1NNWA

Hypothetical protein from pyrococcus furiosus pfu-1218608
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
251
structure length
251
Chain Sequence
b'VYVAVLANIAGNLPALTAALSRIEEMREEGYEIEKYYILGNIVGLFPYPKEVIEVIKDLTKKENVKIIRGKYDQIIAMSDPHATDPGYIDKLELPGHVKKALKFTWEKLGHEGREYLRDLPIYLVDKIGGNEVFGVYGSPINPFDGEVLAEQPTSYYEAIMRPVKDYEMLIVASPMYPVDAMTRYGRVVCPGSVGFPPGKEHKATFALVDVDTLKPKFIEVEYDKKIIEERIRAEGLPEEIIKILYHGGRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Southeast Collaboratory for Structural Genomics: hypothetical protein from Pyrococcus furiosus Pfu-1218608
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 79
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1nnwA00
1T71A 3PSNA 3LL8A 4DT2A 2WDCA 3CK2A 1FJMA 4O43A 4MOYA 4J6OA 4OR9A 3P71C 1HO5A 1HPUA 3H61A 4FBWA 3T1IA 2WDDA 1IT6A 4H2GA 4H1SA 2BCDA 2NPPC 1S3NA 3AV0A 4H2FA 1QFCA 3DSDA 3GVEA 4HD0A 3KBPA 3HVQA 2Z72A 4F0ZA 1SU1A 3QFOA 4FCXA 4DHLA 3H69A 3K7VC 1XZWA 3E7AA 3H66A 2HYOA 3H60A 1HP1A 4V0VA 3IVDA 1AUIA 3QFNA 4Q7FA 1II7A 2HYPA 4TUGA 3H63A 4FBKA 4UT3B 3ZTVA 3E7BA 3K7WC 1S95A 4B2OA 2YVTA 5IOHA 2NYMC 2QFRA 2QJCA 2QFPA 2JOGA 4LTYA 4ZVZA 3QG5C 5DNYA 4I5LC 1NNWA 3QFMA 2BDXA 1OIDA 2O8AA 4KBPA 2XMOA 3C5WC 1MF8A 2ZBMA 2Q8UA 1W24A 3EGHA 4M0VA 3EGGA 1T70A 3RQZA 4FBQA 3RL4A 2CV9A 5HPEA 4TUIA 4V0WA 4O24A 4O4KA 1S70A 5EQVA 3IVEA 3THNA 2KKNA 3N5UA 4H1YP 4H2IA 2HY1A 4LU9A 5C1VA 4LACC 4JA9A 3V4YA 3RL5A 5JPFA 3ICFA 4YKEA 1U32A 2NYLC 2P6BA 1QHWA 4UT3A 5B8IA 1USHA 1V73A 2IE3C 2WDFA 1KBPA 2O8GA 2R17A 4XPNA 4ORBA 3PSOA 1UTEA 2Z1AA 3RL3A 4KKZA 4ZX2A 4I5NC 5INBA 2WDEA 1OI8A 4MP0A 2GJUA 3C9FA 3ZU0A 1S3MA 3DSCA 1OIEA 2DFJA 3H68A 4UWQA 2BQ8X 2USHA 3H67A 2A22A 3IB8A 4MOVA 5JJTA 5GTUA 1S8EA 1XM7A 4H2BA 4DSYA 3FGAC 4WWLA 4UT2A 1UF3A 2IAEC 3AUZA 4JA7A 1S3LA 5F3WA 1M63A 3IB7A 1Z2WA 1TCOA 2IE4C 2NXFA 4NZVA 1Z2XA 4IYPC 1WAO1 3H62B 4G9JA 1WARA 5JPEA 1G5BA 4V0XA 3H64A 3QFKA 3DW8C 4IL1A 4O5GA 4ORAA 2AHDA 3JYFA 3TGHA 3THOB 5J28A 2Z06A 4ORCA 1JK7A
chains in the Genus database with same CATH superfamily
1T71A 3PSNA 3LL8A 4DT2A 2WDCA 3CK2A 1FJMA 2DXNA 4O43A 2YEQA 4MOYA 4J6OA 4OR9A 2ZO9B 3P71C 1HO5A 1HPUA 3H61A 4FBWA 3T1IA 2WDDA 1IT6A 4H2GA 4H1SA 2BCDA 2NPPC 1S3NA 3AV0A 4H2FA 1QFCA 3DSDA 3GVEA 4HD0A 3KBPA 3HVQA 3E0JA 2Z72A 4F0ZA 1SU1A 3QFOA 4FCXA 4DHLA 3H69A 3K7VC 1XZWA 3E7AA 3H66A 2HYOA 3H60A 1HP1A 4V0VA 3IVDA 1AUIA 3QFNA 4Q7FA 1II7A 2HYPA 4TUGA 3H63A 4FBKA 4UT3B 3ZTVA 3E7BA 3K7WC 1S95A 4B2OA 2YVTA 5IOHA 2NYMC 2DXLA 2QFRA 2QJCA 2QFPA 2JOGA 4LTYA 4ZVZA 3QG5C 3D03A 5DNYA 4I5LC 1NNWA 3QFMA 2ZOAA 2BDXA 1OIDA 2O8AA 4KBPA 2XMOA 3C5WC 1MF8A 2ZBMA 2Q8UA 1W24A 3EGHA 4M0VA 3EGGA 1T70A 3RQZA 4FBQA 3RL4A 2CV9A 5HPEA 4TUIA 4V0WA 4O24A 4O4KA 1S70A 5EQVA 3IVEA 3THNA 2KKNA 3N5UA 4H1YP 4H2IA 2HY1A 4LU9A 5C1VA 4LACC 4JA9A 3V4YA 3RL5A 5JPFA 3ICFA 4YKEA 1U32A 2NYLC 2P6BA 1QHWA 4UT3A 5B8IA 1USHA 1V73A 2IE3C 2WDFA 1KBPA 2O8GA 2R17A 4XPNA 4ORBA 3PSOA 1UTEA 2Z1AA 3RL3A 4KKZA 4ZX2A 4I5NC 5INBA 2WDEA 1OI8A 4MP0A 3FLOA 2GJUA 3C9FA 3ZU0A 1S3MA 3DSCA 1OIEA 2DFJA 3H68A 4UWQA 2BQ8X 2USHA 3H67A 2A22A 3IB8A 4MOVA 5JJTA 5GTUA 1S8EA 1XM7A 4H2BA 4DSYA 3FGAC 4WWLA 4UT2A 1UF3A 2IAEC 3AUZA 4JA7A 1S3LA 5F3WA 1M63A 3IB7A 1Z2WA 1TCOA 2IE4C 2NXFA 4NZVA 1Z2XA 4IYPC 1WAO1 3H62B 4G9JA 1WARA 5JPEA 1G5BA 4V0XA 3H64A 3QFKA 3DW8C 4IL1A 4O5GA 4ORAA 2AHDA 3JYFA 3TGHA 3THOB 5J28A 2Z06A 4ORCA 1JK7A
chains in the Genus database with same CATH topology
1T71A 3PSNA 3LL8A 4DT2A 2WDCA 3CK2A 1FJMA 2DXNA 4O43A 2YEQA 4MOYA 4J6OA 4OR9A 2ZO9B 3P71C 1HO5A 1HPUA 3H61A 4FBWA 3T1IA 2WDDA 1IT6A 4H2GA 4H1SA 2BCDA 2NPPC 1S3NA 3AV0A 4H2FA 1QFCA 3DSDA 3GVEA 4HD0A 3KBPA 3HVQA 3E0JA 2Z72A 4F0ZA 1SU1A 3QFOA 4FCXA 4DHLA 3H69A 3K7VC 1XZWA 3E7AA 3H66A 2HYOA 3H60A 1HP1A 4V0VA 3IVDA 1AUIA 3QFNA 4Q7FA 1II7A 2HYPA 4TUGA 3H63A 4FBKA 4UT3B 3ZTVA 3E7BA 3K7WC 1S95A 4B2OA 2YVTA 5IOHA 2NYMC 2DXLA 2QFRA 2QJCA 2QFPA 2JOGA 4LTYA 4ZVZA 3QG5C 3D03A 5DNYA 4I5LC 1NNWA 3QFMA 2ZOAA 2BDXA 1OIDA 2O8AA 4KBPA 2XMOA 3C5WC 1MF8A 2ZBMA 2Q8UA 1W24A 3EGHA 4M0VA 3EGGA 1T70A 3RQZA 4FBQA 3RL4A 2CV9A 5HPEA 4TUIA 4V0WA 4O24A 4O4KA 1S70A 5EQVA 3IVEA 3THNA 2KKNA 3N5UA 4H1YP 4H2IA 2HY1A 4LU9A 5C1VA 4LACC 4JA9A 3V4YA 3RL5A 5JPFA 3ICFA 4YKEA 1U32A 2NYLC 2P6BA 1QHWA 4UT3A 5B8IA 1USHA 1V73A 2IE3C 2WDFA 1KBPA 2O8GA 2R17A 4XPNA 4ORBA 3PSOA 1UTEA 2Z1AA 3RL3A 4KKZA 4ZX2A 4I5NC 5INBA 2WDEA 1OI8A 4MP0A 3FLOA 2GJUA 3C9FA 3ZU0A 1S3MA 3DSCA 1OIEA 2DFJA 3H68A 4UWQA 2BQ8X 2USHA 3H67A 2A22A 3IB8A 4MOVA 5JJTA 5GTUA 1S8EA 1XM7A 4H2BA 4DSYA 3FGAC 4WWLA 4UT2A 1UF3A 2IAEC 3AUZA 4JA7A 1S3LA 5F3WA 1M63A 3IB7A 1Z2WA 1TCOA 2IE4C 2NXFA 4NZVA 1Z2XA 4IYPC 1WAO1 3H62B 4G9JA 1WARA 5JPEA 1G5BA 4V0XA 3H64A 3QFKA 3DW8C 4IL1A 4O5GA 4ORAA 2AHDA 3JYFA 3TGHA 3THOB 5J28A 2Z06A 4ORCA 1JK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T71 A;  3PSN A;  3LL8 A;  4DT2 A;  2WDC A;  3CK2 A;  1FJM A;  4O43 A;  4MOY A;  4J6O A;  4OR9 A;  3P71 C;  1HO5 A;  1HPU A;  3H61 A;  4FBW A;  3T1I A;  2WDD A;  1IT6 A;  4H2G A;  4H1S A;  2BCD A;  2NPP C;  1S3N A;  3AV0 A;  4H2F A;  1QFC A;  3DSD A;  3GVE A;  4HD0 A;  3KBP A;  3HVQ A;  2Z72 A;  4F0Z A;  1SU1 A;  3QFO A;  4FCX A;  4DHL A;  3H69 A;  3K7V C;  1XZW A;  3E7A A;  3H66 A;  2HYO A;  3H60 A;  1HP1 A;  4V0V A;  3IVD A;  1AUI A;  3QFN A;  4Q7F A;  1II7 A;  2HYP A;  4TUG A;  3H63 A;  4FBK A;  4UT3 B;  3ZTV A;  3E7B A;  3K7W C;  1S95 A;  4B2O A;  2YVT A;  5IOH A;  2NYM C;  2QFR A;  2QJC A;  2QFP A;  2JOG A;  4LTY A;  4ZVZ A;  3QG5 C;  5DNY A;  4I5L C;  1NNW A;  3QFM A;  2BDX A;  1OID A;  2O8A A;  4KBP A;  2XMO A;  3C5W C;  1MF8 A;  2ZBM A;  2Q8U A;  1W24 A;  3EGH A;  4M0V A;  3EGG A;  1T70 A;  3RQZ A;  4FBQ A;  3RL4 A;  2CV9 A;  5HPE A;  4TUI A;  4V0W A;  4O24 A;  4O4K A;  1S70 A;  5EQV A;  3IVE A;  3THN A;  2KKN A;  3N5U A;  4H1Y P;  4H2I A;  2HY1 A;  4LU9 A;  5C1V A;  4LAC C;  4JA9 A;  3V4Y A;  3RL5 A;  5JPF A;  3ICF A;  4YKE A;  1U32 A;  2NYL C;  2P6B A;  1QHW A;  4UT3 A;  5B8I A;  1USH A;  1V73 A;  2IE3 C;  2WDF A;  1KBP A;  2O8G A;  2R17 A;  4XPN A;  4ORB A;  3PSO A;  1UTE A;  2Z1A A;  3RL3 A;  4KKZ A;  4ZX2 A;  4I5N C;  5INB A;  2WDE A;  1OI8 A;  4MP0 A;  2GJU A;  3C9F A;  3ZU0 A;  1S3M A;  3DSC A;  1OIE A;  2DFJ A;  3H68 A;  4UWQ A;  2BQ8 X;  2USH A;  3H67 A;  2A22 A;  3IB8 A;  4MOV A;  5JJT A;  5GTU A;  1S8E A;  1XM7 A;  4H2B A;  4DSY A;  3FGA C;  4WWL A;  4UT2 A;  1UF3 A;  2IAE C;  3AUZ A;  4JA7 A;  1S3L A;  5F3W A;  1M63 A;  3IB7 A;  1Z2W A;  1TCO A;  2IE4 C;  2NXF A;  4NZV A;  1Z2X A;  4IYP C;  1WAO 1;  3H62 B;  4G9J A;  1WAR A;  5JPE A;  1G5B A;  4V0X A;  3H64 A;  3QFK A;  3DW8 C;  4IL1 A;  4O5G A;  4ORA A;  2AHD A;  3JYF A;  3TGH A;  3THO B;  5J28 A;  2Z06 A;  4ORC A;  1JK7 A; 
#chains in the Genus database with same CATH topology
 1T71 A;  3PSN A;  3LL8 A;  4DT2 A;  2WDC A;  3CK2 A;  1FJM A;  2DXN A;  4O43 A;  2YEQ A;  4MOY A;  4J6O A;  4OR9 A;  2ZO9 B;  3P71 C;  1HO5 A;  1HPU A;  3H61 A;  4FBW A;  3T1I A;  2WDD A;  1IT6 A;  4H2G A;  4H1S A;  2BCD A;  2NPP C;  1S3N A;  3AV0 A;  4H2F A;  1QFC A;  3DSD A;  3GVE A;  4HD0 A;  3KBP A;  3HVQ A;  3E0J A;  2Z72 A;  4F0Z A;  1SU1 A;  3QFO A;  4FCX A;  4DHL A;  3H69 A;  3K7V C;  1XZW A;  3E7A A;  3H66 A;  2HYO A;  3H60 A;  1HP1 A;  4V0V A;  3IVD A;  1AUI A;  3QFN A;  4Q7F A;  1II7 A;  2HYP A;  4TUG A;  3H63 A;  4FBK A;  4UT3 B;  3ZTV A;  3E7B A;  3K7W C;  1S95 A;  4B2O A;  2YVT A;  5IOH A;  2NYM C;  2DXL A;  2QFR A;  2QJC A;  2QFP A;  2JOG A;  4LTY A;  4ZVZ A;  3QG5 C;  3D03 A;  5DNY A;  4I5L C;  1NNW A;  3QFM A;  2ZOA A;  2BDX A;  1OID A;  2O8A A;  4KBP A;  2XMO A;  3C5W C;  1MF8 A;  2ZBM A;  2Q8U A;  1W24 A;  3EGH A;  4M0V A;  3EGG A;  1T70 A;  3RQZ A;  4FBQ A;  3RL4 A;  2CV9 A;  5HPE A;  4TUI A;  4V0W A;  4O24 A;  4O4K A;  1S70 A;  5EQV A;  3IVE A;  3THN A;  2KKN A;  3N5U A;  4H1Y P;  4H2I A;  2HY1 A;  4LU9 A;  5C1V A;  4LAC C;  4JA9 A;  3V4Y A;  3RL5 A;  5JPF A;  3ICF A;  4YKE A;  1U32 A;  2NYL C;  2P6B A;  1QHW A;  4UT3 A;  5B8I A;  1USH A;  1V73 A;  2IE3 C;  2WDF A;  1KBP A;  2O8G A;  2R17 A;  4XPN A;  4ORB A;  3PSO A;  1UTE A;  2Z1A A;  3RL3 A;  4KKZ A;  4ZX2 A;  4I5N C;  5INB A;  2WDE A;  1OI8 A;  4MP0 A;  3FLO A;  2GJU A;  3C9F A;  3ZU0 A;  1S3M A;  3DSC A;  1OIE A;  2DFJ A;  3H68 A;  4UWQ A;  2BQ8 X;  2USH A;  3H67 A;  2A22 A;  3IB8 A;  4MOV A;  5JJT A;  5GTU A;  1S8E A;  1XM7 A;  4H2B A;  4DSY A;  3FGA C;  4WWL A;  4UT2 A;  1UF3 A;  2IAE C;  3AUZ A;  4JA7 A;  1S3L A;  5F3W A;  1M63 A;  3IB7 A;  1Z2W A;  1TCO A;  2IE4 C;  2NXF A;  4NZV A;  1Z2X A;  4IYP C;  1WAO 1;  3H62 B;  4G9J A;  1WAR A;  5JPE A;  1G5B A;  4V0X A;  3H64 A;  3QFK A;  3DW8 C;  4IL1 A;  4O5G A;  4ORA A;  2AHD A;  3JYF A;  3TGH A;  3THO B;  5J28 A;  2Z06 A;  4ORC A;  1JK7 A; 
#chains in the Genus database with same CATH homology
 1T71 A;  3PSN A;  3LL8 A;  4DT2 A;  2WDC A;  3CK2 A;  1FJM A;  2DXN A;  4O43 A;  2YEQ A;  4MOY A;  4J6O A;  4OR9 A;  2ZO9 B;  3P71 C;  1HO5 A;  1HPU A;  3H61 A;  4FBW A;  3T1I A;  2WDD A;  1IT6 A;  4H2G A;  4H1S A;  2BCD A;  2NPP C;  1S3N A;  3AV0 A;  4H2F A;  1QFC A;  3DSD A;  3GVE A;  4HD0 A;  3KBP A;  3HVQ A;  3E0J A;  2Z72 A;  4F0Z A;  1SU1 A;  3QFO A;  4FCX A;  4DHL A;  3H69 A;  3K7V C;  1XZW A;  3E7A A;  3H66 A;  2HYO A;  3H60 A;  1HP1 A;  4V0V A;  3IVD A;  1AUI A;  3QFN A;  4Q7F A;  1II7 A;  2HYP A;  4TUG A;  3H63 A;  4FBK A;  4UT3 B;  3ZTV A;  3E7B A;  3K7W C;  1S95 A;  4B2O A;  2YVT A;  5IOH A;  2NYM C;  2DXL A;  2QFR A;  2QJC A;  2QFP A;  2JOG A;  4LTY A;  4ZVZ A;  3QG5 C;  3D03 A;  5DNY A;  4I5L C;  1NNW A;  3QFM A;  2ZOA A;  2BDX A;  1OID A;  2O8A A;  4KBP A;  2XMO A;  3C5W C;  1MF8 A;  2ZBM A;  2Q8U A;  1W24 A;  3EGH A;  4M0V A;  3EGG A;  1T70 A;  3RQZ A;  4FBQ A;  3RL4 A;  2CV9 A;  5HPE A;  4TUI A;  4V0W A;  4O24 A;  4O4K A;  1S70 A;  5EQV A;  3IVE A;  3THN A;  2KKN A;  3N5U A;  4H1Y P;  4H2I A;  2HY1 A;  4LU9 A;  5C1V A;  4LAC C;  4JA9 A;  3V4Y A;  3RL5 A;  5JPF A;  3ICF A;  4YKE A;  1U32 A;  2NYL C;  2P6B A;  1QHW A;  4UT3 A;  5B8I A;  1USH A;  1V73 A;  2IE3 C;  2WDF A;  1KBP A;  2O8G A;  2R17 A;  4XPN A;  4ORB A;  3PSO A;  1UTE A;  2Z1A A;  3RL3 A;  4KKZ A;  4ZX2 A;  4I5N C;  5INB A;  2WDE A;  1OI8 A;  4MP0 A;  3FLO A;  2GJU A;  3C9F A;  3ZU0 A;  1S3M A;  3DSC A;  1OIE A;  2DFJ A;  3H68 A;  4UWQ A;  2BQ8 X;  2USH A;  3H67 A;  2A22 A;  3IB8 A;  4MOV A;  5JJT A;  5GTU A;  1S8E A;  1XM7 A;  4H2B A;  4DSY A;  3FGA C;  4WWL A;  4UT2 A;  1UF3 A;  2IAE C;  3AUZ A;  4JA7 A;  1S3L A;  5F3W A;  1M63 A;  3IB7 A;  1Z2W A;  1TCO A;  2IE4 C;  2NXF A;  4NZV A;  1Z2X A;  4IYP C;  1WAO 1;  3H62 B;  4G9J A;  1WAR A;  5JPE A;  1G5B A;  4V0X A;  3H64 A;  3QFK A;  3DW8 C;  4IL1 A;  4O5G A;  4ORA A;  2AHD A;  3JYF A;  3TGH A;  3THO B;  5J28 A;  2Z06 A;  4ORC A;  1JK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...