1NNWA

Hypothetical protein from pyrococcus furiosus pfu-1218608
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
251
structure length
251
Chain Sequence
VYVAVLANIAGNLPALTAALSRIEEMREEGYEIEKYYILGNIVGLFPYPKEVIEVIKDLTKKENVKIIRGKYDQIIAMSDPHATDPGYIDKLELPGHVKKALKFTWEKLGHEGREYLRDLPIYLVDKIGGNEVFGVYGSPINPFDGEVLAEQPTSYYEAIMRPVKDYEMLIVASPMYPVDAMTRYGRVVCPGSVGFPPGKEHKATFALVDVDTLKPKFIEVEYDKKIIEERIRAEGLPEEIIKILYHGGRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Southeast Collaboratory for Structural Genomics: hypothetical protein from Pyrococcus furiosus Pfu-1218608
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 79
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1nnwA00
4KBPA 4Q7FA 4MOVA 3KBPA 2Z06A 3H66A 1TCOA 4MOYA 2HY1A 2USHA 1S70A 1OIDA 2DFJA 3C9FA 3QFMA 2QFPA 1JK7A 1HPUA 2Z1AA 3THOB 1S8EA 2Q8UA 1S3NA 3DSDA 4LTYA 2QJCA 4O5GA 4NZVA 3K7WC 1FJMA 2NYLC 2NPPC 4LU9A 3QFNA 4J6OA 3RL5A 3T1IA 4KKZA 4V0WA 3H67A 3QG5C 4ZX2A 5JPEA 5F3WA 3P71C 2IE4C 2WDCA 5C1VA 4IL1A 4M0VA 4H1SA 3H60A 3H61A 5DNYA 2O8GA 3K7VC 2BQ8X 1U32A 3EGHA 4H1YP 1AUIA 4OR9A 2ZBMA 4DT2A 4H2FA 1WARA 2CV9A 1V73A 1Z2WA 1KBPA 5J28A 3RQZA 4G9JA 4O43A 4B2OA 3THNA 4O4KA 3RL3A 4UT3A 3H69A 1HO5A 3ZTVA 3E7BA 2HYPA 1G5BA 2KKNA 1Z2XA 1T70A 3H62B 4ORCA 2IE3C 3GVEA 3PSOA 1QHWA 3IB7A 4UT3B 1UTEA 3IVEA 3DSCA 2AHDA 4HD0A 3H64A 1USHA 4FBKA 1T71A 4JA7A 4MP0A 2NXFA 2O8AA 2YVTA 1M63A 2Z72A 4O24A 3H63A 1XZWA 1S95A 2WDFA 3AV0A 3E7AA 2BCDA 3N5UA 2QFRA 4ORBA 1WAO1 4V0VA 1QFCA 2XMOA 4I5LC 3JYFA 1OI8A 3ZU0A 1UF3A 3C5WC 3V4YA 5B8IA 4FBWA 4H2GA 4I5NC 2GJUA 5HPEA 1NNWA 5GTUA 1S3MA 4H2IA 4LACC 3QFOA 3IVDA 2R17A 4WWLA 1W24A 4DSYA 3DW8C 5JPFA 3AUZA 2WDEA 4IYPC 4DHLA 4TUIA 4FCXA 4ZVZA 5JJTA 3CK2A 4ORAA 3HVQA 4V0XA 1XM7A 5EQVA 1S3LA 3IB8A 3PSNA 4F0ZA 3TGHA 4XPNA 4TUGA 2P6BA 2IAEC 2WDDA 3H68A 3QFKA 4FBQA 1II7A 4UWQA 3RL4A 1IT6A 2HYOA 2A22A 5IOHA 2JOGA 4H2BA 3ICFA 5INBA 1OIEA 4YKEA 4JA9A 2NYMC 3FGAC 3LL8A 1HP1A 1SU1A 2BDXA 4UT2A 3EGGA 1MF8A
chains in the Genus database with same CATH superfamily
4KBPA 4Q7FA 4MOVA 3KBPA 2Z06A 3H66A 1TCOA 4MOYA 4UT2A 2HY1A 2USHA 1S70A 1OIDA 2DFJA 3C9FA 3QFMA 2QFPA 1JK7A 1HPUA 2Z1AA 3THOB 1S8EA 2Q8UA 1S3NA 3DSDA 4LTYA 2QJCA 4O5GA 4NZVA 3K7WC 1FJMA 2NYLC 2NPPC 4LU9A 3QFNA 4J6OA 3RL5A 3T1IA 4KKZA 4V0WA 3H67A 3QG5C 4ZX2A 5JPEA 5F3WA 3P71C 2IE4C 2WDCA 5C1VA 4IL1A 4M0VA 4H1SA 3H60A 3H61A 5DNYA 2O8GA 3K7VC 2BQ8X 1U32A 2DXLA 3EGHA 4H1YP 1AUIA 4OR9A 2ZBMA 4DT2A 4H2FA 1WARA 2CV9A 1V73A 1Z2WA 1KBPA 5J28A 3RQZA 4G9JA 4O43A 4B2OA 3THNA 4O4KA 2DXNA 3RL3A 4UT3A 2YEQA 3H69A 1HO5A 3ZTVA 2ZO9B 3E7BA 2HYPA 1G5BA 3FLOA 2KKNA 1Z2XA 1T70A 3H62B 4ORCA 2IE3C 3GVEA 3PSOA 1QHWA 2ZOAA 3IB7A 1UTEA 4UT3B 3IVEA 3DSCA 2AHDA 4HD0A 3H64A 1USHA 3D03A 4FBKA 1T71A 4JA7A 4MP0A 2NXFA 2O8AA 2YVTA 1M63A 2Z72A 4O24A 3H63A 1XZWA 1S95A 2WDFA 3AV0A 3E7AA 2BCDA 3N5UA 2QFRA 4ORBA 1WAO1 4V0VA 1QFCA 2XMOA 4I5LC 3JYFA 1OI8A 3ZU0A 1UF3A 3C5WC 3V4YA 5B8IA 4FBWA 4H2GA 4I5NC 2GJUA 5HPEA 1NNWA 5GTUA 1S3MA 4H2IA 4LACC 3QFOA 3IVDA 2R17A 4WWLA 1W24A 4DSYA 3DW8C 5JPFA 3AUZA 2WDEA 4IYPC 4DHLA 4TUIA 4FCXA 4ZVZA 5JJTA 3CK2A 4ORAA 3HVQA 4V0XA 1XM7A 5EQVA 1S3LA 3IB8A 3PSNA 4F0ZA 3TGHA 4XPNA 4TUGA 2P6BA 2IAEC 2WDDA 3H68A 3QFKA 4FBQA 1II7A 4UWQA 3RL4A 1IT6A 2HYOA 2A22A 5IOHA 2JOGA 4H2BA 3ICFA 5INBA 1OIEA 4YKEA 4JA9A 2NYMC 3FGAC 3LL8A 1HP1A 1SU1A 2BDXA 3E0JA 3EGGA 1MF8A
chains in the Genus database with same CATH topology
4KBPA 4Q7FA 4MOVA 3KBPA 2Z06A 3H66A 1TCOA 4MOYA 4UT2A 2HY1A 2USHA 1S70A 1OIDA 2DFJA 3C9FA 3QFMA 2QFPA 1JK7A 1HPUA 2Z1AA 3THOB 1S8EA 2Q8UA 1S3NA 3DSDA 4LTYA 2QJCA 4O5GA 4NZVA 3K7WC 1FJMA 2NYLC 2NPPC 4LU9A 3QFNA 4J6OA 3RL5A 3T1IA 4KKZA 4V0WA 3H67A 3QG5C 4ZX2A 5JPEA 5F3WA 3P71C 2IE4C 2WDCA 5C1VA 4IL1A 4M0VA 4H1SA 3H60A 3H61A 5DNYA 2O8GA 3K7VC 2BQ8X 1U32A 2DXLA 3EGHA 4H1YP 1AUIA 4OR9A 2ZBMA 4DT2A 4H2FA 1WARA 2CV9A 1V73A 1Z2WA 1KBPA 5J28A 3RQZA 4G9JA 4O43A 4B2OA 3THNA 4O4KA 2DXNA 3RL3A 4UT3A 2YEQA 3H69A 1HO5A 3ZTVA 2ZO9B 3E7BA 2HYPA 1G5BA 3FLOA 2KKNA 1Z2XA 1T70A 3H62B 4ORCA 2IE3C 3GVEA 3PSOA 1QHWA 2ZOAA 3IB7A 1UTEA 4UT3B 3IVEA 3DSCA 2AHDA 4HD0A 3H64A 1USHA 3D03A 4FBKA 1T71A 4JA7A 4MP0A 2NXFA 2O8AA 2YVTA 1M63A 2Z72A 4O24A 3H63A 1XZWA 1S95A 2WDFA 3AV0A 3E7AA 2BCDA 3N5UA 2QFRA 4ORBA 1WAO1 4V0VA 1QFCA 2XMOA 4I5LC 3JYFA 1OI8A 3ZU0A 1UF3A 3C5WC 3V4YA 5B8IA 4FBWA 4H2GA 4I5NC 2GJUA 5HPEA 1NNWA 5GTUA 1S3MA 4H2IA 4LACC 3QFOA 3IVDA 2R17A 4WWLA 1W24A 4DSYA 3DW8C 5JPFA 3AUZA 2WDEA 4IYPC 4DHLA 4TUIA 4FCXA 4ZVZA 5JJTA 3CK2A 4ORAA 3HVQA 4V0XA 1XM7A 5EQVA 1S3LA 3IB8A 3PSNA 4F0ZA 3TGHA 4XPNA 4TUGA 2P6BA 2IAEC 2WDDA 3H68A 3QFKA 4FBQA 1II7A 4UWQA 3RL4A 1IT6A 2HYOA 2A22A 5IOHA 2JOGA 4H2BA 3ICFA 5INBA 1OIEA 4YKEA 4JA9A 2NYMC 3FGAC 3LL8A 1HP1A 1SU1A 2BDXA 3E0JA 3EGGA 1MF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBP A;  4Q7F A;  4MOV A;  3KBP A;  2Z06 A;  3H66 A;  1TCO A;  4MOY A;  2HY1 A;  2USH A;  1S70 A;  1OID A;  2DFJ A;  3C9F A;  3QFM A;  2QFP A;  1JK7 A;  1HPU A;  2Z1A A;  3THO B;  1S8E A;  2Q8U A;  1S3N A;  3DSD A;  4LTY A;  2QJC A;  4O5G A;  4NZV A;  3K7W C;  1FJM A;  2NYL C;  2NPP C;  4LU9 A;  3QFN A;  4J6O A;  3RL5 A;  3T1I A;  4KKZ A;  4V0W A;  3H67 A;  3QG5 C;  4ZX2 A;  5JPE A;  5F3W A;  3P71 C;  2IE4 C;  2WDC A;  5C1V A;  4IL1 A;  4M0V A;  4H1S A;  3H60 A;  3H61 A;  5DNY A;  2O8G A;  3K7V C;  2BQ8 X;  1U32 A;  3EGH A;  4H1Y P;  1AUI A;  4OR9 A;  2ZBM A;  4DT2 A;  4H2F A;  1WAR A;  2CV9 A;  1V73 A;  1Z2W A;  1KBP A;  5J28 A;  3RQZ A;  4G9J A;  4O43 A;  4B2O A;  3THN A;  4O4K A;  3RL3 A;  4UT3 A;  3H69 A;  1HO5 A;  3ZTV A;  3E7B A;  2HYP A;  1G5B A;  2KKN A;  1Z2X A;  1T70 A;  3H62 B;  4ORC A;  2IE3 C;  3GVE A;  3PSO A;  1QHW A;  3IB7 A;  4UT3 B;  1UTE A;  3IVE A;  3DSC A;  2AHD A;  4HD0 A;  3H64 A;  1USH A;  4FBK A;  1T71 A;  4JA7 A;  4MP0 A;  2NXF A;  2O8A A;  2YVT A;  1M63 A;  2Z72 A;  4O24 A;  3H63 A;  1XZW A;  1S95 A;  2WDF A;  3AV0 A;  3E7A A;  2BCD A;  3N5U A;  2QFR A;  4ORB A;  1WAO 1;  4V0V A;  1QFC A;  2XMO A;  4I5L C;  3JYF A;  1OI8 A;  3ZU0 A;  1UF3 A;  3C5W C;  3V4Y A;  5B8I A;  4FBW A;  4H2G A;  4I5N C;  2GJU A;  5HPE A;  1NNW A;  5GTU A;  1S3M A;  4H2I A;  4LAC C;  3QFO A;  3IVD A;  2R17 A;  4WWL A;  1W24 A;  4DSY A;  3DW8 C;  5JPF A;  3AUZ A;  2WDE A;  4IYP C;  4DHL A;  4TUI A;  4FCX A;  4ZVZ A;  5JJT A;  3CK2 A;  4ORA A;  3HVQ A;  4V0X A;  1XM7 A;  5EQV A;  1S3L A;  3IB8 A;  3PSN A;  4F0Z A;  3TGH A;  4XPN A;  4TUG A;  2P6B A;  2IAE C;  2WDD A;  3H68 A;  3QFK A;  4FBQ A;  1II7 A;  4UWQ A;  3RL4 A;  1IT6 A;  2HYO A;  2A22 A;  5IOH A;  2JOG A;  4H2B A;  3ICF A;  5INB A;  1OIE A;  4YKE A;  4JA9 A;  2NYM C;  3FGA C;  3LL8 A;  1HP1 A;  1SU1 A;  2BDX A;  4UT2 A;  3EGG A;  1MF8 A; 
#chains in the Genus database with same CATH topology
 4KBP A;  4Q7F A;  4MOV A;  3KBP A;  2Z06 A;  3H66 A;  1TCO A;  4MOY A;  4UT2 A;  2HY1 A;  2USH A;  1S70 A;  1OID A;  2DFJ A;  3C9F A;  3QFM A;  2QFP A;  1JK7 A;  1HPU A;  2Z1A A;  3THO B;  1S8E A;  2Q8U A;  1S3N A;  3DSD A;  4LTY A;  2QJC A;  4O5G A;  4NZV A;  3K7W C;  1FJM A;  2NYL C;  2NPP C;  4LU9 A;  3QFN A;  4J6O A;  3RL5 A;  3T1I A;  4KKZ A;  4V0W A;  3H67 A;  3QG5 C;  4ZX2 A;  5JPE A;  5F3W A;  3P71 C;  2IE4 C;  2WDC A;  5C1V A;  4IL1 A;  4M0V A;  4H1S A;  3H60 A;  3H61 A;  5DNY A;  2O8G A;  3K7V C;  2BQ8 X;  1U32 A;  2DXL A;  3EGH A;  4H1Y P;  1AUI A;  4OR9 A;  2ZBM A;  4DT2 A;  4H2F A;  1WAR A;  2CV9 A;  1V73 A;  1Z2W A;  1KBP A;  5J28 A;  3RQZ A;  4G9J A;  4O43 A;  4B2O A;  3THN A;  4O4K A;  2DXN A;  3RL3 A;  4UT3 A;  2YEQ A;  3H69 A;  1HO5 A;  3ZTV A;  2ZO9 B;  3E7B A;  2HYP A;  1G5B A;  3FLO A;  2KKN A;  1Z2X A;  1T70 A;  3H62 B;  4ORC A;  2IE3 C;  3GVE A;  3PSO A;  1QHW A;  2ZOA A;  3IB7 A;  1UTE A;  4UT3 B;  3IVE A;  3DSC A;  2AHD A;  4HD0 A;  3H64 A;  1USH A;  3D03 A;  4FBK A;  1T71 A;  4JA7 A;  4MP0 A;  2NXF A;  2O8A A;  2YVT A;  1M63 A;  2Z72 A;  4O24 A;  3H63 A;  1XZW A;  1S95 A;  2WDF A;  3AV0 A;  3E7A A;  2BCD A;  3N5U A;  2QFR A;  4ORB A;  1WAO 1;  4V0V A;  1QFC A;  2XMO A;  4I5L C;  3JYF A;  1OI8 A;  3ZU0 A;  1UF3 A;  3C5W C;  3V4Y A;  5B8I A;  4FBW A;  4H2G A;  4I5N C;  2GJU A;  5HPE A;  1NNW A;  5GTU A;  1S3M A;  4H2I A;  4LAC C;  3QFO A;  3IVD A;  2R17 A;  4WWL A;  1W24 A;  4DSY A;  3DW8 C;  5JPF A;  3AUZ A;  2WDE A;  4IYP C;  4DHL A;  4TUI A;  4FCX A;  4ZVZ A;  5JJT A;  3CK2 A;  4ORA A;  3HVQ A;  4V0X A;  1XM7 A;  5EQV A;  1S3L A;  3IB8 A;  3PSN A;  4F0Z A;  3TGH A;  4XPN A;  4TUG A;  2P6B A;  2IAE C;  2WDD A;  3H68 A;  3QFK A;  4FBQ A;  1II7 A;  4UWQ A;  3RL4 A;  1IT6 A;  2HYO A;  2A22 A;  5IOH A;  2JOG A;  4H2B A;  3ICF A;  5INB A;  1OIE A;  4YKE A;  4JA9 A;  2NYM C;  3FGA C;  3LL8 A;  1HP1 A;  1SU1 A;  2BDX A;  3E0J A;  3EGG A;  1MF8 A; 
#chains in the Genus database with same CATH homology
 4KBP A;  4Q7F A;  4MOV A;  3KBP A;  2Z06 A;  3H66 A;  1TCO A;  4MOY A;  4UT2 A;  2HY1 A;  2USH A;  1S70 A;  1OID A;  2DFJ A;  3C9F A;  3QFM A;  2QFP A;  1JK7 A;  1HPU A;  2Z1A A;  3THO B;  1S8E A;  2Q8U A;  1S3N A;  3DSD A;  4LTY A;  2QJC A;  4O5G A;  4NZV A;  3K7W C;  1FJM A;  2NYL C;  2NPP C;  4LU9 A;  3QFN A;  4J6O A;  3RL5 A;  3T1I A;  4KKZ A;  4V0W A;  3H67 A;  3QG5 C;  4ZX2 A;  5JPE A;  5F3W A;  3P71 C;  2IE4 C;  2WDC A;  5C1V A;  4IL1 A;  4M0V A;  4H1S A;  3H60 A;  3H61 A;  5DNY A;  2O8G A;  3K7V C;  2BQ8 X;  1U32 A;  2DXL A;  3EGH A;  4H1Y P;  1AUI A;  4OR9 A;  2ZBM A;  4DT2 A;  4H2F A;  1WAR A;  2CV9 A;  1V73 A;  1Z2W A;  1KBP A;  5J28 A;  3RQZ A;  4G9J A;  4O43 A;  4B2O A;  3THN A;  4O4K A;  2DXN A;  3RL3 A;  4UT3 A;  2YEQ A;  3H69 A;  1HO5 A;  3ZTV A;  2ZO9 B;  3E7B A;  2HYP A;  1G5B A;  3FLO A;  2KKN A;  1Z2X A;  1T70 A;  3H62 B;  4ORC A;  2IE3 C;  3GVE A;  3PSO A;  1QHW A;  2ZOA A;  3IB7 A;  1UTE A;  4UT3 B;  3IVE A;  3DSC A;  2AHD A;  4HD0 A;  3H64 A;  1USH A;  3D03 A;  4FBK A;  1T71 A;  4JA7 A;  4MP0 A;  2NXF A;  2O8A A;  2YVT A;  1M63 A;  2Z72 A;  4O24 A;  3H63 A;  1XZW A;  1S95 A;  2WDF A;  3AV0 A;  3E7A A;  2BCD A;  3N5U A;  2QFR A;  4ORB A;  1WAO 1;  4V0V A;  1QFC A;  2XMO A;  4I5L C;  3JYF A;  1OI8 A;  3ZU0 A;  1UF3 A;  3C5W C;  3V4Y A;  5B8I A;  4FBW A;  4H2G A;  4I5N C;  2GJU A;  5HPE A;  1NNW A;  5GTU A;  1S3M A;  4H2I A;  4LAC C;  3QFO A;  3IVD A;  2R17 A;  4WWL A;  1W24 A;  4DSY A;  3DW8 C;  5JPF A;  3AUZ A;  2WDE A;  4IYP C;  4DHL A;  4TUI A;  4FCX A;  4ZVZ A;  5JJT A;  3CK2 A;  4ORA A;  3HVQ A;  4V0X A;  1XM7 A;  5EQV A;  1S3L A;  3IB8 A;  3PSN A;  4F0Z A;  3TGH A;  4XPN A;  4TUG A;  2P6B A;  2IAE C;  2WDD A;  3H68 A;  3QFK A;  4FBQ A;  1II7 A;  4UWQ A;  3RL4 A;  1IT6 A;  2HYO A;  2A22 A;  5IOH A;  2JOG A;  4H2B A;  3ICF A;  5INB A;  1OIE A;  4YKE A;  4JA9 A;  2NYM C;  3FGA C;  3LL8 A;  1HP1 A;  1SU1 A;  2BDX A;  3E0J A;  3EGG A;  1MF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...