1V73A

Crystal structure of cold-active protein-tyrosine phosphatase of a psychrophile shewanella sp.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
331
structure length
331
Chain Sequence
TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cold-Active Protein-Tyrosine Phosphatase from a Psychrophile, Shewanella sp
pubmed doi rcsb
source organism Shewanella sp.
molecule tags Hydrolase
molecule keywords psychrophilic phosphatase I
total genus 108
structure length 331
sequence length 331
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1v73A00
1XM7A 1S3LA 3QFMA 4FBQA 3C9FA 3RQZA 4IL1A 1FJMA 4V0XA 2WDDA 3ICFA 3K7WC 3RL5A 1S8EA 3DSCA 1T71A 3H68A 3T1IA 3IVEA 4LACC 3IB8A 4IYPC 3V4YA 3HVQA 1UTEA 1WAO1 2QFPA 4DHLA 2HYOA 2Z06A 3DSDA 1QFCA 3KBPA 3QFOA 2BDXA 3JYFA 3H61A 3AUZA 3IVDA 4ORAA 5INBA 1HO5A 1NNWA 3RL3A 2O8AA 1S3NA 1QHWA 2JOGA 4HD0A 1V73A 2GJUA 5EQVA 4MOYA 2AHDA 2Q8UA 1G5BA 2ZBMA 3H63A 2Z1AA 2Z72A 2KKNA 5HPEA 4JA9A 3THNA 1SU1A 3THOB 4H2IA 4V0VA 2USHA 4MP0A 2O8GA 3ZU0A 4XPNA 1S3MA 2IE3C 4O4KA 5F3WA 2IAEC 3EGGA 4DT2A 4FBKA 4H1YP 3H66A 3H64A 3RL4A 1II7A 2WDCA 4LTYA 4TUIA 1HP1A 3E7AA 4G9JA 1MF8A 3P71C 2NXFA 4TUGA 3H62B 3H69A 5B8IA 2QJCA 1HPUA 5IOHA 4WWLA 3ZTVA 1U32A 3QFKA 4ZX2A 3TGHA 5JPEA 4NZVA 1OI8A 4UWQA 1W24A 4H2FA 4M0VA 4KKZA 4F0ZA 4MOVA 1XZWA 4UT2A 2BQ8X 3C5WC 1Z2WA 5C1VA 2NYMC 5GTUA 4UT3A 4UT3B 5JJTA 3E7BA 2NPPC 4LU9A 3FGAC 1OIEA 3QG5C 2CV9A 4KBPA 3DW8C 1USHA 4B2OA 3N5UA 2HY1A 2HYPA 4I5LC 1JK7A 1S70A 4H2BA 1WARA 4O5GA 4V0WA 4YKEA 1M63A 3QFNA 1T70A 3IB7A 4OR9A 4DSYA 2IE4C 1OIDA 3K7VC 4FBWA 1Z2XA 4FCXA 4I5NC 3H67A 5J28A 3LL8A 4ZVZA 2WDFA 1UF3A 4J6OA 4H1SA 2YVTA 3PSNA 4Q7FA 2NYLC 4O43A 2QFRA 3CK2A 3H60A 4JA7A 1IT6A 4O24A 1TCOA 2DFJA 3EGHA 5JPFA 1S95A 2BCDA 2XMOA 1KBPA 2WDEA 2P6BA 1AUIA 3AV0A 2A22A 3PSOA 4ORCA 4H2GA 4ORBA 3GVEA 5DNYA 2R17A
chains in the Genus database with same CATH superfamily
1XM7A 1S3LA 3QFMA 4FBQA 3C9FA 3RQZA 4IL1A 1FJMA 4V0XA 2WDDA 3ICFA 3K7WC 3RL5A 1S8EA 3DSCA 1T71A 3H68A 3T1IA 3IVEA 4LACC 3IB8A 4IYPC 3V4YA 3HVQA 1UTEA 1WAO1 2QFPA 4DHLA 2HYOA 2Z06A 3DSDA 1QFCA 3KBPA 3QFOA 2BDXA 3JYFA 3H61A 3AUZA 3IVDA 4ORAA 5INBA 1HO5A 1NNWA 3RL3A 2O8AA 1S3NA 1QHWA 2JOGA 4HD0A 1V73A 2GJUA 2ZO9B 5EQVA 4MOYA 2AHDA 2Q8UA 1G5BA 2ZBMA 3H63A 2Z1AA 2Z72A 2KKNA 5HPEA 4JA9A 3THNA 1SU1A 3THOB 4H2IA 4V0VA 2USHA 4MP0A 2O8GA 3ZU0A 4XPNA 1S3MA 2IE3C 4O4KA 5F3WA 2IAEC 3EGGA 4DT2A 4FBKA 4H1YP 3H66A 3H64A 3RL4A 1II7A 2WDCA 2YEQA 4LTYA 4TUIA 1HP1A 3E7AA 4G9JA 1MF8A 3P71C 2NXFA 4TUGA 3H62B 3H69A 5B8IA 2QJCA 1HPUA 5IOHA 4WWLA 3ZTVA 1U32A 3QFKA 4ZX2A 3TGHA 5JPEA 4NZVA 1OI8A 4UWQA 1W24A 4H2FA 4M0VA 4KKZA 4F0ZA 4MOVA 1XZWA 4UT2A 2BQ8X 3C5WC 1Z2WA 5C1VA 2NYMC 2DXNA 5GTUA 4UT3A 4UT3B 5JJTA 3E7BA 2NPPC 4LU9A 3FGAC 1OIEA 3E0JA 3QG5C 2CV9A 4KBPA 1USHA 3DW8C 4B2OA 3N5UA 2HY1A 2HYPA 4I5LC 1JK7A 2ZOAA 1S70A 4H2BA 1WARA 4O5GA 4V0WA 4YKEA 1M63A 3QFNA 1T70A 3IB7A 4OR9A 4DSYA 2DXLA 2IE4C 1OIDA 3K7VC 4FBWA 1Z2XA 4FCXA 4I5NC 3H67A 5J28A 3LL8A 4ZVZA 2WDFA 1UF3A 4J6OA 4H1SA 2YVTA 3PSNA 4Q7FA 2NYLC 4O43A 2QFRA 3CK2A 3H60A 4JA7A 1IT6A 4O24A 1TCOA 3FLOA 2DFJA 3EGHA 5JPFA 1S95A 2BCDA 2XMOA 1KBPA 2WDEA 2P6BA 1AUIA 3AV0A 2A22A 3PSOA 3D03A 4ORCA 4H2GA 4ORBA 3GVEA 5DNYA 2R17A
chains in the Genus database with same CATH topology
1XM7A 1S3LA 3QFMA 4FBQA 3C9FA 3RQZA 4IL1A 1FJMA 4V0XA 2WDDA 3ICFA 3K7WC 3RL5A 1S8EA 3DSCA 1T71A 3H68A 3T1IA 3IVEA 4LACC 3IB8A 4IYPC 3V4YA 3HVQA 1UTEA 1WAO1 2QFPA 4DHLA 2HYOA 2Z06A 3DSDA 1QFCA 3KBPA 3QFOA 2BDXA 3JYFA 3H61A 3AUZA 3IVDA 4ORAA 5INBA 1HO5A 1NNWA 3RL3A 2O8AA 1S3NA 1QHWA 2JOGA 4HD0A 1V73A 2GJUA 2ZO9B 5EQVA 4MOYA 2AHDA 2Q8UA 1G5BA 2ZBMA 3H63A 2Z1AA 2Z72A 2KKNA 5HPEA 4JA9A 3THNA 1SU1A 3THOB 4H2IA 4V0VA 2USHA 4MP0A 2O8GA 3ZU0A 4XPNA 1S3MA 2IE3C 4O4KA 5F3WA 2IAEC 3EGGA 4DT2A 4FBKA 4H1YP 3H66A 3H64A 3RL4A 1II7A 2WDCA 2YEQA 4LTYA 4TUIA 1HP1A 3E7AA 4G9JA 1MF8A 3P71C 2NXFA 4TUGA 3H62B 3H69A 5B8IA 2QJCA 1HPUA 5IOHA 4WWLA 3ZTVA 1U32A 3QFKA 4ZX2A 3TGHA 5JPEA 4NZVA 1OI8A 4UWQA 1W24A 4H2FA 4M0VA 4KKZA 4F0ZA 4MOVA 1XZWA 4UT2A 2BQ8X 3C5WC 1Z2WA 5C1VA 2NYMC 2DXNA 5GTUA 4UT3A 4UT3B 5JJTA 3E7BA 2NPPC 4LU9A 3FGAC 1OIEA 3E0JA 3QG5C 2CV9A 4KBPA 1USHA 3DW8C 4B2OA 3N5UA 2HY1A 2HYPA 4I5LC 1JK7A 2ZOAA 1S70A 4H2BA 1WARA 4O5GA 4V0WA 4YKEA 1M63A 3QFNA 1T70A 3IB7A 4OR9A 4DSYA 2DXLA 2IE4C 1OIDA 3K7VC 4FBWA 1Z2XA 4FCXA 4I5NC 3H67A 5J28A 3LL8A 4ZVZA 2WDFA 1UF3A 4J6OA 4H1SA 2YVTA 3PSNA 4Q7FA 2NYLC 4O43A 2QFRA 3CK2A 3H60A 4JA7A 1IT6A 4O24A 1TCOA 3FLOA 2DFJA 3EGHA 5JPFA 1S95A 2BCDA 2XMOA 1KBPA 2WDEA 2P6BA 1AUIA 3AV0A 2A22A 3PSOA 3D03A 4ORCA 4H2GA 4ORBA 3GVEA 5DNYA 2R17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XM7 A;  1S3L A;  3QFM A;  4FBQ A;  3C9F A;  3RQZ A;  4IL1 A;  1FJM A;  4V0X A;  2WDD A;  3ICF A;  3K7W C;  3RL5 A;  1S8E A;  3DSC A;  1T71 A;  3H68 A;  3T1I A;  3IVE A;  4LAC C;  3IB8 A;  4IYP C;  3V4Y A;  3HVQ A;  1UTE A;  1WAO 1;  2QFP A;  4DHL A;  2HYO A;  2Z06 A;  3DSD A;  1QFC A;  3KBP A;  3QFO A;  2BDX A;  3JYF A;  3H61 A;  3AUZ A;  3IVD A;  4ORA A;  5INB A;  1HO5 A;  1NNW A;  3RL3 A;  2O8A A;  1S3N A;  1QHW A;  2JOG A;  4HD0 A;  1V73 A;  2GJU A;  5EQV A;  4MOY A;  2AHD A;  2Q8U A;  1G5B A;  2ZBM A;  3H63 A;  2Z1A A;  2Z72 A;  2KKN A;  5HPE A;  4JA9 A;  3THN A;  1SU1 A;  3THO B;  4H2I A;  4V0V A;  2USH A;  4MP0 A;  2O8G A;  3ZU0 A;  4XPN A;  1S3M A;  2IE3 C;  4O4K A;  5F3W A;  2IAE C;  3EGG A;  4DT2 A;  4FBK A;  4H1Y P;  3H66 A;  3H64 A;  3RL4 A;  1II7 A;  2WDC A;  4LTY A;  4TUI A;  1HP1 A;  3E7A A;  4G9J A;  1MF8 A;  3P71 C;  2NXF A;  4TUG A;  3H62 B;  3H69 A;  5B8I A;  2QJC A;  1HPU A;  5IOH A;  4WWL A;  3ZTV A;  1U32 A;  3QFK A;  4ZX2 A;  3TGH A;  5JPE A;  4NZV A;  1OI8 A;  4UWQ A;  1W24 A;  4H2F A;  4M0V A;  4KKZ A;  4F0Z A;  4MOV A;  1XZW A;  4UT2 A;  2BQ8 X;  3C5W C;  1Z2W A;  5C1V A;  2NYM C;  5GTU A;  4UT3 A;  4UT3 B;  5JJT A;  3E7B A;  2NPP C;  4LU9 A;  3FGA C;  1OIE A;  3QG5 C;  2CV9 A;  4KBP A;  3DW8 C;  1USH A;  4B2O A;  3N5U A;  2HY1 A;  2HYP A;  4I5L C;  1JK7 A;  1S70 A;  4H2B A;  1WAR A;  4O5G A;  4V0W A;  4YKE A;  1M63 A;  3QFN A;  1T70 A;  3IB7 A;  4OR9 A;  4DSY A;  2IE4 C;  1OID A;  3K7V C;  4FBW A;  1Z2X A;  4FCX A;  4I5N C;  3H67 A;  5J28 A;  3LL8 A;  4ZVZ A;  2WDF A;  1UF3 A;  4J6O A;  4H1S A;  2YVT A;  3PSN A;  4Q7F A;  2NYL C;  4O43 A;  2QFR A;  3CK2 A;  3H60 A;  4JA7 A;  1IT6 A;  4O24 A;  1TCO A;  2DFJ A;  3EGH A;  5JPF A;  1S95 A;  2BCD A;  2XMO A;  1KBP A;  2WDE A;  2P6B A;  1AUI A;  3AV0 A;  2A22 A;  3PSO A;  4ORC A;  4H2G A;  4ORB A;  3GVE A;  5DNY A;  2R17 A; 
#chains in the Genus database with same CATH topology
 1XM7 A;  1S3L A;  3QFM A;  4FBQ A;  3C9F A;  3RQZ A;  4IL1 A;  1FJM A;  4V0X A;  2WDD A;  3ICF A;  3K7W C;  3RL5 A;  1S8E A;  3DSC A;  1T71 A;  3H68 A;  3T1I A;  3IVE A;  4LAC C;  3IB8 A;  4IYP C;  3V4Y A;  3HVQ A;  1UTE A;  1WAO 1;  2QFP A;  4DHL A;  2HYO A;  2Z06 A;  3DSD A;  1QFC A;  3KBP A;  3QFO A;  2BDX A;  3JYF A;  3H61 A;  3AUZ A;  3IVD A;  4ORA A;  5INB A;  1HO5 A;  1NNW A;  3RL3 A;  2O8A A;  1S3N A;  1QHW A;  2JOG A;  4HD0 A;  1V73 A;  2GJU A;  2ZO9 B;  5EQV A;  4MOY A;  2AHD A;  2Q8U A;  1G5B A;  2ZBM A;  3H63 A;  2Z1A A;  2Z72 A;  2KKN A;  5HPE A;  4JA9 A;  3THN A;  1SU1 A;  3THO B;  4H2I A;  4V0V A;  2USH A;  4MP0 A;  2O8G A;  3ZU0 A;  4XPN A;  1S3M A;  2IE3 C;  4O4K A;  5F3W A;  2IAE C;  3EGG A;  4DT2 A;  4FBK A;  4H1Y P;  3H66 A;  3H64 A;  3RL4 A;  1II7 A;  2WDC A;  2YEQ A;  4LTY A;  4TUI A;  1HP1 A;  3E7A A;  4G9J A;  1MF8 A;  3P71 C;  2NXF A;  4TUG A;  3H62 B;  3H69 A;  5B8I A;  2QJC A;  1HPU A;  5IOH A;  4WWL A;  3ZTV A;  1U32 A;  3QFK A;  4ZX2 A;  3TGH A;  5JPE A;  4NZV A;  1OI8 A;  4UWQ A;  1W24 A;  4H2F A;  4M0V A;  4KKZ A;  4F0Z A;  4MOV A;  1XZW A;  4UT2 A;  2BQ8 X;  3C5W C;  1Z2W A;  5C1V A;  2NYM C;  2DXN A;  5GTU A;  4UT3 A;  4UT3 B;  5JJT A;  3E7B A;  2NPP C;  4LU9 A;  3FGA C;  1OIE A;  3E0J A;  3QG5 C;  2CV9 A;  4KBP A;  1USH A;  3DW8 C;  4B2O A;  3N5U A;  2HY1 A;  2HYP A;  4I5L C;  1JK7 A;  2ZOA A;  1S70 A;  4H2B A;  1WAR A;  4O5G A;  4V0W A;  4YKE A;  1M63 A;  3QFN A;  1T70 A;  3IB7 A;  4OR9 A;  4DSY A;  2DXL A;  2IE4 C;  1OID A;  3K7V C;  4FBW A;  1Z2X A;  4FCX A;  4I5N C;  3H67 A;  5J28 A;  3LL8 A;  4ZVZ A;  2WDF A;  1UF3 A;  4J6O A;  4H1S A;  2YVT A;  3PSN A;  4Q7F A;  2NYL C;  4O43 A;  2QFR A;  3CK2 A;  3H60 A;  4JA7 A;  1IT6 A;  4O24 A;  1TCO A;  3FLO A;  2DFJ A;  3EGH A;  5JPF A;  1S95 A;  2BCD A;  2XMO A;  1KBP A;  2WDE A;  2P6B A;  1AUI A;  3AV0 A;  2A22 A;  3PSO A;  3D03 A;  4ORC A;  4H2G A;  4ORB A;  3GVE A;  5DNY A;  2R17 A; 
#chains in the Genus database with same CATH homology
 1XM7 A;  1S3L A;  3QFM A;  4FBQ A;  3C9F A;  3RQZ A;  4IL1 A;  1FJM A;  4V0X A;  2WDD A;  3ICF A;  3K7W C;  3RL5 A;  1S8E A;  3DSC A;  1T71 A;  3H68 A;  3T1I A;  3IVE A;  4LAC C;  3IB8 A;  4IYP C;  3V4Y A;  3HVQ A;  1UTE A;  1WAO 1;  2QFP A;  4DHL A;  2HYO A;  2Z06 A;  3DSD A;  1QFC A;  3KBP A;  3QFO A;  2BDX A;  3JYF A;  3H61 A;  3AUZ A;  3IVD A;  4ORA A;  5INB A;  1HO5 A;  1NNW A;  3RL3 A;  2O8A A;  1S3N A;  1QHW A;  2JOG A;  4HD0 A;  1V73 A;  2GJU A;  2ZO9 B;  5EQV A;  4MOY A;  2AHD A;  2Q8U A;  1G5B A;  2ZBM A;  3H63 A;  2Z1A A;  2Z72 A;  2KKN A;  5HPE A;  4JA9 A;  3THN A;  1SU1 A;  3THO B;  4H2I A;  4V0V A;  2USH A;  4MP0 A;  2O8G A;  3ZU0 A;  4XPN A;  1S3M A;  2IE3 C;  4O4K A;  5F3W A;  2IAE C;  3EGG A;  4DT2 A;  4FBK A;  4H1Y P;  3H66 A;  3H64 A;  3RL4 A;  1II7 A;  2WDC A;  2YEQ A;  4LTY A;  4TUI A;  1HP1 A;  3E7A A;  4G9J A;  1MF8 A;  3P71 C;  2NXF A;  4TUG A;  3H62 B;  3H69 A;  5B8I A;  2QJC A;  1HPU A;  5IOH A;  4WWL A;  3ZTV A;  1U32 A;  3QFK A;  4ZX2 A;  3TGH A;  5JPE A;  4NZV A;  1OI8 A;  4UWQ A;  1W24 A;  4H2F A;  4M0V A;  4KKZ A;  4F0Z A;  4MOV A;  1XZW A;  4UT2 A;  2BQ8 X;  3C5W C;  1Z2W A;  5C1V A;  2NYM C;  2DXN A;  5GTU A;  4UT3 A;  4UT3 B;  5JJT A;  3E7B A;  2NPP C;  4LU9 A;  3FGA C;  1OIE A;  3E0J A;  3QG5 C;  2CV9 A;  4KBP A;  1USH A;  3DW8 C;  4B2O A;  3N5U A;  2HY1 A;  2HYP A;  4I5L C;  1JK7 A;  2ZOA A;  1S70 A;  4H2B A;  1WAR A;  4O5G A;  4V0W A;  4YKE A;  1M63 A;  3QFN A;  1T70 A;  3IB7 A;  4OR9 A;  4DSY A;  2DXL A;  2IE4 C;  1OID A;  3K7V C;  4FBW A;  1Z2X A;  4FCX A;  4I5N C;  3H67 A;  5J28 A;  3LL8 A;  4ZVZ A;  2WDF A;  1UF3 A;  4J6O A;  4H1S A;  2YVT A;  3PSN A;  4Q7F A;  2NYL C;  4O43 A;  2QFR A;  3CK2 A;  3H60 A;  4JA7 A;  1IT6 A;  4O24 A;  1TCO A;  3FLO A;  2DFJ A;  3EGH A;  5JPF A;  1S95 A;  2BCD A;  2XMO A;  1KBP A;  2WDE A;  2P6B A;  1AUI A;  3AV0 A;  2A22 A;  3PSO A;  3D03 A;  4ORC A;  4H2G A;  4ORB A;  3GVE A;  5DNY A;  2R17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...