4MOVA

1.45 a resolution crystal structure of protein phosphatase 1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Understanding the antagonism of retinoblastoma protein dephosphorylation by PNUTS provides insights into the PP1 regulatory code.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4movA00
1QFCA 2NXFA 1G5BA 1S70A 4DSYA 2Z06A 1AUIA 2AHDA 2WDDA 2IE3C 5IOHA 3HVQA 4G9JA 2QFRA 1S8EA 2GJUA 3EGHA 5EQVA 2YVTA 2HY1A 2HYPA 4XPNA 4O4KA 2QJCA 2Z72A 1SU1A 3PSNA 4ORAA 2R17A 2NPPC 3FGAC 3GVEA 3T1IA 4IL1A 4H2BA 3H68A 3K7WC 5B8IA 5JJTA 2NYLC 2WDEA 3AV0A 3V4YA 1Z2WA 4UWQA 3QG5C 3N5UA 3QFMA 1OIDA 1W24A 4JA9A 3C9FA 1OI8A 3QFOA 4YKEA 4WWLA 3ICFA 3IB7A 4J6OA 4Q7FA 5HPEA 1USHA 3AUZA 4MOYA 1QHWA 5J28A 2ZBMA 1M63A 2QFPA 4MOVA 1OIEA 3QFKA 2P6BA 1S3NA 3IVEA 3KBPA 3LL8A 1V73A 3RL3A 1U32A 5JPEA 4O5GA 3ZTVA 3H67A 3RQZA 4ORCA 4H1SA 3CK2A 2BQ8X 4FBWA 4DT2A 3C5WC 1FJMA 4FBKA 3DSDA 4LACC 1WARA 4NZVA 3QFNA 1XM7A 1HO5A 4IYPC 2Z1AA 3IB8A 3RL4A 1XZWA 1S95A 1HPUA 1S3MA 2NYMC 1TCOA 2Q8UA 2BDXA 2XMOA 3PSOA 4TUIA 4O24A 3JYFA 5C1VA 4V0XA 3THNA 5F3WA 1UF3A 4JA7A 2IE4C 3H60A 4KKZA 3H66A 2USHA 2IAEC 1WAO1 1MF8A 1JK7A 3DSCA 1IT6A 3ZU0A 3E7BA 3TGHA 4MP0A 3H62B 3K7VC 2WDFA 4H2IA 4UT3A 4UT3B 4ORBA 1T71A 2DFJA 1Z2XA 4B2OA 4DHLA 1S3LA 5INBA 3H64A 4LTYA 2WDCA 3E7AA 2O8AA 1HP1A 2A22A 4HD0A 1UTEA 4V0VA 3RL5A 5GTUA 1II7A 2KKNA 3DW8C 4V0WA 5DNYA 4O43A 1KBPA 1T70A 4H2FA 4ZX2A 4FBQA 4UT2A 4I5LC 3P71C 4KBPA 4LU9A 5JPFA 2HYOA 2CV9A 3H61A 3IVDA 3H69A 4H2GA 4F0ZA 3H63A 3THOB 3EGGA 4FCXA 2O8GA 4H1YP 4TUGA 4M0VA 4I5NC 1NNWA 2JOGA 2BCDA 4ZVZA 4OR9A
chains in the Genus database with same CATH superfamily
1QFCA 2NXFA 1G5BA 1S70A 4DSYA 2Z06A 2ZO9B 1AUIA 2AHDA 2WDDA 2IE3C 5IOHA 3HVQA 4G9JA 2QFRA 1S8EA 2GJUA 3EGHA 5EQVA 2YVTA 2HY1A 2HYPA 4XPNA 4O4KA 2QJCA 2Z72A 1SU1A 3PSNA 4ORAA 2R17A 2NPPC 3FGAC 3GVEA 2DXLA 3T1IA 4IL1A 4H2BA 3H68A 2ZOAA 3K7WC 5B8IA 5JJTA 2NYLC 2WDEA 3AV0A 3V4YA 1Z2WA 4UWQA 3QG5C 3N5UA 3QFMA 1OIDA 1W24A 4JA9A 3C9FA 1OI8A 3E0JA 3QFOA 4YKEA 4WWLA 3ICFA 3IB7A 4J6OA 4Q7FA 5HPEA 1USHA 2YEQA 3AUZA 4MOYA 1QHWA 5J28A 2ZBMA 1M63A 2QFPA 4MOVA 1OIEA 3QFKA 2P6BA 1S3NA 3IVEA 3KBPA 3LL8A 1V73A 3RL3A 1U32A 5JPEA 4O5GA 3ZTVA 3H67A 3RQZA 4ORCA 4H1SA 3CK2A 2BQ8X 4FBWA 4DT2A 3C5WC 1FJMA 4FBKA 3DSDA 4LACC 1WARA 4NZVA 3QFNA 1XM7A 1HO5A 4IYPC 2Z1AA 3IB8A 3RL4A 1XZWA 1S95A 1HPUA 1S3MA 2NYMC 1TCOA 2Q8UA 2BDXA 2DXNA 2XMOA 3PSOA 4O24A 3JYFA 4TUIA 5C1VA 4V0XA 3THNA 5F3WA 1UF3A 4JA7A 2IE4C 3H60A 4KKZA 3H66A 2USHA 2IAEC 1WAO1 1MF8A 1JK7A 3DSCA 1IT6A 3ZU0A 3E7BA 3TGHA 4MP0A 3H62B 3K7VC 2WDFA 4H2IA 4UT3A 4UT3B 4ORBA 1T71A 2DFJA 1Z2XA 4B2OA 4DHLA 1S3LA 5INBA 3D03A 3H64A 4LTYA 3FLOA 2WDCA 3E7AA 2O8AA 1HP1A 2A22A 4HD0A 1UTEA 4V0VA 3RL5A 5GTUA 1II7A 2KKNA 3DW8C 4V0WA 5DNYA 4O43A 1KBPA 1T70A 4H2FA 4ZX2A 4FBQA 4UT2A 4I5LC 3P71C 4KBPA 4LU9A 5JPFA 2HYOA 2CV9A 3H61A 3IVDA 3H69A 4H2GA 4F0ZA 3H63A 3THOB 3EGGA 4FCXA 2O8GA 4H1YP 4TUGA 4M0VA 4I5NC 1NNWA 2JOGA 2BCDA 4ZVZA 4OR9A
chains in the Genus database with same CATH topology
1QFCA 2NXFA 1G5BA 1S70A 4DSYA 2Z06A 2ZO9B 1AUIA 2AHDA 2WDDA 2IE3C 5IOHA 3HVQA 4G9JA 2QFRA 1S8EA 2GJUA 3EGHA 5EQVA 2YVTA 2HY1A 2HYPA 4XPNA 4O4KA 2QJCA 2Z72A 1SU1A 3PSNA 4ORAA 2R17A 2NPPC 3FGAC 3GVEA 2DXLA 3T1IA 4IL1A 4H2BA 3H68A 2ZOAA 3K7WC 5B8IA 5JJTA 2NYLC 2WDEA 3AV0A 3V4YA 1Z2WA 4UWQA 3QG5C 3N5UA 3QFMA 1OIDA 1W24A 4JA9A 3C9FA 1OI8A 3E0JA 3QFOA 4YKEA 4WWLA 3ICFA 3IB7A 4J6OA 4Q7FA 5HPEA 1USHA 2YEQA 3AUZA 4MOYA 1QHWA 5J28A 2ZBMA 1M63A 2QFPA 4MOVA 1OIEA 3QFKA 2P6BA 1S3NA 3IVEA 3KBPA 3LL8A 1V73A 3RL3A 1U32A 5JPEA 4O5GA 3ZTVA 3H67A 3RQZA 4ORCA 4H1SA 3CK2A 2BQ8X 4FBWA 4DT2A 3C5WC 1FJMA 4FBKA 3DSDA 4LACC 1WARA 4NZVA 3QFNA 1XM7A 1HO5A 4IYPC 2Z1AA 3IB8A 3RL4A 1XZWA 1S95A 1HPUA 1S3MA 2NYMC 1TCOA 2Q8UA 2BDXA 2DXNA 2XMOA 3PSOA 4O24A 3JYFA 4TUIA 5C1VA 4V0XA 3THNA 5F3WA 1UF3A 4JA7A 2IE4C 3H60A 4KKZA 3H66A 2USHA 2IAEC 1WAO1 1MF8A 1JK7A 3DSCA 1IT6A 3ZU0A 3E7BA 3TGHA 4MP0A 3H62B 3K7VC 2WDFA 4H2IA 4UT3A 4UT3B 4ORBA 1T71A 2DFJA 1Z2XA 4B2OA 4DHLA 1S3LA 5INBA 3D03A 3H64A 4LTYA 3FLOA 2WDCA 3E7AA 2O8AA 1HP1A 2A22A 4HD0A 1UTEA 4V0VA 3RL5A 5GTUA 1II7A 2KKNA 3DW8C 4V0WA 5DNYA 4O43A 1KBPA 1T70A 4H2FA 4ZX2A 4FBQA 4UT2A 4I5LC 3P71C 4KBPA 4LU9A 5JPFA 2HYOA 2CV9A 3H61A 3IVDA 3H69A 4H2GA 4F0ZA 3H63A 3THOB 3EGGA 4FCXA 2O8GA 4H1YP 4TUGA 4M0VA 4I5NC 1NNWA 2JOGA 2BCDA 4ZVZA 4OR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFC A;  2NXF A;  1G5B A;  1S70 A;  4DSY A;  2Z06 A;  1AUI A;  2AHD A;  2WDD A;  2IE3 C;  5IOH A;  3HVQ A;  4G9J A;  2QFR A;  1S8E A;  2GJU A;  3EGH A;  5EQV A;  2YVT A;  2HY1 A;  2HYP A;  4XPN A;  4O4K A;  2QJC A;  2Z72 A;  1SU1 A;  3PSN A;  4ORA A;  2R17 A;  2NPP C;  3FGA C;  3GVE A;  3T1I A;  4IL1 A;  4H2B A;  3H68 A;  3K7W C;  5B8I A;  5JJT A;  2NYL C;  2WDE A;  3AV0 A;  3V4Y A;  1Z2W A;  4UWQ A;  3QG5 C;  3N5U A;  3QFM A;  1OID A;  1W24 A;  4JA9 A;  3C9F A;  1OI8 A;  3QFO A;  4YKE A;  4WWL A;  3ICF A;  3IB7 A;  4J6O A;  4Q7F A;  5HPE A;  1USH A;  3AUZ A;  4MOY A;  1QHW A;  5J28 A;  2ZBM A;  1M63 A;  2QFP A;  4MOV A;  1OIE A;  3QFK A;  2P6B A;  1S3N A;  3IVE A;  3KBP A;  3LL8 A;  1V73 A;  3RL3 A;  1U32 A;  5JPE A;  4O5G A;  3ZTV A;  3H67 A;  3RQZ A;  4ORC A;  4H1S A;  3CK2 A;  2BQ8 X;  4FBW A;  4DT2 A;  3C5W C;  1FJM A;  4FBK A;  3DSD A;  4LAC C;  1WAR A;  4NZV A;  3QFN A;  1XM7 A;  1HO5 A;  4IYP C;  2Z1A A;  3IB8 A;  3RL4 A;  1XZW A;  1S95 A;  1HPU A;  1S3M A;  2NYM C;  1TCO A;  2Q8U A;  2BDX A;  2XMO A;  3PSO A;  4TUI A;  4O24 A;  3JYF A;  5C1V A;  4V0X A;  3THN A;  5F3W A;  1UF3 A;  4JA7 A;  2IE4 C;  3H60 A;  4KKZ A;  3H66 A;  2USH A;  2IAE C;  1WAO 1;  1MF8 A;  1JK7 A;  3DSC A;  1IT6 A;  3ZU0 A;  3E7B A;  3TGH A;  4MP0 A;  3H62 B;  3K7V C;  2WDF A;  4H2I A;  4UT3 A;  4UT3 B;  4ORB A;  1T71 A;  2DFJ A;  1Z2X A;  4B2O A;  4DHL A;  1S3L A;  5INB A;  3H64 A;  4LTY A;  2WDC A;  3E7A A;  2O8A A;  1HP1 A;  2A22 A;  4HD0 A;  1UTE A;  4V0V A;  3RL5 A;  5GTU A;  1II7 A;  2KKN A;  3DW8 C;  4V0W A;  5DNY A;  4O43 A;  1KBP A;  1T70 A;  4H2F A;  4ZX2 A;  4FBQ A;  4UT2 A;  4I5L C;  3P71 C;  4KBP A;  4LU9 A;  5JPF A;  2HYO A;  2CV9 A;  3H61 A;  3IVD A;  3H69 A;  4H2G A;  4F0Z A;  3H63 A;  3THO B;  3EGG A;  4FCX A;  2O8G A;  4H1Y P;  4TUG A;  4M0V A;  4I5N C;  1NNW A;  2JOG A;  2BCD A;  4ZVZ A;  4OR9 A; 
#chains in the Genus database with same CATH topology
 1QFC A;  2NXF A;  1G5B A;  1S70 A;  4DSY A;  2Z06 A;  2ZO9 B;  1AUI A;  2AHD A;  2WDD A;  2IE3 C;  5IOH A;  3HVQ A;  4G9J A;  2QFR A;  1S8E A;  2GJU A;  3EGH A;  5EQV A;  2YVT A;  2HY1 A;  2HYP A;  4XPN A;  4O4K A;  2QJC A;  2Z72 A;  1SU1 A;  3PSN A;  4ORA A;  2R17 A;  2NPP C;  3FGA C;  3GVE A;  2DXL A;  3T1I A;  4IL1 A;  4H2B A;  3H68 A;  2ZOA A;  3K7W C;  5B8I A;  5JJT A;  2NYL C;  2WDE A;  3AV0 A;  3V4Y A;  1Z2W A;  4UWQ A;  3QG5 C;  3N5U A;  3QFM A;  1OID A;  1W24 A;  4JA9 A;  3C9F A;  1OI8 A;  3E0J A;  3QFO A;  4YKE A;  4WWL A;  3ICF A;  3IB7 A;  4J6O A;  4Q7F A;  5HPE A;  1USH A;  2YEQ A;  3AUZ A;  4MOY A;  1QHW A;  5J28 A;  2ZBM A;  1M63 A;  2QFP A;  4MOV A;  1OIE A;  3QFK A;  2P6B A;  1S3N A;  3IVE A;  3KBP A;  3LL8 A;  1V73 A;  3RL3 A;  1U32 A;  5JPE A;  4O5G A;  3ZTV A;  3H67 A;  3RQZ A;  4ORC A;  4H1S A;  3CK2 A;  2BQ8 X;  4FBW A;  4DT2 A;  3C5W C;  1FJM A;  4FBK A;  3DSD A;  4LAC C;  1WAR A;  4NZV A;  3QFN A;  1XM7 A;  1HO5 A;  4IYP C;  2Z1A A;  3IB8 A;  3RL4 A;  1XZW A;  1S95 A;  1HPU A;  1S3M A;  2NYM C;  1TCO A;  2Q8U A;  2BDX A;  2DXN A;  2XMO A;  3PSO A;  4O24 A;  3JYF A;  4TUI A;  5C1V A;  4V0X A;  3THN A;  5F3W A;  1UF3 A;  4JA7 A;  2IE4 C;  3H60 A;  4KKZ A;  3H66 A;  2USH A;  2IAE C;  1WAO 1;  1MF8 A;  1JK7 A;  3DSC A;  1IT6 A;  3ZU0 A;  3E7B A;  3TGH A;  4MP0 A;  3H62 B;  3K7V C;  2WDF A;  4H2I A;  4UT3 A;  4UT3 B;  4ORB A;  1T71 A;  2DFJ A;  1Z2X A;  4B2O A;  4DHL A;  1S3L A;  5INB A;  3D03 A;  3H64 A;  4LTY A;  3FLO A;  2WDC A;  3E7A A;  2O8A A;  1HP1 A;  2A22 A;  4HD0 A;  1UTE A;  4V0V A;  3RL5 A;  5GTU A;  1II7 A;  2KKN A;  3DW8 C;  4V0W A;  5DNY A;  4O43 A;  1KBP A;  1T70 A;  4H2F A;  4ZX2 A;  4FBQ A;  4UT2 A;  4I5L C;  3P71 C;  4KBP A;  4LU9 A;  5JPF A;  2HYO A;  2CV9 A;  3H61 A;  3IVD A;  3H69 A;  4H2G A;  4F0Z A;  3H63 A;  3THO B;  3EGG A;  4FCX A;  2O8G A;  4H1Y P;  4TUG A;  4M0V A;  4I5N C;  1NNW A;  2JOG A;  2BCD A;  4ZVZ A;  4OR9 A; 
#chains in the Genus database with same CATH homology
 1QFC A;  2NXF A;  1G5B A;  1S70 A;  4DSY A;  2Z06 A;  2ZO9 B;  1AUI A;  2AHD A;  2WDD A;  2IE3 C;  5IOH A;  3HVQ A;  4G9J A;  2QFR A;  1S8E A;  2GJU A;  3EGH A;  5EQV A;  2YVT A;  2HY1 A;  2HYP A;  4XPN A;  4O4K A;  2QJC A;  2Z72 A;  1SU1 A;  3PSN A;  4ORA A;  2R17 A;  2NPP C;  3FGA C;  3GVE A;  2DXL A;  3T1I A;  4IL1 A;  4H2B A;  3H68 A;  2ZOA A;  3K7W C;  5B8I A;  5JJT A;  2NYL C;  2WDE A;  3AV0 A;  3V4Y A;  1Z2W A;  4UWQ A;  3QG5 C;  3N5U A;  3QFM A;  1OID A;  1W24 A;  4JA9 A;  3C9F A;  1OI8 A;  3E0J A;  3QFO A;  4YKE A;  4WWL A;  3ICF A;  3IB7 A;  4J6O A;  4Q7F A;  5HPE A;  1USH A;  2YEQ A;  3AUZ A;  4MOY A;  1QHW A;  5J28 A;  2ZBM A;  1M63 A;  2QFP A;  4MOV A;  1OIE A;  3QFK A;  2P6B A;  1S3N A;  3IVE A;  3KBP A;  3LL8 A;  1V73 A;  3RL3 A;  1U32 A;  5JPE A;  4O5G A;  3ZTV A;  3H67 A;  3RQZ A;  4ORC A;  4H1S A;  3CK2 A;  2BQ8 X;  4FBW A;  4DT2 A;  3C5W C;  1FJM A;  4FBK A;  3DSD A;  4LAC C;  1WAR A;  4NZV A;  3QFN A;  1XM7 A;  1HO5 A;  4IYP C;  2Z1A A;  3IB8 A;  3RL4 A;  1XZW A;  1S95 A;  1HPU A;  1S3M A;  2NYM C;  1TCO A;  2Q8U A;  2BDX A;  2DXN A;  2XMO A;  3PSO A;  4O24 A;  3JYF A;  4TUI A;  5C1V A;  4V0X A;  3THN A;  5F3W A;  1UF3 A;  4JA7 A;  2IE4 C;  3H60 A;  4KKZ A;  3H66 A;  2USH A;  2IAE C;  1WAO 1;  1MF8 A;  1JK7 A;  3DSC A;  1IT6 A;  3ZU0 A;  3E7B A;  3TGH A;  4MP0 A;  3H62 B;  3K7V C;  2WDF A;  4H2I A;  4UT3 A;  4UT3 B;  4ORB A;  1T71 A;  2DFJ A;  1Z2X A;  4B2O A;  4DHL A;  1S3L A;  5INB A;  3D03 A;  3H64 A;  4LTY A;  3FLO A;  2WDC A;  3E7A A;  2O8A A;  1HP1 A;  2A22 A;  4HD0 A;  1UTE A;  4V0V A;  3RL5 A;  5GTU A;  1II7 A;  2KKN A;  3DW8 C;  4V0W A;  5DNY A;  4O43 A;  1KBP A;  1T70 A;  4H2F A;  4ZX2 A;  4FBQ A;  4UT2 A;  4I5L C;  3P71 C;  4KBP A;  4LU9 A;  5JPF A;  2HYO A;  2CV9 A;  3H61 A;  3IVD A;  3H69 A;  4H2G A;  4F0Z A;  3H63 A;  3THO B;  3EGG A;  4FCX A;  2O8G A;  4H1Y P;  4TUG A;  4M0V A;  4I5N C;  1NNW A;  2JOG A;  2BCD A;  4ZVZ A;  4OR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...