4WWLA

E. coli 5'-nucleotidase mutant i521c labeled with mtsl (intermediate form)
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFCDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title E. coli 5'-nucleotidase mutant I521C labeled with MTSL (intermediate form)
rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
molecule keywords Protein UshA
total genus 183
structure length 525
sequence length 525
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4wwlA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 4wwlA02
1T70A 5J28A 2IAEC 2XMOA 4Q7FA 3AUZA 3C5WC 1M63A 3H67A 2NXFA 2USHA 4MOYA 5HPEA 3K7WC 4UWQA 3IB7A 4KBPA 4UT3B 4KKZA 2CV9A 3H68A 4G9JA 4V0VA 3QFNA 3QFOA 2A22A 1QFCA 1Z2XA 3DW8C 3THNA 5JJTA 2HYOA 3H69A 1KBPA 5JPFA 4FBQA 4FCXA 4NZVA 1OIEA 4DT2A 2NYLC 3H60A 3KBPA 4M0VA 4O4KA 4IL1A 4JA9A 2QFRA 4UT2A 1Z2WA 3IVEA 4IYPC 3K7VC 3ICFA 4B2OA 1S70A 1FJMA 4JA7A 3H62B 3ZU0A 1OI8A 1T71A 2P6BA 3QFMA 1UTEA 1XZWA 3IVDA 1IT6A 4OR9A 4DSYA 1AUIA 2O8AA 5EQVA 3T1IA 2JOGA 2NPPC 3HVQA 2HYPA 4ORBA 5C1VA 2QJCA 2BQ8X 4J6OA 1NNWA 1S8EA 3FGAC 1WARA 3PSOA 4LTYA 4O43A 2Z1AA 4ORCA 4YKEA 3H64A 4ORAA 3QG5C 1USHA 3N5UA 4TUIA 2KKNA 2BDXA 4DHLA 1HP1A 3P71C 4F0ZA 5JPEA 2QFPA 4H2IA 4ZVZA 3RL5A 4O5GA 5IOHA 2Z06A 4V0XA 3PSNA 3RQZA 3AV0A 4FBWA 1XM7A 3H61A 1W24A 2WDDA 3JYFA 4V0WA 5B8IA 3DSCA 4MP0A 4UT3A 1G5BA 2WDCA 2IE4C 4H1SA 4XPNA 3THOB 2YVTA 3EGHA 4H2BA 2O8GA 1SU1A 1QHWA 2WDEA 4I5NC 2AHDA 3ZTVA 1MF8A 1S3LA 2ZBMA 3H66A 1JK7A 3LL8A 3RL3A 4H2GA 3EGGA 2IE3C 1TCOA 1V73A 4I5LC 4LACC 4TUGA 4FBKA 3IB8A 1II7A 4LU9A 5GTUA 3V4YA 3TGHA 3CK2A 2WDFA 3GVEA 1S3MA 2Z72A 3QFKA 3RL4A 1WAO1 1UF3A 3E7AA 3H63A 5DNYA 5INBA 3C9FA 2NYMC 4WWLA 1OIDA 5F3WA 2GJUA 2Q8UA 4ZX2A 1HO5A 1U32A 3DSDA 3E7BA 2R17A 2BCDA 1S95A 4HD0A 4H1YP 1S3NA 4O24A 1HPUA 2DFJA 4MOVA 4H2FA 2HY1A
chains in the Genus database with same CATH superfamily
1T70A 5J28A 2IAEC 2XMOA 4Q7FA 3AUZA 3C5WC 1M63A 3H67A 2NXFA 2USHA 4MOYA 5HPEA 3K7WC 4UWQA 3IB7A 4KBPA 4UT3B 4KKZA 2CV9A 3H68A 4G9JA 4V0VA 3QFNA 3QFOA 2A22A 1QFCA 1Z2XA 3DW8C 3THNA 5JJTA 2DXLA 2HYOA 3H69A 1KBPA 5JPFA 4FBQA 4FCXA 4NZVA 1OIEA 4DT2A 2NYLC 3H60A 3KBPA 4M0VA 4O4KA 4IL1A 4JA9A 2QFRA 4UT2A 1Z2WA 3IVEA 4IYPC 3K7VC 3ICFA 4B2OA 1S70A 1FJMA 4JA7A 3D03A 3H62B 3ZU0A 1OI8A 1T71A 2P6BA 3QFMA 1UTEA 1XZWA 3IVDA 1IT6A 4OR9A 4DSYA 1AUIA 2O8AA 5EQVA 3T1IA 2JOGA 2NPPC 3HVQA 2HYPA 4ORBA 5C1VA 2QJCA 2BQ8X 4J6OA 1NNWA 1S8EA 3FGAC 1WARA 3PSOA 4LTYA 4O43A 2Z1AA 4ORCA 4YKEA 3H64A 4ORAA 3QG5C 1USHA 3N5UA 4TUIA 2KKNA 2BDXA 4DHLA 1HP1A 3P71C 4F0ZA 5JPEA 2YEQA 2QFPA 4H2IA 4ZVZA 3RL5A 4O5GA 5IOHA 2Z06A 4V0XA 3PSNA 3RQZA 3AV0A 3FLOA 4FBWA 1XM7A 3H61A 1W24A 2WDDA 3JYFA 4V0WA 5B8IA 3DSCA 4MP0A 4UT3A 1G5BA 2WDCA 2IE4C 4H1SA 4XPNA 3THOB 2YVTA 3EGHA 4H2BA 2O8GA 3E0JA 1SU1A 1QHWA 2WDEA 4I5NC 2AHDA 3ZTVA 1MF8A 1S3LA 2ZBMA 3H66A 1JK7A 3LL8A 3RL3A 4H2GA 3EGGA 2IE3C 1TCOA 1V73A 4I5LC 4LACC 4TUGA 4FBKA 3IB8A 1II7A 4LU9A 5GTUA 3V4YA 3TGHA 3CK2A 2WDFA 3GVEA 1S3MA 2Z72A 3QFKA 3RL4A 2ZO9B 1WAO1 1UF3A 3E7AA 3H63A 5DNYA 5INBA 3C9FA 2NYMC 2DXNA 4WWLA 1OIDA 5F3WA 2GJUA 2Q8UA 4ZX2A 1HO5A 1U32A 2ZOAA 3DSDA 3E7BA 2R17A 2BCDA 1S95A 4HD0A 4H1YP 1S3NA 4O24A 1HPUA 2DFJA 4MOVA 4H2FA 2HY1A
chains in the Genus database with same CATH topology
1T70A 5J28A 2IAEC 2XMOA 4Q7FA 3AUZA 3C5WC 1M63A 3H67A 2NXFA 2USHA 4MOYA 5HPEA 3K7WC 4UWQA 3IB7A 4KBPA 4UT3B 4KKZA 2CV9A 3H68A 4G9JA 4V0VA 3QFNA 3QFOA 2A22A 1QFCA 1Z2XA 3DW8C 3THNA 5JJTA 2DXLA 2HYOA 3H69A 1KBPA 5JPFA 4FBQA 4FCXA 4NZVA 1OIEA 4DT2A 2NYLC 3H60A 3KBPA 4M0VA 4O4KA 4IL1A 4JA9A 2QFRA 4UT2A 1Z2WA 3IVEA 4IYPC 3K7VC 3ICFA 4B2OA 1S70A 1FJMA 4JA7A 3D03A 3H62B 3ZU0A 1OI8A 1T71A 2P6BA 3QFMA 1UTEA 1XZWA 3IVDA 1IT6A 4OR9A 4DSYA 1AUIA 2O8AA 5EQVA 3T1IA 2JOGA 2NPPC 3HVQA 2HYPA 4ORBA 5C1VA 2QJCA 2BQ8X 4J6OA 1NNWA 1S8EA 3FGAC 1WARA 3PSOA 4LTYA 4O43A 2Z1AA 4ORCA 4YKEA 3H64A 4ORAA 3QG5C 1USHA 3N5UA 4TUIA 2KKNA 2BDXA 4DHLA 1HP1A 3P71C 4F0ZA 5JPEA 2YEQA 2QFPA 4H2IA 4ZVZA 3RL5A 4O5GA 5IOHA 2Z06A 4V0XA 3PSNA 3RQZA 3AV0A 3FLOA 4FBWA 1XM7A 3H61A 1W24A 2WDDA 3JYFA 4V0WA 5B8IA 3DSCA 4MP0A 4UT3A 1G5BA 2WDCA 2IE4C 4H1SA 4XPNA 3THOB 2YVTA 3EGHA 4H2BA 2O8GA 3E0JA 1SU1A 1QHWA 2WDEA 4I5NC 2AHDA 3ZTVA 1MF8A 1S3LA 2ZBMA 3H66A 1JK7A 3LL8A 3RL3A 4H2GA 3EGGA 2IE3C 1TCOA 1V73A 4I5LC 4LACC 4TUGA 4FBKA 3IB8A 1II7A 4LU9A 5GTUA 3V4YA 3TGHA 3CK2A 2WDFA 3GVEA 1S3MA 2Z72A 3QFKA 3RL4A 2ZO9B 1WAO1 1UF3A 3E7AA 3H63A 5DNYA 5INBA 3C9FA 2NYMC 2DXNA 4WWLA 1OIDA 5F3WA 2GJUA 2Q8UA 4ZX2A 1HO5A 1U32A 2ZOAA 3DSDA 3E7BA 2R17A 2BCDA 1S95A 4HD0A 4H1YP 1S3NA 4O24A 1HPUA 2DFJA 4MOVA 4H2FA 2HY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T70 A;  5J28 A;  2IAE C;  2XMO A;  4Q7F A;  3AUZ A;  3C5W C;  1M63 A;  3H67 A;  2NXF A;  2USH A;  4MOY A;  5HPE A;  3K7W C;  4UWQ A;  3IB7 A;  4KBP A;  4UT3 B;  4KKZ A;  2CV9 A;  3H68 A;  4G9J A;  4V0V A;  3QFN A;  3QFO A;  2A22 A;  1QFC A;  1Z2X A;  3DW8 C;  3THN A;  5JJT A;  2HYO A;  3H69 A;  1KBP A;  5JPF A;  4FBQ A;  4FCX A;  4NZV A;  1OIE A;  4DT2 A;  2NYL C;  3H60 A;  3KBP A;  4M0V A;  4O4K A;  4IL1 A;  4JA9 A;  2QFR A;  4UT2 A;  1Z2W A;  3IVE A;  4IYP C;  3K7V C;  3ICF A;  4B2O A;  1S70 A;  1FJM A;  4JA7 A;  3H62 B;  3ZU0 A;  1OI8 A;  1T71 A;  2P6B A;  3QFM A;  1UTE A;  1XZW A;  3IVD A;  1IT6 A;  4OR9 A;  4DSY A;  1AUI A;  2O8A A;  5EQV A;  3T1I A;  2JOG A;  2NPP C;  3HVQ A;  2HYP A;  4ORB A;  5C1V A;  2QJC A;  2BQ8 X;  4J6O A;  1NNW A;  1S8E A;  3FGA C;  1WAR A;  3PSO A;  4LTY A;  4O43 A;  2Z1A A;  4ORC A;  4YKE A;  3H64 A;  4ORA A;  3QG5 C;  1USH A;  3N5U A;  4TUI A;  2KKN A;  2BDX A;  4DHL A;  1HP1 A;  3P71 C;  4F0Z A;  5JPE A;  2QFP A;  4H2I A;  4ZVZ A;  3RL5 A;  4O5G A;  5IOH A;  2Z06 A;  4V0X A;  3PSN A;  3RQZ A;  3AV0 A;  4FBW A;  1XM7 A;  3H61 A;  1W24 A;  2WDD A;  3JYF A;  4V0W A;  5B8I A;  3DSC A;  4MP0 A;  4UT3 A;  1G5B A;  2WDC A;  2IE4 C;  4H1S A;  4XPN A;  3THO B;  2YVT A;  3EGH A;  4H2B A;  2O8G A;  1SU1 A;  1QHW A;  2WDE A;  4I5N C;  2AHD A;  3ZTV A;  1MF8 A;  1S3L A;  2ZBM A;  3H66 A;  1JK7 A;  3LL8 A;  3RL3 A;  4H2G A;  3EGG A;  2IE3 C;  1TCO A;  1V73 A;  4I5L C;  4LAC C;  4TUG A;  4FBK A;  3IB8 A;  1II7 A;  4LU9 A;  5GTU A;  3V4Y A;  3TGH A;  3CK2 A;  2WDF A;  3GVE A;  1S3M A;  2Z72 A;  3QFK A;  3RL4 A;  1WAO 1;  1UF3 A;  3E7A A;  3H63 A;  5DNY A;  5INB A;  3C9F A;  2NYM C;  4WWL A;  1OID A;  5F3W A;  2GJU A;  2Q8U A;  4ZX2 A;  1HO5 A;  1U32 A;  3DSD A;  3E7B A;  2R17 A;  2BCD A;  1S95 A;  4HD0 A;  4H1Y P;  1S3N A;  4O24 A;  1HPU A;  2DFJ A;  4MOV A;  4H2F A;  2HY1 A; 
#chains in the Genus database with same CATH topology
 1T70 A;  5J28 A;  2IAE C;  2XMO A;  4Q7F A;  3AUZ A;  3C5W C;  1M63 A;  3H67 A;  2NXF A;  2USH A;  4MOY A;  5HPE A;  3K7W C;  4UWQ A;  3IB7 A;  4KBP A;  4UT3 B;  4KKZ A;  2CV9 A;  3H68 A;  4G9J A;  4V0V A;  3QFN A;  3QFO A;  2A22 A;  1QFC A;  1Z2X A;  3DW8 C;  3THN A;  5JJT A;  2DXL A;  2HYO A;  3H69 A;  1KBP A;  5JPF A;  4FBQ A;  4FCX A;  4NZV A;  1OIE A;  4DT2 A;  2NYL C;  3H60 A;  3KBP A;  4M0V A;  4O4K A;  4IL1 A;  4JA9 A;  2QFR A;  4UT2 A;  1Z2W A;  3IVE A;  4IYP C;  3K7V C;  3ICF A;  4B2O A;  1S70 A;  1FJM A;  4JA7 A;  3D03 A;  3H62 B;  3ZU0 A;  1OI8 A;  1T71 A;  2P6B A;  3QFM A;  1UTE A;  1XZW A;  3IVD A;  1IT6 A;  4OR9 A;  4DSY A;  1AUI A;  2O8A A;  5EQV A;  3T1I A;  2JOG A;  2NPP C;  3HVQ A;  2HYP A;  4ORB A;  5C1V A;  2QJC A;  2BQ8 X;  4J6O A;  1NNW A;  1S8E A;  3FGA C;  1WAR A;  3PSO A;  4LTY A;  4O43 A;  2Z1A A;  4ORC A;  4YKE A;  3H64 A;  4ORA A;  3QG5 C;  1USH A;  3N5U A;  4TUI A;  2KKN A;  2BDX A;  4DHL A;  1HP1 A;  3P71 C;  4F0Z A;  5JPE A;  2YEQ A;  2QFP A;  4H2I A;  4ZVZ A;  3RL5 A;  4O5G A;  5IOH A;  2Z06 A;  4V0X A;  3PSN A;  3RQZ A;  3AV0 A;  3FLO A;  4FBW A;  1XM7 A;  3H61 A;  1W24 A;  2WDD A;  3JYF A;  4V0W A;  5B8I A;  3DSC A;  4MP0 A;  4UT3 A;  1G5B A;  2WDC A;  2IE4 C;  4H1S A;  4XPN A;  3THO B;  2YVT A;  3EGH A;  4H2B A;  2O8G A;  3E0J A;  1SU1 A;  1QHW A;  2WDE A;  4I5N C;  2AHD A;  3ZTV A;  1MF8 A;  1S3L A;  2ZBM A;  3H66 A;  1JK7 A;  3LL8 A;  3RL3 A;  4H2G A;  3EGG A;  2IE3 C;  1TCO A;  1V73 A;  4I5L C;  4LAC C;  4TUG A;  4FBK A;  3IB8 A;  1II7 A;  4LU9 A;  5GTU A;  3V4Y A;  3TGH A;  3CK2 A;  2WDF A;  3GVE A;  1S3M A;  2Z72 A;  3QFK A;  3RL4 A;  2ZO9 B;  1WAO 1;  1UF3 A;  3E7A A;  3H63 A;  5DNY A;  5INB A;  3C9F A;  2NYM C;  2DXN A;  4WWL A;  1OID A;  5F3W A;  2GJU A;  2Q8U A;  4ZX2 A;  1HO5 A;  1U32 A;  2ZOA A;  3DSD A;  3E7B A;  2R17 A;  2BCD A;  1S95 A;  4HD0 A;  4H1Y P;  1S3N A;  4O24 A;  1HPU A;  2DFJ A;  4MOV A;  4H2F A;  2HY1 A; 
#chains in the Genus database with same CATH homology
 1T70 A;  5J28 A;  2IAE C;  2XMO A;  4Q7F A;  3AUZ A;  3C5W C;  1M63 A;  3H67 A;  2NXF A;  2USH A;  4MOY A;  5HPE A;  3K7W C;  4UWQ A;  3IB7 A;  4KBP A;  4UT3 B;  4KKZ A;  2CV9 A;  3H68 A;  4G9J A;  4V0V A;  3QFN A;  3QFO A;  2A22 A;  1QFC A;  1Z2X A;  3DW8 C;  3THN A;  5JJT A;  2DXL A;  2HYO A;  3H69 A;  1KBP A;  5JPF A;  4FBQ A;  4FCX A;  4NZV A;  1OIE A;  4DT2 A;  2NYL C;  3H60 A;  3KBP A;  4M0V A;  4O4K A;  4IL1 A;  4JA9 A;  2QFR A;  4UT2 A;  1Z2W A;  3IVE A;  4IYP C;  3K7V C;  3ICF A;  4B2O A;  1S70 A;  1FJM A;  4JA7 A;  3D03 A;  3H62 B;  3ZU0 A;  1OI8 A;  1T71 A;  2P6B A;  3QFM A;  1UTE A;  1XZW A;  3IVD A;  1IT6 A;  4OR9 A;  4DSY A;  1AUI A;  2O8A A;  5EQV A;  3T1I A;  2JOG A;  2NPP C;  3HVQ A;  2HYP A;  4ORB A;  5C1V A;  2QJC A;  2BQ8 X;  4J6O A;  1NNW A;  1S8E A;  3FGA C;  1WAR A;  3PSO A;  4LTY A;  4O43 A;  2Z1A A;  4ORC A;  4YKE A;  3H64 A;  4ORA A;  3QG5 C;  1USH A;  3N5U A;  4TUI A;  2KKN A;  2BDX A;  4DHL A;  1HP1 A;  3P71 C;  4F0Z A;  5JPE A;  2YEQ A;  2QFP A;  4H2I A;  4ZVZ A;  3RL5 A;  4O5G A;  5IOH A;  2Z06 A;  4V0X A;  3PSN A;  3RQZ A;  3AV0 A;  3FLO A;  4FBW A;  1XM7 A;  3H61 A;  1W24 A;  2WDD A;  3JYF A;  4V0W A;  5B8I A;  3DSC A;  4MP0 A;  4UT3 A;  1G5B A;  2WDC A;  2IE4 C;  4H1S A;  4XPN A;  3THO B;  2YVT A;  3EGH A;  4H2B A;  2O8G A;  3E0J A;  1SU1 A;  1QHW A;  2WDE A;  4I5N C;  2AHD A;  3ZTV A;  1MF8 A;  1S3L A;  2ZBM A;  3H66 A;  1JK7 A;  3LL8 A;  3RL3 A;  4H2G A;  3EGG A;  2IE3 C;  1TCO A;  1V73 A;  4I5L C;  4LAC C;  4TUG A;  4FBK A;  3IB8 A;  1II7 A;  4LU9 A;  5GTU A;  3V4Y A;  3TGH A;  3CK2 A;  2WDF A;  3GVE A;  1S3M A;  2Z72 A;  3QFK A;  3RL4 A;  2ZO9 B;  1WAO 1;  1UF3 A;  3E7A A;  3H63 A;  5DNY A;  5INB A;  3C9F A;  2NYM C;  2DXN A;  4WWL A;  1OID A;  5F3W A;  2GJU A;  2Q8U A;  4ZX2 A;  1HO5 A;  1U32 A;  2ZOA A;  3DSD A;  3E7B A;  2R17 A;  2BCD A;  1S95 A;  4HD0 A;  4H1Y P;  1S3N A;  4O24 A;  1HPU A;  2DFJ A;  4MOV A;  4H2F A;  2HY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...