1V73A

Crystal structure of cold-active protein-tyrosine phosphatase of a psychrophile shewanella sp.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
331
structure length
331
Chain Sequence
TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords psychrophilic phosphatase I
publication title Crystal Structure of Cold-Active Protein-Tyrosine Phosphatase from a Psychrophile, Shewanella sp
pubmed doi rcsb
source organism Shewanella sp.
total genus 108
structure length 331
sequence length 331
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1v73A00
1S95A 1HO5A 4FBWA 1OI8A 2ZBMA 4H1YP 4H2IA 3H69A 3K7WC 4DT2A 3E7BA 5DNYA 2QJCA 3QG5C 2JOGA 2USHA 4DHLA 1JK7A 3FGAC 3N5UA 4DSYA 3H64A 3IB7A 1QFCA 4O5GA 4O43A 2NXFA 2BDXA 1T70A 2DFJA 3C9FA 3THOB 2R17A 1Z2WA 3ICFA 3T1IA 1Z2XA 2Q8UA 3H66A 1UTEA 4YKEA 3JYFA 2HYPA 1KBPA 4I5LC 4JA7A 1WAO1 1U32A 3THNA 4UT3A 2WDCA 3AV0A 3EGGA 4G9JA 2Z72A 1USHA 5HPEA 1G5BA 1OIEA 1S3MA 4IL1A 4NZVA 2HY1A 4F0ZA 3V4YA 1S8EA 4V0XA 3IVEA 4TUIA 1XZWA 3H61A 1OIDA 1UF3A 2WDEA 4H2GA 2BCDA 2BQ8X 5GTUA 4OR9A 1II7A 5F3WA 3C5WC 1NNWA 4FBQA 4MOYA 1AUIA 4V0VA 4LTYA 4O4KA 1FJMA 3QFMA 3DSDA 4O24A 3K7VC 4B2OA 3RL5A 3H67A 2O8GA 3PSOA 3ZTVA 4FCXA 2A22A 1HP1A 4V0WA 4H2FA 4ORCA 4TUGA 4XPNA 3DSCA 5IOHA 2NPPC 2KKNA 2HYOA 3QFNA 5J28A 2WDDA 3IB8A 4UWQA 5JPFA 2XMOA 2YVTA 1M63A 2CV9A 2Z06A 4J6OA 4UT3B 5C1VA 1QHWA 4H2BA 2IE3C 4ZVZA 4KKZA 2NYMC 4MP0A 1SU1A 2WDFA 2Z1AA 3LL8A 1V73A 3PSNA 3QFOA 2P6BA 4M0VA 3H62B 2QFPA 3P71C 3TGHA 5B8IA 1TCOA 5JJTA 4ZX2A 2O8AA 3H63A 1HPUA 4H1SA 1MF8A 3EGHA 4I5NC 1S3NA 2GJUA 4LACC 1S3LA 3ZU0A 5INBA 3AUZA 1W24A 3IVDA 3CK2A 4KBPA 3H60A 4LU9A 4UT2A 3H68A 5EQVA 2IE4C 2NYLC 4ORAA 4ORBA 4Q7FA 3DW8C 1IT6A 3RL4A 3RL3A 1S70A 4HD0A 4JA9A 1XM7A 4IYPC 2QFRA 3RQZA 4WWLA 3QFKA 3GVEA 3KBPA 3HVQA 2AHDA 3E7AA 4MOVA 1T71A 4FBKA 2IAEC 5JPEA 1WARA
chains in the Genus database with same CATH superfamily
1S95A 1HO5A 4FBWA 1OI8A 2ZBMA 4H1YP 4H2IA 3H69A 3K7WC 4DT2A 3E7BA 5DNYA 2QJCA 3QG5C 2JOGA 2USHA 4DHLA 1JK7A 3FGAC 3N5UA 4DSYA 3H64A 3IB7A 1QFCA 4O5GA 4O43A 2NXFA 2BDXA 1T70A 2DFJA 3C9FA 3THOB 2R17A 1Z2WA 2DXLA 3ICFA 3T1IA 1Z2XA 2Q8UA 3H66A 1UTEA 4YKEA 3JYFA 2HYPA 1KBPA 4I5LC 4JA7A 1WAO1 1U32A 3THNA 4UT3A 2WDCA 3AV0A 3EGGA 4G9JA 2Z72A 1USHA 5HPEA 1G5BA 1OIEA 1S3MA 4IL1A 4NZVA 2HY1A 4F0ZA 3V4YA 1S8EA 4V0XA 3IVEA 4TUIA 1XZWA 3H61A 1OIDA 1UF3A 2WDEA 4H2GA 2BCDA 2BQ8X 5GTUA 4OR9A 1II7A 5F3WA 3C5WC 1NNWA 4FBQA 4MOYA 1AUIA 4V0VA 4LTYA 4O4KA 1FJMA 3QFMA 3DSDA 4O24A 3K7VC 4B2OA 3RL5A 3H67A 2O8GA 3PSOA 3ZTVA 4FCXA 2A22A 1HP1A 4V0WA 4H2FA 4ORCA 4TUGA 4XPNA 3DSCA 5IOHA 2NPPC 2KKNA 2HYOA 3QFNA 5J28A 2WDDA 3IB8A 4UWQA 5JPFA 3FLOA 2XMOA 2YVTA 1M63A 2CV9A 2Z06A 4J6OA 4UT3B 5C1VA 1QHWA 4H2BA 2IE3C 4ZVZA 2DXNA 4KKZA 2NYMC 4MP0A 1SU1A 2WDFA 2YEQA 2Z1AA 3LL8A 1V73A 3PSNA 3QFOA 2P6BA 4M0VA 3H62B 2QFPA 3P71C 3TGHA 5B8IA 1TCOA 2ZOAA 5JJTA 4ZX2A 2O8AA 3H63A 1HPUA 4H1SA 1MF8A 3EGHA 4I5NC 1S3NA 2GJUA 4LACC 1S3LA 3ZU0A 3E0JA 5INBA 3AUZA 1W24A 3IVDA 3CK2A 4KBPA 3H60A 4LU9A 4UT2A 3H68A 5EQVA 2IE4C 2NYLC 4ORAA 4ORBA 4Q7FA 3D03A 3DW8C 1IT6A 3RL4A 2ZO9B 1S70A 4HD0A 3RL3A 4JA9A 1XM7A 4IYPC 2QFRA 3RQZA 4WWLA 3QFKA 3GVEA 3KBPA 3HVQA 2AHDA 3E7AA 4MOVA 1T71A 4FBKA 2IAEC 5JPEA 1WARA
chains in the Genus database with same CATH topology
1S95A 1HO5A 4FBWA 1OI8A 2ZBMA 4H1YP 4H2IA 3H69A 3K7WC 4DT2A 3E7BA 5DNYA 2QJCA 3QG5C 2JOGA 2USHA 4DHLA 1JK7A 3FGAC 3N5UA 4DSYA 3H64A 3IB7A 1QFCA 4O5GA 4O43A 2NXFA 2BDXA 1T70A 2DFJA 3C9FA 3THOB 2R17A 1Z2WA 2DXLA 3ICFA 3T1IA 1Z2XA 2Q8UA 3H66A 1UTEA 4YKEA 3JYFA 2HYPA 1KBPA 4I5LC 4JA7A 1WAO1 1U32A 3THNA 4UT3A 2WDCA 3AV0A 3EGGA 4G9JA 2Z72A 1USHA 5HPEA 1G5BA 1OIEA 1S3MA 4IL1A 4NZVA 2HY1A 4F0ZA 3V4YA 1S8EA 4V0XA 3IVEA 4TUIA 1XZWA 3H61A 1OIDA 1UF3A 2WDEA 4H2GA 2BCDA 2BQ8X 5GTUA 4OR9A 1II7A 5F3WA 3C5WC 1NNWA 4FBQA 4MOYA 1AUIA 4V0VA 4LTYA 4O4KA 1FJMA 3QFMA 3DSDA 4O24A 3K7VC 4B2OA 3RL5A 3H67A 2O8GA 3PSOA 3ZTVA 4FCXA 2A22A 1HP1A 4V0WA 4H2FA 4ORCA 4TUGA 4XPNA 3DSCA 5IOHA 2NPPC 2KKNA 2HYOA 3QFNA 5J28A 2WDDA 3IB8A 4UWQA 5JPFA 3FLOA 2XMOA 2YVTA 1M63A 2CV9A 2Z06A 4J6OA 4UT3B 5C1VA 1QHWA 4H2BA 2IE3C 4ZVZA 2DXNA 4KKZA 2NYMC 4MP0A 1SU1A 2WDFA 2YEQA 2Z1AA 3LL8A 1V73A 3PSNA 3QFOA 2P6BA 4M0VA 3H62B 2QFPA 3P71C 3TGHA 5B8IA 1TCOA 2ZOAA 5JJTA 4ZX2A 2O8AA 3H63A 1HPUA 4H1SA 1MF8A 3EGHA 4I5NC 1S3NA 2GJUA 4LACC 1S3LA 3ZU0A 3E0JA 5INBA 3AUZA 1W24A 3IVDA 3CK2A 4KBPA 3H60A 4LU9A 4UT2A 3H68A 5EQVA 2IE4C 2NYLC 4ORAA 4ORBA 4Q7FA 3D03A 3DW8C 1IT6A 3RL4A 2ZO9B 1S70A 4HD0A 3RL3A 4JA9A 1XM7A 4IYPC 2QFRA 3RQZA 4WWLA 3QFKA 3GVEA 3KBPA 3HVQA 2AHDA 3E7AA 4MOVA 1T71A 4FBKA 2IAEC 5JPEA 1WARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S95 A;  1HO5 A;  4FBW A;  1OI8 A;  2ZBM A;  4H1Y P;  4H2I A;  3H69 A;  3K7W C;  4DT2 A;  3E7B A;  5DNY A;  2QJC A;  3QG5 C;  2JOG A;  2USH A;  4DHL A;  1JK7 A;  3FGA C;  3N5U A;  4DSY A;  3H64 A;  3IB7 A;  1QFC A;  4O5G A;  4O43 A;  2NXF A;  2BDX A;  1T70 A;  2DFJ A;  3C9F A;  3THO B;  2R17 A;  1Z2W A;  3ICF A;  3T1I A;  1Z2X A;  2Q8U A;  3H66 A;  1UTE A;  4YKE A;  3JYF A;  2HYP A;  1KBP A;  4I5L C;  4JA7 A;  1WAO 1;  1U32 A;  3THN A;  4UT3 A;  2WDC A;  3AV0 A;  3EGG A;  4G9J A;  2Z72 A;  1USH A;  5HPE A;  1G5B A;  1OIE A;  1S3M A;  4IL1 A;  4NZV A;  2HY1 A;  4F0Z A;  3V4Y A;  1S8E A;  4V0X A;  3IVE A;  4TUI A;  1XZW A;  3H61 A;  1OID A;  1UF3 A;  2WDE A;  4H2G A;  2BCD A;  2BQ8 X;  5GTU A;  4OR9 A;  1II7 A;  5F3W A;  3C5W C;  1NNW A;  4FBQ A;  4MOY A;  1AUI A;  4V0V A;  4LTY A;  4O4K A;  1FJM A;  3QFM A;  3DSD A;  4O24 A;  3K7V C;  4B2O A;  3RL5 A;  3H67 A;  2O8G A;  3PSO A;  3ZTV A;  4FCX A;  2A22 A;  1HP1 A;  4V0W A;  4H2F A;  4ORC A;  4TUG A;  4XPN A;  3DSC A;  5IOH A;  2NPP C;  2KKN A;  2HYO A;  3QFN A;  5J28 A;  2WDD A;  3IB8 A;  4UWQ A;  5JPF A;  2XMO A;  2YVT A;  1M63 A;  2CV9 A;  2Z06 A;  4J6O A;  4UT3 B;  5C1V A;  1QHW A;  4H2B A;  2IE3 C;  4ZVZ A;  4KKZ A;  2NYM C;  4MP0 A;  1SU1 A;  2WDF A;  2Z1A A;  3LL8 A;  1V73 A;  3PSN A;  3QFO A;  2P6B A;  4M0V A;  3H62 B;  2QFP A;  3P71 C;  3TGH A;  5B8I A;  1TCO A;  5JJT A;  4ZX2 A;  2O8A A;  3H63 A;  1HPU A;  4H1S A;  1MF8 A;  3EGH A;  4I5N C;  1S3N A;  2GJU A;  4LAC C;  1S3L A;  3ZU0 A;  5INB A;  3AUZ A;  1W24 A;  3IVD A;  3CK2 A;  4KBP A;  3H60 A;  4LU9 A;  4UT2 A;  3H68 A;  5EQV A;  2IE4 C;  2NYL C;  4ORA A;  4ORB A;  4Q7F A;  3DW8 C;  1IT6 A;  3RL4 A;  3RL3 A;  1S70 A;  4HD0 A;  4JA9 A;  1XM7 A;  4IYP C;  2QFR A;  3RQZ A;  4WWL A;  3QFK A;  3GVE A;  3KBP A;  3HVQ A;  2AHD A;  3E7A A;  4MOV A;  1T71 A;  4FBK A;  2IAE C;  5JPE A;  1WAR A; 
#chains in the Genus database with same CATH topology
 1S95 A;  1HO5 A;  4FBW A;  1OI8 A;  2ZBM A;  4H1Y P;  4H2I A;  3H69 A;  3K7W C;  4DT2 A;  3E7B A;  5DNY A;  2QJC A;  3QG5 C;  2JOG A;  2USH A;  4DHL A;  1JK7 A;  3FGA C;  3N5U A;  4DSY A;  3H64 A;  3IB7 A;  1QFC A;  4O5G A;  4O43 A;  2NXF A;  2BDX A;  1T70 A;  2DFJ A;  3C9F A;  3THO B;  2R17 A;  1Z2W A;  2DXL A;  3ICF A;  3T1I A;  1Z2X A;  2Q8U A;  3H66 A;  1UTE A;  4YKE A;  3JYF A;  2HYP A;  1KBP A;  4I5L C;  4JA7 A;  1WAO 1;  1U32 A;  3THN A;  4UT3 A;  2WDC A;  3AV0 A;  3EGG A;  4G9J A;  2Z72 A;  1USH A;  5HPE A;  1G5B A;  1OIE A;  1S3M A;  4IL1 A;  4NZV A;  2HY1 A;  4F0Z A;  3V4Y A;  1S8E A;  4V0X A;  3IVE A;  4TUI A;  1XZW A;  3H61 A;  1OID A;  1UF3 A;  2WDE A;  4H2G A;  2BCD A;  2BQ8 X;  5GTU A;  4OR9 A;  1II7 A;  5F3W A;  3C5W C;  1NNW A;  4FBQ A;  4MOY A;  1AUI A;  4V0V A;  4LTY A;  4O4K A;  1FJM A;  3QFM A;  3DSD A;  4O24 A;  3K7V C;  4B2O A;  3RL5 A;  3H67 A;  2O8G A;  3PSO A;  3ZTV A;  4FCX A;  2A22 A;  1HP1 A;  4V0W A;  4H2F A;  4ORC A;  4TUG A;  4XPN A;  3DSC A;  5IOH A;  2NPP C;  2KKN A;  2HYO A;  3QFN A;  5J28 A;  2WDD A;  3IB8 A;  4UWQ A;  5JPF A;  3FLO A;  2XMO A;  2YVT A;  1M63 A;  2CV9 A;  2Z06 A;  4J6O A;  4UT3 B;  5C1V A;  1QHW A;  4H2B A;  2IE3 C;  4ZVZ A;  2DXN A;  4KKZ A;  2NYM C;  4MP0 A;  1SU1 A;  2WDF A;  2YEQ A;  2Z1A A;  3LL8 A;  1V73 A;  3PSN A;  3QFO A;  2P6B A;  4M0V A;  3H62 B;  2QFP A;  3P71 C;  3TGH A;  5B8I A;  1TCO A;  2ZOA A;  5JJT A;  4ZX2 A;  2O8A A;  3H63 A;  1HPU A;  4H1S A;  1MF8 A;  3EGH A;  4I5N C;  1S3N A;  2GJU A;  4LAC C;  1S3L A;  3ZU0 A;  3E0J A;  5INB A;  3AUZ A;  1W24 A;  3IVD A;  3CK2 A;  4KBP A;  3H60 A;  4LU9 A;  4UT2 A;  3H68 A;  5EQV A;  2IE4 C;  2NYL C;  4ORA A;  4ORB A;  4Q7F A;  3D03 A;  3DW8 C;  1IT6 A;  3RL4 A;  2ZO9 B;  1S70 A;  4HD0 A;  3RL3 A;  4JA9 A;  1XM7 A;  4IYP C;  2QFR A;  3RQZ A;  4WWL A;  3QFK A;  3GVE A;  3KBP A;  3HVQ A;  2AHD A;  3E7A A;  4MOV A;  1T71 A;  4FBK A;  2IAE C;  5JPE A;  1WAR A; 
#chains in the Genus database with same CATH homology
 1S95 A;  1HO5 A;  4FBW A;  1OI8 A;  2ZBM A;  4H1Y P;  4H2I A;  3H69 A;  3K7W C;  4DT2 A;  3E7B A;  5DNY A;  2QJC A;  3QG5 C;  2JOG A;  2USH A;  4DHL A;  1JK7 A;  3FGA C;  3N5U A;  4DSY A;  3H64 A;  3IB7 A;  1QFC A;  4O5G A;  4O43 A;  2NXF A;  2BDX A;  1T70 A;  2DFJ A;  3C9F A;  3THO B;  2R17 A;  1Z2W A;  2DXL A;  3ICF A;  3T1I A;  1Z2X A;  2Q8U A;  3H66 A;  1UTE A;  4YKE A;  3JYF A;  2HYP A;  1KBP A;  4I5L C;  4JA7 A;  1WAO 1;  1U32 A;  3THN A;  4UT3 A;  2WDC A;  3AV0 A;  3EGG A;  4G9J A;  2Z72 A;  1USH A;  5HPE A;  1G5B A;  1OIE A;  1S3M A;  4IL1 A;  4NZV A;  2HY1 A;  4F0Z A;  3V4Y A;  1S8E A;  4V0X A;  3IVE A;  4TUI A;  1XZW A;  3H61 A;  1OID A;  1UF3 A;  2WDE A;  4H2G A;  2BCD A;  2BQ8 X;  5GTU A;  4OR9 A;  1II7 A;  5F3W A;  3C5W C;  1NNW A;  4FBQ A;  4MOY A;  1AUI A;  4V0V A;  4LTY A;  4O4K A;  1FJM A;  3QFM A;  3DSD A;  4O24 A;  3K7V C;  4B2O A;  3RL5 A;  3H67 A;  2O8G A;  3PSO A;  3ZTV A;  4FCX A;  2A22 A;  1HP1 A;  4V0W A;  4H2F A;  4ORC A;  4TUG A;  4XPN A;  3DSC A;  5IOH A;  2NPP C;  2KKN A;  2HYO A;  3QFN A;  5J28 A;  2WDD A;  3IB8 A;  4UWQ A;  5JPF A;  3FLO A;  2XMO A;  2YVT A;  1M63 A;  2CV9 A;  2Z06 A;  4J6O A;  4UT3 B;  5C1V A;  1QHW A;  4H2B A;  2IE3 C;  4ZVZ A;  2DXN A;  4KKZ A;  2NYM C;  4MP0 A;  1SU1 A;  2WDF A;  2YEQ A;  2Z1A A;  3LL8 A;  1V73 A;  3PSN A;  3QFO A;  2P6B A;  4M0V A;  3H62 B;  2QFP A;  3P71 C;  3TGH A;  5B8I A;  1TCO A;  2ZOA A;  5JJT A;  4ZX2 A;  2O8A A;  3H63 A;  1HPU A;  4H1S A;  1MF8 A;  3EGH A;  4I5N C;  1S3N A;  2GJU A;  4LAC C;  1S3L A;  3ZU0 A;  3E0J A;  5INB A;  3AUZ A;  1W24 A;  3IVD A;  3CK2 A;  4KBP A;  3H60 A;  4LU9 A;  4UT2 A;  3H68 A;  5EQV A;  2IE4 C;  2NYL C;  4ORA A;  4ORB A;  4Q7F A;  3D03 A;  3DW8 C;  1IT6 A;  3RL4 A;  2ZO9 B;  1S70 A;  4HD0 A;  3RL3 A;  4JA9 A;  1XM7 A;  4IYP C;  2QFR A;  3RQZ A;  4WWL A;  3QFK A;  3GVE A;  3KBP A;  3HVQ A;  2AHD A;  3E7A A;  4MOV A;  1T71 A;  4FBK A;  2IAE C;  5JPE A;  1WAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...