2C5RA 3M7GA 1S3LA 2Z7JA 1S8EA 4NL4H 2YTIA 3E46A 2RTXA 1GL6A 2I7PA 1GQEA 2YRHA 2DXNA 2W82A 2F5NA 3P1XA 4NXNM 3FTDA 3JR5A 3KS8A 1MGTA 1N33M 2FTXB 3F6GA 4JI7E 2EPRA 2EE8A 5KL3A 5FLXS 4LFAM 2C98A 2M9AA 1AUIA 4NRVA 1NJFA 2QCUA 1IBLM 2V86A 1PJQA 4LRSA 3SATA 1IBKE 3DJWA 3Q8GA 1YSAC 2EPPA 4WXDA 2LVHA 4FK5C 4H1SA 2OOAA 3GO8A 1TF3A 1DI2A 1IN7A 4NOOB 2WDEA 2RGOA 2JPAA 4DSYA 4DUYE 1IXSA 4UT3A 4BCAA 1Z5AA 1KBPA 1E32A 3THOB 4HL4A 1VEKA 2KHHA 1W5SA 4BC9A 4I81A 2YTFA 4B3SE 3B89A 1TF6A 1X6HA 1YSYA 1IQOA 4LF8E 3L28A 4MGYE 2M7QA 2LUQA 2B9DA 1XNQM 2V1CA 2MDRA 2CE7A 4OX9M 1JQJC 3W0FA 4WPYA 1L8QA 1QNTA 2UU9E 3FGAC 4R2PA 4GH9A 3U6PA 2USHA 4DV6M 2LVNC 4FBWA 2VF1A 1V73A 4A3VB 3VHTB 2EPUA 4NZVA 3F92A 2HAKA 1VQ1A 2G8LA 3K9OA 4ORCA 1RQ0A 1EKZA 1R5LA 3HJSA 2Y21A 1SXJC 4MGZE 1IN8A 4B7FA 3A98B 3FYDA 3VYXA 4I5NC 5BR8M 1Q3BA 3FLOA 3IG8A 5LMUE 4IIWA 2L6MA 4N4RB 4GIPA 2EN2A 4MP0A 3EIHA 1Z5CA 4LY6A 1F4IA 4ANRA 2KXEA 2XZUA 4D82A 2YU8A 4LF4M 2EKFA 1I4WA 2H36X 2RSMA 1OIPA 4R8OA 5ITUA 2ODRC 3TWKA 3E9SA 3HY5A 1MN3A 1JK1A 2DFJA 5IT9S 1IQPA 4DR2M 2G7HA 2MC5A 2DVWB 4JI4M 4R03A 4RNAA 4MB7A 2ELZA 4YHHE 3PSNA 4GEWA 1PDAA 4DR5E 3C4TA 4JYAM 1J26A 3GLGB 1XNRE 2DAIA 2QZ4A 4K0KE 2DLQA 1NNWA 2QP9X 4LRTA 4BLCA 3RQZA 2B7VA 2HHHM 4KHPE 3K92A 1AH5A 3LQQA 4JI7M 2N3GA 4NRWA 4LFAE 2DZOB 2FFJA 1T38A 1BB8A 3GLHB 2MKDA 2JY7A 3E7AA 2L6OA 2APLA 2C96A 4FWHA 5IREB 1XNQE 2KNVA 2YVTA 4CIZA 1NNJA 2EKKA 1STUA 3UK3C 1N78A 2ZBMA 4DR4E 2P5TA 4LF9E 1TH3A 4DV2E 4J8ZA 1G71A 1R6BX 2OO9A 4YY3E 4GHLA 3BBGA 2EZ6A 2JP7A 3BGHA 1XMOE 1WRJA 4G4OA 4AKIA 2EMAA 2L09A 2CUZA 4AI6A 3TPZA 3QFOA 3KOXE 4ITQA 1VDDA 4B3TE 3C9PA 1HT2E 2XF3A 4NC6A 3SMSA 4F2JC 3U6MA 2MC6A 4S12A 4V0VA 5LMNM 2EMXA 2EPKX 1X37A 1LV7A 4OR9A 4FW9A 1L4SA 2VDBB 4WSPA 2EOSA 1C7YA 2CHVA 3AKZA 4LF7M 4LJ4A 1IBKM 4UN2B 4R2DA 3QYEA 2UUAM 3NBXX 3WHKA 4DV4E 1ZMWA 4I5SA 3U60B 2ZAOA 4WWLA 2Y0TA 1J7KA 3D8LA 1T43A 1YYWA 2NPPC 1HQCA 1VG5A 1HT1E 3K9PA 3CF0A 1OJLA 1HNXE 4DR3M 3JR4A 4M9SA 1UILA 3FTFA 4XBOA 2YU5A 3AV0A 2LHGA 3M6AA 1D0LA 2RSIA 4DR5M 4LJ8A 1YYKA 3R8FA 1VDLA 3T1YE 3IECA 3ZH9B 3UMMA 4BHBA 2J7NA 1K3XA 2V87A 1X6FA 2JOXA 5ADZA 2NABA 4JI3E 2V8QB 5FTNA 4WFTA 1OIDA 2EM2A 1OFHA 5ITYA 3HTXA 5EJCA 3IHPA 1S70A 3EGHA 5CFFE 2B3TA 2HWJA 3V76A 4B7HA 2XLJA 3DSDA 1AIPC 2XSZA 1TTEA 2EOHA 4LZJA 1TGUA 3GQ5A 4JI6M 3TQMA 2EOJA 2C9OA 3RGPA 4KLNA 4O43A 2A22A 2KEBA 1JB0F 4IBCA 2R46A 2YPNA 2WBSA 5A6BA 2H1RA 5LMNE 2R62A 1DO0A 5KPRA 4AKHA 1TCOA 3E0JA 4DR4M 4V0XA 3ADLA 3B9PA 1NO1A 1ZU1A 4KZSA 4CJ6A 3BF2A 2KKNA 3HHXA 1T4LB 5EP2A 4F9AB 1O0WA 1SXJA 5C18A 2EPMX 3SBJA 5IZ7D 4ZVZA 4JV5M 2EPAA 4F0ZA 2Z1AA 4NXMM 1DQ3A 1GLNA 2BWBA 1GVNA 3DSCA 4GKKM 2WSEF 2UU9M 2DWNA 1EE8A 2X49A 2JY5A 1YYOA 3B7ZA 1XC8A 2N35A 4X62M 1YE9A 2Z4RA 2Z4SA 2FV4B 4BHCA 4WP2A 2H5XA 1RU3A 3J80S 2WZOA 2EMLA 2D7HA 4DR3E 1WR1B 4R2QA 1PM5A 3RE8A 2BCDA 4DR1M 1KYQA 1PJSA 2QSFX 2Z72A 5JJTA 1T39A 4L78A 3OTOE 1OI8A 2EMHA 4ZPXA 3KVWA 4CHTB 2G3QA 3KOWE 1N32E 4G6ZA 3LLHA 2BJVA 1EH8A 4I8OA 4QOZC 5KL4A 1IN5A 2KZSA 3LMMA 2NA2A 3RFWA 2LVOC 2F5SA 4OVZA 4REZA 4GZNC 4J6OA 4L15A 4GKJE 3BIDA 3L29A 3FUTA 1HNWM 3U6QA 4FWDA 4LF5M 2FH0A 3SASA 1GO5A 2YNMD 1VEJA 2DLKA 3C58A 4FCXA 2UUBM 4JI6E 3MMPA 4BC7A 2F5QA 4DV2M 1Z2WA 3FUVA 1I94M 3TL4X 1H6UA 2EPCA 2WCC3 2VQFM 4B3ME 5EP3A 2LMZA 2QJCA 1IN6A 3KDSE 2JOGA 1WXQA 1SXJD 4F6MA 2ENAA 4IJDA 1IY2A 1HO5A 5AC4A 2GJUA 2O5RA 2MJ5B 2R45A 2BB8A 4HEOA 3SFZA 4HLQA 1ZV1A 1A1GA 1QUSA 2YTEA 3H66A 2DHRA 2UXBM 5KL6A 4LFCE 5EXTA 3RL4A 3C3DA 4PCZA 2JY9A 5FSWA 1DGFA 3GLFE 4H2GA 5A69A 2UUCM 4H2FA 1A1IA 3KSXA 2YRMA 1XNRM 3KSJA 2IE4C 3M0EA 4ZYEA 2AHMA 3GLHE 4II7A 3GPUA 1DGHB 4XPNA 2WDCA 1G2FC 3HHYA 3QWLA 4BMJA 3EPHA 5IWAM 3ADGA 2BWEA 4IBFA 3L25A 2JR1A 2I13A 3BXWA 2M4IA 2KNAA 2F8BA 3HU2A 2EO2A 5E6JA 3FYCA 2MGWA 3GQ4A 3U6SA 3GLIE 4TUGA 4JI8E 4F6NA 2EOMA 5F3WA 1Z59A 2KA6B 2L7IA 3AFHA 3IWDA 1C1KA 1KFVA 4CGYB 1NEIA 4B3RE 2L2DA 3IWCA 1JR3D 1N36E 4LZZA 5AE2A 3THGA 1Z1BA 4TUIA 4LGYA 3GPPA 1ZMUA 4GKKE 3HHZA 3K6QA 2DAMA 1P47A 1QDRA 1DGHA 2Z06A 3E4RA 3J27B 2EMGA 4X62E 3ZC7B 3MHVC 1JK2A 2N3HA 3VYYA 4G4QA 1TN9A 4LF5E 1NVMA 4CISA 3TWMA 4H1YP 1D0KA 2UUAE 3ZU0A 2CV0A 2LUPB 2WZJA 4FWGA 2LT7A 4F2LA 2J5YA 4DR6E 4KO8A 2DMIA 1V33A 2NUEA 2KDLA 4DT2A 1OKSA 4JI0E 2HY1A 2DSYA 1T3TA 3QAUA 4PDGA 3SAUA 4JA7A 4BB9A 4M9ZA 2EL5A 2QQ8A 3T1YM 2EM5A 2C99A 4WURA 4GC5A 4GRIA 4V0WA 1HNZM 3VDUA 4X9JA 1D2NA 3SMPA 1NV9A 2L8TA 3J7AS 4GEQB 4M0DA 4QNRA 3KW6A 3VDPA 1QAOA 1YPNA 2LRSA 3UGJA 3F6HA 5KO3A 5LL6R 4X8WA 1R2YA 2UUCE 5IOHA 5DYIA 3KZYA 1AAYA 4ZYHA 2DHYA 2VQEE 2EA0A 2DWLA 2EOQA 3Q8XA 3NBIA 2OQ4A 3B74A 2N8XA 2EPOA 2EM0A 2WSFF 2ZAMA 1T6OA 5EXXA 4GC9A 1SXJB 2YTPA 2JY8A 1T4OA 4BS9A 5EQTA 2EN1A 2M60A 2Y0QA 1IXZA 1OQYA 2DAEA 1SFEA 2D9HA 3J7AG 2QFPA 3CGWA 2DWZB 3H60A 4Q7FA 4LFBE 3GRVA 3SAWA 4F54A 2FE8A 4R2AA 1A1HA 3HZJA 1GABA 2K9DA 2DXIA 2LJUA 3LMLA 2V6ZM 3WHLA 5C1VA 5KPTA 2EUCA 3KWRA 4DV6E 4IBKA 1OTRA 4DR1E 1EFUB 1N3GA 2CWBA 3GP1A 2OPFA 3VKGA 1T71A 2CHGA 3DZDA 1WHQA 4MOVA 2CV1A 2NUGA 2ADRA 2Z8YM 1J09A 1J5EM 1IY1A 2HJJA 5T6JA 1M63A 3MJ5A 1SU1A 3SC3A 4R2EA 2HCBA 4TUWA 1YUJA 4NSOB 1X47A 1S3SA 2VE7C 3OMLA 4X65M 1MEYC 5DYGA 1I94E 3HPSA 2DB2A 1SG9A 5IWAE 4B3MM 2VQFE 3H4JA 2LTUA 2E5LE 3ECRA 1TR8A 3EQ1A 4AZFA 1GKIA 4PD2A 3E21A 1K82A 3NWLA 4KBPA 4DUZE 3FKEA 1HR0E 4MGIE 2FNAA 4YHHM 2DGCA 1CUKA 1A1FA 4JI0M 3I4VA 2LE2A 4IJFA 4DV0M 1BVSA 3T38A 4B3RM 2LCEA 1NJGA 2YZTA 4B2OA 4R71A 1A1LA 4M9XA 1N32M 1NSFA 4QOSA 3SYKA 4IBGA 5ITRA 2O25A 2ENHA 4JA9A 3J2PB 2CTDA 2Y20A 2DMYA 2YTQA 1UBDC 2Q2EB 3VFDA 2RGHA 2DZNB 2YT4A 3H4MA 4M9VC 1PKPA 3GQ3A 3HJ8A 3PVSA 3U60A 3CF2A 4HTGA 2UXBE 4LFBM 3SAVA 2R76A 4FBKA 2NQ8C 1YZ9A 5ITQA 2KOUA 3T1HM 1N75A 4OVZB 4QNMA 2VRDA 2ZM6E 2KRUA 2A25A 4FVMA 2YTDA 2YSPA 2QNJA 3SARA 4WXCA 2K7IA 3ZOQB 3PSOA 5FTJA 1XMQM 3SYLA 5A2QC 2LBSB 3AOEC 4B3TM 2YTNA 3GLGA 1XXHA 4KKZA 1LTMA 2JXPA 1N36M 2JZ0A 2F4VM 2IHR1 4LTYA 2GNOA 4X64E 2CHQA 2PRTA 2VIIA 2EMBA 3AOGA 3GRUA 2DAKA 4JI8M 2B3TB 4LF7E 3QFMA 1FKAE 2G5GX 2GPIA 5KL2A 2DKLA 4DV5E 2ZANA 2LBCA 1DO2A 1ZQ9A 3B7NA 3LVVA 1T4NA 4M2ZA 2XEPA 1HR0M 2EMZA 2RRUA 2DZLA 4ZYDA 1T70A 4D81A 3I51A 3TWLA 2K4VA 3LQRA 3ZTVA 5J28A 3GRRA 3HX3A 4O4KA 4L4UA 4NXNE 1A1KA 3DW8C 2VF8A 3J7Yp 4AG6A 4DUZM 1KJKA 4P7DA 2JOBA 2FGGA 2LTSA 1WHNA 4LF6M 1IT6A 3FRHA 2Q8UA 1NNUC 5E26A 5ITTA 3LW5F 2CP8A 3VK6A 1FJGM 2EM4A 2UXDE 1SXJE 4GITA 3KOZE 1S3MA 3KFUG 3ADIA 2L92A 3GLIA 7CATA 2X4AA 2FS1A 2WSCF 5EP4A 5FTLA 2L2MA 2AHDA 1IBME 1WARA 2R0IA 5ITXA 4X65E 1BBOA 2GLIA 2DAGA 4HD0A 1YUIA 1GJSA 4EIWA 1HPUA 4MGKE 5KL7A 2KNZA 2HKJA 2O01F 4WW0A 2VQEM 2HYOA 3UK6A 3MHSC 3U6EA 2JNHA 1G3IA 3GLHA 4ORBA 4MOYA 3FUUA 5C1BA 1WXRA 4LF9M 4XGIA 1WJPA 3AJIB 3AOEA 3JYFA 4RKUF 4DR6M 4Z6YA 5BR8E 1UTEA 4NXME 2L4FA 3FTCA 2DRPA 3E7BA 2E72A 1X3CA 2EMCA 2ENCA 1G41A 5JI3E 3DF6A 5EXSA 2EM3A 1OAIA 2I7NA 1L1ZA 1DGBA 5KPZA 2B7TA 3QFNA 1UF3A 3U6CA 3GRYA 2HC5A 4MH0E 5AC5A 4L16A 3HHWA 2JWOA 1GJTA 2C9CA 2EMWA 3AUZA 4IS1C 4JI4E 2ZTDA 5IXMB 1J5EE 4GMQA 4G3OA 4DMIA 2L2KB 2F5OA 4IBDA 4LF6E 1Z5BA 4JYAE 2LJHA 3W67A 1HNXM 1QYRA 1K3WA 3T1IA 1DGCA 1S3NA 3C9FA 2CRUA 4WX9A 1XMQE 1IM2A 2EN8A 1F2IG 1FNNA 2V83A 1NV8A 1R7RA 1EH6A 4IYPC 3HQ1A 4FCVA 4JI2M 1XHBA 2EQ3A 3GPXA 1NCSA 2DNAA 4L8NA 4ZYGA 3FIGA 3KZZA 4HEIA 1NY5A 4X64M 1MF8A 2DENA 1WGLA 1Q02A 4DV1E 1N34M 2F5PA 4NHRA 5AE1A 4AKGA 1XB2B 3KS4A 4P17A 2JWSA 5FTMA 4R2RA 2EOYA 2LNHC 2Z3XA 1PJIA 1MU5A 3AL0C 4M0VA 4G9JA 1WJ7A 1XMOM 4B08A 1E9SA 3H67A 3IWBA 1DV0A 3TE6A 3RL3A 1QU6A 2YSOA 1P3QQ 1QDTA 4ZX2A 4RHBB 1KYIA 5B8IA 4RF0A 1HP1A 1OIEA 2XGNA 1UM8A 2K6BA 2ZTCA 3IG5A 1VEGA 2J7JA 1OAOC 2EOEA 1TF0B 4L8RC 3I01M 3A42A 2RS7A 4BBYA 2YTGA 3T15A 4JXJA 3I04M 2EQ0A 2EOXA 4DV4M 1QQWA 2O8AA 3H68A 3IB8A 2UXDM 3M99B 1AUAA 4UT2A 2JZ1A 3W0LB 4JV5E 3KP1E 4DV5M 1X49A 2EM8A 3C6KA 2R4EA 3KOYE 1IQSA 1G2DC 2EORA 4KODA 3HPZA 4I5LC 1QANA 4PDIA 3J81C 1TDZA 2UXCM 4JI1E 2IAEC 1FJMA 2EOZA 2WDDA 3FE3A 2YWQA 2EOIA 4MLQA 4F9BB 4MM3B 4OU7A 4NSRA 1BBGA 4DR2E 1PRBA 3KXEC 4DV3M 1V92A 5BPVA 4O24A 3RGSA 1ZAAC 3W68A 5A2QS 1L2DA 2R4JA 1IFYA 1MX0A 1USHA 2ZM6M 3RL5A 2HYPA 5TSEA 3VK7A 2QPAA 2LVQD 3EGGA 1FJGE 4JI2E 2JP9A 1W5TA 4WSGA 2CV2A 4KHPM 2ZOAA 2L2NA 1YFHA 3VK8A 4LJ6A 3JAMS 2EOFA 3LL8A 4JN6A 1XWIA 2KRKA 2JVAA 3H64A 3K1JA 2LVPC 2EN3A 5IV8B 3HVQA 4AQYM 1IXSB 4UT3B 4Z8XA 2X8AA 4GKJM 2EPXA 2XZFA 1Q3CA 2EPLX 4LG2A 4Q35B 3LCUA 1OFIA 1HNWE 2IE3C 2EQ1A 4KWYA 2EP3A 2V89A 2RQLA 4QHTA 3GPYA 2EWLA 1RC7A 2EJSA 1UN6B 4IJEA 1IBMM 2ELYA 3L26A 1QUTA 3A45A 2R6FA 3DOAA 4Q28A 3SHGB 2XFSA 2EN6A 2YR0A 4ORAA 3H63A 4W5WA 2CFOA 1R2ZA 4UWQA 3ICFA 3H69A 3HWSA 1KSFX 1QHWA 3IVEA 1EIJA 1G59A 1Z6TA 3LVWA 3ZQJA 1QAQA 1X5WA 2YEQA 3FD9A 2KONA 3EPLA 2EPNA 4LFCM 3CF6E 4R3DA 1ORYB 2CSHA 2J7OA 2MH8A 4GHAA 2EMYA 4DV3E 3K7VC 2R44A 2OOBA 3T6PA 1G4AE 4R2SA 2EMKA 2R18A 3C4BA 3QFKA 4X66M 2L4EA 1NY6A 2BBGA 4G4NA 2EPZA 2RS6A 2O8GA 2YFQA 2L7HA 4AW4A 1Y8GA 1OIZA 3MSWA 2P6BA 1WAO1 4JI3M 8CATA 1U32A 3K7WC 2LWXA 2CV9A 4JI5E 2JXNA 5INBA 2WDFA 2HL7A 5FLXC 1II7A 3CTWB 5FTKA 2JA2A 4M0WA 5EQVA 1IMUA 2A5YB 2D7GA 3HU3A 2D7EA 2LVAA 3U6LA 5AASA 4M30A 3FUWA 4DR7M 2UUBE 3PFIA 1ZBQA 3HU1A 4I4LA 3N5UA 1UHZA 4IBEA 3MK6A 4IBJA 4D80A 1L2BA 1LLMC 4O5GA 1IXRC 2MDGA 4Y28F 4WYQB 4DV1M 4JI1M 2UXCE 1IN4A 1N34E 1A1JA 2EM7A 2EL6A 2R65A 1L2CA 4DHLA 2K0BX 2E5LM 1E94E 1WIVA 3K8ZA 2DIXA 4DBGB 3K2LA 5H37D 2RKOA 3BOSA 4IBBA 3U6DA 4LGMA 4AG5A 3U61B 2V1UA 4PT5A 3HXLA 3FUXA 4LACC 3UJNA 1Q39A 3L2AA 1PJTA 3U5ZB 3GLGE 3JAMC 1X6EA 3H62B 1V34A 3ILKA 5KQDA 4MGHA 1NHGC 4DV0E 4L5NC 2M5ZA 4R2CA 4LJAA 1HQYE 3DFZA 1UFZA 3R9XB 4B7GA 3FTEA 1X48A 3D03A 3UZUA
chains in the Genus database with same CATH topology
1L1ZA 4DV7M 3GLHB 1DGBA 4B3SM 5KPZA 4F9CB 3P71C 1DGHA 2Z06A 2B7TA 1HNZE 3E4RA 3E7AA 3QFNA 3J27B 2L6OA 4X62E 1UF3A 3U6CA 3GRYA 1YUBA 3ZC7B 5EXPA 3MHVC 1GZ6A 2C96A 2BDXA 4MH0E 4DKKA 2N3HA 4FWHA 4G4QA 3VYYA 5IREB 4L16A 4AQYE 1XNQE 4LF5E 1NVMA 2YVTA 4CISA 3HHWA 3TWMA 2C9CA 2JWOA 3QG5C 1NNJA 4H1YP 3AUZA 1STUA 3VLFB 1N78A 4JI4E 2BQ8X 2UUAE 2L3JA 2BNKA 2QENA 4GMQA 1J5EE 3ZU0A 2ZBMA 4DMIA 2P5TA 2XFTA 2CV0A 2LUPB 4LF9E 4DR4E 1TH3A 3T1HE 2L2KB 1JK7A 4FWGA 4RF1A 2XH9A 3HJQA 2F5OA 4J8ZA 4DV2E 4IBDA 1R6BX 4YY3E 1Z2XA 4LF6E 5GTUA 4GHLA 1Z5BA 4JYAE 2EZ6A 2LJHA 2NXFA 4K0KM 4KO8A 1HNXM 4DR6E 2NUEA 1XMOE 1QYRA 1K3WA 1QZMA 3OTOM 3T1IA 3CK2A 4G4OA 4AKIA 4DT2A 1S3NA 1ZBTA 2L09A 2CUZA 3C9FA 1JR3A 4AI6A 1XMQE 1IM2A 3TPZA 4LF8M 4JI0E 2HY1A 2DSYA 3KOXE 4ITQA 1T3TA 3QAUA 1VDDA 4PDGA 1FNNA 3SAUA 2V83A 2HHHE 4B3TE 1HT2E 4M9ZA 4BB9A 2QFRA 3IVDA 1R7RA 2XF3A 3SMSA 3U6MA 3T1YM 4S12A 2MC6A 4IYPC 5LMNM 4V0VA 3HQ1A 4H2IA 4IBIA 4FCVA 4JI2M 3RMPA 2C99A 2FOIC 1XHBA 3GPXA 4WURA 4GC5A 4L8NA 4GRIA 1X37A 2ERCA 2LH0A 3U61A 4V0WA 1HNZM 2F4VE 1LV7A 3J7BA 4YKEA 3VDUA 4OR9A 1D2NA 3PXGA 3SMPA 3FIGA 4FW9A 1NY5A 4X64M 1MF8A 2L8TA 3J7AS 4GEQB 4M0DA 1DGGA 4WSPA 4QNRA 3KW6A 3VDPA 4DV1E 4LF4E 2CHVA 3AKZA 2K47A 1IBLE 4LF7M 1N34M 1QAOA 4LCBA 2LRSA 3UGJA 3F6HA 2F5PA 4LJ4A 1IBKM 5KO3A 1QAMA 3A46A 4X8WA 4AKGA 1R2YA 5LL6R 5AE1A 5AE3A 2L3CA 5DYIA 2KW0A 2UUAM 2QBYB 3ADJA 2UUCE 3K7WC 4LU9A 3KS4A 3GLIB 2VQEE 4DV4E 3WHKA 3TGHA 3U60B 4I5SA 2ZAOA 5FTMA 4WWLA 2EA0A 3THNA 2Y0TA 1J7KA 2DWLA 3D8LA 1YYWA 4BBAA 2NPPC 2LNHC 2Z3XA 1PJIA 1MU5A 1HQCA 3AL0C 4M0VA 1HT1E 4G9JA 3Q8XA 3NBIA 3CF0A 2CPNA 2OQ4A 1OJLA 1HNXE 4DR3M 3JR4A 4M9SA 1PJJA 1SR9A 1XMOM 4XBOA 4B08A 3FTFA 1UILA 1E9SA 3AV0A 3IWBA 2ZAMA 3M6AA 5GKNA 3H67A 5EXXA 3H09A 4GC9A 1SXJB 3TE6A 1T4OA 3RL3A 4BS9A 1QU6A 5EQTA 4DR5M 2M60A 2Y0QA 4ZX2A 4LJ8A 3DA1A 2XMOA 5ITXE 1IXZA 3J81S 3J7AG 2QFPA 1YYKA 3R8FA 1KYIA 2DWZB 4X66E 3ZH9B 3T1YE 3UMMA 2L33A 2J7NA 1K3XA 2V87A 5B8IA 4RF0A 3H60A 3HGIA 1N77A 1HP1A 4LFBE 4Q7FA 1OIEA 3GRVA 2XGNA 1UM8A 2V85A 3PNVA 3SAWA 4F54A 2FE8A 5JPEA 3IG5A 2JOXA 5ADZA 2NYMC 4JI3E 2V8QB 2DXIA 4FCWA 5FTNA 4L8RC 3JU0A 4ORBA 3LMLA 2V6ZM 4WFTA 1W24A 2NYLC 3GLFA 3WHLA 5C1VA 4DV7E 1OIDA 5JI2E 5KPTA 2EUCA 3A42A 3U6OA 2RS7A 3KWRA 1OFHA 1N33E 4BBYA 4DV6E 4IBKA 3T15A 2XSZD 4JXJA 4DR1E 3K6QA 5ITYA 3HTXA 5EJCA 4DV4M 4G4RA 3KP0E 1QQWA 3J80C 3GP1A 2OPFA 3VKGA 1T71A 2CHGA 1S70A 3EGHA 2O8AA 3DZDA 3GLFB 1WHQA 5CFFE 3H68A 3IB8A 1GL7A 4B7HA 2CV1A 4MOVA 2XLJA 2UXDM 4UT2A 2NUGA 3DSDA 2XSZA 1L1TA 1S95A 1QFCA 1J09A 4QHSA 1J5EM 3W0LB 4JV5E 3KP1E 4DV5M 1X49A 1IY1A 4DR7E 4FD2A 1IY0A 1TGUA 1XXHB 2R4EA 4LZJA 2ZO9B 3KOYE 1TH2A 3VKHA 5T6JA 1M63A 2ZBKB 3MJ5A 1SU1A 3SC3A 3GQ5A 2HCBA 4KODA 4TUWA 3HPZA 4JI6M 4R7GA 1QANA 4NSOB 1S3SA 1X47A 2VE7C 3OMLA 4PDIA 4I5LC 4X65M 2C9OA 3RGPA 4KLNA 2YQZA 3ZCBB 3J81C 2A22A 4O43A 5DYGA 1TDZA 1I94E 2KEBA 2UXCM 4IBCA 4JI1E 2R46A 2IAEC 3HPSA 3TQSA 2DB2A 3H61A 2NUFA 3QFOA 1FJMA 5IWAE 3V4YA 2QBYA 2H1RA 2KZUA 4B3MM 2VQFE 2R62A 5LMNE 2E5LE 2M1SA 2WDDA 1DO0A 5KPRA 4AKHA 2ODRD 4OOGC 1TCOA 4LJ9A 3E0JA 4AZFA 3C5WC 1GKIA 4DR4M 4V0XA 4PD2A 3ADLA 3B9PA 1G5BA 3D8BA 1K82A 4MM3B 4F9BB 4OU7A 3L27A 3NWLA 4NSRA 4KZSA 2BJWA 1NHWC 4DUZE 4DR2E 4OX9E 4KBPA 4YY3M 3FKEA 3KXEC 2KKNA 4DUYM 4DV3M 3HHXA 1HR0E 5BPVA 1T4LB 1XZWA 4O24A 5EP2A 3RGSA 4F9AB 4MGIE 3PNYA 5EP1A 5A2QS 2FNAA 4FCTA 1SXJA 4LJ7A 5C18A 4YHHM 2R4JA 1L2DA 1O0WA 3SBJA 4IL1A 1MX0A 5JPFA 5IZ7D 4JI0M 1USHA 3HKPA 2ZM6M 2R17A 4ZVZA 4JV5M 3KBPA 3RL5A 2E1MA 3I4VA 2HYPA 4P78A 2LTRA 3VK7A 2QPAA 4F0ZA 1G8PA 2LE2A 4IJFA 4DV0M 5IT9C 2Z1AA 4UWQA 1XM7A 4NXMM 3EGGA 1DQ3A 3T38A 4B3RM 1GLNA 5KQ8A 1NJGA 4JI2E 1TH4A 1FJGE 1W5TA 1GVNA 3EIEA 2YZTA 4B2OA 2CV2A 1ZAEA 4KHPM 2ZOAA 5HPEA 3U5ZA 4P16A 2L2NA 4M9XA 1N32M 1QVRA 1NSFA 3DSCA 4QOSA 3VK8A 5LMUM 4LJ6A 3SYKA 4IBGA 3JAMS 5ITRA 4GKKM 4H2BA 4JA9A 2UU9M 4JI5M 3J2PB 2DMYA 2Y20A 4JN6A 1TDHA 3IB7A 3LL8A 4FBQA 2Q2EB 1XWIA 2DWNA 3VFDA 1EE8A 2KRKA 2RGHA 2DZNB 4OW0A 2X49A 3H4MA 2JVAA 2YT4A 1PKPA 3K1JA 1XC8A 2LXEA 1E9RA 3GQ3A 2DWMA 4X62M 3HJ8A 1YYOA 4LJ5A 1YE9A 2Z4RA 2Z4SA 3PVSA 3U60A 3CF2A 2FV4B 2KHXA 2UXBE 5IOHA 4LFBM 5DNYA 3SAVA 3I4YA 2DXLA 3HVQA 4AQYM 2V88A 4FBKA 1IXSB 4UT3B 3J80S 2WZOA 4Z8XA 2X8AA 4GKJM 2NQ8C 2CEAA 2XZFA 1Q3CA 1YZ9A 2D7HA 5ITQA 4LG2A 2KOUA 4DR3E 1HNWE 1OFIA 2IE3C 1PM5A 3T1HM 1N75A 4OVZB 4QNMA 3RE8A 2V89A 2BCDA 4QHTA 3JTZA 3SHFA 3GPYA 2C5RA 2EWLA 3M7GA 2ZM6E 2KRUA 1RC7A 4DR1M 4IJEA 1IBMM 1S3LA 4FVMA 3L26A 2Z72A 5JJTA 2Z7JA 1S8EA 3A45A 3SARA 4L78A 3OTOE 1OI8A 3ZOQB 3PSOA 3DOAA 5FTJA 4NL4H 1XMQM 4Q28A 2RTXA 3SYLA 4ZPXA 1GL6A 3KVWA 5A2QC 2I7PA 3KOWE 4CHTB 3SHGB 1GQEA 2LBSB 3AOEC 4B3TM 1N32E 2XFSA 4G6ZA 2DXNA 2YR0A 3GLGA 3LLHA 4ORAA 1XXHA 2W82A 3H63A 4W5WA 4KKZA 2BJVA 2CFOA 1R2ZA 1N36M 2F5NA 3P1XA 3ICFA 4NXNM 3FTDA 3HWSA 3JR5A 3H69A 1KSFX 4I8OA 4QOZC 1QHWA 2F4VM 3IVEA 3KS8A 2IHR1 4LTYA 1IN5A 2KZSA 4X64E 1G59A 2CHQA 3LMMA 1N33M 2FTXB 3RFWA 2NA2A 1Z6TA 3F6GA 4JI7E 2VIIA 3AOGA 3LVWA 5FLXS 4LFAM 3GRUA 2C98A 1QAQA 4OVZA 4NRVA 2F5SA 1AUIA 4REZA 2YEQA 4JI8M 1NJFA 2QCUA 1IBLM 2B3TB 2V86A 4LF7E 3QFMA 4LRSA 3SATA 1IBKE 4J6OA 4L15A 3FD9A 3DJWA 1FKAE 4GKJE 2G5GX 3L29A 2KONA 3FUTA 1HNWM 4LFCM 4DV5E 3U6QA 3CF6E 4H1SA 2ZANA 4R3DA 4FWDA 4LF5M 1DO2A 1ORYB 1ZQ9A 3LVVA 3GO8A 3SASA 1IN7A 4NOOB 1T4NA 1DI2A 2RGOA 2YNMD 2J7OA 2WDEA 3C58A 4M2ZA 4FCXA 4DSYA 2XEPA 1HR0M 4GHAA 4DUYE 4DV3E 4UT3A 3K7VC 4BCAA 2UUBM 3GVEA 1Z5AA 4JI6E 1KBPA 1T70A 4BC7A 1E32A 2F5QA 3THOB 4HL4A 4D81A 3I51A 4DV2M 1Z2WA 3TWLA 3FUVA 1W5SA 1G4AE 2K4VA 3LQRA 1I94M 2R18A 3C4BA 3ZTVA 4BC9A 5J28A 4I81A 3TL4X 3QFKA 1H6UA 4MOYA 3GRRA 4B3SE 4X66M 1NY6A 4G4NA 4L4UA 2VQFM 4B3ME 5EP3A 4O4KA 2RS6A 2LMZA 2YFQA 2L7HA 2O8GA 4AW4A 2QJCA 1YSYA 1IN6A 4NXNE 4LF8E 3KDSE 3L28A 3MSWA 2JOGA 3DW8C 4MGYE 1WXQA 2M7QA 2LUQA 2P6BA 1SXJD 3J7Yp 2B9DA 1WAO1 1XNQM 4AG6A 2V1CA 4JI3M 8CATA 2MDRA 1IY2A 2CE7A 4OX9M 1HO5A 1U32A 4DUZM 1JQJC 2LWXA 3W0FA 4P7DA 4WPYA 2JOBA 2CV9A 2GJUA 1L8QA 2FGGA 2O5RA 2UU9E 2R45A 4JI5E 3FGAC 5INBA 2WDFA 3SFZA 4GH9A 4HLQA 2HL7A 3U6PA 5FLXC 1II7A 3CTWB 2LTSA 5FTKA 4DV6M 2USHA 3H66A 2DHRA 2JA2A 1WHNA 4M0WA 4LF6M 2VF1A 1IT6A 1V73A 2UXBM 4A3VB 4FBWA 4LFCE 2Q8UA 5EQVA 4NZVA 2A5YB 2D7GA 1NNUC 5E26A 2G8LA 3HU3A 5ITTA 2D7EA 3U6LA 5EXTA 4ORCA 3RL4A 1RQ0A 4PCZA 1EKZA 4JA7A 2JY9A 5FSWA 3VK6A 5AASA 4M30A 1DGFA 1FJGM 3FUWA 2UXDE 4H2GA 1SXJE 3HJSA 2UUCM 2Y21A 4DR7M 4GITA 4H2FA 1SXJC 3KOZE 3KSXA 4MGZE 3KFUG 1S3MA 1IN8A 4B7FA 2UUBE 3A98B 3PFIA 3FYDA 1ZBQA 3ADIA 1XNRM 3VYXA 4I5NC 5BR8M 3KSJA 1Q3BA 3GLIA 3HU1A 2L92A 2IE4C 3IG8A 3M0EA 7CATA 2X4AA 5LMUE 3FLOA 4IIWA 2AHMA 2L6MA 4II7A 4I4LA 5EP4A 5FTLA 4GIPA 3GPUA 1DGHB 2L2MA 2AHDA 1IBME 4XPNA 3N5UA 4MP0A 1WARA 1UHZA 3EIHA 1Z5CA 3MK6A 4IBEA 4IBJA 4LY6A 4D80A 1L2BA 2WDCA 4O5GA 5ITXA 1IXRC 2KXEA 3QWLA 3HHYA 2XZUA 4D82A 4BMJA 4X65E 4HD0A 4WYQB 4DV1M 4LF4M 4JI1M 2UXCE 1I4WA 1IN4A 1N34E 5IWAM 3ADGA 2H36X 4EIWA 1HPUA 2R65A 4MGKE 1L2CA 4DHLA 2RSMA 3H64A 4IBFA 2E5LM 1E94E 3L25A 2HKJA 4WW0A 2VQEM 2JR1A 4R8OA 3K8ZA 3UK6A 2DIXA 2HYOA 5ITUA 3K2LA 5H37D 2RKOA 3BOSA 2ODRC 4IBBA 3E9SA 4LGMA 3TWKA 1G3IA 3U6DA 4AG5A 3U6EA 2F8BA 3GLHA 2M4IA 2DFJA 3U61B 5IT9S 1IQPA 3HU2A 2EO2A 4DR2M 2V1UA 4PT5A 2DVWB 2G7HA 2MC5A 3FUXA 3FYCA 5E6JA 3GQ4A 3U6SA 4JI4M 3HXLA 4R03A 4LACC 4RNAA 3FUUA 4TUGA 5C1BA 1WXRA 4MB7A 3UJNA 4LF9M 1Q39A 4JI8E 4YHHE 4XGIA 5F3WA 3L2AA 1Z59A 3PSNA 3AOEA 3AJIB 3JYFA 2KA6B 2L7IA 3AFHA 3IWDA 3U5ZB 4DR5E 1C1KA 3JAMC 1KFVA 3C4TA 4JYAM 4CGYB 3GLGB 1XNRE 1J26A 3H62B 3ILKA 2QZ4A 4Z6YA 5KQDA 4DR6M 5BR8E 4K0KE 1UTEA 1NNWA 4MGHA 1NHGC 4DV0E 2QP9X 4LRTA 4BLCA 2M5ZA 4L5NC 4LJAA 4NXME 4B3RE 3RQZA 1HQYE 3DFZA 2B7VA 3IWCA 3R9XB 1JR3D 1N36E 3FTCA 4LZZA 3THGA 5AE2A 3E7BA 4B7GA 4TUIA 4LGYA 2HHHM 4KHPE 3K92A 1G41A 5JI3E 3GPPA 3FTEA 3DF6A 3LQQA 5EXSA 1X48A 4JI7M 2N3GA 3D03A 4GKKE 4NRWA 4LFAE 2DZOB 3HHZA 3UZUA 2I7NA 2FFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPE A;  1WAO 1;  2NYM C;  2Z06 A;  3P71 C;  3H64 A;  3E7A A;  3QFN A;  4FBQ A;  1HO5 A;  1U32 A;  3K7W C;  2CV9 A;  1UF3 A;  3GVE A;  2GJU A;  2BDX A;  5DNY A;  1W24 A;  2NYL C;  3FGA C;  5INB A;  2WDF A;  3HVQ A;  5C1V A;  1OID A;  2YVT A;  1II7 A;  4FBK A;  2USH A;  3QG5 C;  3H66 A;  4H1Y P;  4UT3 B;  3AUZ A;  1IT6 A;  4FBW A;  1V73 A;  2BQ8 X;  5EQV A;  2Q8U A;  3ZU0 A;  4NZV A;  2IE3 C;  2ZBM A;  4ORC A;  1T71 A;  1S70 A;  3EGH A;  3RL4 A;  2O8A A;  1JK7 A;  2BCD A;  3H68 A;  3IB8 A;  4MOV A;  4H2G A;  3DSD A;  4UT2 A;  1Z2X A;  4H2F A;  5GTU A;  1S95 A;  1QFC A;  1S3M A;  1S3L A;  2NXF A;  2Z72 A;  5JJT A;  4I5N C;  1S8E A;  2IE4 C;  3T1I A;  3CK2 A;  1OI8 A;  4DT2 A;  1S3N A;  3PSO A;  1M63 A;  3C9F A;  2HY1 A;  3QFO A;  1SU1 A;  2AHD A;  4JA7 A;  2QFR A;  4XPN A;  3N5U A;  3IVD A;  1WAR A;  4I5L C;  4MP0 A;  2WDC A;  4O5G A;  4V0V A;  4IYP C;  4H2I A;  4ORA A;  3H63 A;  2A22 A;  4O43 A;  4KKZ A;  4HD0 A;  4UWQ A;  3ICF A;  3H69 A;  3H61 A;  2IAE C;  1QHW A;  3IVE A;  4V0W A;  4YKE A;  4LTY A;  1FJM A;  4OR9 A;  3V4Y A;  1HPU A;  4DHL A;  1MF8 A;  2WDD A;  1TCO A;  1AUI A;  3C5W C;  2HYO A;  4V0X A;  1G5B A;  3QFM A;  4J6O A;  4KBP A;  2DFJ A;  4IL1 A;  4ORB A;  4MOY A;  5IOH A;  2KKN A;  4LAC C;  1XZW A;  4LU9 A;  4O24 A;  4TUG A;  3TGH A;  4H1S A;  4WWL A;  3THN A;  5F3W A;  2NPP C;  4M0V A;  2WDE A;  3PSN A;  3JYF A;  5JPF A;  1USH A;  4FCX A;  4G9J A;  2R17 A;  4DSY A;  4ZVZ A;  3RL5 A;  3KBP A;  4UT3 A;  3K7V C;  2HYP A;  3H62 B;  1KBP A;  1UTE A;  1T70 A;  4F0Z A;  2Z1A A;  1NNW A;  3THO B;  3AV0 A;  3H67 A;  1XM7 A;  3EGG A;  1Z2W A;  3RQZ A;  3RL3 A;  3ZTV A;  3E7B A;  4B2O A;  4ZX2 A;  5J28 A;  3QFK A;  4TUI A;  2XMO A;  5HPE A;  2QFP A;  3DSC A;  4O4K A;  2O8G A;  4H2B A;  4JA9 A;  2QJC A;  5B8I A;  3H60 A;  4Q7F A;  1HP1 A;  1OIE A;  3LL8 A;  3IB7 A;  2JOG A;  3DW8 C;  2P6B A; 
#chains in the Genus database with same CATH topology
 4DV7 M;  2VF7 A;  4B3S M;  4F9C B;  3P71 C;  3LCV B;  1HNZ E;  4KT0 F;  1GZ6 A;  3GVE A;  1YUB A;  5EXP A;  2BDX A;  4DKK A;  2JY6 B;  4AQY E;  2MR9 A;  4Q7J A;  3QG5 C;  5L8R F;  3VLF B;  1HJP A;  2BQ8 X;  2L3J A;  2BNK A;  2QEN A;  2XFT A;  2JUJ A;  3T1H E;  1JK7 A;  4RF1 A;  2XH9 A;  3HJQ A;  1Z2X A;  5GTU A;  2NXF A;  4K0K M;  2RPC A;  1QZM A;  3OTO M;  3CK2 A;  1ZBT A;  1JR3 A;  5A6J A;  4LF8 M;  2HHH E;  2QFR A;  3IVD A;  5DFL A;  3QYB A;  3C6M A;  4H2I A;  1PGY A;  4IBI A;  3RMP A;  2FOI C;  2MRO B;  2ERC A;  2LH0 A;  3U61 A;  4YKE A;  2F4V E;  3J7B A;  3PXG A;  4F1I A;  4RH8 A;  2YTJ A;  1DGG A;  4LF4 E;  1IBL E;  1MJG M;  2K47 A;  4LCB A;  5LLQ A;  5AE3 A;  1QAM A;  3A46 A;  2L3C A;  4IL1 A;  4DR7 E;  2KW0 A;  3ADJ A;  2QBY B;  4LU9 A;  3GLI B;  3TGH A;  1GTK A;  2EMF A;  3THN A;  2CT1 A;  4BBA A;  1RMD A;  2CPN A;  5A6A A;  1PJJ A;  2EM9 A;  1SR9 A;  5GKN A;  3H09 A;  4XK8 F;  3DA1 A;  3MHH C;  2XMO A;  5ITX E;  3J81 S;  5A6K A;  4X66 E;  2L33 A;  4MLV A;  3C3E A;  3HGI A;  1N77 A;  2LO3 A;  2V85 A;  3PNV A;  2JYA A;  5JPE A;  1WGN A;  1B69 A;  2NYM C;  4FCW A;  2EN4 A;  3JU0 A;  1W24 A;  2NYL C;  3GLF A;  1JR3 E;  4DV7 E;  3BBZ A;  2LHC A;  5JI2 E;  3U6O A;  1N33 E;  2EM6 A;  2XSZ D;  4G4R A;  3KP0 E;  1QZE A;  3J80 C;  3GLF B;  1GL7 A;  1L1T A;  1S95 A;  1QFC A;  4QHS A;  1XXH E;  1WHC A;  1YLA A;  2DI0 A;  1IY0 A;  1XXH B;  4FD2 A;  2ZO9 B;  1TH2 A;  3VKH A;  2LV2 A;  2ZBK B;  1A5T A;  5A6B D;  4R7G A;  1EH7 A;  2EOO A;  2YQZ A;  3ZCB B;  2GQF A;  3H61 A;  3TQS A;  2WBU A;  2NUF A;  3V4Y A;  2QBY A;  2EL4 A;  2KZU A;  1ZR9 A;  2YRK A;  2M1S A;  4OOG C;  2ODR D;  4LJ9 A;  3C5W C;  1R4G A;  4L6V 6;  3EPK A;  1G5B A;  3D8B A;  3L27 A;  2R1F A;  4OX9 E;  2BJW A;  1NHW C;  4YY3 M;  4DUY M;  1XZW A;  3FRI A;  3PNY A;  5EP1 A;  4FCT A;  4LJ7 A;  2WBT A;  5KL5 A;  5JPF A;  3HKP A;  2EJ4 A;  2R17 A;  3KBP A;  2E1M A;  4P78 A;  2LTR A;  3L00 A;  2EMI A;  1G8P A;  5IT9 C;  1XM7 A;  5KQ8 A;  1TH4 A;  2HGH A;  3EIE A;  1ZAE A;  5HPE A;  3U5Z A;  4P16 A;  1QVR A;  5LMU M;  4H2B A;  4JI5 M;  3IB7 A;  1TDH A;  4FBQ A;  4OW0 A;  3EPJ A;  2LXE A;  1E9R A;  2DWM A;  1ZMV A;  4LJ5 A;  2KHX A;  2MKN A;  5DNY A;  2QHO B;  3I4Y A;  2DXL A;  2EN7 A;  1D0M A;  2V88 A;  3B7Q A;  2CEA A;  2I9I A;  2YTO A;  2GHF A;  3JTZ A;  3SHF A;  2C5R A;  3M7G A;  1S3L A;  2Z7J A;  1S8E A;  4NL4 H;  2YTI A;  3E46 A;  2RTX A;  1GL6 A;  2I7P A;  1GQE A;  2YRH A;  2DXN A;  2W82 A;  2F5N A;  3P1X A;  4NXN M;  3FTD A;  3JR5 A;  3KS8 A;  1MGT A;  1N33 M;  2FTX B;  3F6G A;  4JI7 E;  2EPR A;  2EE8 A;  5KL3 A;  5FLX S;  4LFA M;  2C98 A;  2M9A A;  1AUI A;  4NRV A;  1NJF A;  2QCU A;  1IBL M;  2V86 A;  1PJQ A;  4LRS A;  3SAT A;  1IBK E;  3DJW A;  3Q8G A;  1YSA C;  2EPP A;  4WXD A;  2LVH A;  4FK5 C;  4H1S A;  2OOA A;  3GO8 A;  1TF3 A;  1DI2 A;  1IN7 A;  4NOO B;  2WDE A;  2RGO A;  2JPA A;  4DSY A;  4DUY E;  1IXS A;  4UT3 A;  4BCA A;  1Z5A A;  1KBP A;  1E32 A;  3THO B;  4HL4 A;  1VEK A;  2KHH A;  1W5S A;  4BC9 A;  4I81 A;  2YTF A;  4B3S E;  3B89 A;  1TF6 A;  1X6H A;  1YSY A;  1IQO A;  4LF8 E;  3L28 A;  4MGY E;  2M7Q A;  2LUQ A;  2B9D A;  1XNQ M;  2V1C A;  2MDR A;  2CE7 A;  4OX9 M;  1JQJ C;  3W0F A;  4WPY A;  1L8Q A;  1QNT A;  2UU9 E;  3FGA C;  4R2P A;  4GH9 A;  3U6P A;  2USH A;  4DV6 M;  2LVN C;  4FBW A;  2VF1 A;  1V73 A;  4A3V B;  3VHT B;  2EPU A;  4NZV A;  3F92 A;  2HAK A;  1VQ1 A;  2G8L A;  3K9O A;  4ORC A;  1RQ0 A;  1EKZ A;  1R5L A;  3HJS A;  2Y21 A;  1SXJ C;  4MGZ E;  1IN8 A;  4B7F A;  3A98 B;  3FYD A;  3VYX A;  4I5N C;  5BR8 M;  1Q3B A;  3FLO A;  3IG8 A;  5LMU E;  4IIW A;  2L6M A;  4N4R B;  4GIP A;  2EN2 A;  4MP0 A;  3EIH A;  1Z5C A;  4LY6 A;  1F4I A;  4ANR A;  2KXE A;  2XZU A;  4D82 A;  2YU8 A;  4LF4 M;  2EKF A;  1I4W A;  2H36 X;  2RSM A;  1OIP A;  4R8O A;  5ITU A;  2ODR C;  3TWK A;  3E9S A;  3HY5 A;  1MN3 A;  1JK1 A;  2DFJ A;  5IT9 S;  1IQP A;  4DR2 M;  2G7H A;  2MC5 A;  2DVW B;  4JI4 M;  4R03 A;  4RNA A;  4MB7 A;  2ELZ A;  4YHH E;  3PSN A;  4GEW A;  1PDA A;  4DR5 E;  3C4T A;  4JYA M;  1J26 A;  3GLG B;  1XNR E;  2DAI A;  2QZ4 A;  4K0K E;  2DLQ A;  1NNW A;  2QP9 X;  4LRT A;  4BLC A;  3RQZ A;  2B7V A;  2HHH M;  4KHP E;  3K92 A;  1AH5 A;  3LQQ A;  4JI7 M;  2N3G A;  4NRW A;  4LFA E;  2DZO B;  2FFJ A;  1T38 A;  1BB8 A;  3GLH B;  2MKD A;  2JY7 A;  3E7A A;  2L6O A;  2APL A;  2C96 A;  4FWH A;  5IRE B;  1XNQ E;  2KNV A;  2YVT A;  4CIZ A;  1NNJ A;  2EKK A;  1STU A;  3UK3 C;  1N78 A;  2ZBM A;  4DR4 E;  2P5T A;  4LF9 E;  1TH3 A;  4DV2 E;  4J8Z A;  1G71 A;  1R6B X;  2OO9 A;  4YY3 E;  4GHL A;  3BBG A;  2EZ6 A;  2JP7 A;  3BGH A;  1XMO E;  1WRJ A;  4G4O A;  4AKI A;  2EMA A;  2L09 A;  2CUZ A;  4AI6 A;  3TPZ A;  3QFO A;  3KOX E;  4ITQ A;  1VDD A;  4B3T E;  3C9P A;  1HT2 E;  2XF3 A;  4NC6 A;  3SMS A;  4F2J C;  3U6M A;  2MC6 A;  4S12 A;  4V0V A;  5LMN M;  2EMX A;  2EPK X;  1X37 A;  1LV7 A;  4OR9 A;  4FW9 A;  1L4S A;  2VDB B;  4WSP A;  2EOS A;  1C7Y A;  2CHV A;  3AKZ A;  4LF7 M;  4LJ4 A;  1IBK M;  4UN2 B;  4R2D A;  3QYE A;  2UUA M;  3NBX X;  3WHK A;  4DV4 E;  1ZMW A;  4I5S A;  3U60 B;  2ZAO A;  4WWL A;  2Y0T A;  1J7K A;  3D8L A;  1T43 A;  1YYW A;  2NPP C;  1HQC A;  1VG5 A;  1HT1 E;  3K9P A;  3CF0 A;  1OJL A;  1HNX E;  4DR3 M;  3JR4 A;  4M9S A;  1UIL A;  3FTF A;  4XBO A;  2YU5 A;  3AV0 A;  2LHG A;  3M6A A;  1D0L A;  2RSI A;  4DR5 M;  4LJ8 A;  1YYK A;  3R8F A;  1VDL A;  3T1Y E;  3IEC A;  3ZH9 B;  3UMM A;  4BHB A;  2J7N A;  1K3X A;  2V87 A;  1X6F A;  2JOX A;  5ADZ A;  2NAB A;  4JI3 E;  2V8Q B;  5FTN A;  4WFT A;  1OID A;  2EM2 A;  1OFH A;  5ITY A;  3HTX A;  5EJC A;  3IHP A;  1S70 A;  3EGH A;  5CFF E;  2B3T A;  2HWJ A;  3V76 A;  4B7H A;  2XLJ A;  3DSD A;  1AIP C;  2XSZ A;  1TTE A;  2EOH A;  4LZJ A;  1TGU A;  3GQ5 A;  4JI6 M;  3TQM A;  2EOJ A;  2C9O A;  3RGP A;  4KLN A;  4O43 A;  2A22 A;  2KEB A;  1JB0 F;  4IBC A;  2R46 A;  2YPN A;  2WBS A;  5A6B A;  2H1R A;  5LMN E;  2R62 A;  1DO0 A;  5KPR A;  4AKH A;  1TCO A;  3E0J A;  4DR4 M;  4V0X A;  3ADL A;  3B9P A;  1NO1 A;  1ZU1 A;  4KZS A;  4CJ6 A;  3BF2 A;  2KKN A;  3HHX A;  1T4L B;  5EP2 A;  4F9A B;  1O0W A;  1SXJ A;  5C18 A;  2EPM X;  3SBJ A;  5IZ7 D;  4ZVZ A;  4JV5 M;  2EPA A;  4F0Z A;  2Z1A A;  4NXM M;  1DQ3 A;  1GLN A;  2BWB A;  1GVN A;  3DSC A;  4GKK M;  2WSE F;  2UU9 M;  2DWN A;  1EE8 A;  2X49 A;  2JY5 A;  1YYO A;  3B7Z A;  1XC8 A;  2N35 A;  4X62 M;  1YE9 A;  2Z4R A;  2Z4S A;  2FV4 B;  4BHC A;  4WP2 A;  2H5X A;  1RU3 A;  3J80 S;  2WZO A;  2EML A;  2D7H A;  4DR3 E;  1WR1 B;  4R2Q A;  1PM5 A;  3RE8 A;  2BCD A;  4DR1 M;  1KYQ A;  1PJS A;  2QSF X;  2Z72 A;  5JJT A;  1T39 A;  4L78 A;  3OTO E;  1OI8 A;  2EMH A;  4ZPX A;  3KVW A;  4CHT B;  2G3Q A;  3KOW E;  1N32 E;  4G6Z A;  3LLH A;  2BJV A;  1EH8 A;  4I8O A;  4QOZ C;  5KL4 A;  1IN5 A;  2KZS A;  3LMM A;  2NA2 A;  3RFW A;  2LVO C;  2F5S A;  4OVZ A;  4REZ A;  4GZN C;  4J6O A;  4L15 A;  4GKJ E;  3BID A;  3L29 A;  3FUT A;  1HNW M;  3U6Q A;  4FWD A;  4LF5 M;  2FH0 A;  3SAS A;  1GO5 A;  2YNM D;  1VEJ A;  2DLK A;  3C58 A;  4FCX A;  2UUB M;  4JI6 E;  3MMP A;  4BC7 A;  2F5Q A;  4DV2 M;  1Z2W A;  3FUV A;  1I94 M;  3TL4 X;  1H6U A;  2EPC A;  2WCC 3;  2VQF M;  4B3M E;  5EP3 A;  2LMZ A;  2QJC A;  1IN6 A;  3KDS E;  2JOG A;  1WXQ A;  1SXJ D;  4F6M A;  2ENA A;  4IJD A;  1IY2 A;  1HO5 A;  5AC4 A;  2GJU A;  2O5R A;  2MJ5 B;  2R45 A;  2BB8 A;  4HEO A;  3SFZ A;  4HLQ A;  1ZV1 A;  1A1G A;  1QUS A;  2YTE A;  3H66 A;  2DHR A;  2UXB M;  5KL6 A;  4LFC E;  5EXT A;  3RL4 A;  3C3D A;  4PCZ A;  2JY9 A;  5FSW A;  1DGF A;  3GLF E;  4H2G A;  5A69 A;  2UUC M;  4H2F A;  1A1I A;  3KSX A;  2YRM A;  1XNR M;  3KSJ A;  2IE4 C;  3M0E A;  4ZYE A;  2AHM A;  3GLH E;  4II7 A;  3GPU A;  1DGH B;  4XPN A;  2WDC A;  1G2F C;  3HHY A;  3QWL A;  4BMJ A;  3EPH A;  5IWA M;  3ADG A;  2BWE A;  4IBF A;  3L25 A;  2JR1 A;  2I13 A;  3BXW A;  2M4I A;  2KNA A;  2F8B A;  3HU2 A;  2EO2 A;  5E6J A;  3FYC A;  2MGW A;  3GQ4 A;  3U6S A;  3GLI E;  4TUG A;  4JI8 E;  4F6N A;  2EOM A;  5F3W A;  1Z59 A;  2KA6 B;  2L7I A;  3AFH A;  3IWD A;  1C1K A;  1KFV A;  4CGY B;  1NEI A;  4B3R E;  2L2D A;  3IWC A;  1JR3 D;  1N36 E;  4LZZ A;  5AE2 A;  3THG A;  1Z1B A;  4TUI A;  4LGY A;  3GPP A;  1ZMU A;  4GKK E;  3HHZ A;  3K6Q A;  2DAM A;  1P47 A;  1QDR A;  1DGH A;  2Z06 A;  3E4R A;  3J27 B;  2EMG A;  4X62 E;  3ZC7 B;  3MHV C;  1JK2 A;  2N3H A;  3VYY A;  4G4Q A;  1TN9 A;  4LF5 E;  1NVM A;  4CIS A;  3TWM A;  4H1Y P;  1D0K A;  2UUA E;  3ZU0 A;  2CV0 A;  2LUP B;  2WZJ A;  4FWG A;  2LT7 A;  4F2L A;  2J5Y A;  4DR6 E;  4KO8 A;  2DMI A;  1V33 A;  2NUE A;  2KDL A;  4DT2 A;  1OKS A;  4JI0 E;  2HY1 A;  2DSY A;  1T3T A;  3QAU A;  4PDG A;  3SAU A;  4JA7 A;  4BB9 A;  4M9Z A;  2EL5 A;  2QQ8 A;  3T1Y M;  2EM5 A;  2C99 A;  4WUR A;  4GC5 A;  4GRI A;  4V0W A;  1HNZ M;  3VDU A;  4X9J A;  1D2N A;  3SMP A;  1NV9 A;  2L8T A;  3J7A S;  4GEQ B;  4M0D A;  4QNR A;  3KW6 A;  3VDP A;  1QAO A;  1YPN A;  2LRS A;  3UGJ A;  3F6H A;  5KO3 A;  5LL6 R;  4X8W A;  1R2Y A;  2UUC E;  5IOH A;  5DYI A;  3KZY A;  1AAY A;  4ZYH A;  2DHY A;  2VQE E;  2EA0 A;  2DWL A;  2EOQ A;  3Q8X A;  3NBI A;  2OQ4 A;  3B74 A;  2N8X A;  2EPO A;  2EM0 A;  2WSF F;  2ZAM A;  1T6O A;  5EXX A;  4GC9 A;  1SXJ B;  2YTP A;  2JY8 A;  1T4O A;  4BS9 A;  5EQT A;  2EN1 A;  2M60 A;  2Y0Q A;  1IXZ A;  1OQY A;  2DAE A;  1SFE A;  2D9H A;  3J7A G;  2QFP A;  3CGW A;  2DWZ B;  3H60 A;  4Q7F A;  4LFB E;  3GRV A;  3SAW A;  4F54 A;  2FE8 A;  4R2A A;  1A1H A;  3HZJ A;  1GAB A;  2K9D A;  2DXI A;  2LJU A;  3LML A;  2V6Z M;  3WHL A;  5C1V A;  5KPT A;  2EUC A;  3KWR A;  4DV6 E;  4IBK A;  1OTR A;  4DR1 E;  1EFU B;  1N3G A;  2CWB A;  3GP1 A;  2OPF A;  3VKG A;  1T71 A;  2CHG A;  3DZD A;  1WHQ A;  4MOV A;  2CV1 A;  2NUG A;  2ADR A;  2Z8Y M;  1J09 A;  1J5E M;  1IY1 A;  2HJJ A;  5T6J A;  1M63 A;  3MJ5 A;  1SU1 A;  3SC3 A;  4R2E A;  2HCB A;  4TUW A;  1YUJ A;  4NSO B;  1X47 A;  1S3S A;  2VE7 C;  3OML A;  4X65 M;  1MEY C;  5DYG A;  1I94 E;  3HPS A;  2DB2 A;  1SG9 A;  5IWA E;  4B3M M;  2VQF E;  3H4J A;  2LTU A;  2E5L E;  3ECR A;  1TR8 A;  3EQ1 A;  4AZF A;  1GKI A;  4PD2 A;  3E21 A;  1K82 A;  3NWL A;  4KBP A;  4DUZ E;  3FKE A;  1HR0 E;  4MGI E;  2FNA A;  4YHH M;  2DGC A;  1CUK A;  1A1F A;  4JI0 M;  3I4V A;  2LE2 A;  4IJF A;  4DV0 M;  1BVS A;  3T38 A;  4B3R M;  2LCE A;  1NJG A;  2YZT A;  4B2O A;  4R71 A;  1A1L A;  4M9X A;  1N32 M;  1NSF A;  4QOS A;  3SYK A;  4IBG A;  5ITR A;  2O25 A;  2ENH A;  4JA9 A;  3J2P B;  2CTD A;  2Y20 A;  2DMY A;  2YTQ A;  1UBD C;  2Q2E B;  3VFD A;  2RGH A;  2DZN B;  2YT4 A;  3H4M A;  4M9V C;  1PKP A;  3GQ3 A;  3HJ8 A;  3PVS A;  3U60 A;  3CF2 A;  4HTG A;  2UXB E;  4LFB M;  3SAV A;  2R76 A;  4FBK A;  2NQ8 C;  1YZ9 A;  5ITQ A;  2KOU A;  3T1H M;  1N75 A;  4OVZ B;  4QNM A;  2VRD A;  2ZM6 E;  2KRU A;  2A25 A;  4FVM A;  2YTD A;  2YSP A;  2QNJ A;  3SAR A;  4WXC A;  2K7I A;  3ZOQ B;  3PSO A;  5FTJ A;  1XMQ M;  3SYL A;  5A2Q C;  2LBS B;  3AOE C;  4B3T M;  2YTN A;  3GLG A;  1XXH A;  4KKZ A;  1LTM A;  2JXP A;  1N36 M;  2JZ0 A;  2F4V M;  2IHR 1;  4LTY A;  2GNO A;  4X64 E;  2CHQ A;  2PRT A;  2VII A;  2EMB A;  3AOG A;  3GRU A;  2DAK A;  4JI8 M;  2B3T B;  4LF7 E;  3QFM A;  1FKA E;  2G5G X;  2GPI A;  5KL2 A;  2DKL A;  4DV5 E;  2ZAN A;  2LBC A;  1DO2 A;  1ZQ9 A;  3B7N A;  3LVV A;  1T4N A;  4M2Z A;  2XEP A;  1HR0 M;  2EMZ A;  2RRU A;  2DZL A;  4ZYD A;  1T70 A;  4D81 A;  3I51 A;  3TWL A;  2K4V A;  3LQR A;  3ZTV A;  5J28 A;  3GRR A;  3HX3 A;  4O4K A;  4L4U A;  4NXN E;  1A1K A;  3DW8 C;  2VF8 A;  3J7Y p;  4AG6 A;  4DUZ M;  1KJK A;  4P7D A;  2JOB A;  2FGG A;  2LTS A;  1WHN A;  4LF6 M;  1IT6 A;  3FRH A;  2Q8U A;  1NNU C;  5E26 A;  5ITT A;  3LW5 F;  2CP8 A;  3VK6 A;  1FJG M;  2EM4 A;  2UXD E;  1SXJ E;  4GIT A;  3KOZ E;  1S3M A;  3KFU G;  3ADI A;  2L92 A;  3GLI A;  7CAT A;  2X4A A;  2FS1 A;  2WSC F;  5EP4 A;  5FTL A;  2L2M A;  2AHD A;  1IBM E;  1WAR A;  2R0I A;  5ITX A;  4X65 E;  1BBO A;  2GLI A;  2DAG A;  4HD0 A;  1YUI A;  1GJS A;  4EIW A;  1HPU A;  4MGK E;  5KL7 A;  2KNZ A;  2HKJ A;  2O01 F;  4WW0 A;  2VQE M;  2HYO A;  3UK6 A;  3MHS C;  3U6E A;  2JNH A;  1G3I A;  3GLH A;  4ORB A;  4MOY A;  3FUU A;  5C1B A;  1WXR A;  4LF9 M;  4XGI A;  1WJP A;  3AJI B;  3AOE A;  3JYF A;  4RKU F;  4DR6 M;  4Z6Y A;  5BR8 E;  1UTE A;  4NXM E;  2L4F A;  3FTC A;  2DRP A;  3E7B A;  2E72 A;  1X3C A;  2EMC A;  2ENC A;  1G41 A;  5JI3 E;  3DF6 A;  5EXS A;  2EM3 A;  1OAI A;  2I7N A;  1L1Z A;  1DGB A;  5KPZ A;  2B7T A;  3QFN A;  1UF3 A;  3U6C A;  3GRY A;  2HC5 A;  4MH0 E;  5AC5 A;  4L16 A;  3HHW A;  2JWO A;  1GJT A;  2C9C A;  2EMW A;  3AUZ A;  4IS1 C;  4JI4 E;  2ZTD A;  5IXM B;  1J5E E;  4GMQ A;  4G3O A;  4DMI A;  2L2K B;  2F5O A;  4IBD A;  4LF6 E;  1Z5B A;  4JYA E;  2LJH A;  3W67 A;  1HNX M;  1QYR A;  1K3W A;  3T1I A;  1DGC A;  1S3N A;  3C9F A;  2CRU A;  4WX9 A;  1XMQ E;  1IM2 A;  2EN8 A;  1F2I G;  1FNN A;  2V83 A;  1NV8 A;  1R7R A;  1EH6 A;  4IYP C;  3HQ1 A;  4FCV A;  4JI2 M;  1XHB A;  2EQ3 A;  3GPX A;  1NCS A;  2DNA A;  4L8N A;  4ZYG A;  3FIG A;  3KZZ A;  4HEI A;  1NY5 A;  4X64 M;  1MF8 A;  2DEN A;  1WGL A;  1Q02 A;  4DV1 E;  1N34 M;  2F5P A;  4NHR A;  5AE1 A;  4AKG A;  1XB2 B;  3KS4 A;  4P17 A;  2JWS A;  5FTM A;  4R2R A;  2EOY A;  2LNH C;  2Z3X A;  1PJI A;  1MU5 A;  3AL0 C;  4M0V A;  4G9J A;  1WJ7 A;  1XMO M;  4B08 A;  1E9S A;  3H67 A;  3IWB A;  1DV0 A;  3TE6 A;  3RL3 A;  1QU6 A;  2YSO A;  1P3Q Q;  1QDT A;  4ZX2 A;  4RHB B;  1KYI A;  5B8I A;  4RF0 A;  1HP1 A;  1OIE A;  2XGN A;  1UM8 A;  2K6B A;  2ZTC A;  3IG5 A;  1VEG A;  2J7J A;  1OAO C;  2EOE A;  1TF0 B;  4L8R C;  3I01 M;  3A42 A;  2RS7 A;  4BBY A;  2YTG A;  3T15 A;  4JXJ A;  3I04 M;  2EQ0 A;  2EOX A;  4DV4 M;  1QQW A;  2O8A A;  3H68 A;  3IB8 A;  2UXD M;  3M99 B;  1AUA A;  4UT2 A;  2JZ1 A;  3W0L B;  4JV5 E;  3KP1 E;  4DV5 M;  1X49 A;  2EM8 A;  3C6K A;  2R4E A;  3KOY E;  1IQS A;  1G2D C;  2EOR A;  4KOD A;  3HPZ A;  4I5L C;  1QAN A;  4PDI A;  3J81 C;  1TDZ A;  2UXC M;  4JI1 E;  2IAE C;  1FJM A;  2EOZ A;  2WDD A;  3FE3 A;  2YWQ A;  2EOI A;  4MLQ A;  4F9B B;  4MM3 B;  4OU7 A;  4NSR A;  1BBG A;  4DR2 E;  1PRB A;  3KXE C;  4DV3 M;  1V92 A;  5BPV A;  4O24 A;  3RGS A;  1ZAA C;  3W68 A;  5A2Q S;  1L2D A;  2R4J A;  1IFY A;  1MX0 A;  1USH A;  2ZM6 M;  3RL5 A;  2HYP A;  5TSE A;  3VK7 A;  2QPA A;  2LVQ D;  3EGG A;  1FJG E;  4JI2 E;  2JP9 A;  1W5T A;  4WSG A;  2CV2 A;  4KHP M;  2ZOA A;  2L2N A;  1YFH A;  3VK8 A;  4LJ6 A;  3JAM S;  2EOF A;  3LL8 A;  4JN6 A;  1XWI A;  2KRK A;  2JVA A;  3H64 A;  3K1J A;  2LVP C;  2EN3 A;  5IV8 B;  3HVQ A;  4AQY M;  1IXS B;  4UT3 B;  4Z8X A;  2X8A A;  4GKJ M;  2EPX A;  2XZF A;  1Q3C A;  2EPL X;  4LG2 A;  4Q35 B;  3LCU A;  1OFI A;  1HNW E;  2IE3 C;  2EQ1 A;  4KWY A;  2EP3 A;  2V89 A;  2RQL A;  4QHT A;  3GPY A;  2EWL A;  1RC7 A;  2EJS A;  1UN6 B;  4IJE A;  1IBM M;  2ELY A;  3L26 A;  1QUT A;  3A45 A;  2R6F A;  3DOA A;  4Q28 A;  3SHG B;  2XFS A;  2EN6 A;  2YR0 A;  4ORA A;  3H63 A;  4W5W A;  2CFO A;  1R2Z A;  4UWQ A;  3ICF A;  3H69 A;  3HWS A;  1KSF X;  1QHW A;  3IVE A;  1EIJ A;  1G59 A;  1Z6T A;  3LVW A;  3ZQJ A;  1QAQ A;  1X5W A;  2YEQ A;  3FD9 A;  2KON A;  3EPL A;  2EPN A;  4LFC M;  3CF6 E;  4R3D A;  1ORY B;  2CSH A;  2J7O A;  2MH8 A;  4GHA A;  2EMY A;  4DV3 E;  3K7V C;  2R44 A;  2OOB A;  3T6P A;  1G4A E;  4R2S A;  2EMK A;  2R18 A;  3C4B A;  3QFK A;  4X66 M;  2L4E A;  1NY6 A;  2BBG A;  4G4N A;  2EPZ A;  2RS6 A;  2O8G A;  2YFQ A;  2L7H A;  4AW4 A;  1Y8G A;  1OIZ A;  3MSW A;  2P6B A;  1WAO 1;  4JI3 M;  8CAT A;  1U32 A;  3K7W C;  2LWX A;  2CV9 A;  4JI5 E;  2JXN A;  5INB A;  2WDF A;  2HL7 A;  5FLX C;  1II7 A;  3CTW B;  5FTK A;  2JA2 A;  4M0W A;  5EQV A;  1IMU A;  2A5Y B;  2D7G A;  3HU3 A;  2D7E A;  2LVA A;  3U6L A;  5AAS A;  4M30 A;  3FUW A;  4DR7 M;  2UUB E;  3PFI A;  1ZBQ A;  3HU1 A;  4I4L A;  3N5U A;  1UHZ A;  4IBE A;  3MK6 A;  4IBJ A;  4D80 A;  1L2B A;  1LLM C;  4O5G A;  1IXR C;  2MDG A;  4Y28 F;  4WYQ B;  4DV1 M;  4JI1 M;  2UXC E;  1IN4 A;  1N34 E;  1A1J A;  2EM7 A;  2EL6 A;  2R65 A;  1L2C A;  4DHL A;  2K0B X;  2E5L M;  1E94 E;  1WIV A;  3K8Z A;  2DIX A;  4DBG B;  3K2L A;  5H37 D;  2RKO A;  3BOS A;  4IBB A;  3U6D A;  4LGM A;  4AG5 A;  3U61 B;  2V1U A;  4PT5 A;  3HXL A;  3FUX A;  4LAC C;  3UJN A;  1Q39 A;  3L2A A;  1PJT A;  3U5Z B;  3GLG E;  3JAM C;  1X6E A;  3H62 B;  1V34 A;  3ILK A;  5KQD A;  4MGH A;  1NHG C;  4DV0 E;  4L5N C;  2M5Z A;  4R2C A;  4LJA A;  1HQY E;  3DFZ A;  1UFZ A;  3R9X B;  4B7G A;  3FTE A;  1X48 A;  3D03 A;  3UZU A; 
#chains in the Genus database with same CATH homology
 1L1Z A;  4DV7 M;  3GLH B;  1DGB A;  4B3S M;  5KPZ A;  4F9C B;  3P71 C;  1DGH A;  2Z06 A;  2B7T A;  1HNZ E;  3E4R A;  3E7A A;  3QFN A;  3J27 B;  2L6O A;  4X62 E;  1UF3 A;  3U6C A;  3GRY A;  1YUB A;  3ZC7 B;  5EXP A;  3MHV C;  1GZ6 A;  2C96 A;  2BDX A;  4MH0 E;  4DKK A;  2N3H A;  4FWH A;  4G4Q A;  3VYY A;  5IRE B;  4L16 A;  4AQY E;  1XNQ E;  4LF5 E;  1NVM A;  2YVT A;  4CIS A;  3HHW A;  3TWM A;  2C9C A;  2JWO A;  3QG5 C;  1NNJ A;  4H1Y P;  3AUZ A;  1STU A;  3VLF B;  1N78 A;  4JI4 E;  2BQ8 X;  2UUA E;  2L3J A;  2BNK A;  2QEN A;  4GMQ A;  1J5E E;  3ZU0 A;  2ZBM A;  4DMI A;  2P5T A;  2XFT A;  2CV0 A;  2LUP B;  4LF9 E;  4DR4 E;  1TH3 A;  3T1H E;  2L2K B;  1JK7 A;  4FWG A;  4RF1 A;  2XH9 A;  3HJQ A;  2F5O A;  4J8Z A;  4DV2 E;  4IBD A;  1R6B X;  4YY3 E;  1Z2X A;  4LF6 E;  5GTU A;  4GHL A;  1Z5B A;  4JYA E;  2EZ6 A;  2LJH A;  2NXF A;  4K0K M;  4KO8 A;  1HNX M;  4DR6 E;  2NUE A;  1XMO E;  1QYR A;  1K3W A;  1QZM A;  3OTO M;  3T1I A;  3CK2 A;  4G4O A;  4AKI A;  4DT2 A;  1S3N A;  1ZBT A;  2L09 A;  2CUZ A;  3C9F A;  1JR3 A;  4AI6 A;  1XMQ E;  1IM2 A;  3TPZ A;  4LF8 M;  4JI0 E;  2HY1 A;  2DSY A;  3KOX E;  4ITQ A;  1T3T A;  3QAU A;  1VDD A;  4PDG A;  1FNN A;  3SAU A;  2V83 A;  2HHH E;  4B3T E;  1HT2 E;  4M9Z A;  4BB9 A;  2QFR A;  3IVD A;  1R7R A;  2XF3 A;  3SMS A;  3U6M A;  3T1Y M;  4S12 A;  2MC6 A;  4IYP C;  5LMN M;  4V0V A;  3HQ1 A;  4H2I A;  4IBI A;  4FCV A;  4JI2 M;  3RMP A;  2C99 A;  2FOI C;  1XHB A;  3GPX A;  4WUR A;  4GC5 A;  4L8N A;  4GRI A;  1X37 A;  2ERC A;  2LH0 A;  3U61 A;  4V0W A;  1HNZ M;  2F4V E;  1LV7 A;  3J7B A;  4YKE A;  3VDU A;  4OR9 A;  1D2N A;  3PXG A;  3SMP A;  3FIG A;  4FW9 A;  1NY5 A;  4X64 M;  1MF8 A;  2L8T A;  3J7A S;  4GEQ B;  4M0D A;  1DGG A;  4WSP A;  4QNR A;  3KW6 A;  3VDP A;  4DV1 E;  4LF4 E;  2CHV A;  3AKZ A;  2K47 A;  1IBL E;  4LF7 M;  1N34 M;  1QAO A;  4LCB A;  2LRS A;  3UGJ A;  3F6H A;  2F5P A;  4LJ4 A;  1IBK M;  5KO3 A;  1QAM A;  3A46 A;  4X8W A;  4AKG A;  1R2Y A;  5LL6 R;  5AE1 A;  5AE3 A;  2L3C A;  5DYI A;  2KW0 A;  2UUA M;  2QBY B;  3ADJ A;  2UUC E;  3K7W C;  4LU9 A;  3KS4 A;  3GLI B;  2VQE E;  4DV4 E;  3WHK A;  3TGH A;  3U60 B;  4I5S A;  2ZAO A;  5FTM A;  4WWL A;  2EA0 A;  3THN A;  2Y0T A;  1J7K A;  2DWL A;  3D8L A;  1YYW A;  4BBA A;  2NPP C;  2LNH C;  2Z3X A;  1PJI A;  1MU5 A;  1HQC A;  3AL0 C;  4M0V A;  1HT1 E;  4G9J A;  3Q8X A;  3NBI A;  3CF0 A;  2CPN A;  2OQ4 A;  1OJL A;  1HNX E;  4DR3 M;  3JR4 A;  4M9S A;  1PJJ A;  1SR9 A;  1XMO M;  4XBO A;  4B08 A;  3FTF A;  1UIL A;  1E9S A;  3AV0 A;  3IWB A;  2ZAM A;  3M6A A;  5GKN A;  3H67 A;  5EXX A;  3H09 A;  4GC9 A;  1SXJ B;  3TE6 A;  1T4O A;  3RL3 A;  4BS9 A;  1QU6 A;  5EQT A;  4DR5 M;  2M60 A;  2Y0Q A;  4ZX2 A;  4LJ8 A;  3DA1 A;  2XMO A;  5ITX E;  1IXZ A;  3J81 S;  3J7A G;  2QFP A;  1YYK A;  3R8F A;  1KYI A;  2DWZ B;  4X66 E;  3ZH9 B;  3T1Y E;  3UMM A;  2L33 A;  2J7N A;  1K3X A;  2V87 A;  5B8I A;  4RF0 A;  3H60 A;  3HGI A;  1N77 A;  1HP1 A;  4LFB E;  4Q7F A;  1OIE A;  3GRV A;  2XGN A;  1UM8 A;  2V85 A;  3PNV A;  3SAW A;  4F54 A;  2FE8 A;  5JPE A;  3IG5 A;  2JOX A;  5ADZ A;  2NYM C;  4JI3 E;  2V8Q B;  2DXI A;  4FCW A;  5FTN A;  4L8R C;  3JU0 A;  4ORB A;  3LML A;  2V6Z M;  4WFT A;  1W24 A;  2NYL C;  3GLF A;  3WHL A;  5C1V A;  4DV7 E;  1OID A;  5JI2 E;  5KPT A;  2EUC A;  3A42 A;  3U6O A;  2RS7 A;  3KWR A;  1OFH A;  1N33 E;  4BBY A;  4DV6 E;  4IBK A;  3T15 A;  2XSZ D;  4JXJ A;  4DR1 E;  3K6Q A;  5ITY A;  3HTX A;  5EJC A;  4DV4 M;  4G4R A;  3KP0 E;  1QQW A;  3J80 C;  3GP1 A;  2OPF A;  3VKG A;  1T71 A;  2CHG A;  1S70 A;  3EGH A;  2O8A A;  3DZD A;  3GLF B;  1WHQ A;  5CFF E;  3H68 A;  3IB8 A;  1GL7 A;  4B7H A;  2CV1 A;  4MOV A;  2XLJ A;  2UXD M;  4UT2 A;  2NUG A;  3DSD A;  2XSZ A;  1L1T A;  1S95 A;  1QFC A;  1J09 A;  4QHS A;  1J5E M;  3W0L B;  4JV5 E;  3KP1 E;  4DV5 M;  1X49 A;  1IY1 A;  4DR7 E;  4FD2 A;  1IY0 A;  1TGU A;  1XXH B;  2R4E A;  4LZJ A;  2ZO9 B;  3KOY E;  1TH2 A;  3VKH A;  5T6J A;  1M63 A;  2ZBK B;  3MJ5 A;  1SU1 A;  3SC3 A;  3GQ5 A;  2HCB A;  4KOD A;  4TUW A;  3HPZ A;  4JI6 M;  4R7G A;  1QAN A;  4NSO B;  1S3S A;  1X47 A;  2VE7 C;  3OML A;  4PDI A;  4I5L C;  4X65 M;  2C9O A;  3RGP A;  4KLN A;  2YQZ A;  3ZCB B;  3J81 C;  2A22 A;  4O43 A;  5DYG A;  1TDZ A;  1I94 E;  2KEB A;  2UXC M;  4IBC A;  4JI1 E;  2R46 A;  2IAE C;  3HPS A;  3TQS A;  2DB2 A;  3H61 A;  2NUF A;  3QFO A;  1FJM A;  5IWA E;  3V4Y A;  2QBY A;  2H1R A;  2KZU A;  4B3M M;  2VQF E;  2R62 A;  5LMN E;  2E5L E;  2M1S A;  2WDD A;  1DO0 A;  5KPR A;  4AKH A;  2ODR D;  4OOG C;  1TCO A;  4LJ9 A;  3E0J A;  4AZF A;  3C5W C;  1GKI A;  4DR4 M;  4V0X A;  4PD2 A;  3ADL A;  3B9P A;  1G5B A;  3D8B A;  1K82 A;  4MM3 B;  4F9B B;  4OU7 A;  3L27 A;  3NWL A;  4NSR A;  4KZS A;  2BJW A;  1NHW C;  4DUZ E;  4DR2 E;  4OX9 E;  4KBP A;  4YY3 M;  3FKE A;  3KXE C;  2KKN A;  4DUY M;  4DV3 M;  3HHX A;  1HR0 E;  5BPV A;  1T4L B;  1XZW A;  4O24 A;  5EP2 A;  3RGS A;  4F9A B;  4MGI E;  3PNY A;  5EP1 A;  5A2Q S;  2FNA A;  4FCT A;  1SXJ A;  4LJ7 A;  5C18 A;  4YHH M;  2R4J A;  1L2D A;  1O0W A;  3SBJ A;  4IL1 A;  1MX0 A;  5JPF A;  5IZ7 D;  4JI0 M;  1USH A;  3HKP A;  2ZM6 M;  2R17 A;  4ZVZ A;  4JV5 M;  3KBP A;  3RL5 A;  2E1M A;  3I4V A;  2HYP A;  4P78 A;  2LTR A;  3VK7 A;  2QPA A;  4F0Z A;  1G8P A;  2LE2 A;  4IJF A;  4DV0 M;  5IT9 C;  2Z1A A;  4UWQ A;  1XM7 A;  4NXM M;  3EGG A;  1DQ3 A;  3T38 A;  4B3R M;  1GLN A;  5KQ8 A;  1NJG A;  4JI2 E;  1TH4 A;  1FJG E;  1W5T A;  1GVN A;  3EIE A;  2YZT A;  4B2O A;  2CV2 A;  1ZAE A;  4KHP M;  2ZOA A;  5HPE A;  3U5Z A;  4P16 A;  2L2N A;  4M9X A;  1N32 M;  1QVR A;  1NSF A;  3DSC A;  4QOS A;  3VK8 A;  5LMU M;  4LJ6 A;  3SYK A;  4IBG A;  3JAM S;  5ITR A;  4GKK M;  4H2B A;  4JA9 A;  2UU9 M;  4JI5 M;  3J2P B;  2DMY A;  2Y20 A;  4JN6 A;  1TDH A;  3IB7 A;  3LL8 A;  4FBQ A;  2Q2E B;  1XWI A;  2DWN A;  3VFD A;  1EE8 A;  2KRK A;  2RGH A;  2DZN B;  4OW0 A;  2X49 A;  3H4M A;  2JVA A;  2YT4 A;  1PKP A;  3K1J A;  1XC8 A;  2LXE A;  1E9R A;  3GQ3 A;  2DWM A;  4X62 M;  3HJ8 A;  1YYO A;  4LJ5 A;  1YE9 A;  2Z4R A;  2Z4S A;  3PVS A;  3U60 A;  3CF2 A;  2FV4 B;  2KHX A;  2UXB E;  5IOH A;  4LFB M;  5DNY A;  3SAV A;  3I4Y A;  2DXL A;  3HVQ A;  4AQY M;  2V88 A;  4FBK A;  1IXS B;  4UT3 B;  3J80 S;  2WZO A;  4Z8X A;  2X8A A;  4GKJ M;  2NQ8 C;  2CEA A;  2XZF A;  1Q3C A;  1YZ9 A;  2D7H A;  5ITQ A;  4LG2 A;  2KOU A;  4DR3 E;  1HNW E;  1OFI A;  2IE3 C;  1PM5 A;  3T1H M;  1N75 A;  4OVZ B;  4QNM A;  3RE8 A;  2V89 A;  2BCD A;  4QHT A;  3JTZ A;  3SHF A;  3GPY A;  2C5R A;  2EWL A;  3M7G A;  2ZM6 E;  2KRU A;  1RC7 A;  4DR1 M;  4IJE A;  1IBM M;  1S3L A;  4FVM A;  3L26 A;  2Z72 A;  5JJT A;  2Z7J A;  1S8E A;  3A45 A;  3SAR A;  4L78 A;  3OTO E;  1OI8 A;  3ZOQ B;  3PSO A;  3DOA A;  5FTJ A;  4NL4 H;  1XMQ M;  4Q28 A;  2RTX A;  3SYL A;  4ZPX A;  1GL6 A;  3KVW A;  5A2Q C;  2I7P A;  3KOW E;  4CHT B;  3SHG B;  1GQE A;  2LBS B;  3AOE C;  4B3T M;  1N32 E;  2XFS A;  4G6Z A;  2DXN A;  2YR0 A;  3GLG A;  3LLH A;  4ORA A;  1XXH A;  2W82 A;  3H63 A;  4W5W A;  4KKZ A;  2BJV A;  2CFO A;  1R2Z A;  1N36 M;  2F5N A;  3P1X A;  3ICF A;  4NXN M;  3FTD A;  3HWS A;  3JR5 A;  3H69 A;  1KSF X;  4I8O A;  4QOZ C;  1QHW A;  2F4V M;  3IVE A;  3KS8 A;  2IHR 1;  4LTY A;  1IN5 A;  2KZS A;  4X64 E;  1G59 A;  2CHQ A;  3LMM A;  1N33 M;  2FTX B;  3RFW A;  2NA2 A;  1Z6T A;  3F6G A;  4JI7 E;  2VII A;  3AOG A;  3LVW A;  5FLX S;  4LFA M;  3GRU A;  2C98 A;  1QAQ A;  4OVZ A;  4NRV A;  2F5S A;  1AUI A;  4REZ A;  2YEQ A;  4JI8 M;  1NJF A;  2QCU A;  1IBL M;  2B3T B;  2V86 A;  4LF7 E;  3QFM A;  4LRS A;  3SAT A;  1IBK E;  4J6O A;  4L15 A;  3FD9 A;  3DJW A;  1FKA E;  4GKJ E;  2G5G X;  3L29 A;  2KON A;  3FUT A;  1HNW M;  4LFC M;  4DV5 E;  3U6Q A;  3CF6 E;  4H1S A;  2ZAN A;  4R3D A;  4FWD A;  4LF5 M;  1DO2 A;  1ORY B;  1ZQ9 A;  3LVV A;  3GO8 A;  3SAS A;  1IN7 A;  4NOO B;  1T4N A;  1DI2 A;  2RGO A;  2YNM D;  2J7O A;  2WDE A;  3C58 A;  4M2Z A;  4FCX A;  4DSY A;  2XEP A;  1HR0 M;  4GHA A;  4DUY E;  4DV3 E;  4UT3 A;  3K7V C;  4BCA A;  2UUB M;  3GVE A;  1Z5A A;  4JI6 E;  1KBP A;  1T70 A;  4BC7 A;  1E32 A;  2F5Q A;  3THO B;  4HL4 A;  4D81 A;  3I51 A;  4DV2 M;  1Z2W A;  3TWL A;  3FUV A;  1W5S A;  1G4A E;  2K4V A;  3LQR A;  1I94 M;  2R18 A;  3C4B A;  3ZTV A;  4BC9 A;  5J28 A;  4I81 A;  3TL4 X;  3QFK A;  1H6U A;  4MOY A;  3GRR A;  4B3S E;  4X66 M;  1NY6 A;  4G4N A;  4L4U A;  2VQF M;  4B3M E;  5EP3 A;  4O4K A;  2RS6 A;  2LMZ A;  2YFQ A;  2L7H A;  2O8G A;  4AW4 A;  2QJC A;  1YSY A;  1IN6 A;  4NXN E;  4LF8 E;  3KDS E;  3L28 A;  3MSW A;  2JOG A;  3DW8 C;  4MGY E;  1WXQ A;  2M7Q A;  2LUQ A;  2P6B A;  1SXJ D;  3J7Y p;  2B9D A;  1WAO 1;  1XNQ M;  4AG6 A;  2V1C A;  4JI3 M;  8CAT A;  2MDR A;  1IY2 A;  2CE7 A;  4OX9 M;  1HO5 A;  1U32 A;  4DUZ M;  1JQJ C;  2LWX A;  3W0F A;  4P7D A;  4WPY A;  2JOB A;  2CV9 A;  2GJU A;  1L8Q A;  2FGG A;  2O5R A;  2UU9 E;  2R45 A;  4JI5 E;  3FGA C;  5INB A;  2WDF A;  3SFZ A;  4GH9 A;  4HLQ A;  2HL7 A;  3U6P A;  5FLX C;  1II7 A;  3CTW B;  2LTS A;  5FTK A;  4DV6 M;  2USH A;  3H66 A;  2DHR A;  2JA2 A;  1WHN A;  4M0W A;  4LF6 M;  2VF1 A;  1IT6 A;  1V73 A;  2UXB M;  4A3V B;  4FBW A;  4LFC E;  2Q8U A;  5EQV A;  4NZV A;  2A5Y B;  2D7G A;  1NNU C;  5E26 A;  2G8L A;  3HU3 A;  5ITT A;  2D7E A;  3U6L A;  5EXT A;  4ORC A;  3RL4 A;  1RQ0 A;  4PCZ A;  1EKZ A;  4JA7 A;  2JY9 A;  5FSW A;  3VK6 A;  5AAS A;  4M30 A;  1DGF A;  1FJG M;  3FUW A;  2UXD E;  4H2G A;  1SXJ E;  3HJS A;  2UUC M;  2Y21 A;  4DR7 M;  4GIT A;  4H2F A;  1SXJ C;  3KOZ E;  3KSX A;  4MGZ E;  3KFU G;  1S3M A;  1IN8 A;  4B7F A;  2UUB E;  3A98 B;  3PFI A;  3FYD A;  1ZBQ A;  3ADI A;  1XNR M;  3VYX A;  4I5N C;  5BR8 M;  3KSJ A;  1Q3B A;  3GLI A;  3HU1 A;  2L92 A;  2IE4 C;  3IG8 A;  3M0E A;  7CAT A;  2X4A A;  5LMU E;  3FLO A;  4IIW A;  2AHM A;  2L6M A;  4II7 A;  4I4L A;  5EP4 A;  5FTL A;  4GIP A;  3GPU A;  1DGH B;  2L2M A;  2AHD A;  1IBM E;  4XPN A;  3N5U A;  4MP0 A;  1WAR A;  1UHZ A;  3EIH A;  1Z5C A;  3MK6 A;  4IBE A;  4IBJ A;  4LY6 A;  4D80 A;  1L2B A;  2WDC A;  4O5G A;  5ITX A;  1IXR C;  2KXE A;  3QWL A;  3HHY A;  2XZU A;  4D82 A;  4BMJ A;  4X65 E;  4HD0 A;  4WYQ B;  4DV1 M;  4LF4 M;  4JI1 M;  2UXC E;  1I4W A;  1IN4 A;  1N34 E;  5IWA M;  3ADG A;  2H36 X;  4EIW A;  1HPU A;  2R65 A;  4MGK E;  1L2C A;  4DHL A;  2RSM A;  3H64 A;  4IBF A;  2E5L M;  1E94 E;  3L25 A;  2HKJ A;  4WW0 A;  2VQE M;  2JR1 A;  4R8O A;  3K8Z A;  3UK6 A;  2DIX A;  2HYO A;  5ITU A;  3K2L A;  5H37 D;  2RKO A;  3BOS A;  2ODR C;  4IBB A;  3E9S A;  4LGM A;  3TWK A;  1G3I A;  3U6D A;  4AG5 A;  3U6E A;  2F8B A;  3GLH A;  2M4I A;  2DFJ A;  3U61 B;  5IT9 S;  1IQP A;  3HU2 A;  2EO2 A;  4DR2 M;  2V1U A;  4PT5 A;  2DVW B;  2G7H A;  2MC5 A;  3FUX A;  3FYC A;  5E6J A;  3GQ4 A;  3U6S A;  4JI4 M;  3HXL A;  4R03 A;  4LAC C;  4RNA A;  3FUU A;  4TUG A;  5C1B A;  1WXR A;  4MB7 A;  3UJN A;  4LF9 M;  1Q39 A;  4JI8 E;  4YHH E;  4XGI A;  5F3W A;  3L2A A;  1Z59 A;  3PSN A;  3AOE A;  3AJI B;  3JYF A;  2KA6 B;  2L7I A;  3AFH A;  3IWD A;  3U5Z B;  4DR5 E;  1C1K A;  3JAM C;  1KFV A;  3C4T A;  4JYA M;  4CGY B;  3GLG B;  1XNR E;  1J26 A;  3H62 B;  3ILK A;  2QZ4 A;  4Z6Y A;  5KQD A;  4DR6 M;  5BR8 E;  4K0K E;  1UTE A;  1NNW A;  4MGH A;  1NHG C;  4DV0 E;  2QP9 X;  4LRT A;  4BLC A;  2M5Z A;  4L5N C;  4LJA A;  4NXM E;  4B3R E;  3RQZ A;  1HQY E;  3DFZ A;  2B7V A;  3IWC A;  3R9X B;  1JR3 D;  1N36 E;  3FTC A;  4LZZ A;  3THG A;  5AE2 A;  3E7B A;  4B7G A;  4TUI A;  4LGY A;  2HHH M;  4KHP E;  3K92 A;  1G41 A;  5JI3 E;  3GPP A;  3FTE A;  3DF6 A;  3LQQ A;  5EXS A;  1X48 A;  4JI7 M;  2N3G A;  3D03 A;  4GKK E;  4NRW A;  4LFA E;  2DZO B;  3HHZ A;  3UZU A;  2I7N A;  2FFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...