1NNWA

Hypothetical protein from pyrococcus furiosus pfu-1218608
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
251
structure length
251
Chain Sequence
VYVAVLANIAGNLPALTAALSRIEEMREEGYEIEKYYILGNIVGLFPYPKEVIEVIKDLTKKENVKIIRGKYDQIIAMSDPHATDPGYIDKLELPGHVKKALKFTWEKLGHEGREYLRDLPIYLVDKIGGNEVFGVYGSPINPFDGEVLAEQPTSYYEAIMRPVKDYEMLIVASPMYPVDAMTRYGRVVCPGSVGFPPGKEHKATFALVDVDTLKPKFIEVEYDKKIIEERIRAEGLPEEIIKILYHGGRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Southeast Collaboratory for Structural Genomics: hypothetical protein from Pyrococcus furiosus Pfu-1218608
rcsb
source organism Pyrococcus furiosus
total genus 79
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1nnwA00
1HP1A 2IAEC 4LTYA 1G5BA 3KBPA 3DW8C 3H64A 2WDCA 3K7VC 3IVDA 4H2GA 2WDDA 2JOGA 1AUIA 1S3LA 4TUIA 4ORCA 3RQZA 1OIEA 4H1SA 1OI8A 1OIDA 2HY1A 4UT3A 4ZVZA 4H2IA 1UTEA 1FJMA 3IVEA 4J6OA 3H63A 3C9FA 5JJTA 4YKEA 2Z1AA 1XZWA 4DSYA 4WWLA 2GJUA 2BQ8X 1TCOA 3E7AA 2WDFA 4IL1A 3TGHA 4B2OA 4G9JA 5GTUA 3THOB 4MOYA 2Z06A 4MP0A 1U32A 3RL4A 2BDXA 3EGGA 2NXFA 3CK2A 2IE3C 3H60A 4H1YP 4Q7FA 4XPNA 3ZU0A 2R17A 4UT3B 1W24A 5J28A 1SU1A 2QJCA 3K7WC 3ZTVA 1MF8A 4UWQA 4LACC 1HPUA 3C5WC 3EGHA 4HD0A 5DNYA 2O8GA 2O8AA 1T71A 4F0ZA 3JYFA 2A22A 3QG5C 3HVQA 2AHDA 4IYPC 2QFPA 3H66A 3IB7A 3QFNA 1HO5A 4JA9A 2DFJA 2Z72A 1IT6A 4MOVA 3V4YA 4ORAA 3DSDA 3DSCA 1T70A 3QFMA 2NYMC 1S3MA 4JA7A 3GVEA 3E7BA 3H68A 2IE4C 5JPEA 3H62B 4FCXA 1NNWA 3RL5A 3QFKA 3H67A 4V0XA 4V0WA 4ZX2A 1XM7A 5F3WA 4OR9A 4O43A 2CV9A 2XMOA 4NZVA 3H69A 1S8EA 4FBQA 3RL3A 1S3NA 3PSOA 3QFOA 1Z2WA 4I5LC 1II7A 4H2BA 2HYPA 4DT2A 1USHA 3THNA 3PSNA 2NYLC 4ORBA 3AUZA 3LL8A 3AV0A 3FGAC 1WARA 3P71C 5B8IA 1S70A 1S95A 2WDEA 5JPFA 3N5UA 1QFCA 1JK7A 1Z2XA 5HPEA 5INBA 2HYOA 4O5GA 4LU9A 5EQVA 3T1IA 2YVTA 5IOHA 2KKNA 2Q8UA 4O4KA 1V73A 1UF3A 4FBKA 5C1VA 4UT2A 4DHLA 2ZBMA 4M0VA 2P6BA 3H61A 3IB8A 4KBPA 1KBPA 3ICFA 4O24A 2BCDA 4KKZA 4FBWA 4V0VA 1M63A 2USHA 2QFRA 4H2FA 2NPPC 4TUGA 4I5NC 1QHWA 1WAO1
chains in the Genus database with same CATH superfamily
1HP1A 2IAEC 4LTYA 1G5BA 3KBPA 3DW8C 3H64A 2WDCA 3K7VC 3IVDA 4H2GA 2WDDA 2JOGA 1AUIA 1S3LA 4TUIA 4ORCA 3RQZA 1OIEA 4H1SA 1OI8A 1OIDA 2HY1A 4UT3A 4ZVZA 4H2IA 1UTEA 1FJMA 3IVEA 4J6OA 3H63A 3C9FA 5JJTA 4YKEA 2Z1AA 1XZWA 4DSYA 4WWLA 2GJUA 2BQ8X 1TCOA 3E7AA 2WDFA 4IL1A 3TGHA 4B2OA 4G9JA 5GTUA 3THOB 4MOYA 2Z06A 4MP0A 1U32A 3RL4A 2BDXA 3EGGA 2NXFA 3CK2A 2IE3C 3H60A 4H1YP 4Q7FA 4XPNA 3ZU0A 2R17A 4UT3B 1W24A 5J28A 1SU1A 2QJCA 3K7WC 3ZTVA 1MF8A 4UWQA 4LACC 2DXNA 1HPUA 2ZOAA 3C5WC 3EGHA 4HD0A 5DNYA 2O8GA 2O8AA 1T71A 4F0ZA 3JYFA 2A22A 3QG5C 3HVQA 2AHDA 4IYPC 2QFPA 3H66A 3IB7A 3QFNA 1HO5A 4JA9A 2DFJA 2Z72A 1IT6A 4MOVA 3V4YA 4ORAA 3DSDA 3DSCA 1T70A 3QFMA 2NYMC 1S3MA 4JA7A 3GVEA 2DXLA 3E7BA 3H68A 2IE4C 5JPEA 3H62B 4FCXA 1NNWA 3RL5A 3QFKA 3H67A 4V0XA 4V0WA 4ZX2A 1XM7A 5F3WA 4OR9A 4O43A 2CV9A 2XMOA 4NZVA 3H69A 1S8EA 4FBQA 3RL3A 3D03A 1S3NA 2ZO9B 3PSOA 3QFOA 1Z2WA 4I5LC 1II7A 4H2BA 2HYPA 4DT2A 1USHA 3THNA 3PSNA 2NYLC 3E0JA 4ORBA 3AUZA 3LL8A 3AV0A 3FGAC 1WARA 3P71C 5B8IA 1S70A 1S95A 2WDEA 5JPFA 3N5UA 1QFCA 1JK7A 1Z2XA 5HPEA 5INBA 2HYOA 4O5GA 4LU9A 5EQVA 3T1IA 2YVTA 5IOHA 2KKNA 2Q8UA 4O4KA 1V73A 1UF3A 4FBKA 5C1VA 4UT2A 4DHLA 2ZBMA 4M0VA 2P6BA 3H61A 3IB8A 4KBPA 1KBPA 3ICFA 4O24A 2BCDA 4KKZA 4FBWA 4V0VA 1M63A 2USHA 2QFRA 2YEQA 4H2FA 2NPPC 4TUGA 4I5NC 1QHWA 3FLOA 1WAO1
chains in the Genus database with same CATH topology
1HP1A 2IAEC 4LTYA 1G5BA 3KBPA 3DW8C 3H64A 2WDCA 3K7VC 3IVDA 4H2GA 2WDDA 2JOGA 1AUIA 1S3LA 4TUIA 4ORCA 3RQZA 1OIEA 4H1SA 1OI8A 1OIDA 2HY1A 4UT3A 4ZVZA 4H2IA 1UTEA 1FJMA 3IVEA 4J6OA 3H63A 3C9FA 5JJTA 4YKEA 2Z1AA 1XZWA 4DSYA 4WWLA 2GJUA 2BQ8X 1TCOA 3E7AA 2WDFA 4IL1A 3TGHA 4B2OA 4G9JA 5GTUA 3THOB 4MOYA 2Z06A 4MP0A 1U32A 3RL4A 2BDXA 3EGGA 2NXFA 3CK2A 2IE3C 3H60A 4H1YP 4Q7FA 4XPNA 3ZU0A 2R17A 4UT3B 1W24A 5J28A 1SU1A 2QJCA 3K7WC 3ZTVA 1MF8A 4UWQA 4LACC 2DXNA 1HPUA 2ZOAA 3C5WC 3EGHA 4HD0A 5DNYA 2O8GA 2O8AA 1T71A 4F0ZA 3JYFA 2A22A 3QG5C 3HVQA 2AHDA 4IYPC 2QFPA 3H66A 3IB7A 3QFNA 1HO5A 4JA9A 2DFJA 2Z72A 1IT6A 4MOVA 3V4YA 4ORAA 3DSDA 3DSCA 1T70A 3QFMA 2NYMC 1S3MA 4JA7A 3GVEA 2DXLA 3E7BA 3H68A 2IE4C 5JPEA 3H62B 4FCXA 1NNWA 3RL5A 3QFKA 3H67A 4V0XA 4V0WA 4ZX2A 1XM7A 5F3WA 4OR9A 4O43A 2CV9A 2XMOA 4NZVA 3H69A 1S8EA 4FBQA 3RL3A 3D03A 1S3NA 2ZO9B 3PSOA 3QFOA 1Z2WA 4I5LC 1II7A 4H2BA 2HYPA 4DT2A 1USHA 3THNA 3PSNA 2NYLC 3E0JA 4ORBA 3AUZA 3LL8A 3AV0A 3FGAC 1WARA 3P71C 5B8IA 1S70A 1S95A 2WDEA 5JPFA 3N5UA 1QFCA 1JK7A 1Z2XA 5HPEA 5INBA 2HYOA 4O5GA 4LU9A 5EQVA 3T1IA 2YVTA 5IOHA 2KKNA 2Q8UA 4O4KA 1V73A 1UF3A 4FBKA 5C1VA 4UT2A 4DHLA 2ZBMA 4M0VA 2P6BA 3H61A 3IB8A 4KBPA 1KBPA 3ICFA 4O24A 2BCDA 4KKZA 4FBWA 4V0VA 1M63A 2USHA 2QFRA 2YEQA 4H2FA 2NPPC 4TUGA 4I5NC 1QHWA 3FLOA 1WAO1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP1 A;  2IAE C;  4LTY A;  1G5B A;  3KBP A;  3DW8 C;  3H64 A;  2WDC A;  3K7V C;  3IVD A;  4H2G A;  2WDD A;  2JOG A;  1AUI A;  1S3L A;  4TUI A;  4ORC A;  3RQZ A;  1OIE A;  4H1S A;  1OI8 A;  1OID A;  2HY1 A;  4UT3 A;  4ZVZ A;  4H2I A;  1UTE A;  1FJM A;  3IVE A;  4J6O A;  3H63 A;  3C9F A;  5JJT A;  4YKE A;  2Z1A A;  1XZW A;  4DSY A;  4WWL A;  2GJU A;  2BQ8 X;  1TCO A;  3E7A A;  2WDF A;  4IL1 A;  3TGH A;  4B2O A;  4G9J A;  5GTU A;  3THO B;  4MOY A;  2Z06 A;  4MP0 A;  1U32 A;  3RL4 A;  2BDX A;  3EGG A;  2NXF A;  3CK2 A;  2IE3 C;  3H60 A;  4H1Y P;  4Q7F A;  4XPN A;  3ZU0 A;  2R17 A;  4UT3 B;  1W24 A;  5J28 A;  1SU1 A;  2QJC A;  3K7W C;  3ZTV A;  1MF8 A;  4UWQ A;  4LAC C;  1HPU A;  3C5W C;  3EGH A;  4HD0 A;  5DNY A;  2O8G A;  2O8A A;  1T71 A;  4F0Z A;  3JYF A;  2A22 A;  3QG5 C;  3HVQ A;  2AHD A;  4IYP C;  2QFP A;  3H66 A;  3IB7 A;  3QFN A;  1HO5 A;  4JA9 A;  2DFJ A;  2Z72 A;  1IT6 A;  4MOV A;  3V4Y A;  4ORA A;  3DSD A;  3DSC A;  1T70 A;  3QFM A;  2NYM C;  1S3M A;  4JA7 A;  3GVE A;  3E7B A;  3H68 A;  2IE4 C;  5JPE A;  3H62 B;  4FCX A;  1NNW A;  3RL5 A;  3QFK A;  3H67 A;  4V0X A;  4V0W A;  4ZX2 A;  1XM7 A;  5F3W A;  4OR9 A;  4O43 A;  2CV9 A;  2XMO A;  4NZV A;  3H69 A;  1S8E A;  4FBQ A;  3RL3 A;  1S3N A;  3PSO A;  3QFO A;  1Z2W A;  4I5L C;  1II7 A;  4H2B A;  2HYP A;  4DT2 A;  1USH A;  3THN A;  3PSN A;  2NYL C;  4ORB A;  3AUZ A;  3LL8 A;  3AV0 A;  3FGA C;  1WAR A;  3P71 C;  5B8I A;  1S70 A;  1S95 A;  2WDE A;  5JPF A;  3N5U A;  1QFC A;  1JK7 A;  1Z2X A;  5HPE A;  5INB A;  2HYO A;  4O5G A;  4LU9 A;  5EQV A;  3T1I A;  2YVT A;  5IOH A;  2KKN A;  2Q8U A;  4O4K A;  1V73 A;  1UF3 A;  4FBK A;  5C1V A;  4UT2 A;  4DHL A;  2ZBM A;  4M0V A;  2P6B A;  3H61 A;  3IB8 A;  4KBP A;  1KBP A;  3ICF A;  4O24 A;  2BCD A;  4KKZ A;  4FBW A;  4V0V A;  1M63 A;  2USH A;  2QFR A;  4H2F A;  2NPP C;  4TUG A;  4I5N C;  1QHW A;  1WAO 1; 
#chains in the Genus database with same CATH topology
 1HP1 A;  2IAE C;  4LTY A;  1G5B A;  3KBP A;  3DW8 C;  3H64 A;  2WDC A;  3K7V C;  3IVD A;  4H2G A;  2WDD A;  2JOG A;  1AUI A;  1S3L A;  4TUI A;  4ORC A;  3RQZ A;  1OIE A;  4H1S A;  1OI8 A;  1OID A;  2HY1 A;  4UT3 A;  4ZVZ A;  4H2I A;  1UTE A;  1FJM A;  3IVE A;  4J6O A;  3H63 A;  3C9F A;  5JJT A;  4YKE A;  2Z1A A;  1XZW A;  4DSY A;  4WWL A;  2GJU A;  2BQ8 X;  1TCO A;  3E7A A;  2WDF A;  4IL1 A;  3TGH A;  4B2O A;  4G9J A;  5GTU A;  3THO B;  4MOY A;  2Z06 A;  4MP0 A;  1U32 A;  3RL4 A;  2BDX A;  3EGG A;  2NXF A;  3CK2 A;  2IE3 C;  3H60 A;  4H1Y P;  4Q7F A;  4XPN A;  3ZU0 A;  2R17 A;  4UT3 B;  1W24 A;  5J28 A;  1SU1 A;  2QJC A;  3K7W C;  3ZTV A;  1MF8 A;  4UWQ A;  4LAC C;  2DXN A;  1HPU A;  2ZOA A;  3C5W C;  3EGH A;  4HD0 A;  5DNY A;  2O8G A;  2O8A A;  1T71 A;  4F0Z A;  3JYF A;  2A22 A;  3QG5 C;  3HVQ A;  2AHD A;  4IYP C;  2QFP A;  3H66 A;  3IB7 A;  3QFN A;  1HO5 A;  4JA9 A;  2DFJ A;  2Z72 A;  1IT6 A;  4MOV A;  3V4Y A;  4ORA A;  3DSD A;  3DSC A;  1T70 A;  3QFM A;  2NYM C;  1S3M A;  4JA7 A;  3GVE A;  2DXL A;  3E7B A;  3H68 A;  2IE4 C;  5JPE A;  3H62 B;  4FCX A;  1NNW A;  3RL5 A;  3QFK A;  3H67 A;  4V0X A;  4V0W A;  4ZX2 A;  1XM7 A;  5F3W A;  4OR9 A;  4O43 A;  2CV9 A;  2XMO A;  4NZV A;  3H69 A;  1S8E A;  4FBQ A;  3RL3 A;  3D03 A;  1S3N A;  2ZO9 B;  3PSO A;  3QFO A;  1Z2W A;  4I5L C;  1II7 A;  4H2B A;  2HYP A;  4DT2 A;  1USH A;  3THN A;  3PSN A;  2NYL C;  3E0J A;  4ORB A;  3AUZ A;  3LL8 A;  3AV0 A;  3FGA C;  1WAR A;  3P71 C;  5B8I A;  1S70 A;  1S95 A;  2WDE A;  5JPF A;  3N5U A;  1QFC A;  1JK7 A;  1Z2X A;  5HPE A;  5INB A;  2HYO A;  4O5G A;  4LU9 A;  5EQV A;  3T1I A;  2YVT A;  5IOH A;  2KKN A;  2Q8U A;  4O4K A;  1V73 A;  1UF3 A;  4FBK A;  5C1V A;  4UT2 A;  4DHL A;  2ZBM A;  4M0V A;  2P6B A;  3H61 A;  3IB8 A;  4KBP A;  1KBP A;  3ICF A;  4O24 A;  2BCD A;  4KKZ A;  4FBW A;  4V0V A;  1M63 A;  2USH A;  2QFR A;  2YEQ A;  4H2F A;  2NPP C;  4TUG A;  4I5N C;  1QHW A;  3FLO A;  1WAO 1; 
#chains in the Genus database with same CATH homology
 1HP1 A;  2IAE C;  4LTY A;  1G5B A;  3KBP A;  3DW8 C;  3H64 A;  2WDC A;  3K7V C;  3IVD A;  4H2G A;  2WDD A;  2JOG A;  1AUI A;  1S3L A;  4TUI A;  4ORC A;  3RQZ A;  1OIE A;  4H1S A;  1OI8 A;  1OID A;  2HY1 A;  4UT3 A;  4ZVZ A;  4H2I A;  1UTE A;  1FJM A;  3IVE A;  4J6O A;  3H63 A;  3C9F A;  5JJT A;  4YKE A;  2Z1A A;  1XZW A;  4DSY A;  4WWL A;  2GJU A;  2BQ8 X;  1TCO A;  3E7A A;  2WDF A;  4IL1 A;  3TGH A;  4B2O A;  4G9J A;  5GTU A;  3THO B;  4MOY A;  2Z06 A;  4MP0 A;  1U32 A;  3RL4 A;  2BDX A;  3EGG A;  2NXF A;  3CK2 A;  2IE3 C;  3H60 A;  4H1Y P;  4Q7F A;  4XPN A;  3ZU0 A;  2R17 A;  4UT3 B;  1W24 A;  5J28 A;  1SU1 A;  2QJC A;  3K7W C;  3ZTV A;  1MF8 A;  4UWQ A;  4LAC C;  2DXN A;  1HPU A;  2ZOA A;  3C5W C;  3EGH A;  4HD0 A;  5DNY A;  2O8G A;  2O8A A;  1T71 A;  4F0Z A;  3JYF A;  2A22 A;  3QG5 C;  3HVQ A;  2AHD A;  4IYP C;  2QFP A;  3H66 A;  3IB7 A;  3QFN A;  1HO5 A;  4JA9 A;  2DFJ A;  2Z72 A;  1IT6 A;  4MOV A;  3V4Y A;  4ORA A;  3DSD A;  3DSC A;  1T70 A;  3QFM A;  2NYM C;  1S3M A;  4JA7 A;  3GVE A;  2DXL A;  3E7B A;  3H68 A;  2IE4 C;  5JPE A;  3H62 B;  4FCX A;  1NNW A;  3RL5 A;  3QFK A;  3H67 A;  4V0X A;  4V0W A;  4ZX2 A;  1XM7 A;  5F3W A;  4OR9 A;  4O43 A;  2CV9 A;  2XMO A;  4NZV A;  3H69 A;  1S8E A;  4FBQ A;  3RL3 A;  3D03 A;  1S3N A;  2ZO9 B;  3PSO A;  3QFO A;  1Z2W A;  4I5L C;  1II7 A;  4H2B A;  2HYP A;  4DT2 A;  1USH A;  3THN A;  3PSN A;  2NYL C;  3E0J A;  4ORB A;  3AUZ A;  3LL8 A;  3AV0 A;  3FGA C;  1WAR A;  3P71 C;  5B8I A;  1S70 A;  1S95 A;  2WDE A;  5JPF A;  3N5U A;  1QFC A;  1JK7 A;  1Z2X A;  5HPE A;  5INB A;  2HYO A;  4O5G A;  4LU9 A;  5EQV A;  3T1I A;  2YVT A;  5IOH A;  2KKN A;  2Q8U A;  4O4K A;  1V73 A;  1UF3 A;  4FBK A;  5C1V A;  4UT2 A;  4DHL A;  2ZBM A;  4M0V A;  2P6B A;  3H61 A;  3IB8 A;  4KBP A;  1KBP A;  3ICF A;  4O24 A;  2BCD A;  4KKZ A;  4FBW A;  4V0V A;  1M63 A;  2USH A;  2QFR A;  2YEQ A;  4H2F A;  2NPP C;  4TUG A;  4I5N C;  1QHW A;  3FLO A;  1WAO 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...