5DNYA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Recombination/dna
total genus 107
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5dnyA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5dnyA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5dnyA01
3IVEA 4O43A 3AV0A 2Z1AA 4FBWA 1USHA 1OIEA 4DSYA 1Z2WA 2AHDA 3N5UA 4IYPC 2IAEC 4MOYA 1M63A 5F3WA 1V73A 4UT2A 4H2GA 1W24A 2JOGA 1KBPA 3V4YA 4I5NC 2USHA 2O8GA 1WAO1 3H66A 3KBPA 2HYOA 4XPNA 2DFJA 5C1VA 1SU1A 3DSCA 4O4KA 4V0XA 3H61A 2WDCA 3H63A 3E7BA 2P6BA 2NXFA 4O24A 1WARA 3K7VC 5EQVA 3PSOA 1AUIA 1S8EA 2GJUA 1OI8A 2QJCA 4G9JA 3THOB 4ZX2A 1JK7A 5JPEA 4I5LC 4H1SA 5DNYA 4TUIA 1S95A 3IB8A 4DHLA 4F0ZA 5JJTA 3IB7A 4H1YP 1II7A 2BQ8X 4J6OA 4ORCA 3CK2A 4JA9A 1UF3A 3QFOA 4KBPA 1IT6A 4V0WA 2XMOA 4MP0A 4ZVZA 4HD0A 4UWQA 1S3NA 3C9FA 1U32A 1S3MA 1OIDA 4ORAA 4B2OA 3TGHA 4NZVA 4FBQA 3JYFA 1MF8A 4YKEA 5GTUA 4UT3A 1FJMA 3DW8C 5HPEA 3GVEA 4H2BA 3FGAC 4O5GA 2NYLC 3H62B 3DSDA 2Z06A 4FBKA 4LTYA 3H68A 3QFNA 4M0VA 1HP1A 3P71C 3H60A 1NNWA 3RL4A 4UT3B 2WDFA 5IOHA 3C5WC 3H69A 4TUGA 3ICFA 2NPPC 2NYMC 1Z2XA 1QHWA 5JPFA 4Q7FA 2WDEA 3RL3A 2QFPA 1XZWA 1S3LA 1T70A 1TCOA 2WDDA 4LU9A 3AUZA 3QFKA 1S70A 2QFRA 2HY1A 2IE3C 4MOVA 1HO5A 4ORBA 3RL5A 1UTEA 3EGGA 4V0VA 4FCXA 5B8IA 3QG5C 4OR9A 4LACC 3QFMA 2IE4C 3T1IA 2Q8UA 4H2FA 3ZU0A 4KKZA 2O8AA 1QFCA 2ZBMA 1T71A 3IVDA 4DT2A 5INBA 3RQZA 3H67A 2A22A 3EGHA 2YVTA 3PSNA 4H2IA 3H64A 2HYPA 3E7AA 5J28A 3HVQA 3THNA 2CV9A 2KKNA 4IL1A 2BCDA 4JA7A 1HPUA 3LL8A 1G5BA 2R17A 4WWLA 2Z72A 1XM7A 2BDXA 3ZTVA 3K7WC
chains in the Genus database with same CATH superfamily
2O25A 4P7DA 4FBWA 3GLGB 4LRSA 1V34A 1IBLM 3RGSA 3M7GA 4X65M 1VEGA 1XMQE 2EOEA 2VQFE 2DMYA 3VHTB 3SYLA 2CV0A 2FH0A 1EH8A 2LT7A 1QZMA 1N78A 2R76A 2WDCA 2XSZD 4F1IA 3HY5A 3U5ZA 4W5WA 2UU9E 4JI5M 4LF8M 4DR1E 2L8TA 4F9BB 3SARA 2KNAA 3HJSA 1XHBA 4JI3E 2UXCM 1BBOA 4HEIA 1G4AE 4NXME 2LMZA 2EM2A 5LMNE 2EPUA 4MGKE 5C18A 4B3ME 3MMPA 3ECRA 3J7AG 1NVMA 1L1ZA 3LCVB 3AFHA 2V85A 5KL7A 4ANRA 4L16A 1YPNA 4UT3A 1N33M 5EP2A 3GO8A 5HPEA 4BBYA 2BBGA 1QANA 2EO2A 2H1RA 2WDFA 3KP0E 4M9VC 5DFLA 1NHGC 4EIWA 1NY5A 2JWOA 2QFPA 2R1FA 2M60A 3C3EA 2JR1A 1A1LA 2ELZA 1ZMVA 2IE3C 4AW4A 5B8IA 4II7A 1IBLE 3MSWA 5ITYA 4R8OA 2GPIA 4Y28F 2YTEA 3HVQA 2CEAA 3VKHA 1G5BA 3U61B 3ZTVA 3H09A 3GLFB 1DO2A 3VK8A 2Z1AA 1EH6A 2N3HA 3L2AA 4QNMA 1IBKE 3FUUA 4JI5E 4LF8E 2H5XA 2AHMA 4AG5A 1FNNA 4LJ6A 2B3TA 2HAKA 2UXCE 1MEYC 1UILA 1A1FA 3K9OA 1PJSA 1BB8A 1NJGA 4M9SA 3GLHE 4LF9M 2LHCA 3FD9A 1J26A 5JI3E 4Z6YA 4G9JA 3KSXA 3FUXA 2L3JA 1VG5A 1ZU1A 1N33E 3GPPA 3KXEC 4IJDA 3Q8XA 1UHZA 2MC6A 3HZJA 1DV0A 3VFDA 2YRMA 1NV9A 2MROB 3D8BA 2ODRD 3EIEA 2RKOA 2EMCA 2JXNA 2JZ0A 4X64M 1X37A 3VKGA 1WGLA 1OIDA 4B2OA 4DR4M 3JYFA 1OTRA 1T6OA 4GKJE 3AOEA 2ZANA 4X62M 2L2MA 3SHFA 2DGCA 2R45A 4DR6E 1XXHE 2KEBA 1R2ZA 2WDEA 5A2QC 3LVVA 1OAIA 2EM6A 3FYCA 2OQ4A 4B3RM 1V33A 2EM0A 1D0LA 3EPJA 1V92A 4LACC 1ZV1A 2YTNA 2EQ1A 4IJFA 3IVDA 5INBA 3UGJA 3ADLA 3H67A 2K47A 1R6BX 3MHSC 5LLQA 2ERCA 1X6HA 2JY6B 1FKAE 4BBAA 2XZFA 4DR2M 4GITA 3I4YA 2L4EA 1LV7A 1UN6B 3WHLA 2LCEA 3FKEA 1DGFA 3U5ZB 1WAO1 1C7YA 2JY5A 4MLQA 2MDGA 4AKHA 4QNRA 1SU1A 4Q35B 2KDLA 4UN2B 2NXFA 3I4VA 4X64E 2YTPA 2ADRA 3KP1E 1T39A 3L26A 1UFZA 2HJJA 4DR4E 2N3GA 2NUFA 1VQ1A 1TN9A 4QOSA 4LF7E 2KXEA 2JY9A 2YTGA 4FD2A 4DV4E 2BQ8X 4WSGA 5IV8B 1XWIA 4X62E 2UUCM 3ADGA 1MN3A 4YY3E 2R44A 2JZ1A 1PM5A 1L2CA 2NUEA 4B3RE 4JI0E 4O5GA 1IN7A 5GKNA 1OAOC 2RTXA 1MX0A 4BLCA 3ZOQB 1FJGM 3RL4A 1YYKA 1RQ0A 4KZSA 2K4VA 2WDDA 3C6MA 4RF1A 2B7VA 4NRVA 2F8BA 2EOMA 2X49A 3QFMA 2Q8UA 4KKZA 4DT2A 3SASA 5AC4A 4ZYGA 3RQZA 3EGHA 1OJLA 2JPAA 2QQ8A 1ZR9A 3LMMA 5J28A 2CV9A 2HL7A 2FS1A 4ZPXA 4JA7A 1HPUA 4L8RC 2VE7C 1IFYA 2VIIA 2G7HA 4DR5M 2HHHM 3J80C 1OFHA 1LLMC 5IXMB 1IMUA 3GLFE 2BWBA 2L4FA 2M9AA 5BR8M 2MH8A 2G8LA 4P78A 2M7QA 5DYGA 1BVSA 1H6UA 2EPOA 4XPNA 4X9JA 2UUAM 3DOAA 1QYRA 4WP2A 2YWQA 4NSOB 3IG5A 3GQ4A 4O4KA 3H63A 2UUCE 2LWXA 3L25A 2O5RA 2EOZA 4BMJA 5AE2A 4FVMA 2EM9A 2V86A 3T15A 1N36E 3BF2A 1PJIA 4G4OA 3FYDA 2R46A 2JOXA 2JVAA 4GHLA 1A1JA 1MGTA 4GKKM 2VDBB 3CK2A 1FJGE 2XMOA 4MP0A 5C1BA 3H4JA 3ZCBB 5LMUM 2BB8A 4DV6M 4AKIA 4R2PA 5IREB 2EOFA 2WCC3 5ITXE 4RH8A 3H62B 2WBUA 1XMOM 1KYIA 3GPXA 3HQ1A 2DWNA 2R4EA 3IG8A 1Z5CA 2MKNA 1IXSA 2QFRA 1KFVA 3VLFB 1OIPA 3GLIA 2F5NA 2HHHE 1TDZA 4FCXA 2D7EA 1GLNA 1WJ7A 1QNTA 1HNXM 3BBGA 1SXJB 1RU3A 2A22A 1VEJA 5BR8E 1G41A 3E7AA 3THNA 3SAVA 1GVNA 4DKKA 4WWLA 2Z72A 4BS9A 1G2DC 5T6JA 2UUAE 2YZTA 2XLJA 2DXNA 4R2RA 4TUWA 2ZOAA 5JI2E 5EQTA 3SAWA 2LUQA 2FGGA 2DAIA 5F3WA 2FFJA 3BIDA 3GRVA 1GABA 1T4NA 3V76A 4M9XA 2CWBA 3KOYE 3FTEA 2N8XA 3C3DA 2DFJA 4NXNM 1YUJA 4LFCM 4XBOA 4JYAE 4GKKE 5KPTA 2MC5A 2DIXA 2KA6B 3KDSE 1DI2A 2J7NA 1ZAEA 2Z7JA 5EP3A 5KQ8A 3T6PA 1AUIA 3EPLA 5LMUE 3RFWA 1KSFX 3GQ3A 1IBMM 1N32E 2EA0A 3U6QA 2X4AA 1JK1A 1XMOE 4LGYA 4ORCA 2L6OA 4ZYEA 3R8FA 4JA9A 4LFBM 1Z59A 2LRSA 1TTEA 1KYQA 4A3VB 4FK5C 1DGBA 2Y20A 1S3MA 4JXJA 4WSPA 4I5SA 3KOXE 1FJMA 3FLOA 3FUTA 2F5SA 2L2NA 3KS8A 5H37D 4S12A 3A45A 2Y21A 2EORA 1A1GA 1SG9A 3L00A 5IOHA 4GMQA 3C5WC 1HNXE 3BOSA 2NYMC 3KW6A 3DA1A 4IBGA 2ZM6E 2L3CA 3THGA 2D7GA 3SAUA 2DNAA 3JR5A 2UXDM 1UTEA 4F6MA 3FTDA 2YQZA 1TH2A 3QG5C 5EP4A 2K6BA 3JR4A 3VK7A 2DI0A 4GHAA 4H2IA 1KJKA 2EPPA 1QQWA 2DZLA 4PD2A 2UXBM 3U6DA 4NXNE 2X8AA 4LFCE 2V1CA 3KOZE 2DAEA 4N4RB 1GQEA 1VDLA 1SFEA 5KL2A 3T38A 3C9PA 1ZBQA 1ZMUA 1K3XA 4OVZA 2EPRA 2XFTA 1IBME 1DGGA 2G5GX 1YFHA 3E46A 2HKJA 3FTCA 1WHNA 3JU0A 3K7VC 1YYOA 1DO0A 4J8ZA 1X48A 5IWAM 4CHTB 3CF0A 2VF7A 2DWMA 1LTMA 4H1SA 4IBFA 4B3TE 3K92A 1S95A 2EPXA 1BBGA 2WSFF 2FOIC 4V0WA 1IT6A 2QENA 4HD0A 2PRTA 3GQ5A 4LJ9A 4WURA 5FTNA 3M0EA 2V89A 3J81S 1A1HA 3CGWA 2E1MA 4L6V6 3HJQA 3QYEA 2UXDE 2JA2A 3IWDA 2ZTCA 4JI7M 1IXSB 3LMLA 3QFNA 3MHHC 1YUBA 3HGIA 3GLIB 3VDPA 1L2DA 5AASA 1W5SA 5CFFE 3M6AA 1D0KA 2EJSA 3KSJA 2F5OA 1XNRM 1X5WA 3HHXA 5FLXC 3HU1A 2YFQA 2CV2A 2ZAOA 2CV1A 4H2FA 1IY1A 3SMPA 3U6CA 2OOAA 4LRTA 2EM4A 1YLAA 2RPCA 4F6NA 1JR3E 2JY8A 2KHXA 3JAMS 1SXJE 4JV5M 1NNUC 4HLQA 2KONA 2QZ4A 4IYPC 3N5UA 3H4MA 4H2GA 4IIWA 3K1JA 3ZQJA 1TR8A 2O8GA 1SXJC 4B3SM 4PDIA 1IQOA 2A25A 4X65E 4JI8M 2VF8A 3LQRA 2YNMD 3A98B 1A5TA 1WARA 4KWYA 1QU6A 1S8EA 5LL6R 2EN8A 1DGHB 1OI8A 2C9OA 5JPEA 4LF4M 2EOHA 2C98A 4JI7E 1Q3BA 1E9SA 1UF3A 2QP9X 1WHCA 2R18A 4WX9A 1TH3A 3K9PA 4L8NA 1WHQA 3C6KA 3DF6A 1XNRE 4YKEA 3AL0C 3DW8C 2LBSB 3UZUA 2BNKA 5IT9S 2LTRA 1HP1A 2O01F 3IWBA 1YYWA 2ZO9B 3HX3A 5JPFA 4LFAM 3RL3A 5KL3A 3PNVA 3QFKA 4BHBA 4FCVA 3CF2A 3M99B 3RL5A 1HO5A 4JV5E 3T1HM 4OR9A 2EN2A 4MGHA 2LVHA 3KZYA 3GRUA 1EE8A 1GJTA 4JI8E 3K7WC 4O43A 3AV0A 2LO3A 2L09A 2D9HA 2I13A 4AI6A 1Z2WA 4AQYM 4QHTA 4F9AB 1STUA 3C4TA 1QDTA 4JI4M 1E94E 5TSEA 2KW0A 4R2SA 3VYYA 4LF4E 2V6ZM 3J7BA 3SFZA 3J81C 2YRHA 4CISA 3H61A 3B7ZA 3EPKA 5L8RF 1N77A 1TGUA 4YHHM 4FWDA 4L4UA 1R2YA 2EMAA 4LF9E 3HHYA 2EN4A 4I5LC 2DHYA 1EH7A 3KFUG 3GLGE 2DVWB 2JNHA 2EM8A 2KNVA 4OW0A 3IB8A 4DHLA 4H1YP 1II7A 3PXGA 5AE3A 4KBPA 3L27A 2JYAA 1Z6TA 1X49A 3RE8A 4NOOB 4R2EA 2CFOA 4ORAA 2DSYA 4NZVA 1MF8A 5GTUA 3MK6A 2EKKA 2Z06A 2YT4A 2XEPA 1JK2A 3T1HE 2KOUA 3JAMC 3H60A 1NNWA 4UT3B 2NPPC 2V88A 2VQEM 2DLKA 3E0JA 2CRUA 3E9SA 2GQFA 1QZEA 1E32A 2DAMA 4JI1M 4L15A 2EPMX 1ZBTA 3AUZA 1J5EM 1RC7A 4MOVA 2LV2A 5FTJA 1ZMWA 4P16A 4BC9A 2EZ6A 2IE4C 4AQYE 2ENAA 2LE2A 1TH4A 2KRKA 2XFSA 3H64A 4JI4E 3K8ZA 5EXPA 3KZZA 1QUSA 4KHPM 4GEQB 2BCDA 1XM7A 2RSMA 3A42A 3HXLA 4WFTA 1NV8A 2LTUA 2FV4B 2V8QB 1HJPA 3UK3C 3GLHA 4DR2E 2K9DA 1GZ6A 2EMZA 1W24A 1XNQM 4I5NC 1QAOA 4DV7M 1NSFA 1X6EA 5C1VA 3MHVC 4IJEA 2QBYA 4AKGA 2MKDA 2HCBA 5EXTA 2B3TB 1OKSA 1D2NA 3J2PB 4LF6M 1OFIA 3I01M 2WZOA 3W67A 3THOB 4ZYDA 3HHZA 2YTOA 3OMLA 3TWLA 5A6JA 3LW5F 4LF5M 2XH9A 4MH0E 2HC5A 2VQEE 2DKLA 4RNAA 3BGHA 2EMYA 3KVWA 1J5EE 2EOOA 3SBJA 2H36X 2HWJA 3DSDA 4LTYA 2NA2A 4R2QA 2L7HA 4KODA 2XF3A 4TUGA 1IQPA 1UBDC 1IM2A 1NJFA 1XZWA 4KHPE 1NO1A 3DZDA 2FE8A 1S70A 4ORBA 4F9CB 2QCUA 3FTFA 2UUBM 3U6MA 4FWGA 2EUCA 3ZU0A 1PKPA 4F2LA 2LUPB 4X66M 1XNQE 1VDDA 2KKNA 4DV7E 1QVRA 1HNWM 1AAYA 2R17A 5ADZA 4G3OA 3LCUA 2EOJA 2DXLA 4NSRA 2JP7A 2QNJA 2MGWA 2AHDA 3L29A 4DR5E 2APLA 3IHPA 4LF6E 3R9XB 3H66A 2B9DA 2LBCA 4B7HA 1N3GA 5KL4A 4LJ4A 1PDAA 2OOBA 4LJ7A 4DR7M 3E7BA 3FRIA 1X3CA 3FUWA 3FE3A 2P5TA 4B7GA 2K0BX 3W0LB 4WXCA 4F54A 1WIVA 4R3DA 4TUIA 4REZA 5FSWA 3LQQA 1WRJA 1S3SA 1TF0B 1PJJA 2B7TA 2ZAMA 4WYQB 4JI6M 3QAUA 2MJ5B 3WHKA 2GNOA 4B7FA 4DV6E 1EIJA 2NABA 2EMHA 2UUBE 2I7NA 2Z8YM 2YEQA 1HT1E 3T1YM 1IN4A 3H69A 3ICFA 4X66E 4GH9A 5E26A 3NBIA 5FTMA 2HY1A 2CP8A 2D7HA 2CE7A 3U61A 1Y8GA 3GLFA 1HR0M 2ZBMA 2YTIA 2EKFA 5A6KA 1P47A 1NCSA 3B9PA 1L2BA 4I81A 2BDXA 2NQ8C 3GRRA 2EM3A 2RSIA 2MDRA 5ITRA 4LY6A 4L78A 4DR7E 3B89A 2QBYB 5KQDA 2WBTA 4K0KM 1R7RA 2A5YB 2YSOA 3AJIB 1F4IA 3KS4A 2QSFX 4RKUF 1GKIA 1GO5A 2EPKX 2Y0QA 2LH0A 5KO3A 2ELYA 2DAGA 5FTLA 3E4RA 1XC8A 5BPVA 4BC7A 1HNZM 2V87A 3B7NA 3B74A 1TF3A 1P3QQ 2QHOB 2EOXA 2QJCA 4JI6E 3HPSA 3CTWB 4NXMM 3OTOM 3MJ5A 4GC5A 5KL5A 3GPYA 2EMIA 1TDHA 2KZUA 5JJTA 1WGNA 1VEKA 2EPZA 1R4GA 4J6OA 2JXPA 3HPZA 2XGNA 1QAQA 1GL6A 2C99A 1WJPA 3T1YE 4DUYM 4Q28A 1UM8A 1X6FA 2C96A 4LFBE 1G3IA 4GC9A 2K7IA 2CTDA 1NNJA 2CHGA 4KT0F 2J7JA 1J7KA 4FBKA 5AE1A 5A69A 1MJGM 3TQSA 4D82A 1HR0E 2KRUA 4M30A 1Z2XA 3U6LA 2DWLA 1I94M 2OO9A 1TCOA 2WBSA 5A2QS 4XK8F 4QOZC 4GEWA 2WSEF 3VYXA 2Z4SA 4OX9M 3TQMA 4K0KE 3IECA 2HYPA 3HHWA 2NUGA 2L2DA 4IL1A 3F92A 2V83A 1IBKM 4MM3B 4IBEA 3AOEC 2LVNC 2UXBE 3D8LA 1HNZE 1JB0F 2EP3A 4ZYHA 4DMIA 2JOGA 4B08A 1IXZA 3OTOE 4GIPA 3HJ8A 4MB7A 2BWEA 3LLHA 4PDGA 4L5NC 4HEOA 4QHSA 4KLNA 3CF6E 1YZ9A 3VDUA 4V0XA 4O24A 4DUYE 3PSOA 2Y0TA 3KOWE 2JOBA 1Z1BA 2KZSA 3PVSA 5IWAE 3SHGB 1T43A 2E5LM 3FIGA 1ZQ9A 1IN8A 2Z3XA 2EPCA 2GHFA 2EM5A 3SATA 1I94E 1U32A 4GKJM 3UJNA 3GVEA 4DR6M 2EMGA 3EIHA 4OX9E 1JR3D 4CJ6A 1C1KA 1SXJD 3RMPA 1RMDA 4FW9A 4LJ5A 1Q02A 4OU7A 1N34M 1IY2A 2IHR1 1T70A 3HWSA 4IBKA 2F5QA 5A6BD 3AKZA 4LU9A 1IN5A 4WXDA 5KPRA 3W68A 3U6PA 2EN3A 2F5PA 1AIPC 2JUJA 3T1IA 4CIZA 2C9CA 1Q3CA 1AH5A 4MGIE 2DB2A 2ODRC 5ITQA 2L33A 3SYKA 1HQYE 4AZFA 2R0IA 1USHA 2XSZA 2ZBKB 2IAEC 4MOYA 4PT5A 1PJTA 3J80S 2YPNA 1V73A 4UT2A 4X8WA 4FCWA 2JWSA 5E6JA 1KBPA 2QPAA 4KO8A 2LJHA 4DV1M 2E5LE 3PFIA 2DENA 2L7IA 3A46A 4B3SE 4M9ZA 4IBBA 3TE6A 3DFZA 3QYBA 4OVZB 3TPZA 1TF6A 4LZZA 3B7QA 1JK7A 1IY0A 4LF7M 1X47A 4DV3M 2EJ4A 4DV4M 1E9RA 7CATA 4JI2M 3IWCA 3HU3A 4F0ZA 3IB7A 3BXWA 2CPNA 3TL4X 3U6OA 4YY3M 1T4OA 1L8QA 4JN6A 2EL6A 4DR3M 2EMKA 2EMLA 1N34E 4JI0M 2DXIA 1J09A 3GRYA 3RGPA 2LHGA 2NYLC 4LJAA 1PJQA 4HTGA 3EPHA 3U6EA 1L1TA 3D03A 4IBJA 5EJCA 1JR3A 4LFAE 1SXJA 2R4JA 3NBXX 4NHRA 1OIZA 2EOIA 1DGCA 5A6BA 2L6MA 4RHBB 2EWLA 3JTZA 3PSNA 2F4VM 1JQJC 5ITTA 3U6SA 4DV1E 4LZJA 1T4LB 3GLIE 2N35A 2YTJA 4LJ8A 2JY7A 4HL4A 4LCBA 4R2CA 3VK6A 3TWKA 1L4SA 3HKPA 3V4YA 4BHCA 1O0WA 4DV3E 3DJWA 4Q7JA 3ADJA 2FNAA 5EXSA 4JI2E 2DHRA 3DSCA 1YE9A 2ENCA 3HTXA 2MR9A 4DV0M 4R7GA 4GZNC 2Z4RA 2P6BA 1N36M 2EMFA 5A6AA 5EQVA 1XB2B 1WR1B 4DR3E 2CHQA 4M0DA 2ENHA 3QWLA 3U60A 4ZX2A 2FTXB 2EQ3A 1ZAAC 4AG6A 4YHHE 4R2AA 2DLQA 5DNYA 4I8OA 4LGMA 2EOQA 5IZ7D 1NHWC 1R5LA 1QUTA 2YR0A 3UK6A 4MLVA 4BB9A 1B69A 4UWQA 2M5ZA 4FBQA 5IT9C 4CGYB 1OQYA 1AUAA 5EP1A 2EPLX 4IS1C 2J7OA 2LVOC 4Z8XA 4IBCA 4DBGB 3KWRA 1DQ3A 1G59A 2F4VE 1SR9A 2M4IA 2Q2EB 1S3LA 1XXHA 2LVPC 3L28A 3C4BA 4MGZE 1Z5AA 4JI1E 4NC6A 2CUZA 2C5RA 3GPUA 1QFCA 2O8AA 8CATA 2BJWA 2GLIA 1HT2E 3K2LA 1PGYA 2L92A 4DV2M 1MU5A 4WW0A 4R2DA 1IN6A 4IBDA 1NEIA 4G6ZA 1Q39A 1OIEA 4DV0E 2XZUA 2VF1A 4D81A 2EL4A 2JP9A 3EQ1A 2DZOB 2EMBA 4G4RA 1T38A 4OOGC 2USHA 4JYAM 3KBPA 2HYOA 3GLGA 4P17A 3F6HA 1D0MA 3FUVA 2W82A 4XGIA 3ZH9B 2RGHA 2HGHA 4M0WA 4PCZA 2GJUA 3Q8GA 1N32M 1GTKA 1K82A 4MGYE 3BBZA 2KHHA 1F2IG 2EMXA 1CUKA 2EQ0A 2RS6A 4WPYA 3QFOA 2DAKA 3SMSA 2EPNA 2EN6A 1IXRC 2YSPA 4LG2A 4DUZM 4LF5E 3FRHA 2CSHA 2I7PA 1HQCA 3NWLA 4H2BA 2R6FA 4BCAA 5KPZA 3H68A 2EL5A 2I9IA 1T3TA 2ZM6M 2OPFA 4RF0A 3K6QA 2DWZB 4NL4H 1QHWA 2RS7A 4D80A 4G4QA 2EE8A 2YU8A 4F2JC 2KNZA 5DYIA 1YSYA 2ZTDA 3I51A 1QAMA 4DV2E 1G71A 1A1IA 4GRIA 4V0VA 3PNYA 4IBIA 5FLXS 2CHVA 4ITQA 2YTDA 1T71A 4DV5M 2LTSA 2YVTA 3F6GA 1K3WA 3J27B 3LL8A 2YTFA 3IVEA 2E72A 1HNWE 1QDRA 2RQLA 4DSYA 2RRUA 1GL7A 3GP1A 1WXRA 1Z5BA 1M63A 3TWMA 4R03A 5ITUA 2LXEA 2R62A 3UMMA 2WSCF 1W5TA 2VRDA 3GLHB 1A1KA 3U60B 1G8PA 1DGHA 2RGOA 4R71A 2WZJA 1N75A 1NY6A 3ADIA 2V1UA 3I04M 4FWHA 2EOYA 4M2ZA 4I4LA 1I4WA 2EPAA 5EXXA 4G4NA 4B3TM 1GJSA 2EM7A 4DUZE 5AC5A 2DZNB 1XMQM 3HU2A 4FCTA 2LVQD 2VQFM 3E21A 2LNHC 2R65A 1YSAC 1G2FC 2EOSA 4ZVZA 3ILKA 1WXQA 2UU9M 2LVAA 3SC3A 4DR1M 1S3NA 2BJVA 3C9FA 1YUIA 3ZC7B 5KL6A 3TGHA 2M1SA 4JI3M 2G3QA 1XXHB 3FGAC 5LMNM 5ITXA 4M0VA 3AOGA 4B3MM 3P71C 3W0FA 3C58A 3P1XA 3LVWA 4DV5E 4Q7FA 2EN7A 2YTQA 2J5YA 2EMWA 2L2KB 2DRPA 1IQSA 3J7AS 2EN1A 3EGGA 2YRKA 1EFUB 2LJUA 2YU5A 1EKZA 1ORYB 2CT1A 5FTKA 3J7Yp 1PRBA 2DMIA 4NRWA
chains in the Genus database with same CATH topology
4P7DA 4FBWA 3GLGB 4LRSA 1IBLM 3RGSA 3M7GA 4X65M 1XMQE 2VQFE 2DMYA 3SYLA 2CV0A 1QZMA 1N78A 2WDCA 2XSZD 3U5ZA 4W5WA 2UU9E 4JI5M 4LF8M 4DR1E 2L8TA 4F9BB 3SARA 3HJSA 1XHBA 4JI3E 2UXCM 1G4AE 4NXME 2LMZA 5LMNE 4MGKE 5C18A 4B3ME 3J7AG 1NVMA 1L1ZA 3AFHA 2V85A 4L16A 4UT3A 1N33M 5EP2A 3GO8A 5HPEA 4BBYA 1QANA 2EO2A 2H1RA 2WDFA 3KP0E 1NHGC 4EIWA 1NY5A 2JWOA 2QFPA 2M60A 2JR1A 2IE3C 4AW4A 5B8IA 4II7A 1IBLE 3MSWA 5ITYA 4R8OA 3HVQA 2CEAA 3VKHA 1G5BA 3U61B 3ZTVA 3H09A 3GLFB 1DO2A 3VK8A 2Z1AA 2N3HA 3L2AA 4QNMA 1IBKE 3FUUA 4JI5E 4LF8E 2AHMA 4AG5A 1FNNA 4LJ6A 2UXCE 1UILA 1NJGA 4M9SA 4LF9M 3FD9A 1J26A 5JI3E 4Z6YA 4G9JA 3KSXA 3FUXA 2L3JA 1N33E 3GPPA 3KXEC 3Q8XA 1UHZA 2MC6A 3VFDA 3D8BA 2ODRD 3EIEA 2RKOA 4X64M 1X37A 3VKGA 1OIDA 4B2OA 4DR4M 3JYFA 4GKJE 3AOEA 2ZANA 4X62M 2L2MA 3SHFA 2R45A 4DR6E 2KEBA 1R2ZA 2WDEA 5A2QC 3LVVA 3FYCA 2OQ4A 4B3RM 4LACC 4IJFA 3IVDA 5INBA 3UGJA 3ADLA 3H67A 2K47A 1R6BX 2ERCA 1FKAE 4BBAA 2XZFA 4DR2M 4GITA 3I4YA 1LV7A 3WHLA 3FKEA 1DGFA 3U5ZB 1WAO1 4AKHA 4QNRA 1SU1A 2NXFA 3I4VA 4X64E 3KP1E 3L26A 4DR4E 2N3GA 2NUFA 4QOSA 4LF7E 2KXEA 2JY9A 4FD2A 4DV4E 2BQ8X 1XWIA 4X62E 2UUCM 3ADGA 4YY3E 1PM5A 1L2CA 2NUEA 4B3RE 4JI0E 4O5GA 1IN7A 5GKNA 2RTXA 1MX0A 4BLCA 3ZOQB 1FJGM 3RL4A 1YYKA 1RQ0A 4KZSA 2K4VA 2WDDA 4RF1A 2B7VA 4NRVA 2F8BA 2X49A 3QFMA 2Q8UA 4KKZA 4DT2A 3SASA 3RQZA 3EGHA 1OJLA 3LMMA 5J28A 2CV9A 2HL7A 4ZPXA 4JA7A 1HPUA 4L8RC 2VE7C 2VIIA 2G7HA 4DR5M 2HHHM 3J80C 1OFHA 5BR8M 2G8LA 4P78A 2M7QA 5DYGA 1H6UA 4XPNA 2UUAM 3DOAA 1QYRA 4O4KA 4NSOB 3IG5A 3GQ4A 3H63A 2UUCE 2LWXA 3L25A 2O5RA 4BMJA 5AE2A 4FVMA 2V86A 3T15A 1N36E 1PJIA 4G4OA 3FYDA 2R46A 4GHLA 2JOXA 2JVAA 4GKKM 3CK2A 1FJGE 2XMOA 4MP0A 5C1BA 3ZCBB 5LMUM 4DV6M 4AKIA 5IREB 5ITXE 3H62B 1XMOM 1KYIA 3GPXA 3HQ1A 2DWNA 2R4EA 3IG8A 1Z5CA 2QFRA 1KFVA 3VLFB 3GLIA 2F5NA 2HHHE 1TDZA 4FCXA 2D7EA 1GLNA 1HNXM 1SXJB 2A22A 5BR8E 1G41A 3E7AA 3THNA 3SAVA 1GVNA 4DKKA 4WWLA 2Z72A 4BS9A 5T6JA 2UUAE 2YZTA 2XLJA 2DXNA 4TUWA 2ZOAA 5JI2E 5EQTA 3SAWA 2LUQA 2FGGA 5F3WA 2FFJA 3GRVA 1T4NA 4M9XA 3FTEA 3KOYE 2DFJA 4NXNM 4LFCM 4XBOA 4JYAE 4GKKE 5KPTA 2MC5A 2DIXA 2KA6B 3KDSE 1DI2A 2J7NA 1ZAEA 2Z7JA 5EP3A 5KQ8A 1AUIA 5LMUE 3RFWA 1KSFX 3GQ3A 1IBMM 1N32E 2EA0A 3U6QA 2X4AA 1XMOE 4LGYA 4ORCA 2L6OA 4JA9A 3R8FA 4LFBM 1Z59A 2LRSA 4A3VB 1DGBA 2Y20A 1S3MA 4JXJA 4WSPA 4I5SA 3KOXE 1FJMA 3FLOA 3FUTA 2F5SA 2L2NA 3KS8A 5H37D 4S12A 3A45A 2Y21A 5IOHA 4GMQA 3C5WC 1HNXE 3BOSA 2NYMC 3KW6A 3DA1A 4IBGA 2ZM6E 2L3CA 3THGA 2D7GA 3SAUA 3JR5A 2UXDM 1UTEA 3FTDA 2YQZA 1TH2A 3QG5C 5EP4A 3JR4A 3VK7A 4GHAA 4H2IA 1QQWA 4PD2A 2UXBM 3U6DA 4NXNE 2X8AA 4LFCE 2V1CA 3KOZE 1GQEA 3T38A 1ZBQA 1K3XA 4OVZA 2XFTA 1IBME 1DGGA 2G5GX 2HKJA 3FTCA 1WHNA 3JU0A 3K7VC 1YYOA 1DO0A 4J8ZA 1X48A 5IWAM 4CHTB 3CF0A 2DWMA 4H1SA 4IBFA 4B3TE 3K92A 1S95A 2FOIC 4V0WA 1IT6A 2QENA 4HD0A 3GQ5A 4LJ9A 4WURA 5FTNA 3M0EA 2V89A 3J81S 2E1MA 3HJQA 2UXDE 2JA2A 3IWDA 4JI7M 1IXSB 3LMLA 3QFNA 1YUBA 3HGIA 3GLIB 3VDPA 1L2DA 5AASA 1W5SA 5CFFE 3M6AA 3KSJA 2F5OA 1XNRM 3HHXA 5FLXC 3HU1A 2YFQA 2CV2A 2ZAOA 2CV1A 4H2FA 1IY1A 3SMPA 3U6CA 4LRTA 2KHXA 3JAMS 1SXJE 4JV5M 1NNUC 4HLQA 2KONA 2QZ4A 4IYPC 3N5UA 3H4MA 4H2GA 4IIWA 3K1JA 2O8GA 1SXJC 4B3SM 4PDIA 4X65E 4JI8M 3LQRA 2YNMD 3A98B 1WARA 1QU6A 1S8EA 5LL6R 1DGHB 1OI8A 2C9OA 5JPEA 4LF4M 2C98A 4JI7E 1Q3BA 1E9SA 1UF3A 2QP9X 2R18A 1TH3A 4L8NA 1WHQA 3DF6A 1XNRE 4YKEA 3AL0C 3DW8C 2LBSB 3UZUA 2BNKA 5IT9S 2LTRA 1HP1A 3IWBA 1YYWA 2ZO9B 5JPFA 4LFAM 3RL3A 3PNVA 3QFKA 4FCVA 3CF2A 3RL5A 1HO5A 4JV5E 3T1HM 4OR9A 4MGHA 3GRUA 1EE8A 4JI8E 3K7WC 4O43A 3AV0A 2L09A 4AI6A 1Z2WA 4AQYM 4QHTA 4F9AB 1STUA 3C4TA 4JI4M 1E94E 2KW0A 3VYYA 4LF4E 2V6ZM 3J7BA 3SFZA 3J81C 4CISA 3H61A 1N77A 1TGUA 4YHHM 4FWDA 4L4UA 1R2YA 4LF9E 3HHYA 4I5LC 3KFUG 2DVWB 4OW0A 3IB8A 4DHLA 4H1YP 1II7A 3PXGA 5AE3A 4KBPA 3L27A 1Z6TA 1X49A 3RE8A 4NOOB 2CFOA 4ORAA 2DSYA 4NZVA 1MF8A 5GTUA 3MK6A 2Z06A 2YT4A 2XEPA 3T1HE 2KOUA 3JAMC 3H60A 1NNWA 4UT3B 2NPPC 2V88A 2VQEM 3E0JA 3E9SA 1E32A 4JI1M 4L15A 1ZBTA 3AUZA 1J5EM 1RC7A 4MOVA 5FTJA 4P16A 4BC9A 2EZ6A 2IE4C 4AQYE 2LE2A 1TH4A 2KRKA 2XFSA 3H64A 4JI4E 3K8ZA 5EXPA 4KHPM 4GEQB 2BCDA 1XM7A 2RSMA 3A42A 3HXLA 4WFTA 2FV4B 2V8QB 3GLHA 4DR2E 1GZ6A 1W24A 1XNQM 4I5NC 1QAOA 4DV7M 1NSFA 5C1VA 3MHVC 4IJEA 2QBYA 4AKGA 2HCBA 5EXTA 2B3TB 1D2NA 3J2PB 4LF6M 1OFIA 2WZOA 3THOB 3HHZA 3OMLA 3TWLA 4LF5M 2XH9A 4MH0E 2VQEE 4RNAA 3KVWA 1J5EE 3SBJA 2H36X 3DSDA 4LTYA 2NA2A 2L7HA 4KODA 2XF3A 4TUGA 1IQPA 1IM2A 1NJFA 1XZWA 4KHPE 3DZDA 2FE8A 1S70A 4ORBA 4F9CB 2QCUA 3FTFA 2UUBM 3U6MA 4FWGA 2EUCA 3ZU0A 1PKPA 2LUPB 4X66M 1XNQE 1VDDA 2KKNA 4DV7E 1QVRA 1HNWM 2R17A 5ADZA 2DXLA 4NSRA 2AHDA 3L29A 4DR5E 4LF6E 3R9XB 3H66A 2B9DA 4B7HA 4LJ4A 4LJ7A 4DR7M 3E7BA 3FUWA 2P5TA 4B7GA 3W0LB 4F54A 4R3DA 4TUIA 4REZA 5FSWA 3LQQA 1S3SA 1PJJA 2B7TA 2ZAMA 4WYQB 4JI6M 3QAUA 3WHKA 4B7FA 4DV6E 2UUBE 2I7NA 2YEQA 1HT1E 3T1YM 1IN4A 3H69A 3ICFA 4X66E 4GH9A 5E26A 3NBIA 5FTMA 2HY1A 2D7HA 2CE7A 3U61A 3GLFA 1HR0M 2ZBMA 3B9PA 1L2BA 4I81A 2BDXA 3GRRA 2NQ8C 2MDRA 5ITRA 4LY6A 4L78A 4DR7E 2QBYB 5KQDA 4K0KM 1R7RA 2A5YB 3AJIB 3KS4A 1GKIA 2Y0QA 2LH0A 5KO3A 5FTLA 3E4RA 1XC8A 5BPVA 4BC7A 1HNZM 2V87A 2QJCA 4JI6E 3HPSA 3CTWB 4NXMM 3OTOM 3MJ5A 4GC5A 3GPYA 1TDHA 2KZUA 5JJTA 4J6OA 3HPZA 2XGNA 1QAQA 1GL6A 2C99A 3T1YE 4DUYM 4Q28A 1UM8A 2C96A 4LFBE 1G3IA 4GC9A 1NNJA 2CHGA 1J7KA 4FBKA 5AE1A 3TQSA 4D82A 1HR0E 2KRUA 4M30A 1Z2XA 3U6LA 2DWLA 1I94M 1TCOA 5A2QS 4QOZC 3VYXA 2Z4SA 4OX9M 4K0KE 2HYPA 3HHWA 2NUGA 4IL1A 2V83A 1IBKM 4MM3B 4IBEA 3AOEC 2UXBE 3D8LA 1HNZE 4DMIA 2JOGA 4B08A 1IXZA 3OTOE 4GIPA 3HJ8A 4MB7A 3LLHA 4PDGA 4L5NC 4QHSA 4KLNA 3CF6E 4V0XA 3VDUA 1YZ9A 4DUYE 4O24A 3PSOA 2Y0TA 3KOWE 2JOBA 2KZSA 3PVSA 5IWAE 3SHGB 2E5LM 3FIGA 1ZQ9A 1IN8A 2Z3XA 3SATA 1I94E 1U32A 4GKJM 3UJNA 3GVEA 4DR6M 3EIHA 4OX9E 1JR3D 1C1KA 1SXJD 3RMPA 4FW9A 4LJ5A 4OU7A 1N34M 1IY2A 2IHR1 1T70A 3HWSA 4IBKA 2F5QA 3AKZA 4LU9A 1IN5A 5KPRA 3U6PA 2F5PA 3T1IA 2C9CA 1Q3CA 4MGIE 2DB2A 2ODRC 5ITQA 2L33A 3SYKA 1HQYE 4AZFA 1USHA 2XSZA 2ZBKB 2IAEC 4MOYA 4PT5A 3J80S 1V73A 4UT2A 4X8WA 4FCWA 5E6JA 1KBPA 2QPAA 4KO8A 2LJHA 4DV1M 2E5LE 3PFIA 2L7IA 3A46A 4B3SE 4M9ZA 4IBBA 3TE6A 3DFZA 4OVZB 3TPZA 4LZZA 1JK7A 1IY0A 4LF7M 1X47A 4DV3M 4DV4M 1E9RA 7CATA 4JI2M 3IWCA 3HU3A 4F0ZA 3IB7A 2CPNA 3TL4X 3U6OA 4YY3M 1T4OA 1L8QA 4JN6A 4DR3M 1N34E 4JI0M 2DXIA 1J09A 3GRYA 3RGPA 2NYLC 4LJAA 3U6EA 1L1TA 3D03A 4IBJA 5EJCA 1JR3A 4LFAE 1SXJA 2R4JA 2L6MA 2EWLA 3JTZA 3PSNA 2F4VM 1JQJC 5ITTA 3U6SA 4DV1E 4LZJA 1T4LB 4LJ8A 4HL4A 4LCBA 3VK6A 3TWKA 3V4YA 3HKPA 1O0WA 4DV3E 3DJWA 3ADJA 2FNAA 5EXSA 4JI2E 2DHRA 3DSCA 1YE9A 3HTXA 4DV0M 4R7GA 2Z4RA 2P6BA 1N36M 5EQVA 4DR3E 2CHQA 4M0DA 3QWLA 3U60A 4ZX2A 2FTXB 4AG6A 4YHHE 5DNYA 4I8OA 4LGMA 5IZ7D 1NHWC 2YR0A 3UK6A 4BB9A 4UWQA 2M5ZA 4FBQA 5IT9C 4CGYB 5EP1A 2J7OA 4Z8XA 4IBCA 3KWRA 1DQ3A 1G59A 2F4VE 1SR9A 2M4IA 2Q2EB 1S3LA 1XXHA 3L28A 3C4BA 4MGZE 1Z5AA 4JI1E 2CUZA 2C5RA 3GPUA 1QFCA 2O8AA 8CATA 2BJWA 1HT2E 3K2LA 2L92A 4DV2M 1MU5A 4WW0A 1IN6A 4IBDA 4G6ZA 1Q39A 1OIEA 4DV0E 2XZUA 2VF1A 4D81A 2DZOB 4G4RA 4OOGC 2USHA 4JYAM 3KBPA 2HYOA 3GLGA 3F6HA 3FUVA 2W82A 4XGIA 3ZH9B 2RGHA 4M0WA 4PCZA 2GJUA 1N32M 1K82A 4MGYE 3QFOA 2RS6A 4WPYA 3SMSA 1IXRC 4LG2A 4DUZM 4LF5E 2I7PA 1HQCA 3NWLA 4H2BA 4BCAA 5KPZA 3H68A 1T3TA 2ZM6M 2OPFA 4RF0A 3K6QA 2DWZB 4NL4H 1QHWA 2RS7A 4D80A 4G4QA 5DYIA 1YSYA 3I51A 1QAMA 4DV2E 4V0VA 4GRIA 3PNYA 4IBIA 5FLXS 2CHVA 4ITQA 1T71A 4DV5M 2LTSA 2YVTA 3F6GA 1K3WA 3J27B 3LL8A 3IVEA 1HNWE 4DSYA 1GL7A 3GP1A 1WXRA 1Z5BA 1M63A 3TWMA 4R03A 5ITUA 2LXEA 2R62A 3UMMA 1W5TA 3GLHB 3U60B 1G8PA 1DGHA 2RGOA 1N75A 1NY6A 3ADIA 2V1UA 4FWHA 4M2ZA 4I4LA 1I4WA 5EXXA 4G4NA 4B3TM 4DUZE 2DZNB 1XMQM 3HU2A 4FCTA 2VQFM 2LNHC 2R65A 4ZVZA 3ILKA 1WXQA 2UU9M 3SC3A 4DR1M 1S3NA 2BJVA 3C9FA 3ZC7B 3TGHA 2M1SA 4JI3M 1XXHB 3FGAC 5LMNM 5ITXA 4M0VA 3AOGA 4B3MM 3P71C 3W0FA 3C58A 3P1XA 3LVWA 4DV5E 4Q7FA 2L2KB 3J7AS 3EGGA 1EKZA 1ORYB 3J7Yp 5FTKA 4NRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVE A;  4O43 A;  3AV0 A;  2Z1A A;  4FBW A;  1USH A;  1OIE A;  4DSY A;  1Z2W A;  2AHD A;  3N5U A;  4IYP C;  2IAE C;  4MOY A;  1M63 A;  5F3W A;  1V73 A;  4UT2 A;  4H2G A;  1W24 A;  2JOG A;  1KBP A;  3V4Y A;  4I5N C;  2USH A;  2O8G A;  1WAO 1;  3H66 A;  3KBP A;  2HYO A;  4XPN A;  2DFJ A;  5C1V A;  1SU1 A;  3DSC A;  4O4K A;  4V0X A;  3H61 A;  2WDC A;  3H63 A;  3E7B A;  2P6B A;  2NXF A;  4O24 A;  1WAR A;  3K7V C;  5EQV A;  3PSO A;  1AUI A;  1S8E A;  2GJU A;  1OI8 A;  2QJC A;  4G9J A;  3THO B;  4ZX2 A;  1JK7 A;  5JPE A;  4I5L C;  4H1S A;  5DNY A;  4TUI A;  1S95 A;  3IB8 A;  4DHL A;  4F0Z A;  5JJT A;  3IB7 A;  4H1Y P;  1II7 A;  2BQ8 X;  4J6O A;  4ORC A;  3CK2 A;  4JA9 A;  1UF3 A;  3QFO A;  4KBP A;  1IT6 A;  4V0W A;  2XMO A;  4MP0 A;  4ZVZ A;  4HD0 A;  4UWQ A;  1S3N A;  3C9F A;  1U32 A;  1S3M A;  1OID A;  4ORA A;  4B2O A;  3TGH A;  4NZV A;  4FBQ A;  3JYF A;  1MF8 A;  4YKE A;  5GTU A;  4UT3 A;  1FJM A;  3DW8 C;  5HPE A;  3GVE A;  4H2B A;  3FGA C;  4O5G A;  2NYL C;  3H62 B;  3DSD A;  2Z06 A;  4FBK A;  4LTY A;  3H68 A;  3QFN A;  4M0V A;  1HP1 A;  3P71 C;  3H60 A;  1NNW A;  3RL4 A;  4UT3 B;  2WDF A;  5IOH A;  3C5W C;  3H69 A;  4TUG A;  3ICF A;  2NPP C;  2NYM C;  1Z2X A;  1QHW A;  5JPF A;  4Q7F A;  2WDE A;  3RL3 A;  2QFP A;  1XZW A;  1S3L A;  1T70 A;  1TCO A;  2WDD A;  4LU9 A;  3AUZ A;  3QFK A;  1S70 A;  2QFR A;  2HY1 A;  2IE3 C;  4MOV A;  1HO5 A;  4ORB A;  3RL5 A;  1UTE A;  3EGG A;  4V0V A;  4FCX A;  5B8I A;  3QG5 C;  4OR9 A;  4LAC C;  3QFM A;  2IE4 C;  3T1I A;  2Q8U A;  4H2F A;  3ZU0 A;  4KKZ A;  2O8A A;  1QFC A;  2ZBM A;  1T71 A;  3IVD A;  4DT2 A;  5INB A;  3RQZ A;  3H67 A;  2A22 A;  3EGH A;  2YVT A;  3PSN A;  4H2I A;  3H64 A;  2HYP A;  3E7A A;  5J28 A;  3HVQ A;  3THN A;  2CV9 A;  2KKN A;  4IL1 A;  2BCD A;  4JA7 A;  1HPU A;  3LL8 A;  1G5B A;  2R17 A;  4WWL A;  2Z72 A;  1XM7 A;  2BDX A;  3ZTV A;  3K7W C; 
#chains in the Genus database with same CATH topology
 2O25 A;  4P7D A;  4FBW A;  3GLG B;  4LRS A;  1V34 A;  1IBL M;  3RGS A;  3M7G A;  4X65 M;  1VEG A;  1XMQ E;  2EOE A;  2VQF E;  2DMY A;  3VHT B;  3SYL A;  2CV0 A;  2FH0 A;  1EH8 A;  2LT7 A;  1QZM A;  1N78 A;  2R76 A;  2WDC A;  2XSZ D;  4F1I A;  3HY5 A;  3U5Z A;  4W5W A;  2UU9 E;  4JI5 M;  4LF8 M;  4DR1 E;  2L8T A;  4F9B B;  3SAR A;  2KNA A;  3HJS A;  1XHB A;  4JI3 E;  2UXC M;  1BBO A;  4HEI A;  1G4A E;  4NXM E;  2LMZ A;  2EM2 A;  5LMN E;  2EPU A;  4MGK E;  5C18 A;  4B3M E;  3MMP A;  3ECR A;  3J7A G;  1NVM A;  1L1Z A;  3LCV B;  3AFH A;  2V85 A;  5KL7 A;  4ANR A;  4L16 A;  1YPN A;  4UT3 A;  1N33 M;  5EP2 A;  3GO8 A;  5HPE A;  4BBY A;  2BBG A;  1QAN A;  2EO2 A;  2H1R A;  2WDF A;  3KP0 E;  4M9V C;  5DFL A;  1NHG C;  4EIW A;  1NY5 A;  2JWO A;  2QFP A;  2R1F A;  2M60 A;  3C3E A;  2JR1 A;  1A1L A;  2ELZ A;  1ZMV A;  2IE3 C;  4AW4 A;  5B8I A;  4II7 A;  1IBL E;  3MSW A;  5ITY A;  4R8O A;  2GPI A;  4Y28 F;  2YTE A;  3HVQ A;  2CEA A;  3VKH A;  1G5B A;  3U61 B;  3ZTV A;  3H09 A;  3GLF B;  1DO2 A;  3VK8 A;  2Z1A A;  1EH6 A;  2N3H A;  3L2A A;  4QNM A;  1IBK E;  3FUU A;  4JI5 E;  4LF8 E;  2H5X A;  2AHM A;  4AG5 A;  1FNN A;  4LJ6 A;  2B3T A;  2HAK A;  2UXC E;  1MEY C;  1UIL A;  1A1F A;  3K9O A;  1PJS A;  1BB8 A;  1NJG A;  4M9S A;  3GLH E;  4LF9 M;  2LHC A;  3FD9 A;  1J26 A;  5JI3 E;  4Z6Y A;  4G9J A;  3KSX A;  3FUX A;  2L3J A;  1VG5 A;  1ZU1 A;  1N33 E;  3GPP A;  3KXE C;  4IJD A;  3Q8X A;  1UHZ A;  2MC6 A;  3HZJ A;  1DV0 A;  3VFD A;  2YRM A;  1NV9 A;  2MRO B;  3D8B A;  2ODR D;  3EIE A;  2RKO A;  2EMC A;  2JXN A;  2JZ0 A;  4X64 M;  1X37 A;  3VKG A;  1WGL A;  1OID A;  4B2O A;  4DR4 M;  3JYF A;  1OTR A;  1T6O A;  4GKJ E;  3AOE A;  2ZAN A;  4X62 M;  2L2M A;  3SHF A;  2DGC A;  2R45 A;  4DR6 E;  1XXH E;  2KEB A;  1R2Z A;  2WDE A;  5A2Q C;  3LVV A;  1OAI A;  2EM6 A;  3FYC A;  2OQ4 A;  4B3R M;  1V33 A;  2EM0 A;  1D0L A;  3EPJ A;  1V92 A;  4LAC C;  1ZV1 A;  2YTN A;  2EQ1 A;  4IJF A;  3IVD A;  5INB A;  3UGJ A;  3ADL A;  3H67 A;  2K47 A;  1R6B X;  3MHS C;  5LLQ A;  2ERC A;  1X6H A;  2JY6 B;  1FKA E;  4BBA A;  2XZF A;  4DR2 M;  4GIT A;  3I4Y A;  2L4E A;  1LV7 A;  1UN6 B;  3WHL A;  2LCE A;  3FKE A;  1DGF A;  3U5Z B;  1WAO 1;  1C7Y A;  2JY5 A;  4MLQ A;  2MDG A;  4AKH A;  4QNR A;  1SU1 A;  4Q35 B;  2KDL A;  4UN2 B;  2NXF A;  3I4V A;  4X64 E;  2YTP A;  2ADR A;  3KP1 E;  1T39 A;  3L26 A;  1UFZ A;  2HJJ A;  4DR4 E;  2N3G A;  2NUF A;  1VQ1 A;  1TN9 A;  4QOS A;  4LF7 E;  2KXE A;  2JY9 A;  2YTG A;  4FD2 A;  4DV4 E;  2BQ8 X;  4WSG A;  5IV8 B;  1XWI A;  4X62 E;  2UUC M;  3ADG A;  1MN3 A;  4YY3 E;  2R44 A;  2JZ1 A;  1PM5 A;  1L2C A;  2NUE A;  4B3R E;  4JI0 E;  4O5G A;  1IN7 A;  5GKN A;  1OAO C;  2RTX A;  1MX0 A;  4BLC A;  3ZOQ B;  1FJG M;  3RL4 A;  1YYK A;  1RQ0 A;  4KZS A;  2K4V A;  2WDD A;  3C6M A;  4RF1 A;  2B7V A;  4NRV A;  2F8B A;  2EOM A;  2X49 A;  3QFM A;  2Q8U A;  4KKZ A;  4DT2 A;  3SAS A;  5AC4 A;  4ZYG A;  3RQZ A;  3EGH A;  1OJL A;  2JPA A;  2QQ8 A;  1ZR9 A;  3LMM A;  5J28 A;  2CV9 A;  2HL7 A;  2FS1 A;  4ZPX A;  4JA7 A;  1HPU A;  4L8R C;  2VE7 C;  1IFY A;  2VII A;  2G7H A;  4DR5 M;  2HHH M;  3J80 C;  1OFH A;  1LLM C;  5IXM B;  1IMU A;  3GLF E;  2BWB A;  2L4F A;  2M9A A;  5BR8 M;  2MH8 A;  2G8L A;  4P78 A;  2M7Q A;  5DYG A;  1BVS A;  1H6U A;  2EPO A;  4XPN A;  4X9J A;  2UUA M;  3DOA A;  1QYR A;  4WP2 A;  2YWQ A;  4NSO B;  3IG5 A;  3GQ4 A;  4O4K A;  3H63 A;  2UUC E;  2LWX A;  3L25 A;  2O5R A;  2EOZ A;  4BMJ A;  5AE2 A;  4FVM A;  2EM9 A;  2V86 A;  3T15 A;  1N36 E;  3BF2 A;  1PJI A;  4G4O A;  3FYD A;  2R46 A;  2JOX A;  2JVA A;  4GHL A;  1A1J A;  1MGT A;  4GKK M;  2VDB B;  3CK2 A;  1FJG E;  2XMO A;  4MP0 A;  5C1B A;  3H4J A;  3ZCB B;  5LMU M;  2BB8 A;  4DV6 M;  4AKI A;  4R2P A;  5IRE B;  2EOF A;  2WCC 3;  5ITX E;  4RH8 A;  3H62 B;  2WBU A;  1XMO M;  1KYI A;  3GPX A;  3HQ1 A;  2DWN A;  2R4E A;  3IG8 A;  1Z5C A;  2MKN A;  1IXS A;  2QFR A;  1KFV A;  3VLF B;  1OIP A;  3GLI A;  2F5N A;  2HHH E;  1TDZ A;  4FCX A;  2D7E A;  1GLN A;  1WJ7 A;  1QNT A;  1HNX M;  3BBG A;  1SXJ B;  1RU3 A;  2A22 A;  1VEJ A;  5BR8 E;  1G41 A;  3E7A A;  3THN A;  3SAV A;  1GVN A;  4DKK A;  4WWL A;  2Z72 A;  4BS9 A;  1G2D C;  5T6J A;  2UUA E;  2YZT A;  2XLJ A;  2DXN A;  4R2R A;  4TUW A;  2ZOA A;  5JI2 E;  5EQT A;  3SAW A;  2LUQ A;  2FGG A;  2DAI A;  5F3W A;  2FFJ A;  3BID A;  3GRV A;  1GAB A;  1T4N A;  3V76 A;  4M9X A;  2CWB A;  3KOY E;  3FTE A;  2N8X A;  3C3D A;  2DFJ A;  4NXN M;  1YUJ A;  4LFC M;  4XBO A;  4JYA E;  4GKK E;  5KPT A;  2MC5 A;  2DIX A;  2KA6 B;  3KDS E;  1DI2 A;  2J7N A;  1ZAE A;  2Z7J A;  5EP3 A;  5KQ8 A;  3T6P A;  1AUI A;  3EPL A;  5LMU E;  3RFW A;  1KSF X;  3GQ3 A;  1IBM M;  1N32 E;  2EA0 A;  3U6Q A;  2X4A A;  1JK1 A;  1XMO E;  4LGY A;  4ORC A;  2L6O A;  4ZYE A;  3R8F A;  4JA9 A;  4LFB M;  1Z59 A;  2LRS A;  1TTE A;  1KYQ A;  4A3V B;  4FK5 C;  1DGB A;  2Y20 A;  1S3M A;  4JXJ A;  4WSP A;  4I5S A;  3KOX E;  1FJM A;  3FLO A;  3FUT A;  2F5S A;  2L2N A;  3KS8 A;  5H37 D;  4S12 A;  3A45 A;  2Y21 A;  2EOR A;  1A1G A;  1SG9 A;  3L00 A;  5IOH A;  4GMQ A;  3C5W C;  1HNX E;  3BOS A;  2NYM C;  3KW6 A;  3DA1 A;  4IBG A;  2ZM6 E;  2L3C A;  3THG A;  2D7G A;  3SAU A;  2DNA A;  3JR5 A;  2UXD M;  1UTE A;  4F6M A;  3FTD A;  2YQZ A;  1TH2 A;  3QG5 C;  5EP4 A;  2K6B A;  3JR4 A;  3VK7 A;  2DI0 A;  4GHA A;  4H2I A;  1KJK A;  2EPP A;  1QQW A;  2DZL A;  4PD2 A;  2UXB M;  3U6D A;  4NXN E;  2X8A A;  4LFC E;  2V1C A;  3KOZ E;  2DAE A;  4N4R B;  1GQE A;  1VDL A;  1SFE A;  5KL2 A;  3T38 A;  3C9P A;  1ZBQ A;  1ZMU A;  1K3X A;  4OVZ A;  2EPR A;  2XFT A;  1IBM E;  1DGG A;  2G5G X;  1YFH A;  3E46 A;  2HKJ A;  3FTC A;  1WHN A;  3JU0 A;  3K7V C;  1YYO A;  1DO0 A;  4J8Z A;  1X48 A;  5IWA M;  4CHT B;  3CF0 A;  2VF7 A;  2DWM A;  1LTM A;  4H1S A;  4IBF A;  4B3T E;  3K92 A;  1S95 A;  2EPX A;  1BBG A;  2WSF F;  2FOI C;  4V0W A;  1IT6 A;  2QEN A;  4HD0 A;  2PRT A;  3GQ5 A;  4LJ9 A;  4WUR A;  5FTN A;  3M0E A;  2V89 A;  3J81 S;  1A1H A;  3CGW A;  2E1M A;  4L6V 6;  3HJQ A;  3QYE A;  2UXD E;  2JA2 A;  3IWD A;  2ZTC A;  4JI7 M;  1IXS B;  3LML A;  3QFN A;  3MHH C;  1YUB A;  3HGI A;  3GLI B;  3VDP A;  1L2D A;  5AAS A;  1W5S A;  5CFF E;  3M6A A;  1D0K A;  2EJS A;  3KSJ A;  2F5O A;  1XNR M;  1X5W A;  3HHX A;  5FLX C;  3HU1 A;  2YFQ A;  2CV2 A;  2ZAO A;  2CV1 A;  4H2F A;  1IY1 A;  3SMP A;  3U6C A;  2OOA A;  4LRT A;  2EM4 A;  1YLA A;  2RPC A;  4F6N A;  1JR3 E;  2JY8 A;  2KHX A;  3JAM S;  1SXJ E;  4JV5 M;  1NNU C;  4HLQ A;  2KON A;  2QZ4 A;  4IYP C;  3N5U A;  3H4M A;  4H2G A;  4IIW A;  3K1J A;  3ZQJ A;  1TR8 A;  2O8G A;  1SXJ C;  4B3S M;  4PDI A;  1IQO A;  2A25 A;  4X65 E;  4JI8 M;  2VF8 A;  3LQR A;  2YNM D;  3A98 B;  1A5T A;  1WAR A;  4KWY A;  1QU6 A;  1S8E A;  5LL6 R;  2EN8 A;  1DGH B;  1OI8 A;  2C9O A;  5JPE A;  4LF4 M;  2EOH A;  2C98 A;  4JI7 E;  1Q3B A;  1E9S A;  1UF3 A;  2QP9 X;  1WHC A;  2R18 A;  4WX9 A;  1TH3 A;  3K9P A;  4L8N A;  1WHQ A;  3C6K A;  3DF6 A;  1XNR E;  4YKE A;  3AL0 C;  3DW8 C;  2LBS B;  3UZU A;  2BNK A;  5IT9 S;  2LTR A;  1HP1 A;  2O01 F;  3IWB A;  1YYW A;  2ZO9 B;  3HX3 A;  5JPF A;  4LFA M;  3RL3 A;  5KL3 A;  3PNV A;  3QFK A;  4BHB A;  4FCV A;  3CF2 A;  3M99 B;  3RL5 A;  1HO5 A;  4JV5 E;  3T1H M;  4OR9 A;  2EN2 A;  4MGH A;  2LVH A;  3KZY A;  3GRU A;  1EE8 A;  1GJT A;  4JI8 E;  3K7W C;  4O43 A;  3AV0 A;  2LO3 A;  2L09 A;  2D9H A;  2I13 A;  4AI6 A;  1Z2W A;  4AQY M;  4QHT A;  4F9A B;  1STU A;  3C4T A;  1QDT A;  4JI4 M;  1E94 E;  5TSE A;  2KW0 A;  4R2S A;  3VYY A;  4LF4 E;  2V6Z M;  3J7B A;  3SFZ A;  3J81 C;  2YRH A;  4CIS A;  3H61 A;  3B7Z A;  3EPK A;  5L8R F;  1N77 A;  1TGU A;  4YHH M;  4FWD A;  4L4U A;  1R2Y A;  2EMA A;  4LF9 E;  3HHY A;  2EN4 A;  4I5L C;  2DHY A;  1EH7 A;  3KFU G;  3GLG E;  2DVW B;  2JNH A;  2EM8 A;  2KNV A;  4OW0 A;  3IB8 A;  4DHL A;  4H1Y P;  1II7 A;  3PXG A;  5AE3 A;  4KBP A;  3L27 A;  2JYA A;  1Z6T A;  1X49 A;  3RE8 A;  4NOO B;  4R2E A;  2CFO A;  4ORA A;  2DSY A;  4NZV A;  1MF8 A;  5GTU A;  3MK6 A;  2EKK A;  2Z06 A;  2YT4 A;  2XEP A;  1JK2 A;  3T1H E;  2KOU A;  3JAM C;  3H60 A;  1NNW A;  4UT3 B;  2NPP C;  2V88 A;  2VQE M;  2DLK A;  3E0J A;  2CRU A;  3E9S A;  2GQF A;  1QZE A;  1E32 A;  2DAM A;  4JI1 M;  4L15 A;  2EPM X;  1ZBT A;  3AUZ A;  1J5E M;  1RC7 A;  4MOV A;  2LV2 A;  5FTJ A;  1ZMW A;  4P16 A;  4BC9 A;  2EZ6 A;  2IE4 C;  4AQY E;  2ENA A;  2LE2 A;  1TH4 A;  2KRK A;  2XFS A;  3H64 A;  4JI4 E;  3K8Z A;  5EXP A;  3KZZ A;  1QUS A;  4KHP M;  4GEQ B;  2BCD A;  1XM7 A;  2RSM A;  3A42 A;  3HXL A;  4WFT A;  1NV8 A;  2LTU A;  2FV4 B;  2V8Q B;  1HJP A;  3UK3 C;  3GLH A;  4DR2 E;  2K9D A;  1GZ6 A;  2EMZ A;  1W24 A;  1XNQ M;  4I5N C;  1QAO A;  4DV7 M;  1NSF A;  1X6E A;  5C1V A;  3MHV C;  4IJE A;  2QBY A;  4AKG A;  2MKD A;  2HCB A;  5EXT A;  2B3T B;  1OKS A;  1D2N A;  3J2P B;  4LF6 M;  1OFI A;  3I01 M;  2WZO A;  3W67 A;  3THO B;  4ZYD A;  3HHZ A;  2YTO A;  3OML A;  3TWL A;  5A6J A;  3LW5 F;  4LF5 M;  2XH9 A;  4MH0 E;  2HC5 A;  2VQE E;  2DKL A;  4RNA A;  3BGH A;  2EMY A;  3KVW A;  1J5E E;  2EOO A;  3SBJ A;  2H36 X;  2HWJ A;  3DSD A;  4LTY A;  2NA2 A;  4R2Q A;  2L7H A;  4KOD A;  2XF3 A;  4TUG A;  1IQP A;  1UBD C;  1IM2 A;  1NJF A;  1XZW A;  4KHP E;  1NO1 A;  3DZD A;  2FE8 A;  1S70 A;  4ORB A;  4F9C B;  2QCU A;  3FTF A;  2UUB M;  3U6M A;  4FWG A;  2EUC A;  3ZU0 A;  1PKP A;  4F2L A;  2LUP B;  4X66 M;  1XNQ E;  1VDD A;  2KKN A;  4DV7 E;  1QVR A;  1HNW M;  1AAY A;  2R17 A;  5ADZ A;  4G3O A;  3LCU A;  2EOJ A;  2DXL A;  4NSR A;  2JP7 A;  2QNJ A;  2MGW A;  2AHD A;  3L29 A;  4DR5 E;  2APL A;  3IHP A;  4LF6 E;  3R9X B;  3H66 A;  2B9D A;  2LBC A;  4B7H A;  1N3G A;  5KL4 A;  4LJ4 A;  1PDA A;  2OOB A;  4LJ7 A;  4DR7 M;  3E7B A;  3FRI A;  1X3C A;  3FUW A;  3FE3 A;  2P5T A;  4B7G A;  2K0B X;  3W0L B;  4WXC A;  4F54 A;  1WIV A;  4R3D A;  4TUI A;  4REZ A;  5FSW A;  3LQQ A;  1WRJ A;  1S3S A;  1TF0 B;  1PJJ A;  2B7T A;  2ZAM A;  4WYQ B;  4JI6 M;  3QAU A;  2MJ5 B;  3WHK A;  2GNO A;  4B7F A;  4DV6 E;  1EIJ A;  2NAB A;  2EMH A;  2UUB E;  2I7N A;  2Z8Y M;  2YEQ A;  1HT1 E;  3T1Y M;  1IN4 A;  3H69 A;  3ICF A;  4X66 E;  4GH9 A;  5E26 A;  3NBI A;  5FTM A;  2HY1 A;  2CP8 A;  2D7H A;  2CE7 A;  3U61 A;  1Y8G A;  3GLF A;  1HR0 M;  2ZBM A;  2YTI A;  2EKF A;  5A6K A;  1P47 A;  1NCS A;  3B9P A;  1L2B A;  4I81 A;  2BDX A;  2NQ8 C;  3GRR A;  2EM3 A;  2RSI A;  2MDR A;  5ITR A;  4LY6 A;  4L78 A;  4DR7 E;  3B89 A;  2QBY B;  5KQD A;  2WBT A;  4K0K M;  1R7R A;  2A5Y B;  2YSO A;  3AJI B;  1F4I A;  3KS4 A;  2QSF X;  4RKU F;  1GKI A;  1GO5 A;  2EPK X;  2Y0Q A;  2LH0 A;  5KO3 A;  2ELY A;  2DAG A;  5FTL A;  3E4R A;  1XC8 A;  5BPV A;  4BC7 A;  1HNZ M;  2V87 A;  3B7N A;  3B74 A;  1TF3 A;  1P3Q Q;  2QHO B;  2EOX A;  2QJC A;  4JI6 E;  3HPS A;  3CTW B;  4NXM M;  3OTO M;  3MJ5 A;  4GC5 A;  5KL5 A;  3GPY A;  2EMI A;  1TDH A;  2KZU A;  5JJT A;  1WGN A;  1VEK A;  2EPZ A;  1R4G A;  4J6O A;  2JXP A;  3HPZ A;  2XGN A;  1QAQ A;  1GL6 A;  2C99 A;  1WJP A;  3T1Y E;  4DUY M;  4Q28 A;  1UM8 A;  1X6F A;  2C96 A;  4LFB E;  1G3I A;  4GC9 A;  2K7I A;  2CTD A;  1NNJ A;  2CHG A;  4KT0 F;  2J7J A;  1J7K A;  4FBK A;  5AE1 A;  5A69 A;  1MJG M;  3TQS A;  4D82 A;  1HR0 E;  2KRU A;  4M30 A;  1Z2X A;  3U6L A;  2DWL A;  1I94 M;  2OO9 A;  1TCO A;  2WBS A;  5A2Q S;  4XK8 F;  4QOZ C;  4GEW A;  2WSE F;  3VYX A;  2Z4S A;  4OX9 M;  3TQM A;  4K0K E;  3IEC A;  2HYP A;  3HHW A;  2NUG A;  2L2D A;  4IL1 A;  3F92 A;  2V83 A;  1IBK M;  4MM3 B;  4IBE A;  3AOE C;  2LVN C;  2UXB E;  3D8L A;  1HNZ E;  1JB0 F;  2EP3 A;  4ZYH A;  4DMI A;  2JOG A;  4B08 A;  1IXZ A;  3OTO E;  4GIP A;  3HJ8 A;  4MB7 A;  2BWE A;  3LLH A;  4PDG A;  4L5N C;  4HEO A;  4QHS A;  4KLN A;  3CF6 E;  1YZ9 A;  3VDU A;  4V0X A;  4O24 A;  4DUY E;  3PSO A;  2Y0T A;  3KOW E;  2JOB A;  1Z1B A;  2KZS A;  3PVS A;  5IWA E;  3SHG B;  1T43 A;  2E5L M;  3FIG A;  1ZQ9 A;  1IN8 A;  2Z3X A;  2EPC A;  2GHF A;  2EM5 A;  3SAT A;  1I94 E;  1U32 A;  4GKJ M;  3UJN A;  3GVE A;  4DR6 M;  2EMG A;  3EIH A;  4OX9 E;  1JR3 D;  4CJ6 A;  1C1K A;  1SXJ D;  3RMP A;  1RMD A;  4FW9 A;  4LJ5 A;  1Q02 A;  4OU7 A;  1N34 M;  1IY2 A;  2IHR 1;  1T70 A;  3HWS A;  4IBK A;  2F5Q A;  5A6B D;  3AKZ A;  4LU9 A;  1IN5 A;  4WXD A;  5KPR A;  3W68 A;  3U6P A;  2EN3 A;  2F5P A;  1AIP C;  2JUJ A;  3T1I A;  4CIZ A;  2C9C A;  1Q3C A;  1AH5 A;  4MGI E;  2DB2 A;  2ODR C;  5ITQ A;  2L33 A;  3SYK A;  1HQY E;  4AZF A;  2R0I A;  1USH A;  2XSZ A;  2ZBK B;  2IAE C;  4MOY A;  4PT5 A;  1PJT A;  3J80 S;  2YPN A;  1V73 A;  4UT2 A;  4X8W A;  4FCW A;  2JWS A;  5E6J A;  1KBP A;  2QPA A;  4KO8 A;  2LJH A;  4DV1 M;  2E5L E;  3PFI A;  2DEN A;  2L7I A;  3A46 A;  4B3S E;  4M9Z A;  4IBB A;  3TE6 A;  3DFZ A;  3QYB A;  4OVZ B;  3TPZ A;  1TF6 A;  4LZZ A;  3B7Q A;  1JK7 A;  1IY0 A;  4LF7 M;  1X47 A;  4DV3 M;  2EJ4 A;  4DV4 M;  1E9R A;  7CAT A;  4JI2 M;  3IWC A;  3HU3 A;  4F0Z A;  3IB7 A;  3BXW A;  2CPN A;  3TL4 X;  3U6O A;  4YY3 M;  1T4O A;  1L8Q A;  4JN6 A;  2EL6 A;  4DR3 M;  2EMK A;  2EML A;  1N34 E;  4JI0 M;  2DXI A;  1J09 A;  3GRY A;  3RGP A;  2LHG A;  2NYL C;  4LJA A;  1PJQ A;  4HTG A;  3EPH A;  3U6E A;  1L1T A;  3D03 A;  4IBJ A;  5EJC A;  1JR3 A;  4LFA E;  1SXJ A;  2R4J A;  3NBX X;  4NHR A;  1OIZ A;  2EOI A;  1DGC A;  5A6B A;  2L6M A;  4RHB B;  2EWL A;  3JTZ A;  3PSN A;  2F4V M;  1JQJ C;  5ITT A;  3U6S A;  4DV1 E;  4LZJ A;  1T4L B;  3GLI E;  2N35 A;  2YTJ A;  4LJ8 A;  2JY7 A;  4HL4 A;  4LCB A;  4R2C A;  3VK6 A;  3TWK A;  1L4S A;  3HKP A;  3V4Y A;  4BHC A;  1O0W A;  4DV3 E;  3DJW A;  4Q7J A;  3ADJ A;  2FNA A;  5EXS A;  4JI2 E;  2DHR A;  3DSC A;  1YE9 A;  2ENC A;  3HTX A;  2MR9 A;  4DV0 M;  4R7G A;  4GZN C;  2Z4R A;  2P6B A;  1N36 M;  2EMF A;  5A6A A;  5EQV A;  1XB2 B;  1WR1 B;  4DR3 E;  2CHQ A;  4M0D A;  2ENH A;  3QWL A;  3U60 A;  4ZX2 A;  2FTX B;  2EQ3 A;  1ZAA C;  4AG6 A;  4YHH E;  4R2A A;  2DLQ A;  5DNY A;  4I8O A;  4LGM A;  2EOQ A;  5IZ7 D;  1NHW C;  1R5L A;  1QUT A;  2YR0 A;  3UK6 A;  4MLV A;  4BB9 A;  1B69 A;  4UWQ A;  2M5Z A;  4FBQ A;  5IT9 C;  4CGY B;  1OQY A;  1AUA A;  5EP1 A;  2EPL X;  4IS1 C;  2J7O A;  2LVO C;  4Z8X A;  4IBC A;  4DBG B;  3KWR A;  1DQ3 A;  1G59 A;  2F4V E;  1SR9 A;  2M4I A;  2Q2E B;  1S3L A;  1XXH A;  2LVP C;  3L28 A;  3C4B A;  4MGZ E;  1Z5A A;  4JI1 E;  4NC6 A;  2CUZ A;  2C5R A;  3GPU A;  1QFC A;  2O8A A;  8CAT A;  2BJW A;  2GLI A;  1HT2 E;  3K2L A;  1PGY A;  2L92 A;  4DV2 M;  1MU5 A;  4WW0 A;  4R2D A;  1IN6 A;  4IBD A;  1NEI A;  4G6Z A;  1Q39 A;  1OIE A;  4DV0 E;  2XZU A;  2VF1 A;  4D81 A;  2EL4 A;  2JP9 A;  3EQ1 A;  2DZO B;  2EMB A;  4G4R A;  1T38 A;  4OOG C;  2USH A;  4JYA M;  3KBP A;  2HYO A;  3GLG A;  4P17 A;  3F6H A;  1D0M A;  3FUV A;  2W82 A;  4XGI A;  3ZH9 B;  2RGH A;  2HGH A;  4M0W A;  4PCZ A;  2GJU A;  3Q8G A;  1N32 M;  1GTK A;  1K82 A;  4MGY E;  3BBZ A;  2KHH A;  1F2I G;  2EMX A;  1CUK A;  2EQ0 A;  2RS6 A;  4WPY A;  3QFO A;  2DAK A;  3SMS A;  2EPN A;  2EN6 A;  1IXR C;  2YSP A;  4LG2 A;  4DUZ M;  4LF5 E;  3FRH A;  2CSH A;  2I7P A;  1HQC A;  3NWL A;  4H2B A;  2R6F A;  4BCA A;  5KPZ A;  3H68 A;  2EL5 A;  2I9I A;  1T3T A;  2ZM6 M;  2OPF A;  4RF0 A;  3K6Q A;  2DWZ B;  4NL4 H;  1QHW A;  2RS7 A;  4D80 A;  4G4Q A;  2EE8 A;  2YU8 A;  4F2J C;  2KNZ A;  5DYI A;  1YSY A;  2ZTD A;  3I51 A;  1QAM A;  4DV2 E;  1G71 A;  1A1I A;  4GRI A;  4V0V A;  3PNY A;  4IBI A;  5FLX S;  2CHV A;  4ITQ A;  2YTD A;  1T71 A;  4DV5 M;  2LTS A;  2YVT A;  3F6G A;  1K3W A;  3J27 B;  3LL8 A;  2YTF A;  3IVE A;  2E72 A;  1HNW E;  1QDR A;  2RQL A;  4DSY A;  2RRU A;  1GL7 A;  3GP1 A;  1WXR A;  1Z5B A;  1M63 A;  3TWM A;  4R03 A;  5ITU A;  2LXE A;  2R62 A;  3UMM A;  2WSC F;  1W5T A;  2VRD A;  3GLH B;  1A1K A;  3U60 B;  1G8P A;  1DGH A;  2RGO A;  4R71 A;  2WZJ A;  1N75 A;  1NY6 A;  3ADI A;  2V1U A;  3I04 M;  4FWH A;  2EOY A;  4M2Z A;  4I4L A;  1I4W A;  2EPA A;  5EXX A;  4G4N A;  4B3T M;  1GJS A;  2EM7 A;  4DUZ E;  5AC5 A;  2DZN B;  1XMQ M;  3HU2 A;  4FCT A;  2LVQ D;  2VQF M;  3E21 A;  2LNH C;  2R65 A;  1YSA C;  1G2F C;  2EOS A;  4ZVZ A;  3ILK A;  1WXQ A;  2UU9 M;  2LVA A;  3SC3 A;  4DR1 M;  1S3N A;  2BJV A;  3C9F A;  1YUI A;  3ZC7 B;  5KL6 A;  3TGH A;  2M1S A;  4JI3 M;  2G3Q A;  1XXH B;  3FGA C;  5LMN M;  5ITX A;  4M0V A;  3AOG A;  4B3M M;  3P71 C;  3W0F A;  3C58 A;  3P1X A;  3LVW A;  4DV5 E;  4Q7F A;  2EN7 A;  2YTQ A;  2J5Y A;  2EMW A;  2L2K B;  2DRP A;  1IQS A;  3J7A S;  2EN1 A;  3EGG A;  2YRK A;  1EFU B;  2LJU A;  2YU5 A;  1EKZ A;  1ORY B;  2CT1 A;  5FTK A;  3J7Y p;  1PRB A;  2DMI A;  4NRW A; 
#chains in the Genus database with same CATH homology
 4P7D A;  4FBW A;  3GLG B;  4LRS A;  1IBL M;  3RGS A;  3M7G A;  4X65 M;  1XMQ E;  2VQF E;  2DMY A;  3SYL A;  2CV0 A;  1QZM A;  1N78 A;  2WDC A;  2XSZ D;  3U5Z A;  4W5W A;  2UU9 E;  4JI5 M;  4LF8 M;  4DR1 E;  2L8T A;  4F9B B;  3SAR A;  3HJS A;  1XHB A;  4JI3 E;  2UXC M;  1G4A E;  4NXM E;  2LMZ A;  5LMN E;  4MGK E;  5C18 A;  4B3M E;  3J7A G;  1NVM A;  1L1Z A;  3AFH A;  2V85 A;  4L16 A;  4UT3 A;  1N33 M;  5EP2 A;  3GO8 A;  5HPE A;  4BBY A;  1QAN A;  2EO2 A;  2H1R A;  2WDF A;  3KP0 E;  1NHG C;  4EIW A;  1NY5 A;  2JWO A;  2QFP A;  2M60 A;  2JR1 A;  2IE3 C;  4AW4 A;  5B8I A;  4II7 A;  1IBL E;  3MSW A;  5ITY A;  4R8O A;  3HVQ A;  2CEA A;  3VKH A;  1G5B A;  3U61 B;  3ZTV A;  3H09 A;  3GLF B;  1DO2 A;  3VK8 A;  2Z1A A;  2N3H A;  3L2A A;  4QNM A;  1IBK E;  3FUU A;  4JI5 E;  4LF8 E;  2AHM A;  4AG5 A;  1FNN A;  4LJ6 A;  2UXC E;  1UIL A;  1NJG A;  4M9S A;  4LF9 M;  3FD9 A;  1J26 A;  5JI3 E;  4Z6Y A;  4G9J A;  3KSX A;  3FUX A;  2L3J A;  1N33 E;  3GPP A;  3KXE C;  3Q8X A;  1UHZ A;  2MC6 A;  3VFD A;  3D8B A;  2ODR D;  3EIE A;  2RKO A;  4X64 M;  1X37 A;  3VKG A;  1OID A;  4B2O A;  4DR4 M;  3JYF A;  4GKJ E;  3AOE A;  2ZAN A;  4X62 M;  2L2M A;  3SHF A;  2R45 A;  4DR6 E;  2KEB A;  1R2Z A;  2WDE A;  5A2Q C;  3LVV A;  3FYC A;  2OQ4 A;  4B3R M;  4LAC C;  4IJF A;  3IVD A;  5INB A;  3UGJ A;  3ADL A;  3H67 A;  2K47 A;  1R6B X;  2ERC A;  1FKA E;  4BBA A;  2XZF A;  4DR2 M;  4GIT A;  3I4Y A;  1LV7 A;  3WHL A;  3FKE A;  1DGF A;  3U5Z B;  1WAO 1;  4AKH A;  4QNR A;  1SU1 A;  2NXF A;  3I4V A;  4X64 E;  3KP1 E;  3L26 A;  4DR4 E;  2N3G A;  2NUF A;  4QOS A;  4LF7 E;  2KXE A;  2JY9 A;  4FD2 A;  4DV4 E;  2BQ8 X;  1XWI A;  4X62 E;  2UUC M;  3ADG A;  4YY3 E;  1PM5 A;  1L2C A;  2NUE A;  4B3R E;  4JI0 E;  4O5G A;  1IN7 A;  5GKN A;  2RTX A;  1MX0 A;  4BLC A;  3ZOQ B;  1FJG M;  3RL4 A;  1YYK A;  1RQ0 A;  4KZS A;  2K4V A;  2WDD A;  4RF1 A;  2B7V A;  4NRV A;  2F8B A;  2X49 A;  3QFM A;  2Q8U A;  4KKZ A;  4DT2 A;  3SAS A;  3RQZ A;  3EGH A;  1OJL A;  3LMM A;  5J28 A;  2CV9 A;  2HL7 A;  4ZPX A;  4JA7 A;  1HPU A;  4L8R C;  2VE7 C;  2VII A;  2G7H A;  4DR5 M;  2HHH M;  3J80 C;  1OFH A;  5BR8 M;  2G8L A;  4P78 A;  2M7Q A;  5DYG A;  1H6U A;  4XPN A;  2UUA M;  3DOA A;  1QYR A;  4O4K A;  4NSO B;  3IG5 A;  3GQ4 A;  3H63 A;  2UUC E;  2LWX A;  3L25 A;  2O5R A;  4BMJ A;  5AE2 A;  4FVM A;  2V86 A;  3T15 A;  1N36 E;  1PJI A;  4G4O A;  3FYD A;  2R46 A;  4GHL A;  2JOX A;  2JVA A;  4GKK M;  3CK2 A;  1FJG E;  2XMO A;  4MP0 A;  5C1B A;  3ZCB B;  5LMU M;  4DV6 M;  4AKI A;  5IRE B;  5ITX E;  3H62 B;  1XMO M;  1KYI A;  3GPX A;  3HQ1 A;  2DWN A;  2R4E A;  3IG8 A;  1Z5C A;  2QFR A;  1KFV A;  3VLF B;  3GLI A;  2F5N A;  2HHH E;  1TDZ A;  4FCX A;  2D7E A;  1GLN A;  1HNX M;  1SXJ B;  2A22 A;  5BR8 E;  1G41 A;  3E7A A;  3THN A;  3SAV A;  1GVN A;  4DKK A;  4WWL A;  2Z72 A;  4BS9 A;  5T6J A;  2UUA E;  2YZT A;  2XLJ A;  2DXN A;  4TUW A;  2ZOA A;  5JI2 E;  5EQT A;  3SAW A;  2LUQ A;  2FGG A;  5F3W A;  2FFJ A;  3GRV A;  1T4N A;  4M9X A;  3FTE A;  3KOY E;  2DFJ A;  4NXN M;  4LFC M;  4XBO A;  4JYA E;  4GKK E;  5KPT A;  2MC5 A;  2DIX A;  2KA6 B;  3KDS E;  1DI2 A;  2J7N A;  1ZAE A;  2Z7J A;  5EP3 A;  5KQ8 A;  1AUI A;  5LMU E;  3RFW A;  1KSF X;  3GQ3 A;  1IBM M;  1N32 E;  2EA0 A;  3U6Q A;  2X4A A;  1XMO E;  4LGY A;  4ORC A;  2L6O A;  4JA9 A;  3R8F A;  4LFB M;  1Z59 A;  2LRS A;  4A3V B;  1DGB A;  2Y20 A;  1S3M A;  4JXJ A;  4WSP A;  4I5S A;  3KOX E;  1FJM A;  3FLO A;  3FUT A;  2F5S A;  2L2N A;  3KS8 A;  5H37 D;  4S12 A;  3A45 A;  2Y21 A;  5IOH A;  4GMQ A;  3C5W C;  1HNX E;  3BOS A;  2NYM C;  3KW6 A;  3DA1 A;  4IBG A;  2ZM6 E;  2L3C A;  3THG A;  2D7G A;  3SAU A;  3JR5 A;  2UXD M;  1UTE A;  3FTD A;  2YQZ A;  1TH2 A;  3QG5 C;  5EP4 A;  3JR4 A;  3VK7 A;  4GHA A;  4H2I A;  1QQW A;  4PD2 A;  2UXB M;  3U6D A;  4NXN E;  2X8A A;  4LFC E;  2V1C A;  3KOZ E;  1GQE A;  3T38 A;  1ZBQ A;  1K3X A;  4OVZ A;  2XFT A;  1IBM E;  1DGG A;  2G5G X;  2HKJ A;  3FTC A;  1WHN A;  3JU0 A;  3K7V C;  1YYO A;  1DO0 A;  4J8Z A;  1X48 A;  5IWA M;  4CHT B;  3CF0 A;  2DWM A;  4H1S A;  4IBF A;  4B3T E;  3K92 A;  1S95 A;  2FOI C;  4V0W A;  1IT6 A;  2QEN A;  4HD0 A;  3GQ5 A;  4LJ9 A;  4WUR A;  5FTN A;  3M0E A;  2V89 A;  3J81 S;  2E1M A;  3HJQ A;  2UXD E;  2JA2 A;  3IWD A;  4JI7 M;  1IXS B;  3LML A;  3QFN A;  1YUB A;  3HGI A;  3GLI B;  3VDP A;  1L2D A;  5AAS A;  1W5S A;  5CFF E;  3M6A A;  3KSJ A;  2F5O A;  1XNR M;  3HHX A;  5FLX C;  3HU1 A;  2YFQ A;  2CV2 A;  2ZAO A;  2CV1 A;  4H2F A;  1IY1 A;  3SMP A;  3U6C A;  4LRT A;  2KHX A;  3JAM S;  1SXJ E;  4JV5 M;  1NNU C;  4HLQ A;  2KON A;  2QZ4 A;  4IYP C;  3N5U A;  3H4M A;  4H2G A;  4IIW A;  3K1J A;  2O8G A;  1SXJ C;  4B3S M;  4PDI A;  4X65 E;  4JI8 M;  3LQR A;  2YNM D;  3A98 B;  1WAR A;  1QU6 A;  1S8E A;  5LL6 R;  1DGH B;  1OI8 A;  2C9O A;  5JPE A;  4LF4 M;  2C98 A;  4JI7 E;  1Q3B A;  1E9S A;  1UF3 A;  2QP9 X;  2R18 A;  1TH3 A;  4L8N A;  1WHQ A;  3DF6 A;  1XNR E;  4YKE A;  3AL0 C;  3DW8 C;  2LBS B;  3UZU A;  2BNK A;  5IT9 S;  2LTR A;  1HP1 A;  3IWB A;  1YYW A;  2ZO9 B;  5JPF A;  4LFA M;  3RL3 A;  3PNV A;  3QFK A;  4FCV A;  3CF2 A;  3RL5 A;  1HO5 A;  4JV5 E;  3T1H M;  4OR9 A;  4MGH A;  3GRU A;  1EE8 A;  4JI8 E;  3K7W C;  4O43 A;  3AV0 A;  2L09 A;  4AI6 A;  1Z2W A;  4AQY M;  4QHT A;  4F9A B;  1STU A;  3C4T A;  4JI4 M;  1E94 E;  2KW0 A;  3VYY A;  4LF4 E;  2V6Z M;  3J7B A;  3SFZ A;  3J81 C;  4CIS A;  3H61 A;  1N77 A;  1TGU A;  4YHH M;  4FWD A;  4L4U A;  1R2Y A;  4LF9 E;  3HHY A;  4I5L C;  3KFU G;  2DVW B;  4OW0 A;  3IB8 A;  4DHL A;  4H1Y P;  1II7 A;  3PXG A;  5AE3 A;  4KBP A;  3L27 A;  1Z6T A;  1X49 A;  3RE8 A;  4NOO B;  2CFO A;  4ORA A;  2DSY A;  4NZV A;  1MF8 A;  5GTU A;  3MK6 A;  2Z06 A;  2YT4 A;  2XEP A;  3T1H E;  2KOU A;  3JAM C;  3H60 A;  1NNW A;  4UT3 B;  2NPP C;  2V88 A;  2VQE M;  3E0J A;  3E9S A;  1E32 A;  4JI1 M;  4L15 A;  1ZBT A;  3AUZ A;  1J5E M;  1RC7 A;  4MOV A;  5FTJ A;  4P16 A;  4BC9 A;  2EZ6 A;  2IE4 C;  4AQY E;  2LE2 A;  1TH4 A;  2KRK A;  2XFS A;  3H64 A;  4JI4 E;  3K8Z A;  5EXP A;  4KHP M;  4GEQ B;  2BCD A;  1XM7 A;  2RSM A;  3A42 A;  3HXL A;  4WFT A;  2FV4 B;  2V8Q B;  3GLH A;  4DR2 E;  1GZ6 A;  1W24 A;  1XNQ M;  4I5N C;  1QAO A;  4DV7 M;  1NSF A;  5C1V A;  3MHV C;  4IJE A;  2QBY A;  4AKG A;  2HCB A;  5EXT A;  2B3T B;  1D2N A;  3J2P B;  4LF6 M;  1OFI A;  2WZO A;  3THO B;  3HHZ A;  3OML A;  3TWL A;  4LF5 M;  2XH9 A;  4MH0 E;  2VQE E;  4RNA A;  3KVW A;  1J5E E;  3SBJ A;  2H36 X;  3DSD A;  4LTY A;  2NA2 A;  2L7H A;  4KOD A;  2XF3 A;  4TUG A;  1IQP A;  1IM2 A;  1NJF A;  1XZW A;  4KHP E;  3DZD A;  2FE8 A;  1S70 A;  4ORB A;  4F9C B;  2QCU A;  3FTF A;  2UUB M;  3U6M A;  4FWG A;  2EUC A;  3ZU0 A;  1PKP A;  2LUP B;  4X66 M;  1XNQ E;  1VDD A;  2KKN A;  4DV7 E;  1QVR A;  1HNW M;  2R17 A;  5ADZ A;  2DXL A;  4NSR A;  2AHD A;  3L29 A;  4DR5 E;  4LF6 E;  3R9X B;  3H66 A;  2B9D A;  4B7H A;  4LJ4 A;  4LJ7 A;  4DR7 M;  3E7B A;  3FUW A;  2P5T A;  4B7G A;  3W0L B;  4F54 A;  4R3D A;  4TUI A;  4REZ A;  5FSW A;  3LQQ A;  1S3S A;  1PJJ A;  2B7T A;  2ZAM A;  4WYQ B;  4JI6 M;  3QAU A;  3WHK A;  4B7F A;  4DV6 E;  2UUB E;  2I7N A;  2YEQ A;  1HT1 E;  3T1Y M;  1IN4 A;  3H69 A;  3ICF A;  4X66 E;  4GH9 A;  5E26 A;  3NBI A;  5FTM A;  2HY1 A;  2D7H A;  2CE7 A;  3U61 A;  3GLF A;  1HR0 M;  2ZBM A;  3B9P A;  1L2B A;  4I81 A;  2BDX A;  3GRR A;  2NQ8 C;  2MDR A;  5ITR A;  4LY6 A;  4L78 A;  4DR7 E;  2QBY B;  5KQD A;  4K0K M;  1R7R A;  2A5Y B;  3AJI B;  3KS4 A;  1GKI A;  2Y0Q A;  2LH0 A;  5KO3 A;  5FTL A;  3E4R A;  1XC8 A;  5BPV A;  4BC7 A;  1HNZ M;  2V87 A;  2QJC A;  4JI6 E;  3HPS A;  3CTW B;  4NXM M;  3OTO M;  3MJ5 A;  4GC5 A;  3GPY A;  1TDH A;  2KZU A;  5JJT A;  4J6O A;  3HPZ A;  2XGN A;  1QAQ A;  1GL6 A;  2C99 A;  3T1Y E;  4DUY M;  4Q28 A;  1UM8 A;  2C96 A;  4LFB E;  1G3I A;  4GC9 A;  1NNJ A;  2CHG A;  1J7K A;  4FBK A;  5AE1 A;  3TQS A;  4D82 A;  1HR0 E;  2KRU A;  4M30 A;  1Z2X A;  3U6L A;  2DWL A;  1I94 M;  1TCO A;  5A2Q S;  4QOZ C;  3VYX A;  2Z4S A;  4OX9 M;  4K0K E;  2HYP A;  3HHW A;  2NUG A;  4IL1 A;  2V83 A;  1IBK M;  4MM3 B;  4IBE A;  3AOE C;  2UXB E;  3D8L A;  1HNZ E;  4DMI A;  2JOG A;  4B08 A;  1IXZ A;  3OTO E;  4GIP A;  3HJ8 A;  4MB7 A;  3LLH A;  4PDG A;  4L5N C;  4QHS A;  4KLN A;  3CF6 E;  4V0X A;  3VDU A;  1YZ9 A;  4DUY E;  4O24 A;  3PSO A;  2Y0T A;  3KOW E;  2JOB A;  2KZS A;  3PVS A;  5IWA E;  3SHG B;  2E5L M;  3FIG A;  1ZQ9 A;  1IN8 A;  2Z3X A;  3SAT A;  1I94 E;  1U32 A;  4GKJ M;  3UJN A;  3GVE A;  4DR6 M;  3EIH A;  4OX9 E;  1JR3 D;  1C1K A;  1SXJ D;  3RMP A;  4FW9 A;  4LJ5 A;  4OU7 A;  1N34 M;  1IY2 A;  2IHR 1;  1T70 A;  3HWS A;  4IBK A;  2F5Q A;  3AKZ A;  4LU9 A;  1IN5 A;  5KPR A;  3U6P A;  2F5P A;  3T1I A;  2C9C A;  1Q3C A;  4MGI E;  2DB2 A;  2ODR C;  5ITQ A;  2L33 A;  3SYK A;  1HQY E;  4AZF A;  1USH A;  2XSZ A;  2ZBK B;  2IAE C;  4MOY A;  4PT5 A;  3J80 S;  1V73 A;  4UT2 A;  4X8W A;  4FCW A;  5E6J A;  1KBP A;  2QPA A;  4KO8 A;  2LJH A;  4DV1 M;  2E5L E;  3PFI A;  2L7I A;  3A46 A;  4B3S E;  4M9Z A;  4IBB A;  3TE6 A;  3DFZ A;  4OVZ B;  3TPZ A;  4LZZ A;  1JK7 A;  1IY0 A;  4LF7 M;  1X47 A;  4DV3 M;  4DV4 M;  1E9R A;  7CAT A;  4JI2 M;  3IWC A;  3HU3 A;  4F0Z A;  3IB7 A;  2CPN A;  3TL4 X;  3U6O A;  4YY3 M;  1T4O A;  1L8Q A;  4JN6 A;  4DR3 M;  1N34 E;  4JI0 M;  2DXI A;  1J09 A;  3GRY A;  3RGP A;  2NYL C;  4LJA A;  3U6E A;  1L1T A;  3D03 A;  4IBJ A;  5EJC A;  1JR3 A;  4LFA E;  1SXJ A;  2R4J A;  2L6M A;  2EWL A;  3JTZ A;  3PSN A;  2F4V M;  1JQJ C;  5ITT A;  3U6S A;  4DV1 E;  4LZJ A;  1T4L B;  4LJ8 A;  4HL4 A;  4LCB A;  3VK6 A;  3TWK A;  3V4Y A;  3HKP A;  1O0W A;  4DV3 E;  3DJW A;  3ADJ A;  2FNA A;  5EXS A;  4JI2 E;  2DHR A;  3DSC A;  1YE9 A;  3HTX A;  4DV0 M;  4R7G A;  2Z4R A;  2P6B A;  1N36 M;  5EQV A;  4DR3 E;  2CHQ A;  4M0D A;  3QWL A;  3U60 A;  4ZX2 A;  2FTX B;  4AG6 A;  4YHH E;  5DNY A;  4I8O A;  4LGM A;  5IZ7 D;  1NHW C;  2YR0 A;  3UK6 A;  4BB9 A;  4UWQ A;  2M5Z A;  4FBQ A;  5IT9 C;  4CGY B;  5EP1 A;  2J7O A;  4Z8X A;  4IBC A;  3KWR A;  1DQ3 A;  1G59 A;  2F4V E;  1SR9 A;  2M4I A;  2Q2E B;  1S3L A;  1XXH A;  3L28 A;  3C4B A;  4MGZ E;  1Z5A A;  4JI1 E;  2CUZ A;  2C5R A;  3GPU A;  1QFC A;  2O8A A;  8CAT A;  2BJW A;  1HT2 E;  3K2L A;  2L92 A;  4DV2 M;  1MU5 A;  4WW0 A;  1IN6 A;  4IBD A;  4G6Z A;  1Q39 A;  1OIE A;  4DV0 E;  2XZU A;  2VF1 A;  4D81 A;  2DZO B;  4G4R A;  4OOG C;  2USH A;  4JYA M;  3KBP A;  2HYO A;  3GLG A;  3F6H A;  3FUV A;  2W82 A;  4XGI A;  3ZH9 B;  2RGH A;  4M0W A;  4PCZ A;  2GJU A;  1N32 M;  1K82 A;  4MGY E;  3QFO A;  2RS6 A;  4WPY A;  3SMS A;  1IXR C;  4LG2 A;  4DUZ M;  4LF5 E;  2I7P A;  1HQC A;  3NWL A;  4H2B A;  4BCA A;  5KPZ A;  3H68 A;  1T3T A;  2ZM6 M;  2OPF A;  4RF0 A;  3K6Q A;  2DWZ B;  4NL4 H;  1QHW A;  2RS7 A;  4D80 A;  4G4Q A;  5DYI A;  1YSY A;  3I51 A;  1QAM A;  4DV2 E;  4V0V A;  4GRI A;  3PNY A;  4IBI A;  5FLX S;  2CHV A;  4ITQ A;  1T71 A;  4DV5 M;  2LTS A;  2YVT A;  3F6G A;  1K3W A;  3J27 B;  3LL8 A;  3IVE A;  1HNW E;  4DSY A;  1GL7 A;  3GP1 A;  1WXR A;  1Z5B A;  1M63 A;  3TWM A;  4R03 A;  5ITU A;  2LXE A;  2R62 A;  3UMM A;  1W5T A;  3GLH B;  3U60 B;  1G8P A;  1DGH A;  2RGO A;  1N75 A;  1NY6 A;  3ADI A;  2V1U A;  4FWH A;  4M2Z A;  4I4L A;  1I4W A;  5EXX A;  4G4N A;  4B3T M;  4DUZ E;  2DZN B;  1XMQ M;  3HU2 A;  4FCT A;  2VQF M;  2LNH C;  2R65 A;  4ZVZ A;  3ILK A;  1WXQ A;  2UU9 M;  3SC3 A;  4DR1 M;  1S3N A;  2BJV A;  3C9F A;  3ZC7 B;  3TGH A;  2M1S A;  4JI3 M;  1XXH B;  3FGA C;  5LMN M;  5ITX A;  4M0V A;  3AOG A;  4B3M M;  3P71 C;  3W0F A;  3C58 A;  3P1X A;  3LVW A;  4DV5 E;  4Q7F A;  2L2K B;  3J7A S;  3EGG A;  1EKZ A;  1ORY B;  3J7Y p;  5FTK A;  4NRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...