1V73A

Crystal structure of cold-active protein-tyrosine phosphatase of a psychrophile shewanella sp.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
331
structure length
331
Chain Sequence
TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cold-Active Protein-Tyrosine Phosphatase from a Psychrophile, Shewanella sp
pubmed doi rcsb
source organism Shewanella sp.
molecule tags Hydrolase
molecule keywords psychrophilic phosphatase I
total genus 108
structure length 331
sequence length 331
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1v73A00
2Z72A 3H67A 3AUZA 4J6OA 4I5LC 2KKNA 2ZBMA 1T71A 4Q7FA 3GVEA 4JA7A 4NZVA 1TCOA 4O5GA 5DNYA 4DT2A 2P6BA 3TGHA 4TUGA 5JPEA 3QFKA 3ICFA 4H2FA 5J28A 3C9FA 4O24A 1UF3A 3H68A 4LACC 4IYPC 4I5NC 1Z2WA 1HPUA 2IAEC 2USHA 3K7WC 3DSCA 4LTYA 1OIEA 4YKEA 2AHDA 1SU1A 3AV0A 1JK7A 4V0VA 1II7A 2HYOA 2GJUA 4H1YP 3IVDA 3PSOA 5HPEA 2NYMC 4DSYA 1XZWA 2DFJA 2NXFA 2CV9A 1IT6A 2O8GA 2BDXA 2Z1AA 1S3NA 2WDFA 3P71C 5F3WA 3H64A 1AUIA 1V73A 4V0XA 1QHWA 1XM7A 3RL3A 3DSDA 3E7BA 4ZVZA 1S3LA 3H69A 4HD0A 4IL1A 4ORAA 4UWQA 2BCDA 1HP1A 4TUIA 3LL8A 4ORCA 4FBQA 4UT3A 4H2GA 3IVEA 4MOVA 5EQVA 1S3MA 5JJTA 4H2BA 3ZTVA 3K7VC 2XMOA 1HO5A 4F0ZA 3RQZA 1T70A 3H63A 4KKZA 3T1IA 1S70A 3N5UA 3QFOA 4MOYA 4MP0A 3IB8A 3QG5C 3V4YA 2HY1A 4OR9A 2Z06A 3H62B 3JYFA 3DW8C 2JOGA 3KBPA 4B2OA 1WAO1 3EGHA 4H2IA 1QFCA 4UT2A 4V0WA 1S8EA 2A22A 2QJCA 5INBA 2NYLC 1USHA 5B8IA 2QFRA 1WARA 3CK2A 1Z2XA 4O4KA 1OI8A 4FBWA 3RL5A 2IE4C 4FBKA 1U32A 4KBPA 2WDDA 3EGGA 3H60A 4XPNA 5C1VA 5JPFA 3C5WC 3PSNA 2BQ8X 2HYPA 4FCXA 3HVQA 3H61A 3H66A 3THOB 2R17A 1KBPA 4JA9A 2WDEA 4G9JA 4DHLA 4O43A 1M63A 3FGAC 3QFNA 5IOHA 4M0VA 1NNWA 2O8AA 1OIDA 4ORBA 3E7AA 3THNA 3QFMA 4LU9A 4WWLA 2IE3C 3ZU0A 3RL4A 4H1SA 4ZX2A 1S95A 5GTUA 1FJMA 1G5BA 2NPPC 2QFPA 1W24A 4UT3B 3IB7A 2Q8UA 1MF8A 2YVTA 1UTEA 2WDCA
chains in the Genus database with same CATH superfamily
2Z72A 3H67A 3AUZA 4J6OA 4I5LC 2KKNA 2ZBMA 1T71A 4Q7FA 3GVEA 4JA7A 4NZVA 1TCOA 4O5GA 5DNYA 4DT2A 2P6BA 3TGHA 4TUGA 5JPEA 3QFKA 3ICFA 4H2FA 5J28A 3FLOA 3C9FA 4O24A 1UF3A 3H68A 4LACC 4IYPC 4I5NC 1Z2WA 1HPUA 2IAEC 2USHA 3K7WC 3DSCA 4LTYA 1OIEA 4YKEA 2AHDA 1SU1A 3AV0A 1JK7A 4V0VA 1II7A 2HYOA 2GJUA 4H1YP 3IVDA 3PSOA 5HPEA 2NYMC 4DSYA 1XZWA 2DFJA 2NXFA 2CV9A 1IT6A 2O8GA 2BDXA 2Z1AA 2ZOAA 1S3NA 2WDFA 3P71C 5F3WA 3H64A 1AUIA 1V73A 4V0XA 1QHWA 1XM7A 3RL3A 3DSDA 3E7BA 4ZVZA 2DXNA 1S3LA 3H69A 4HD0A 4IL1A 4ORAA 4UWQA 2BCDA 1HP1A 4TUIA 3LL8A 4ORCA 2DXLA 4FBQA 4H2GA 3IVEA 4MOVA 5EQVA 1S3MA 4UT3A 5JJTA 4H2BA 3ZTVA 3K7VC 2XMOA 1HO5A 4F0ZA 3RQZA 1T70A 3H63A 4KKZA 3T1IA 1S70A 3N5UA 3QFOA 4MOYA 4MP0A 3IB8A 3QG5C 3V4YA 2HY1A 4OR9A 2Z06A 3H62B 3JYFA 3DW8C 2JOGA 3D03A 3KBPA 4B2OA 1WAO1 3EGHA 4H2IA 1QFCA 4UT2A 4V0WA 1S8EA 2A22A 2QJCA 5INBA 2NYLC 1USHA 5B8IA 2QFRA 1WARA 3CK2A 1Z2XA 4O4KA 1OI8A 4FBWA 3RL5A 2IE4C 4FBKA 1U32A 3E0JA 2WDDA 3EGGA 3H60A 4KBPA 4XPNA 5C1VA 5JPFA 3C5WC 3PSNA 2BQ8X 2HYPA 4FCXA 3HVQA 3H61A 3H66A 3THOB 2R17A 1KBPA 4JA9A 2WDEA 4G9JA 4DHLA 4O43A 1M63A 3FGAC 3QFNA 5IOHA 4M0VA 1NNWA 2O8AA 2ZO9B 1OIDA 4ORBA 3E7AA 3THNA 3QFMA 4LU9A 4WWLA 2IE3C 3ZU0A 3RL4A 4H1SA 4ZX2A 1S95A 5GTUA 1FJMA 2YEQA 1G5BA 2NPPC 2QFPA 1W24A 4UT3B 3IB7A 2Q8UA 1MF8A 2YVTA 1UTEA 2WDCA
chains in the Genus database with same CATH topology
2Z72A 3H67A 3AUZA 4J6OA 4I5LC 2KKNA 2ZBMA 1T71A 4Q7FA 3GVEA 4JA7A 4NZVA 1TCOA 4O5GA 5DNYA 4DT2A 2P6BA 3TGHA 4TUGA 5JPEA 3QFKA 3ICFA 4H2FA 5J28A 3FLOA 3C9FA 4O24A 1UF3A 3H68A 4LACC 4IYPC 4I5NC 1Z2WA 1HPUA 2IAEC 2USHA 3K7WC 3DSCA 4LTYA 1OIEA 4YKEA 2AHDA 1SU1A 3AV0A 1JK7A 4V0VA 1II7A 2HYOA 2GJUA 4H1YP 3IVDA 3PSOA 5HPEA 2NYMC 4DSYA 1XZWA 2DFJA 2NXFA 2CV9A 1IT6A 2O8GA 2BDXA 2Z1AA 2ZOAA 1S3NA 2WDFA 3P71C 5F3WA 3H64A 1AUIA 1V73A 4V0XA 1QHWA 1XM7A 3RL3A 3DSDA 3E7BA 4ZVZA 2DXNA 1S3LA 3H69A 4HD0A 4IL1A 4ORAA 4UWQA 2BCDA 1HP1A 4TUIA 3LL8A 4ORCA 2DXLA 4FBQA 4H2GA 3IVEA 4MOVA 5EQVA 1S3MA 4UT3A 5JJTA 4H2BA 3ZTVA 3K7VC 2XMOA 1HO5A 4F0ZA 3RQZA 1T70A 3H63A 4KKZA 3T1IA 1S70A 3N5UA 3QFOA 4MOYA 4MP0A 3IB8A 3QG5C 3V4YA 2HY1A 4OR9A 2Z06A 3H62B 3JYFA 3DW8C 2JOGA 3D03A 3KBPA 4B2OA 1WAO1 3EGHA 4H2IA 1QFCA 4UT2A 4V0WA 1S8EA 2A22A 2QJCA 5INBA 2NYLC 1USHA 5B8IA 2QFRA 1WARA 3CK2A 1Z2XA 4O4KA 1OI8A 4FBWA 3RL5A 2IE4C 4FBKA 1U32A 3E0JA 2WDDA 3EGGA 3H60A 4KBPA 4XPNA 5C1VA 5JPFA 3C5WC 3PSNA 2BQ8X 2HYPA 4FCXA 3HVQA 3H61A 3H66A 3THOB 2R17A 1KBPA 4JA9A 2WDEA 4G9JA 4DHLA 4O43A 1M63A 3FGAC 3QFNA 5IOHA 4M0VA 1NNWA 2O8AA 2ZO9B 1OIDA 4ORBA 3E7AA 3THNA 3QFMA 4LU9A 4WWLA 2IE3C 3ZU0A 3RL4A 4H1SA 4ZX2A 1S95A 5GTUA 1FJMA 2YEQA 1G5BA 2NPPC 2QFPA 1W24A 4UT3B 3IB7A 2Q8UA 1MF8A 2YVTA 1UTEA 2WDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z72 A;  3H67 A;  3AUZ A;  4J6O A;  4I5L C;  2KKN A;  2ZBM A;  1T71 A;  4Q7F A;  3GVE A;  4JA7 A;  4NZV A;  1TCO A;  4O5G A;  5DNY A;  4DT2 A;  2P6B A;  3TGH A;  4TUG A;  5JPE A;  3QFK A;  3ICF A;  4H2F A;  5J28 A;  3C9F A;  4O24 A;  1UF3 A;  3H68 A;  4LAC C;  4IYP C;  4I5N C;  1Z2W A;  1HPU A;  2IAE C;  2USH A;  3K7W C;  3DSC A;  4LTY A;  1OIE A;  4YKE A;  2AHD A;  1SU1 A;  3AV0 A;  1JK7 A;  4V0V A;  1II7 A;  2HYO A;  2GJU A;  4H1Y P;  3IVD A;  3PSO A;  5HPE A;  2NYM C;  4DSY A;  1XZW A;  2DFJ A;  2NXF A;  2CV9 A;  1IT6 A;  2O8G A;  2BDX A;  2Z1A A;  1S3N A;  2WDF A;  3P71 C;  5F3W A;  3H64 A;  1AUI A;  1V73 A;  4V0X A;  1QHW A;  1XM7 A;  3RL3 A;  3DSD A;  3E7B A;  4ZVZ A;  1S3L A;  3H69 A;  4HD0 A;  4IL1 A;  4ORA A;  4UWQ A;  2BCD A;  1HP1 A;  4TUI A;  3LL8 A;  4ORC A;  4FBQ A;  4UT3 A;  4H2G A;  3IVE A;  4MOV A;  5EQV A;  1S3M A;  5JJT A;  4H2B A;  3ZTV A;  3K7V C;  2XMO A;  1HO5 A;  4F0Z A;  3RQZ A;  1T70 A;  3H63 A;  4KKZ A;  3T1I A;  1S70 A;  3N5U A;  3QFO A;  4MOY A;  4MP0 A;  3IB8 A;  3QG5 C;  3V4Y A;  2HY1 A;  4OR9 A;  2Z06 A;  3H62 B;  3JYF A;  3DW8 C;  2JOG A;  3KBP A;  4B2O A;  1WAO 1;  3EGH A;  4H2I A;  1QFC A;  4UT2 A;  4V0W A;  1S8E A;  2A22 A;  2QJC A;  5INB A;  2NYL C;  1USH A;  5B8I A;  2QFR A;  1WAR A;  3CK2 A;  1Z2X A;  4O4K A;  1OI8 A;  4FBW A;  3RL5 A;  2IE4 C;  4FBK A;  1U32 A;  4KBP A;  2WDD A;  3EGG A;  3H60 A;  4XPN A;  5C1V A;  5JPF A;  3C5W C;  3PSN A;  2BQ8 X;  2HYP A;  4FCX A;  3HVQ A;  3H61 A;  3H66 A;  3THO B;  2R17 A;  1KBP A;  4JA9 A;  2WDE A;  4G9J A;  4DHL A;  4O43 A;  1M63 A;  3FGA C;  3QFN A;  5IOH A;  4M0V A;  1NNW A;  2O8A A;  1OID A;  4ORB A;  3E7A A;  3THN A;  3QFM A;  4LU9 A;  4WWL A;  2IE3 C;  3ZU0 A;  3RL4 A;  4H1S A;  4ZX2 A;  1S95 A;  5GTU A;  1FJM A;  1G5B A;  2NPP C;  2QFP A;  1W24 A;  4UT3 B;  3IB7 A;  2Q8U A;  1MF8 A;  2YVT A;  1UTE A;  2WDC A; 
#chains in the Genus database with same CATH topology
 2Z72 A;  3H67 A;  3AUZ A;  4J6O A;  4I5L C;  2KKN A;  2ZBM A;  1T71 A;  4Q7F A;  3GVE A;  4JA7 A;  4NZV A;  1TCO A;  4O5G A;  5DNY A;  4DT2 A;  2P6B A;  3TGH A;  4TUG A;  5JPE A;  3QFK A;  3ICF A;  4H2F A;  5J28 A;  3FLO A;  3C9F A;  4O24 A;  1UF3 A;  3H68 A;  4LAC C;  4IYP C;  4I5N C;  1Z2W A;  1HPU A;  2IAE C;  2USH A;  3K7W C;  3DSC A;  4LTY A;  1OIE A;  4YKE A;  2AHD A;  1SU1 A;  3AV0 A;  1JK7 A;  4V0V A;  1II7 A;  2HYO A;  2GJU A;  4H1Y P;  3IVD A;  3PSO A;  5HPE A;  2NYM C;  4DSY A;  1XZW A;  2DFJ A;  2NXF A;  2CV9 A;  1IT6 A;  2O8G A;  2BDX A;  2Z1A A;  2ZOA A;  1S3N A;  2WDF A;  3P71 C;  5F3W A;  3H64 A;  1AUI A;  1V73 A;  4V0X A;  1QHW A;  1XM7 A;  3RL3 A;  3DSD A;  3E7B A;  4ZVZ A;  2DXN A;  1S3L A;  3H69 A;  4HD0 A;  4IL1 A;  4ORA A;  4UWQ A;  2BCD A;  1HP1 A;  4TUI A;  3LL8 A;  4ORC A;  2DXL A;  4FBQ A;  4H2G A;  3IVE A;  4MOV A;  5EQV A;  1S3M A;  4UT3 A;  5JJT A;  4H2B A;  3ZTV A;  3K7V C;  2XMO A;  1HO5 A;  4F0Z A;  3RQZ A;  1T70 A;  3H63 A;  4KKZ A;  3T1I A;  1S70 A;  3N5U A;  3QFO A;  4MOY A;  4MP0 A;  3IB8 A;  3QG5 C;  3V4Y A;  2HY1 A;  4OR9 A;  2Z06 A;  3H62 B;  3JYF A;  3DW8 C;  2JOG A;  3D03 A;  3KBP A;  4B2O A;  1WAO 1;  3EGH A;  4H2I A;  1QFC A;  4UT2 A;  4V0W A;  1S8E A;  2A22 A;  2QJC A;  5INB A;  2NYL C;  1USH A;  5B8I A;  2QFR A;  1WAR A;  3CK2 A;  1Z2X A;  4O4K A;  1OI8 A;  4FBW A;  3RL5 A;  2IE4 C;  4FBK A;  1U32 A;  3E0J A;  2WDD A;  3EGG A;  3H60 A;  4KBP A;  4XPN A;  5C1V A;  5JPF A;  3C5W C;  3PSN A;  2BQ8 X;  2HYP A;  4FCX A;  3HVQ A;  3H61 A;  3H66 A;  3THO B;  2R17 A;  1KBP A;  4JA9 A;  2WDE A;  4G9J A;  4DHL A;  4O43 A;  1M63 A;  3FGA C;  3QFN A;  5IOH A;  4M0V A;  1NNW A;  2O8A A;  2ZO9 B;  1OID A;  4ORB A;  3E7A A;  3THN A;  3QFM A;  4LU9 A;  4WWL A;  2IE3 C;  3ZU0 A;  3RL4 A;  4H1S A;  4ZX2 A;  1S95 A;  5GTU A;  1FJM A;  2YEQ A;  1G5B A;  2NPP C;  2QFP A;  1W24 A;  4UT3 B;  3IB7 A;  2Q8U A;  1MF8 A;  2YVT A;  1UTE A;  2WDC A; 
#chains in the Genus database with same CATH homology
 2Z72 A;  3H67 A;  3AUZ A;  4J6O A;  4I5L C;  2KKN A;  2ZBM A;  1T71 A;  4Q7F A;  3GVE A;  4JA7 A;  4NZV A;  1TCO A;  4O5G A;  5DNY A;  4DT2 A;  2P6B A;  3TGH A;  4TUG A;  5JPE A;  3QFK A;  3ICF A;  4H2F A;  5J28 A;  3FLO A;  3C9F A;  4O24 A;  1UF3 A;  3H68 A;  4LAC C;  4IYP C;  4I5N C;  1Z2W A;  1HPU A;  2IAE C;  2USH A;  3K7W C;  3DSC A;  4LTY A;  1OIE A;  4YKE A;  2AHD A;  1SU1 A;  3AV0 A;  1JK7 A;  4V0V A;  1II7 A;  2HYO A;  2GJU A;  4H1Y P;  3IVD A;  3PSO A;  5HPE A;  2NYM C;  4DSY A;  1XZW A;  2DFJ A;  2NXF A;  2CV9 A;  1IT6 A;  2O8G A;  2BDX A;  2Z1A A;  2ZOA A;  1S3N A;  2WDF A;  3P71 C;  5F3W A;  3H64 A;  1AUI A;  1V73 A;  4V0X A;  1QHW A;  1XM7 A;  3RL3 A;  3DSD A;  3E7B A;  4ZVZ A;  2DXN A;  1S3L A;  3H69 A;  4HD0 A;  4IL1 A;  4ORA A;  4UWQ A;  2BCD A;  1HP1 A;  4TUI A;  3LL8 A;  4ORC A;  2DXL A;  4FBQ A;  4H2G A;  3IVE A;  4MOV A;  5EQV A;  1S3M A;  4UT3 A;  5JJT A;  4H2B A;  3ZTV A;  3K7V C;  2XMO A;  1HO5 A;  4F0Z A;  3RQZ A;  1T70 A;  3H63 A;  4KKZ A;  3T1I A;  1S70 A;  3N5U A;  3QFO A;  4MOY A;  4MP0 A;  3IB8 A;  3QG5 C;  3V4Y A;  2HY1 A;  4OR9 A;  2Z06 A;  3H62 B;  3JYF A;  3DW8 C;  2JOG A;  3D03 A;  3KBP A;  4B2O A;  1WAO 1;  3EGH A;  4H2I A;  1QFC A;  4UT2 A;  4V0W A;  1S8E A;  2A22 A;  2QJC A;  5INB A;  2NYL C;  1USH A;  5B8I A;  2QFR A;  1WAR A;  3CK2 A;  1Z2X A;  4O4K A;  1OI8 A;  4FBW A;  3RL5 A;  2IE4 C;  4FBK A;  1U32 A;  3E0J A;  2WDD A;  3EGG A;  3H60 A;  4KBP A;  4XPN A;  5C1V A;  5JPF A;  3C5W C;  3PSN A;  2BQ8 X;  2HYP A;  4FCX A;  3HVQ A;  3H61 A;  3H66 A;  3THO B;  2R17 A;  1KBP A;  4JA9 A;  2WDE A;  4G9J A;  4DHL A;  4O43 A;  1M63 A;  3FGA C;  3QFN A;  5IOH A;  4M0V A;  1NNW A;  2O8A A;  2ZO9 B;  1OID A;  4ORB A;  3E7A A;  3THN A;  3QFM A;  4LU9 A;  4WWL A;  2IE3 C;  3ZU0 A;  3RL4 A;  4H1S A;  4ZX2 A;  1S95 A;  5GTU A;  1FJM A;  2YEQ A;  1G5B A;  2NPP C;  2QFP A;  1W24 A;  4UT3 B;  3IB7 A;  2Q8U A;  1MF8 A;  2YVT A;  1UTE A;  2WDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...