3AUZA

Crystal structure of mre11 with manganese
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
316
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
molecule keywords DNA double-strand break repair protein mre11
total genus 99
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3auzA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3auzA01
2CV9A 2DFJA 4FBWA 1OI8A 4UT3B 1S95A 2AHDA 3IB7A 5F3WA 1Z2WA 2NXFA 2P6BA 2WDCA 2WDDA 4H1YP 3RL4A 3H63A 5C1VA 2WDEA 4UWQA 3C5WC 4MP0A 2IE4C 2KKNA 2HYPA 3H64A 3LL8A 5HPEA 3K7VC 3THNA 1HP1A 1UF3A 4WWLA 3ZTVA 1JK7A 3DW8C 3GVEA 2IE3C 3C9FA 2USHA 4H2GA 4JA7A 3E7BA 1QFCA 3DSDA 5INBA 2BCDA 5JJTA 3V4YA 3H66A 1T71A 3H61A 1SU1A 3PSNA 4FCXA 2JOGA 1HPUA 3PSOA 5JPFA 4MOVA 2IAEC 4O4KA 1WARA 1OIEA 2Z1AA 1UTEA 5GTUA 2A22A 4V0VA 4JA9A 3RL5A 4V0WA 1NNWA 3QFNA 4H1SA 3RQZA 2GJUA 1S8EA 1S3NA 2O8GA 2WDFA 4YKEA 5J28A 4O43A 4IL1A 4M0VA 5IOHA 2BQ8X 3K7WC 3ICFA 1T70A 4NZVA 2QFRA 4G9JA 1HO5A 3DSCA 1XZWA 4DT2A 1MF8A 3RL3A 4KBPA 4XPNA 4V0XA 2Z72A 4I5LC 4ZVZA 4ZX2A 4Q7FA 3IVDA 2R17A 3AUZA 4KKZA 3QG5C 4DHLA 4IYPC 4LTYA 2XMOA 1FJMA 3QFKA 1S3LA 2NPPC 4OR9A 3KBPA 4B2OA 2HY1A 1XM7A 4H2BA 3EGHA 3H62B 3JYFA 4LU9A 4O24A 4O5GA 4I5NC 4TUGA 4H2IA 5EQVA 3CK2A 3TGHA 1USHA 4F0ZA 4HD0A 1QHWA 1G5BA 2O8AA 1IT6A 3THOB 4ORBA 2Q8UA 2Z06A 2YVTA 1WAO1 2QFPA 3QFOA 4LACC 3H68A 5B8IA 3N5UA 4MOYA 5DNYA 2QJCA 3H67A 5JPEA 3T1IA 1TCOA 1S70A 1Z2XA 3H60A 3FGAC 2NYMC 3P71C 4UT2A 4ORAA 4DSYA 2ZBMA 3IB8A 2BDXA 2NYLC 4FBKA 3AV0A 4J6OA 4H2FA 4TUIA 3QFMA 1S3MA 3H69A 1M63A 1V73A 3IVEA 3ZU0A 1W24A 1II7A 4UT3A 1AUIA 4FBQA 1OIDA 1U32A 2HYOA 1KBPA 3E7AA 3HVQA 4ORCA 3EGGA
chains in the Genus database with same CATH superfamily
2YU8A 2DFJA 2V86A 3VK6A 1Z1BA 5FLXC 4UT3B 2NUGA 2EMCA 3J81C 2EOOA 5F3WA 2NXFA 5AC4A 2V83A 4H1YP 5IT9C 1N36E 3RL4A 3VYYA 5C1VA 1BBOA 4UWQA 2EM7A 3C5WC 4MP0A 2B9DA 2LE2A 1DI2A 4F9AB 1YFHA 1A1HA 1UF3A 2ELZA 3FLOA 2FGGA 3GVEA 1MGTA 2JR1A 4F6MA 4DR3E 2EN8A 3F6GA 2EL6A 1XNRE 2CPNA 3E7BA 3DSDA 2YTNA 5INBA 5LLQA 2ZOAA 3V4YA 5AE1A 1T71A 1SU1A 2EPPA 5A2QC 2EOMA 2DXLA 4O4KA 2IAEC 5KL4A 1IBKE 2YRMA 2FTXB 1WARA 4R2PA 2YSOA 2KHXA 1QNTA 2EPUA 2EMAA 4WPYA 4WXDA 5A69A 1S8EA 2WDFA 4H1SA 1PJSA 3RQZA 4BBYA 4R2AA 1A1LA 3FIGA 4B3SE 3JAMC 1KJKA 1ZBQA 4DR1E 2EPKX 2EMBA 1HR0E 1SR9A 2BQ8X 1T70A 2JXPA 1UHZA 1XZWA 4DT2A 1BBGA 1MF8A 2LT7A 4WSPA 2L3CA 1UN6B 4YY3E 4XPNA 1WJPA 2Z72A 4ZVZA 2JYAA 1RQ0A 3ADIA 3IVDA 1TN9A 4DHLA 2ENAA 3ADLA 4LTYA 2XMOA 3QFKA 2EPAA 2NPPC 3LLHA 2F8BA 3T1YE 4R2SA 2HY1A 4B2OA 2YTOA 2VQFE 2RPCA 4MLVA 2EPMX 4O24A 2UUCE 2EM4A 3F6HA 2E1MA 3CK2A 1T4OA 2EQ3A 1N32E 4WFTA 4WYQB 5LL6R 3OMLA 2H36X 2LTRA 2YZTA 4DV2E 3HPSA 3M99B 5A6BD 4DV7E 2R76A 3N5UA 1IBME 1IQSA 5DNYA 1FJGE 1WHQA 4LFBE 1T39A 2EMWA 3T1IA 2EOSA 2V87A 1Z2XA 1BB8A 3H60A 2N8XA 2NYMC 3P71C 2K7IA 4UT2A 1PKPA 2EOYA 2ZBMA 1NEIA 5KL6A 2NYLC 2CT1A 4FBKA 4H2FA 1N33E 2JOXA 5A6BA 4B3ME 4J8ZA 1UBDC 4X62E 3IVEA 3ZU0A 3VYXA 1W24A 3L00A 4NXME 1AUIA 5CFFE 4FBQA 1OIDA 3E7AA 3HVQA 2EMKA 4RH8A 2WBSA 2LUPB 1G2DC 1A1GA 2L33A 2EOHA 2VQEE 2DXNA 2WBUA 1X47A 2JVAA 2DMYA 2AHDA 3ZOQB 3IB7A 2EM5A 4JI2E 2LJUA 3JU0A 2DB2A 2EORA 4DV4E 3HXLA 2LMZA 3IWCA 2J7JA 2EQ1A 1YSAC 2HHHE 2D9HA 2KOUA 2IE4C 1PDAA 2KKNA 2HYPA 3KZYA 3H64A 2B7TA 2YU5A 2LTSA 1HP1A 1A1JA 2L2NA 3ZTVA 1WXRA 3DW8C 2I13A 4H2GA 2UXCE 1QFCA 2EN1A 2A25A 1B69A 2BCDA 3H66A 3KWRA 4DR7E 3H61A 2NUFA 2YWQA 2BBGA 3BBGA 4IJDA 1AH5A 5GTUA 2A22A 4GZNC 4V0WA 4X8WA 1PJTA 3K6QA 1LLMC 2O8GA 4OX9E 2I9IA 2L2MA 4NXNE 2WZOA 1A1FA 1X6FA 4LF9E 4YKEA 2CSHA 3E0JA 1ZU1A 2EPXA 2ZO9B 3BIDA 1XNQE 3K7WC 4R2RA 2YPNA 4G9JA 4F2JC 4IS1C 1DGCA 1HO5A 4N4RB 2UXDE 3BGHA 5ADZA 4X64E 2RSMA 4JYAE 2V88A 2L2KB 2ENCA 1N3GA 4I5LC 4ZX2A 4M30A 2WCC3 4BMJA 1T4LB 3H09A 2RS6A 5TSEA 1F2IG 3QG5C 4KKZA 2MC5A 1PJQA 4DV1E 1FJMA 1STUA 1WRJA 1QU6A 4DV3E 2RS7A 4BHCA 2R1FA 2LRSA 5LMUE 2B3TB 1YZ9A 4JI1E 4O5GA 3EPJA 5EQVA 4H2IA 4NHRA 2M7QA 4R2DA 4F0ZA 4R8OA 3J7Yp 2EOFA 1YUJA 3MHSC 4JI6E 2LO3A 3THOB 1GTKA 5A6KA 2YTIA 4X9JA 2JOBA 4ORBA 1GQEA 2Z06A 1WAO1 4BC7A 1IBLE 1J5EE 5KL5A 3H68A 2EM2A 4MOYA 4AQYE 3H67A 5JPEA 2DGCA 3EPHA 2GLIA 2EOJA 2GHFA 2UUBE 2WBTA 4DR4E 4LF7E 3ADGA 2EL4A 3FGAC 4JI4E 4ORAA 2DLKA 3HPZA 5BR8E 3MSWA 2V8QB 3J80C 3TQMA 5KL3A 2UUAE 1M63A 1EKZA 3MHHC 1II7A 4YHHE 1U32A 4LFAE 1KBPA 3J7AG 2EL5A 2EOEA 2CV9A 2EN6A 1I94E 2MKNA 4Q35B 1S95A 2EM3A 1X5WA 1Z2WA 2ZM6E 1YYOA 2WDDA 4JI5E 2RQLA 2ENHA 4B3TE 4LFCE 2EOXA 4KZSA 4P7DA 1L4SA 3ADJA 4FK5C 3LL8A 3K7VC 1KYQA 2ODRC 4ZYDA 4WWLA 2YTQA 2EM9A 4DKKA 4KHPE 2PRTA 4DV5E 2EOZA 5AC5A 2LUQA 1ZBTA 1EH6A 2EQ0A 2NA2A 3HQ1A 2V89A 2EMLA 3PSOA 4MOVA 2JP9A 1YYWA 2GPIA 1OIEA 2HGHA 4V0VA 3RMPA 1X6HA 1TF3A 4MLQA 2YRHA 3ECRA 1O0WA 1X6EA 4WX9A 4LF5E 5A6JA 2LV2A 5J28A 4O43A 4IL1A 4M0VA 3C4TA 1XMQE 5IOHA 2DLQA 3ICFA 3C6MA 2EM8A 3DSCA 4RHBB 2DIXA 1JK2A 3RL3A 2N3HA 2VE7C 2EPRA 2YTGA 2EMZA 5AE3A 1ZAAC 3DJWA 3UK3C 2UU9E 1X49A 2JPAA 4IYPC 2LVHA 2L8TA 1JK1A 2EMGA 4GEQB 4F6NA 2EP3A 2V85A 3KBPA 1HNXE 1XM7A 4R2QA 4H2BA 2EE8A 4LU9A 3VHTB 4R2CA 1RC7A 4I5NC 4TUGA 1T4NA 2EZ6A 4DUZE 5IV8B 4HD0A 1ZR9A 1QHWA 2L3JA 1G5BA 4X66E 1IT6A 2O8AA 2IHR1 2YTEA 4M2ZA 1X48A 1NCSA 2E72A 2QFPA 2YVTA 2N3GA 3QFOA 3JTZA 4LACC 2YTDA 1IMUA 2EMIA 2NABA 1S70A 3DF6A 4OOGC 4DV6E 1A1KA 1TCOA 5A6AA 4Q28A 2YEQA 4DSYA 1HNWE 3IB8A 2L6MA 4B3RE 3AV0A 4J6OA 1IQOA 4TUIA 2M4IA 4X65E 2EM6A 1S3MA 3H69A 2ODRD 1V73A 2EMFA 2EOIA 4KWYA 2EJ4A 5LMNE 4L5NC 4ZYHA 2YTPA 4UT3A 2HC5A 3LMLA 1J26A 3JYFA 2YSPA 4ORCA 4FBWA 1OI8A 3EQ1A 2DSYA 1YPNA 2EPZA 4JI0E 2EN4A 2P6BA 2JWOA 4GKKE 2WDCA 3IWBA 4DUYE 2EWLA 3H63A 2WDEA 3KZZA 4JI7E 1HNZE 2F4VE 4WXCA 5AE2A 2UXBE 5IXMB 2DMIA 5HPEA 4JI8E 3THNA 1TF6A 2EPCA 1RMDA 1JK7A 1EH7A 2IE3C 3C9FA 2USHA 2FV4B 4JI3E 1T38A 4JA7A 3EPKA 5JJTA 2JY9A 2L92A 2YT4A 2ADRA 2EPLX 4R2EA 2JOGA 3PSNA 1HPUA 4FCXA 5JPFA 4GKJE 2EPOA 2EMHA 4M9VC 3HTXA 3IWDA 2EN2A 2Z1AA 1UTEA 2EMXA 1YUIA 1DQ3A 4JA9A 2M1SA 2VRDA 3RL5A 1AAYA 1NNWA 3QFNA 4F54A 2GJUA 1S3NA 4BS9A 1MEYC 5KL2A 2EMYA 2MDGA 3P1XA 4LF6E 4HTGA 4BCAA 2YTFA 4NZVA 2QFRA 3D03A 2LBSB 3EPLA 3T1HE 5IWAE 4ZYEA 1YYKA 4KBPA 4P78A 4V0XA 4I8OA 3OTOE 2VF1A 4Q7FA 2LJHA 1GZ6A 2R17A 3AUZA 1G2FC 1S3LA 5KL7A 4JV5E 4OR9A 1N34E 2NUEA 1X3CA 4R03A 3EGHA 3H62B 1WHNA 3TGHA 2RSIA 3C6KA 1FKAE 4DR2E 1USHA 2EOQA 3C4BA 4HEIA 4L8NA 4LF8E 2Q8UA 2HJJA 1UILA 2LCEA 2BB8A 5B8IA 4BHBA 2G7HA 2EPNA 2QJCA 2ELYA 1XMOE 2E5LE 4LF4E 4F9CB 4F9BB 2DRPA 2YRKA 4K0KE 2EN3A 2YTJA 1P47A 4BC9A 2RTXA 5T6JA 2BDXA 2B7VA 1A1IA 3QFMA 2M9AA 2CTDA 4WSGA 5AASA 4DR5E 4DV0E 2MKDA 4ZYGA 4DR6E 3BF2A 2EM0A 2KONA 1SFEA 1EH8A 2EN7A 2HYOA 4DMIA 2MC6A 2K4VA 2MDRA 3EGGA
chains in the Genus database with same CATH topology
2DFJA 2V86A 3VK6A 4UT3B 5FLXC 2NUGA 3J81C 5F3WA 2NXFA 2V83A 4H1YP 5IT9C 1N36E 3RL4A 3VYYA 5C1VA 4UWQA 3C5WC 4MP0A 2B9DA 2LE2A 1DI2A 4F9AB 1UF3A 3FLOA 2FGGA 3GVEA 2JR1A 4DR3E 3F6GA 1XNRE 2CPNA 3E7BA 3DSDA 5INBA 2ZOAA 3V4YA 5AE1A 1T71A 1SU1A 5A2QC 2DXLA 2IAEC 4O4KA 1IBKE 2FTXB 1WARA 2KHXA 4WPYA 4H1SA 3RQZA 2WDFA 1S8EA 4BBYA 3FIGA 4B3SE 3JAMC 1ZBQA 4DR1E 1HR0E 1SR9A 2BQ8X 1T70A 1UHZA 1XZWA 4DT2A 1MF8A 4WSPA 2L3CA 4YY3E 4XPNA 2Z72A 4ZVZA 1RQ0A 3ADIA 3IVDA 4DHLA 3ADLA 4LTYA 2XMOA 3QFKA 2NPPC 3LLHA 2F8BA 3T1YE 4B2OA 2HY1A 2VQFE 4O24A 2UUCE 3F6HA 2E1MA 3CK2A 1T4OA 1N32E 4WFTA 4WYQB 5LL6R 3OMLA 2H36X 2LTRA 2YZTA 4DV2E 3HPSA 4DV7E 3N5UA 1IBME 1FJGE 5DNYA 1WHQA 4LFBE 3T1IA 2V87A 1Z2XA 3H60A 2NYMC 3P71C 4UT2A 1PKPA 2ZBMA 2NYLC 4FBKA 4H2FA 1N33E 2JOXA 4B3ME 4J8ZA 4X62E 3IVEA 3ZU0A 3VYXA 1W24A 4NXME 1AUIA 5CFFE 4FBQA 1OIDA 3E7AA 3HVQA 2LUPB 2L33A 2VQEE 2DXNA 1X47A 2JVAA 2DMYA 2AHDA 3ZOQB 3IB7A 4JI2E 3JU0A 2DB2A 4DV4E 3HXLA 2LMZA 3IWCA 2HHHE 2IE4C 2KOUA 2KKNA 2HYPA 3H64A 2B7TA 2LTSA 1HP1A 2L2NA 3ZTVA 1WXRA 3DW8C 4H2GA 2UXCE 1QFCA 2BCDA 3H66A 3KWRA 4DR7E 3H61A 2NUFA 5GTUA 2A22A 4V0WA 4X8WA 3K6QA 2O8GA 4OX9E 2L2MA 4NXNE 2WZOA 4LF9E 4YKEA 3E0JA 2ZO9B 1XNQE 3K7WC 4G9JA 1HO5A 2UXDE 5ADZA 4X64E 2RSMA 4JYAE 2V88A 2L2KB 4I5LC 4ZX2A 4M30A 4BMJA 1T4LB 3H09A 2RS6A 4KKZA 3QG5C 2MC5A 4DV1E 1FJMA 1STUA 1QU6A 4DV3E 2RS7A 2LRSA 5LMUE 2B3TB 1YZ9A 4JI1E 4O5GA 5EQVA 4H2IA 2M7QA 4F0ZA 4R8OA 3J7Yp 4JI6E 3THOB 2JOBA 4ORBA 1GQEA 2Z06A 1WAO1 4BC7A 1IBLE 1J5EE 3H68A 4MOYA 4AQYE 3H67A 5JPEA 2UUBE 4DR4E 4LF7E 3ADGA 3FGAC 4JI4E 4ORAA 3HPZA 5BR8E 3MSWA 2V8QB 3J80C 2UUAE 1M63A 1EKZA 1II7A 4YHHE 1U32A 4LFAE 1KBPA 3J7AG 2CV9A 1I94E 1S95A 1Z2WA 2ZM6E 1YYOA 2WDDA 4JI5E 4LFCE 4B3TE 4KZSA 4P7DA 3ADJA 3LL8A 3K7VC 2ODRC 4WWLA 4DKKA 4KHPE 4DV5E 2LUQA 1ZBTA 2NA2A 3HQ1A 2V89A 3PSOA 4MOVA 1YYWA 1OIEA 4V0VA 3RMPA 1O0WA 4LF5E 5J28A 4O43A 4IL1A 4M0VA 3C4TA 1XMQE 5IOHA 3ICFA 3DSCA 2DIXA 3RL3A 2N3HA 2VE7C 5AE3A 3DJWA 2UU9E 1X49A 4IYPC 2L8TA 4GEQB 2V85A 3KBPA 1HNXE 1XM7A 4H2BA 4LU9A 1RC7A 4I5NC 4TUGA 1T4NA 2EZ6A 4DUZE 4HD0A 1QHWA 1G5BA 2L3JA 4X66E 1IT6A 2O8AA 2IHR1 4M2ZA 1X48A 2YVTA 2QFPA 2N3GA 3QFOA 3JTZA 4LACC 1TCOA 1S70A 3DF6A 4OOGC 4DV6E 4Q28A 2YEQA 4DSYA 1HNWE 3IB8A 2L6MA 4B3RE 3AV0A 4J6OA 4TUIA 2M4IA 4X65E 1S3MA 3H69A 2ODRD 1V73A 5LMNE 4L5NC 4UT3A 3LMLA 1J26A 3JYFA 4ORCA 4FBWA 1OI8A 2DSYA 4JI0E 2P6BA 2JWOA 4GKKE 2WDCA 3IWBA 4DUYE 2EWLA 3H63A 2WDEA 4JI7E 1HNZE 2F4VE 5AE2A 2UXBE 5HPEA 4JI8E 3THNA 1JK7A 2IE3C 3C9FA 2USHA 2FV4B 4JI3E 4JA7A 5JJTA 2JY9A 2L92A 2YT4A 3PSNA 4FCXA 2JOGA 1HPUA 5JPFA 4GKJE 3HTXA 3IWDA 2Z1AA 1UTEA 1DQ3A 4JA9A 2M1SA 3RL5A 1NNWA 3QFNA 4F54A 2GJUA 1S3NA 4BS9A 3P1XA 4LF6E 4BCAA 4NZVA 2QFRA 3D03A 2LBSB 3T1HE 5IWAE 1YYKA 4KBPA 4P78A 4V0XA 4I8OA 3OTOE 2VF1A 4Q7FA 2LJHA 1GZ6A 2R17A 3AUZA 1S3LA 4JV5E 4OR9A 1N34E 2NUEA 4R03A 3EGHA 3H62B 1WHNA 3TGHA 1FKAE 4DR2E 1USHA 3C4BA 4L8NA 4LF8E 2Q8UA 1UILA 5B8IA 2G7HA 2QJCA 1XMOE 2E5LE 4LF4E 4F9CB 4F9BB 4K0KE 4BC9A 2RTXA 5T6JA 2BDXA 2B7VA 3QFMA 5AASA 4DR5E 4DV0E 4DR6E 2KONA 2HYOA 4DMIA 2MC6A 2K4VA 2MDRA 3EGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV9 A;  2DFJ A;  4FBW A;  1OI8 A;  4UT3 B;  1S95 A;  2AHD A;  3IB7 A;  5F3W A;  1Z2W A;  2NXF A;  2P6B A;  2WDC A;  2WDD A;  4H1Y P;  3RL4 A;  3H63 A;  5C1V A;  2WDE A;  4UWQ A;  3C5W C;  4MP0 A;  2IE4 C;  2KKN A;  2HYP A;  3H64 A;  3LL8 A;  5HPE A;  3K7V C;  3THN A;  1HP1 A;  1UF3 A;  4WWL A;  3ZTV A;  1JK7 A;  3DW8 C;  3GVE A;  2IE3 C;  3C9F A;  2USH A;  4H2G A;  4JA7 A;  3E7B A;  1QFC A;  3DSD A;  5INB A;  2BCD A;  5JJT A;  3V4Y A;  3H66 A;  1T71 A;  3H61 A;  1SU1 A;  3PSN A;  4FCX A;  2JOG A;  1HPU A;  3PSO A;  5JPF A;  4MOV A;  2IAE C;  4O4K A;  1WAR A;  1OIE A;  2Z1A A;  1UTE A;  5GTU A;  2A22 A;  4V0V A;  4JA9 A;  3RL5 A;  4V0W A;  1NNW A;  3QFN A;  4H1S A;  3RQZ A;  2GJU A;  1S8E A;  1S3N A;  2O8G A;  2WDF A;  4YKE A;  5J28 A;  4O43 A;  4IL1 A;  4M0V A;  5IOH A;  2BQ8 X;  3K7W C;  3ICF A;  1T70 A;  4NZV A;  2QFR A;  4G9J A;  1HO5 A;  3DSC A;  1XZW A;  4DT2 A;  1MF8 A;  3RL3 A;  4KBP A;  4XPN A;  4V0X A;  2Z72 A;  4I5L C;  4ZVZ A;  4ZX2 A;  4Q7F A;  3IVD A;  2R17 A;  3AUZ A;  4KKZ A;  3QG5 C;  4DHL A;  4IYP C;  4LTY A;  2XMO A;  1FJM A;  3QFK A;  1S3L A;  2NPP C;  4OR9 A;  3KBP A;  4B2O A;  2HY1 A;  1XM7 A;  4H2B A;  3EGH A;  3H62 B;  3JYF A;  4LU9 A;  4O24 A;  4O5G A;  4I5N C;  4TUG A;  4H2I A;  5EQV A;  3CK2 A;  3TGH A;  1USH A;  4F0Z A;  4HD0 A;  1QHW A;  1G5B A;  2O8A A;  1IT6 A;  3THO B;  4ORB A;  2Q8U A;  2Z06 A;  2YVT A;  1WAO 1;  2QFP A;  3QFO A;  4LAC C;  3H68 A;  5B8I A;  3N5U A;  4MOY A;  5DNY A;  2QJC A;  3H67 A;  5JPE A;  3T1I A;  1TCO A;  1S70 A;  1Z2X A;  3H60 A;  3FGA C;  2NYM C;  3P71 C;  4UT2 A;  4ORA A;  4DSY A;  2ZBM A;  3IB8 A;  2BDX A;  2NYL C;  4FBK A;  3AV0 A;  4J6O A;  4H2F A;  4TUI A;  3QFM A;  1S3M A;  3H69 A;  1M63 A;  1V73 A;  3IVE A;  3ZU0 A;  1W24 A;  1II7 A;  4UT3 A;  1AUI A;  4FBQ A;  1OID A;  1U32 A;  2HYO A;  1KBP A;  3E7A A;  3HVQ A;  4ORC A;  3EGG A; 
#chains in the Genus database with same CATH topology
 2YU8 A;  2DFJ A;  2V86 A;  3VK6 A;  1Z1B A;  5FLX C;  4UT3 B;  2NUG A;  2EMC A;  3J81 C;  2EOO A;  5F3W A;  2NXF A;  5AC4 A;  2V83 A;  4H1Y P;  5IT9 C;  1N36 E;  3RL4 A;  3VYY A;  5C1V A;  1BBO A;  4UWQ A;  2EM7 A;  3C5W C;  4MP0 A;  2B9D A;  2LE2 A;  1DI2 A;  4F9A B;  1YFH A;  1A1H A;  1UF3 A;  2ELZ A;  3FLO A;  2FGG A;  3GVE A;  1MGT A;  2JR1 A;  4F6M A;  4DR3 E;  2EN8 A;  3F6G A;  2EL6 A;  1XNR E;  2CPN A;  3E7B A;  3DSD A;  2YTN A;  5INB A;  5LLQ A;  2ZOA A;  3V4Y A;  5AE1 A;  1T71 A;  1SU1 A;  2EPP A;  5A2Q C;  2EOM A;  2DXL A;  4O4K A;  2IAE C;  5KL4 A;  1IBK E;  2YRM A;  2FTX B;  1WAR A;  4R2P A;  2YSO A;  2KHX A;  1QNT A;  2EPU A;  2EMA A;  4WPY A;  4WXD A;  5A69 A;  1S8E A;  2WDF A;  4H1S A;  1PJS A;  3RQZ A;  4BBY A;  4R2A A;  1A1L A;  3FIG A;  4B3S E;  3JAM C;  1KJK A;  1ZBQ A;  4DR1 E;  2EPK X;  2EMB A;  1HR0 E;  1SR9 A;  2BQ8 X;  1T70 A;  2JXP A;  1UHZ A;  1XZW A;  4DT2 A;  1BBG A;  1MF8 A;  2LT7 A;  4WSP A;  2L3C A;  1UN6 B;  4YY3 E;  4XPN A;  1WJP A;  2Z72 A;  4ZVZ A;  2JYA A;  1RQ0 A;  3ADI A;  3IVD A;  1TN9 A;  4DHL A;  2ENA A;  3ADL A;  4LTY A;  2XMO A;  3QFK A;  2EPA A;  2NPP C;  3LLH A;  2F8B A;  3T1Y E;  4R2S A;  2HY1 A;  4B2O A;  2YTO A;  2VQF E;  2RPC A;  4MLV A;  2EPM X;  4O24 A;  2UUC E;  2EM4 A;  3F6H A;  2E1M A;  3CK2 A;  1T4O A;  2EQ3 A;  1N32 E;  4WFT A;  4WYQ B;  5LL6 R;  3OML A;  2H36 X;  2LTR A;  2YZT A;  4DV2 E;  3HPS A;  3M99 B;  5A6B D;  4DV7 E;  2R76 A;  3N5U A;  1IBM E;  1IQS A;  5DNY A;  1FJG E;  1WHQ A;  4LFB E;  1T39 A;  2EMW A;  3T1I A;  2EOS A;  2V87 A;  1Z2X A;  1BB8 A;  3H60 A;  2N8X A;  2NYM C;  3P71 C;  2K7I A;  4UT2 A;  1PKP A;  2EOY A;  2ZBM A;  1NEI A;  5KL6 A;  2NYL C;  2CT1 A;  4FBK A;  4H2F A;  1N33 E;  2JOX A;  5A6B A;  4B3M E;  4J8Z A;  1UBD C;  4X62 E;  3IVE A;  3ZU0 A;  3VYX A;  1W24 A;  3L00 A;  4NXM E;  1AUI A;  5CFF E;  4FBQ A;  1OID A;  3E7A A;  3HVQ A;  2EMK A;  4RH8 A;  2WBS A;  2LUP B;  1G2D C;  1A1G A;  2L33 A;  2EOH A;  2VQE E;  2DXN A;  2WBU A;  1X47 A;  2JVA A;  2DMY A;  2AHD A;  3ZOQ B;  3IB7 A;  2EM5 A;  4JI2 E;  2LJU A;  3JU0 A;  2DB2 A;  2EOR A;  4DV4 E;  3HXL A;  2LMZ A;  3IWC A;  2J7J A;  2EQ1 A;  1YSA C;  2HHH E;  2D9H A;  2KOU A;  2IE4 C;  1PDA A;  2KKN A;  2HYP A;  3KZY A;  3H64 A;  2B7T A;  2YU5 A;  2LTS A;  1HP1 A;  1A1J A;  2L2N A;  3ZTV A;  1WXR A;  3DW8 C;  2I13 A;  4H2G A;  2UXC E;  1QFC A;  2EN1 A;  2A25 A;  1B69 A;  2BCD A;  3H66 A;  3KWR A;  4DR7 E;  3H61 A;  2NUF A;  2YWQ A;  2BBG A;  3BBG A;  4IJD A;  1AH5 A;  5GTU A;  2A22 A;  4GZN C;  4V0W A;  4X8W A;  1PJT A;  3K6Q A;  1LLM C;  2O8G A;  4OX9 E;  2I9I A;  2L2M A;  4NXN E;  2WZO A;  1A1F A;  1X6F A;  4LF9 E;  4YKE A;  2CSH A;  3E0J A;  1ZU1 A;  2EPX A;  2ZO9 B;  3BID A;  1XNQ E;  3K7W C;  4R2R A;  2YPN A;  4G9J A;  4F2J C;  4IS1 C;  1DGC A;  1HO5 A;  4N4R B;  2UXD E;  3BGH A;  5ADZ A;  4X64 E;  2RSM A;  4JYA E;  2V88 A;  2L2K B;  2ENC A;  1N3G A;  4I5L C;  4ZX2 A;  4M30 A;  2WCC 3;  4BMJ A;  1T4L B;  3H09 A;  2RS6 A;  5TSE A;  1F2I G;  3QG5 C;  4KKZ A;  2MC5 A;  1PJQ A;  4DV1 E;  1FJM A;  1STU A;  1WRJ A;  1QU6 A;  4DV3 E;  2RS7 A;  4BHC A;  2R1F A;  2LRS A;  5LMU E;  2B3T B;  1YZ9 A;  4JI1 E;  4O5G A;  3EPJ A;  5EQV A;  4H2I A;  4NHR A;  2M7Q A;  4R2D A;  4F0Z A;  4R8O A;  3J7Y p;  2EOF A;  1YUJ A;  3MHS C;  4JI6 E;  2LO3 A;  3THO B;  1GTK A;  5A6K A;  2YTI A;  4X9J A;  2JOB A;  4ORB A;  1GQE A;  2Z06 A;  1WAO 1;  4BC7 A;  1IBL E;  1J5E E;  5KL5 A;  3H68 A;  2EM2 A;  4MOY A;  4AQY E;  3H67 A;  5JPE A;  2DGC A;  3EPH A;  2GLI A;  2EOJ A;  2GHF A;  2UUB E;  2WBT A;  4DR4 E;  4LF7 E;  3ADG A;  2EL4 A;  3FGA C;  4JI4 E;  4ORA A;  2DLK A;  3HPZ A;  5BR8 E;  3MSW A;  2V8Q B;  3J80 C;  3TQM A;  5KL3 A;  2UUA E;  1M63 A;  1EKZ A;  3MHH C;  1II7 A;  4YHH E;  1U32 A;  4LFA E;  1KBP A;  3J7A G;  2EL5 A;  2EOE A;  2CV9 A;  2EN6 A;  1I94 E;  2MKN A;  4Q35 B;  1S95 A;  2EM3 A;  1X5W A;  1Z2W A;  2ZM6 E;  1YYO A;  2WDD A;  4JI5 E;  2RQL A;  2ENH A;  4B3T E;  4LFC E;  2EOX A;  4KZS A;  4P7D A;  1L4S A;  3ADJ A;  4FK5 C;  3LL8 A;  3K7V C;  1KYQ A;  2ODR C;  4ZYD A;  4WWL A;  2YTQ A;  2EM9 A;  4DKK A;  4KHP E;  2PRT A;  4DV5 E;  2EOZ A;  5AC5 A;  2LUQ A;  1ZBT A;  1EH6 A;  2EQ0 A;  2NA2 A;  3HQ1 A;  2V89 A;  2EML A;  3PSO A;  4MOV A;  2JP9 A;  1YYW A;  2GPI A;  1OIE A;  2HGH A;  4V0V A;  3RMP A;  1X6H A;  1TF3 A;  4MLQ A;  2YRH A;  3ECR A;  1O0W A;  1X6E A;  4WX9 A;  4LF5 E;  5A6J A;  2LV2 A;  5J28 A;  4O43 A;  4IL1 A;  4M0V A;  3C4T A;  1XMQ E;  5IOH A;  2DLQ A;  3ICF A;  3C6M A;  2EM8 A;  3DSC A;  4RHB B;  2DIX A;  1JK2 A;  3RL3 A;  2N3H A;  2VE7 C;  2EPR A;  2YTG A;  2EMZ A;  5AE3 A;  1ZAA C;  3DJW A;  3UK3 C;  2UU9 E;  1X49 A;  2JPA A;  4IYP C;  2LVH A;  2L8T A;  1JK1 A;  2EMG A;  4GEQ B;  4F6N A;  2EP3 A;  2V85 A;  3KBP A;  1HNX E;  1XM7 A;  4R2Q A;  4H2B A;  2EE8 A;  4LU9 A;  3VHT B;  4R2C A;  1RC7 A;  4I5N C;  4TUG A;  1T4N A;  2EZ6 A;  4DUZ E;  5IV8 B;  4HD0 A;  1ZR9 A;  1QHW A;  2L3J A;  1G5B A;  4X66 E;  1IT6 A;  2O8A A;  2IHR 1;  2YTE A;  4M2Z A;  1X48 A;  1NCS A;  2E72 A;  2QFP A;  2YVT A;  2N3G A;  3QFO A;  3JTZ A;  4LAC C;  2YTD A;  1IMU A;  2EMI A;  2NAB A;  1S70 A;  3DF6 A;  4OOG C;  4DV6 E;  1A1K A;  1TCO A;  5A6A A;  4Q28 A;  2YEQ A;  4DSY A;  1HNW E;  3IB8 A;  2L6M A;  4B3R E;  3AV0 A;  4J6O A;  1IQO A;  4TUI A;  2M4I A;  4X65 E;  2EM6 A;  1S3M A;  3H69 A;  2ODR D;  1V73 A;  2EMF A;  2EOI A;  4KWY A;  2EJ4 A;  5LMN E;  4L5N C;  4ZYH A;  2YTP A;  4UT3 A;  2HC5 A;  3LML A;  1J26 A;  3JYF A;  2YSP A;  4ORC A;  4FBW A;  1OI8 A;  3EQ1 A;  2DSY A;  1YPN A;  2EPZ A;  4JI0 E;  2EN4 A;  2P6B A;  2JWO A;  4GKK E;  2WDC A;  3IWB A;  4DUY E;  2EWL A;  3H63 A;  2WDE A;  3KZZ A;  4JI7 E;  1HNZ E;  2F4V E;  4WXC A;  5AE2 A;  2UXB E;  5IXM B;  2DMI A;  5HPE A;  4JI8 E;  3THN A;  1TF6 A;  2EPC A;  1RMD A;  1JK7 A;  1EH7 A;  2IE3 C;  3C9F A;  2USH A;  2FV4 B;  4JI3 E;  1T38 A;  4JA7 A;  3EPK A;  5JJT A;  2JY9 A;  2L92 A;  2YT4 A;  2ADR A;  2EPL X;  4R2E A;  2JOG A;  3PSN A;  1HPU A;  4FCX A;  5JPF A;  4GKJ E;  2EPO A;  2EMH A;  4M9V C;  3HTX A;  3IWD A;  2EN2 A;  2Z1A A;  1UTE A;  2EMX A;  1YUI A;  1DQ3 A;  4JA9 A;  2M1S A;  2VRD A;  3RL5 A;  1AAY A;  1NNW A;  3QFN A;  4F54 A;  2GJU A;  1S3N A;  4BS9 A;  1MEY C;  5KL2 A;  2EMY A;  2MDG A;  3P1X A;  4LF6 E;  4HTG A;  4BCA A;  2YTF A;  4NZV A;  2QFR A;  3D03 A;  2LBS B;  3EPL A;  3T1H E;  5IWA E;  4ZYE A;  1YYK A;  4KBP A;  4P78 A;  4V0X A;  4I8O A;  3OTO E;  2VF1 A;  4Q7F A;  2LJH A;  1GZ6 A;  2R17 A;  3AUZ A;  1G2F C;  1S3L A;  5KL7 A;  4JV5 E;  4OR9 A;  1N34 E;  2NUE A;  1X3C A;  4R03 A;  3EGH A;  3H62 B;  1WHN A;  3TGH A;  2RSI A;  3C6K A;  1FKA E;  4DR2 E;  1USH A;  2EOQ A;  3C4B A;  4HEI A;  4L8N A;  4LF8 E;  2Q8U A;  2HJJ A;  1UIL A;  2LCE A;  2BB8 A;  5B8I A;  4BHB A;  2G7H A;  2EPN A;  2QJC A;  2ELY A;  1XMO E;  2E5L E;  4LF4 E;  4F9C B;  4F9B B;  2DRP A;  2YRK A;  4K0K E;  2EN3 A;  2YTJ A;  1P47 A;  4BC9 A;  2RTX A;  5T6J A;  2BDX A;  2B7V A;  1A1I A;  3QFM A;  2M9A A;  2CTD A;  4WSG A;  5AAS A;  4DR5 E;  4DV0 E;  2MKD A;  4ZYG A;  4DR6 E;  3BF2 A;  2EM0 A;  2KON A;  1SFE A;  1EH8 A;  2EN7 A;  2HYO A;  4DMI A;  2MC6 A;  2K4V A;  2MDR A;  3EGG A; 
#chains in the Genus database with same CATH homology
 2DFJ A;  2V86 A;  3VK6 A;  4UT3 B;  5FLX C;  2NUG A;  3J81 C;  5F3W A;  2NXF A;  2V83 A;  4H1Y P;  5IT9 C;  1N36 E;  3RL4 A;  3VYY A;  5C1V A;  4UWQ A;  3C5W C;  4MP0 A;  2B9D A;  2LE2 A;  1DI2 A;  4F9A B;  1UF3 A;  3FLO A;  2FGG A;  3GVE A;  2JR1 A;  4DR3 E;  3F6G A;  1XNR E;  2CPN A;  3E7B A;  3DSD A;  5INB A;  2ZOA A;  3V4Y A;  5AE1 A;  1T71 A;  1SU1 A;  5A2Q C;  2DXL A;  2IAE C;  4O4K A;  1IBK E;  2FTX B;  1WAR A;  2KHX A;  4WPY A;  4H1S A;  3RQZ A;  2WDF A;  1S8E A;  4BBY A;  3FIG A;  4B3S E;  3JAM C;  1ZBQ A;  4DR1 E;  1HR0 E;  1SR9 A;  2BQ8 X;  1T70 A;  1UHZ A;  1XZW A;  4DT2 A;  1MF8 A;  4WSP A;  2L3C A;  4YY3 E;  4XPN A;  2Z72 A;  4ZVZ A;  1RQ0 A;  3ADI A;  3IVD A;  4DHL A;  3ADL A;  4LTY A;  2XMO A;  3QFK A;  2NPP C;  3LLH A;  2F8B A;  3T1Y E;  4B2O A;  2HY1 A;  2VQF E;  4O24 A;  2UUC E;  3F6H A;  2E1M A;  3CK2 A;  1T4O A;  1N32 E;  4WFT A;  4WYQ B;  5LL6 R;  3OML A;  2H36 X;  2LTR A;  2YZT A;  4DV2 E;  3HPS A;  4DV7 E;  3N5U A;  1IBM E;  1FJG E;  5DNY A;  1WHQ A;  4LFB E;  3T1I A;  2V87 A;  1Z2X A;  3H60 A;  2NYM C;  3P71 C;  4UT2 A;  1PKP A;  2ZBM A;  2NYL C;  4FBK A;  4H2F A;  1N33 E;  2JOX A;  4B3M E;  4J8Z A;  4X62 E;  3IVE A;  3ZU0 A;  3VYX A;  1W24 A;  4NXM E;  1AUI A;  5CFF E;  4FBQ A;  1OID A;  3E7A A;  3HVQ A;  2LUP B;  2L33 A;  2VQE E;  2DXN A;  1X47 A;  2JVA A;  2DMY A;  2AHD A;  3ZOQ B;  3IB7 A;  4JI2 E;  3JU0 A;  2DB2 A;  4DV4 E;  3HXL A;  2LMZ A;  3IWC A;  2HHH E;  2IE4 C;  2KOU A;  2KKN A;  2HYP A;  3H64 A;  2B7T A;  2LTS A;  1HP1 A;  2L2N A;  3ZTV A;  1WXR A;  3DW8 C;  4H2G A;  2UXC E;  1QFC A;  2BCD A;  3H66 A;  3KWR A;  4DR7 E;  3H61 A;  2NUF A;  5GTU A;  2A22 A;  4V0W A;  4X8W A;  3K6Q A;  2O8G A;  4OX9 E;  2L2M A;  4NXN E;  2WZO A;  4LF9 E;  4YKE A;  3E0J A;  2ZO9 B;  1XNQ E;  3K7W C;  4G9J A;  1HO5 A;  2UXD E;  5ADZ A;  4X64 E;  2RSM A;  4JYA E;  2V88 A;  2L2K B;  4I5L C;  4ZX2 A;  4M30 A;  4BMJ A;  1T4L B;  3H09 A;  2RS6 A;  4KKZ A;  3QG5 C;  2MC5 A;  4DV1 E;  1FJM A;  1STU A;  1QU6 A;  4DV3 E;  2RS7 A;  2LRS A;  5LMU E;  2B3T B;  1YZ9 A;  4JI1 E;  4O5G A;  5EQV A;  4H2I A;  2M7Q A;  4F0Z A;  4R8O A;  3J7Y p;  4JI6 E;  3THO B;  2JOB A;  4ORB A;  1GQE A;  2Z06 A;  1WAO 1;  4BC7 A;  1IBL E;  1J5E E;  3H68 A;  4MOY A;  4AQY E;  3H67 A;  5JPE A;  2UUB E;  4DR4 E;  4LF7 E;  3ADG A;  3FGA C;  4JI4 E;  4ORA A;  3HPZ A;  5BR8 E;  3MSW A;  2V8Q B;  3J80 C;  2UUA E;  1M63 A;  1EKZ A;  1II7 A;  4YHH E;  1U32 A;  4LFA E;  1KBP A;  3J7A G;  2CV9 A;  1I94 E;  1S95 A;  1Z2W A;  2ZM6 E;  1YYO A;  2WDD A;  4JI5 E;  4LFC E;  4B3T E;  4KZS A;  4P7D A;  3ADJ A;  3LL8 A;  3K7V C;  2ODR C;  4WWL A;  4DKK A;  4KHP E;  4DV5 E;  2LUQ A;  1ZBT A;  2NA2 A;  3HQ1 A;  2V89 A;  3PSO A;  4MOV A;  1YYW A;  1OIE A;  4V0V A;  3RMP A;  1O0W A;  4LF5 E;  5J28 A;  4O43 A;  4IL1 A;  4M0V A;  3C4T A;  1XMQ E;  5IOH A;  3ICF A;  3DSC A;  2DIX A;  3RL3 A;  2N3H A;  2VE7 C;  5AE3 A;  3DJW A;  2UU9 E;  1X49 A;  4IYP C;  2L8T A;  4GEQ B;  2V85 A;  3KBP A;  1HNX E;  1XM7 A;  4H2B A;  4LU9 A;  1RC7 A;  4I5N C;  4TUG A;  1T4N A;  2EZ6 A;  4DUZ E;  4HD0 A;  1QHW A;  1G5B A;  2L3J A;  4X66 E;  1IT6 A;  2O8A A;  2IHR 1;  4M2Z A;  1X48 A;  2YVT A;  2QFP A;  2N3G A;  3QFO A;  3JTZ A;  4LAC C;  1TCO A;  1S70 A;  3DF6 A;  4OOG C;  4DV6 E;  4Q28 A;  2YEQ A;  4DSY A;  1HNW E;  3IB8 A;  2L6M A;  4B3R E;  3AV0 A;  4J6O A;  4TUI A;  2M4I A;  4X65 E;  1S3M A;  3H69 A;  2ODR D;  1V73 A;  5LMN E;  4L5N C;  4UT3 A;  3LML A;  1J26 A;  3JYF A;  4ORC A;  4FBW A;  1OI8 A;  2DSY A;  4JI0 E;  2P6B A;  2JWO A;  4GKK E;  2WDC A;  3IWB A;  4DUY E;  2EWL A;  3H63 A;  2WDE A;  4JI7 E;  1HNZ E;  2F4V E;  5AE2 A;  2UXB E;  5HPE A;  4JI8 E;  3THN A;  1JK7 A;  2IE3 C;  3C9F A;  2USH A;  2FV4 B;  4JI3 E;  4JA7 A;  5JJT A;  2JY9 A;  2L92 A;  2YT4 A;  3PSN A;  4FCX A;  2JOG A;  1HPU A;  5JPF A;  4GKJ E;  3HTX A;  3IWD A;  2Z1A A;  1UTE A;  1DQ3 A;  4JA9 A;  2M1S A;  3RL5 A;  1NNW A;  3QFN A;  4F54 A;  2GJU A;  1S3N A;  4BS9 A;  3P1X A;  4LF6 E;  4BCA A;  4NZV A;  2QFR A;  3D03 A;  2LBS B;  3T1H E;  5IWA E;  1YYK A;  4KBP A;  4P78 A;  4V0X A;  4I8O A;  3OTO E;  2VF1 A;  4Q7F A;  2LJH A;  1GZ6 A;  2R17 A;  3AUZ A;  1S3L A;  4JV5 E;  4OR9 A;  1N34 E;  2NUE A;  4R03 A;  3EGH A;  3H62 B;  1WHN A;  3TGH A;  1FKA E;  4DR2 E;  1USH A;  3C4B A;  4L8N A;  4LF8 E;  2Q8U A;  1UIL A;  5B8I A;  2G7H A;  2QJC A;  1XMO E;  2E5L E;  4LF4 E;  4F9C B;  4F9B B;  4K0K E;  4BC9 A;  2RTX A;  5T6J A;  2BDX A;  2B7V A;  3QFM A;  5AAS A;  4DR5 E;  4DV0 E;  4DR6 E;  2KON A;  2HYO A;  4DMI A;  2MC6 A;  2K4V A;  2MDR A;  3EGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...