3AUZA

Crystal structure of mre11 with manganese
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
316
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
molecule keywords DNA double-strand break repair protein mre11
total genus 99
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3auzA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3auzA01
1HP1A 4IYPC 2WDFA 3KBPA 3CK2A 3THNA 3IB7A 3EGGA 3H69A 2YVTA 4B2OA 1WAO1 5J28A 2Z06A 1HPUA 1JK7A 2GJUA 1USHA 4TUIA 4V0WA 5INBA 4V0VA 4LACC 4ORBA 1M63A 3ICFA 3V4YA 1OIDA 4UT2A 2NYLC 1NNWA 1T71A 1S3MA 3ZTVA 3H63A 4H2GA 3ZU0A 2P6BA 5C1VA 2O8AA 5JJTA 2NPPC 1UF3A 4ZVZA 1U32A 2DFJA 4NZVA 4O24A 4KBPA 1Z2XA 2Z72A 4G9JA 2CV9A 4H1SA 5EQVA 5GTUA 1XM7A 2Z1AA 3C5WC 4HD0A 2QFRA 4UT3B 4H2IA 2BDXA 2WDEA 4H1YP 2IE4C 3H68A 4MOVA 3N5UA 4ZX2A 1V73A 3RL5A 1UTEA 2HYOA 1IT6A 1S95A 3H66A 2HYPA 1FJMA 1TCOA 2ZBMA 3K7WC 1QHWA 4XPNA 1QFCA 4WWLA 3H64A 4UT3A 2BQ8X 2IE3C 4I5NC 5JPEA 1W24A 1Z2WA 4FBQA 2XMOA 4DT2A 1XZWA 1G5BA 2QFPA 2WDCA 3RQZA 4YKEA 2Q8UA 1S8EA 4JA9A 4OR9A 3T1IA 4Q7FA 1MF8A 4J6OA 3H62B 1KBPA 1S3LA 3E7BA 3H60A 4FBWA 4V0XA 4I5LC 5F3WA 3LL8A 4TUGA 2NXFA 4O43A 1OI8A 3PSNA 4H2BA 3H61A 3AUZA 4ORCA 1T70A 1SU1A 5DNYA 4H2FA 2JOGA 2A22A 3QFMA 4FBKA 4ORAA 2IAEC 4UWQA 3QFOA 1II7A 4O5GA 4DSYA 3RL3A 3DW8C 3P71C 1AUIA 3FGAC 1S3NA 2R17A 1HO5A 3DSCA 3THOB 3IVEA 3IVDA 4LTYA 4MP0A 3QFKA 4MOYA 5IOHA 3E7AA 4LU9A 5JPFA 3JYFA 3RL4A 5B8IA 1S70A 2NYMC 4M0VA 4F0ZA 3HVQA 3DSDA 3EGHA 2AHDA 3K7VC 4KKZA 3TGHA 3IB8A 4JA7A 3AV0A 4O4KA 1OIEA 3H67A 3C9FA 3PSOA 4IL1A 4DHLA 2USHA 4FCXA 5HPEA 3QG5C 2BCDA 2QJCA 1WARA 2O8GA 2KKNA 2HY1A 3QFNA 2WDDA 3GVEA
chains in the Genus database with same CATH superfamily
1YUJA 2I13A 1HP1A 2WDFA 4J8ZA 2WBUA 3THNA 2EPOA 4YHHE 2EZ6A 2NUEA 2UUAE 1N32E 1WAO1 1HPUA 2LCEA 1X49A 2MC6A 5KL4A 4ORBA 3T1YE 2DGCA 1YYWA 2DMIA 4K0KE 4Q28A 3T1HE 1NNWA 2VE7C 1X6HA 3C4BA 2CPNA 3KWRA 1S3MA 3H63A 4H2GA 2P6BA 3ZTVA 2NUGA 3ZU0A 5JJTA 1X6EA 4OOGC 2BB8A 2EQ0A 1U32A 2EPKX 4O24A 2EL4A 1I94E 4WSGA 2VRDA 2JXPA 2UXBE 1XM7A 2Z1AA 1PJQA 2RS7A 3VYXA 2BDXA 3HPSA 4DR4E 3N5UA 1QNTA 1V73A 1A1IA 2HYOA 2RSMA 3K6QA 3H66A 1B69A 2L33A 4NHRA 2UUBE 2ZBMA 4XPNA 2LVHA 1QFCA 4BHBA 2V89A 4P78A 4UT3A 4JI5E 4I5NC 2RTXA 4DT2A 4WPYA 1TN9A 2EN7A 2EQ1A 5AE1A 2MKNA 3BGHA 2QFPA 1IBME 1GZ6A 2DIXA 2Q8UA 2EOEA 1MF8A 4LF5E 1YZ9A 2L3CA 4X62E 2FTXB 4JV5E 1X48A 4HTGA 4I5LC 5F3WA 4YY3E 5AASA 4TUGA 3HXLA 3J81C 2ZM6E 2NXFA 1IBLE 3ECRA 4I8OA 4DR6E 3LMLA 2DXLA 2EM9A 2L6MA 4X65E 2M9AA 2EWLA 2EMCA 4ORCA 4X8WA 2A22A 4FBKA 4UWQA 1II7A 2RS6A 4DSYA 1J5EE 1N33E 2EM0A 3HTXA 4M9VC 4F9BB 5IT9C 3J7Yp 5KL5A 1TF3A 1DI2A 2EE8A 1HO5A 3THOB 3EPJA 3EPLA 1G2FC 3JYFA 4X9JA 1STUA 3RL4A 5CFFE 2N8XA 2ZOAA 2V85A 1S70A 2YSPA 2VQEE 3F6HA 3HVQA 2MC5A 3K7VC 1RQ0A 2JWOA 5A2QC 1TF6A 5A69A 2YWQA 5A6KA 5BR8E 1YPNA 2ZO9B 4IJDA 2USHA 2LUQA 2EMFA 4F6NA 1YSAC 2YTNA 4BBYA 2HY1A 4ZVZA 2WDDA 4DV4E 4IYPC 4X64E 4L8NA 1A1FA 2JVAA 3IB7A 1JK2A 1WRJA 2LTRA 4F2JC 1JK7A 1USHA 4TUIA 2EN4A 2DLQA 1T4LB 3IWCA 3P1XA 4LACC 5AE3A 2EOMA 4BC9A 4BS9A 3ICFA 2UXDE 3V4YA 5LMNE 1OIDA 1SFEA 5KL7A 4UT2A 2YTFA 4ZYHA 4GKJE 1WJPA 5KL6A 5C1VA 2VF1A 1T4NA 3H09A 1UILA 2K4VA 1UF3A 2JYAA 1BBOA 3KZZA 5AE2A 2DFJA 2EN6A 4KBPA 4H1SA 2Z72A 2EPLX 4DV6E 5EQVA 1ZBQA 2FGGA 3ADJA 2V83A 2EOSA 3C6MA 1IMUA 4H2IA 5AC4A 2IE4C 2LT7A 2MKDA 2F8BA 2YRKA 1RC7A 3RL5A 2GPIA 1IT6A 1GTKA 1PJTA 1FJMA 1TCOA 1HNXE 3K7WC 3E0JA 2M7QA 4BHCA 1N34E 4WWLA 2BQ8X 3MHHC 2IE3C 2XMOA 2B7TA 1XZWA 3DJWA 2JP9A 1A1GA 2WDCA 2R1FA 4YKEA 2LMZA 2NA2A 3IWBA 1S8EA 4JA9A 4Q7FA 3H62B 2DB2A 4ZYDA 1KBPA 4LF8E 2EN1A 1UN6B 2IHR1 2EQ3A 4V0XA 1ZBTA 1NEIA 1P47A 4GEQB 2EMAA 3LL8A 2EOOA 2EPPA 1J26A 1OI8A 5FLXC 2YTPA 4NXNE 3H61A 3AUZA 2L2MA 2YTIA 3EPKA 4DUYE 5DNYA 5IV8B 2JOGA 2YU8A 4R2QA 4O5GA 4BCAA 3RL3A 1WHNA 4LFAE 3DW8C 3P71C 3JAMC 4FK5C 1T39A 1AUIA 3FGAC 2ENCA 2LV2A 4OX9E 1F2IG 2M1SA 2V88A 2VQFE 3VYYA 2YSOA 2EM5A 2BBGA 3DSCA 2H36X 1EH7A 2EMIA 2KHXA 4LTYA 4MP0A 3QFKA 2EM8A 4Q35B 4MOYA 5IOHA 3E7AA 2HGHA 2YU5A 2A25A 1ZR9A 2EOZA 1BBGA 2NYMC 4N4RB 2EORA 4KWYA 2G7HA 1JK1A 4R2EA 3TGHA 3AV0A 1X47A 2WCC3 2EOJA 2EOQA 1OIEA 1ZAAC 2WZOA 4ZYGA 3PSOA 2K7IA 2BCDA 2EPMX 1WARA 4WSPA 2O8GA 4F0ZA 4OR9A 3QFNA 3H64A 4LFBE 1YYKA 3GVEA 4B3SE 3KBPA 3C4TA 2EOYA 3EGGA 3H69A 2EP3A 2UU9E 1O0WA 4B2OA 1DQ3A 2Z06A 1EH6A 3MSWA 2NABA 2EM2A 5ADZA 4JI3E 2L3JA 2GHFA 1L4SA 3FIGA 2RSIA 3JTZA 2EMWA 2MDRA 4IS1C 4DR7E 2EN8A 4DV7E 1A1HA 2L2KB 2YTOA 4KZSA 1YFHA 2EMLA 4M30A 4M2ZA 4NZVA 2DXNA 4G9JA 1QU6A 2EOFA 4WFTA 2EMHA 3HPZA 4DV0E 1G2DC 2QFRA 4MOVA 1IQSA 4ZX2A 1A1KA 4DR1E 2DRPA 2EMXA 1UTEA 1S95A 2EPNA 2YPNA 5IWAE 2HYPA 2EM4A 5KL3A 3FLOA 2EM3A 4NXME 3BBGA 4JI2E 4LF7E 1XMQE 2LJHA 4B3ME 2EOIA 1BB8A 1GQEA 2JOBA 4FBQA 4RH8A 2EPAA 4WX9A 3RQZA 2V87A 4P7DA 3RMPA 2N3HA 2E1MA 2YRHA 1T4OA 1AH5A 4B3RE 5KL2A 4FBWA 1DGCA 3ADLA 1YYOA 1XMOE 3OMLA 4GKKE 1X3CA 1XNQE 2I9IA 5A6AA 3MHSC 2YRMA 4DR3E 3PSNA 4MLVA 3EPHA 1SR9A 4F9CB 4DV2E 2EPUA 2EOHA 2D9HA 1T70A 4H2FA 2N3GA 1PJSA 4R03A 3QFMA 4R2PA 3LLHA 1RMDA 2IAEC 2L8TA 5AC5A 3QFOA 2EM7A 2ODRC 2ELYA 1HR0E 2DLKA 1HNWE 2MDGA 2LO3A 1S3NA 2R17A 2YTDA 2DSYA 4RHBB 3IVEA 2LRSA 1YUIA 1KYQA 2EN2A 2V8QB 1IBKE 2JPAA 5JPFA 5B8IA 3J80C 2M4IA 1UHZA 2ADRA 2EN3A 4LF6E 2AHDA 4KKZA 3BF2A 3IB8A 5A6BD 2ODRD 4JA7A 4KHPE 2EM6A 4O4KA 4X66E 2YTGA 2RQLA 1MGTA 4R2CA 4HEIA 4DHLA 2B9DA 2WBTA 1HNZE 5HPEA 2B7VA 3IWDA 3QG5C 2B3TB 2QJCA 4JI8E 2EMKA 4R2RA 3ADIA 2E72A 2LBSB 3HQ1A 3CK2A 2E5LE 2YVTA 2UUCE 4AQYE 5J28A 3J7AG 2GJUA 1ZU1A 4V0WA 3TQMA 4V0VA 5INBA 2YZTA 2NUFA 1M63A 4JI1E 2HC5A 3DF6A 2F4VE 4DMIA 4ZYEA 2CSHA 4JI4E 2NYLC 1T71A 4DKKA 2YT4A 4DUZE 2UXCE 3BIDA 2O8AA 4DR2E 4F6MA 2NPPC 2ELZA 2CTDA 2EMZA 2L92A 2CT1A 4LFCE 1WHQA 1Z2XA 2CV9A 5GTUA 4MLQA 1PDAA 2LJUA 4R2AA 4DV1E 4R8OA 1N3GA 2R76A 3VHTB 2EMBA 3C5WC 4HD0A 4UT3B 2EMGA 3ADGA 3JU0A 2WDEA 3H68A 3KZYA 4H1YP 1LLMC 1XNRE 2EPZA 1UBDC 1EKZA 2RPCA 4R2SA 2KOUA 2V86A 2DMYA 2KONA 2EPXA 3M99B 1QHWA 3UK3C 2EL6A 1IQOA 2J7JA 4JI6E 2PRTA 2JR1A 4L5NC 1W24A 4JYAE 4LF4E 1Z2WA 5JPEA 4BMJA 1N36E 1X6FA 3D03A 3L00A 1G5BA 4WYQB 1NCSA 1KJKA 3T1IA 4J6OA 4F9AB 1S3LA 3E7BA 3H60A 3F6GA 3VK6A 2ENAA 2FV4B 1MEYC 2LTSA 1PKPA 5T6JA 1FKAE 2YTEA 4O43A 2JOXA 2EOXA 4F54A 4H2BA 1FJGE 5LL6R 4GZNC 1SU1A 1X5WA 5TSEA 2EL5A 2EPRA 4ORAA 2LUPB 2HJJA 4DR5E 4DV5E 2LE2A 4B3TE 3EQ1A 4JI0E 5A6BA 1WXRA 5LLQA 2EPCA 2YTQA 1A1JA 4BC7A 4DV3E 3IVDA 2HHHE 4LF9E 4WXCA 2EJ4A 4LU9A 5IXMB 2L2NA 2EMYA 1EH8A 5A6JA 2YTJA 4WXDA 3C6KA 2GLIA 1T38A 2YEQA 4M0VA 5LMUE 4JI7E 3DSDA 3EGHA 3H67A 3C9FA 1AAYA 3OTOE 1Z1BA 4IL1A 4FCXA 3ZOQB 2JY9A 4R2DA 1A1LA 2KKNA 2ENHA 2WBSA
chains in the Genus database with same CATH topology
1HP1A 2WDFA 4J8ZA 3THNA 4YHHE 2EZ6A 2NUEA 2UUAE 1N32E 1WAO1 1HPUA 1X49A 2MC6A 4ORBA 3T1YE 1YYWA 4K0KE 4Q28A 3T1HE 1NNWA 2VE7C 3C4BA 2CPNA 3KWRA 1S3MA 3H63A 4H2GA 2P6BA 3ZTVA 2NUGA 3ZU0A 5JJTA 4OOGC 1U32A 4O24A 1I94E 2UXBE 1XM7A 2Z1AA 2RS7A 3VYXA 2BDXA 3HPSA 4DR4E 3N5UA 1V73A 2HYOA 2RSMA 3K6QA 3H66A 2L33A 2UUBE 2ZBMA 4XPNA 1QFCA 2V89A 4P78A 4UT3A 4JI5E 4I5NC 2RTXA 4DT2A 4WPYA 5AE1A 2QFPA 1IBME 1GZ6A 2DIXA 2Q8UA 1MF8A 4LF5E 1YZ9A 2L3CA 4X62E 2FTXB 4JV5E 1X48A 4I5LC 5F3WA 4YY3E 5AASA 4TUGA 3HXLA 3J81C 2ZM6E 2NXFA 1IBLE 2DXLA 4I8OA 3LMLA 4DR6E 2L6MA 4X65E 2EWLA 4ORCA 4X8WA 2A22A 4FBKA 4UWQA 1II7A 2RS6A 4DSYA 1J5EE 1N33E 3HTXA 4F9BB 5IT9C 3J7Yp 1DI2A 1HO5A 3THOB 3JYFA 1STUA 3RL4A 5CFFE 2ZOAA 2V85A 1S70A 2VQEE 3F6HA 3HVQA 2MC5A 3K7VC 1RQ0A 2JWOA 5A2QC 5BR8E 2ZO9B 2USHA 2LUQA 4BBYA 2HY1A 4ZVZA 2WDDA 4DV4E 4IYPC 4X64E 4L8NA 2JVAA 3IB7A 2LTRA 1JK7A 1USHA 4TUIA 1T4LB 3IWCA 3P1XA 4LACC 5AE3A 4BC9A 4BS9A 3ICFA 2UXDE 3V4YA 5LMNE 1OIDA 4UT2A 4GKJE 5C1VA 2VF1A 1T4NA 3H09A 1UILA 2K4VA 1UF3A 5AE2A 2DFJA 4KBPA 4H1SA 2Z72A 4DV6E 5EQVA 1ZBQA 2FGGA 3ADJA 2V83A 4H2IA 2IE4C 2F8BA 1RC7A 3RL5A 1IT6A 1FJMA 1TCOA 1HNXE 3K7WC 3E0JA 2M7QA 1N34E 4WWLA 2BQ8X 2IE3C 2XMOA 2B7TA 1XZWA 3DJWA 2WDCA 4YKEA 2LMZA 2NA2A 3IWBA 1S8EA 4JA9A 4Q7FA 3H62B 2DB2A 1KBPA 4LF8E 2IHR1 4V0XA 1ZBTA 4GEQB 3LL8A 1J26A 1OI8A 5FLXC 4NXNE 3H61A 3AUZA 2L2MA 4DUYE 5DNYA 2JOGA 4O5GA 4BCAA 3RL3A 1WHNA 4LFAE 3DW8C 3P71C 3JAMC 1AUIA 3FGAC 4OX9E 2M1SA 2V88A 2VQFE 3VYYA 3DSCA 2H36X 2KHXA 4LTYA 4MP0A 3QFKA 4MOYA 5IOHA 3E7AA 2NYMC 2G7HA 3TGHA 3AV0A 1X47A 1OIEA 2WZOA 3PSOA 2BCDA 1WARA 4WSPA 2O8GA 4F0ZA 4OR9A 3QFNA 3H64A 4LFBE 1YYKA 3GVEA 4B3SE 3KBPA 3C4TA 3EGGA 3H69A 2UU9E 1O0WA 4B2OA 1DQ3A 2Z06A 3MSWA 5ADZA 4JI3E 2L3JA 3FIGA 3JTZA 4DR7E 2MDRA 4DV7E 2L2KB 4KZSA 4M30A 4M2ZA 4NZVA 2DXNA 4G9JA 1QU6A 4WFTA 3HPZA 4DV0E 2QFRA 4MOVA 4ZX2A 4DR1E 1UTEA 1S95A 2HYPA 5IWAE 3FLOA 4NXME 4JI2E 4LF7E 1XMQE 2LJHA 4B3ME 1GQEA 2JOBA 4FBQA 3RQZA 2V87A 4P7DA 3RMPA 2N3HA 2E1MA 1T4OA 4B3RE 4FBWA 3ADLA 1YYOA 1XMOE 3OMLA 4GKKE 1XNQE 4DR3E 3PSNA 1SR9A 4F9CB 4DV2E 1T70A 4H2FA 2N3GA 4R03A 3QFMA 3LLHA 2IAEC 2L8TA 3QFOA 2ODRC 1HR0E 1HNWE 1S3NA 2R17A 2DSYA 3IVEA 2LRSA 2V8QB 1IBKE 5JPFA 5B8IA 3J80C 2M4IA 1UHZA 4LF6E 2AHDA 4KKZA 3IB8A 2ODRD 4JA7A 4KHPE 4O4KA 4X66E 4DHLA 2B9DA 1HNZE 5HPEA 2B7VA 3IWDA 3QG5C 2B3TB 2QJCA 4JI8E 3ADIA 2LBSB 3HQ1A 3CK2A 2E5LE 2YVTA 2UUCE 4AQYE 5J28A 3J7AG 2GJUA 4V0WA 5INBA 4V0VA 2YZTA 2NUFA 1M63A 4JI1E 3DF6A 2F4VE 4DMIA 4JI4E 2NYLC 1T71A 4DKKA 2YT4A 4DUZE 2UXCE 2O8AA 4DR2E 2NPPC 2L92A 4LFCE 1Z2XA 1WHQA 2CV9A 5GTUA 4DV1E 4R8OA 3C5WC 4HD0A 4UT3B 3ADGA 2WDEA 3JU0A 3H68A 4H1YP 1XNRE 1EKZA 2KOUA 2V86A 2DMYA 2KONA 1QHWA 4JI6E 2JR1A 4L5NC 1W24A 1Z2WA 4LF4E 4JYAE 5JPEA 4BMJA 1N36E 3D03A 1G5BA 4WYQB 3T1IA 4J6OA 4F9AB 1S3LA 3E7BA 3H60A 3F6GA 3VK6A 2FV4B 2LTSA 1PKPA 5T6JA 1FKAE 4O43A 2JOXA 4F54A 4H2BA 1FJGE 5LL6R 1SU1A 4ORAA 2LUPB 4DR5E 4DV5E 2LE2A 4B3TE 4JI0E 1WXRA 4BC7A 4DV3E 3IVDA 2HHHE 4LF9E 4LU9A 2L2NA 2YEQA 4M0VA 5LMUE 4JI7E 3DSDA 3EGHA 3H67A 3C9FA 3OTOE 4IL1A 4FCXA 3ZOQB 2JY9A 2KKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP1 A;  4IYP C;  2WDF A;  3KBP A;  3CK2 A;  3THN A;  3IB7 A;  3EGG A;  3H69 A;  2YVT A;  4B2O A;  1WAO 1;  5J28 A;  2Z06 A;  1HPU A;  1JK7 A;  2GJU A;  1USH A;  4TUI A;  4V0W A;  5INB A;  4V0V A;  4LAC C;  4ORB A;  1M63 A;  3ICF A;  3V4Y A;  1OID A;  4UT2 A;  2NYL C;  1NNW A;  1T71 A;  1S3M A;  3ZTV A;  3H63 A;  4H2G A;  3ZU0 A;  2P6B A;  5C1V A;  2O8A A;  5JJT A;  2NPP C;  1UF3 A;  4ZVZ A;  1U32 A;  2DFJ A;  4NZV A;  4O24 A;  4KBP A;  1Z2X A;  2Z72 A;  4G9J A;  2CV9 A;  4H1S A;  5EQV A;  5GTU A;  1XM7 A;  2Z1A A;  3C5W C;  4HD0 A;  2QFR A;  4UT3 B;  4H2I A;  2BDX A;  2WDE A;  4H1Y P;  2IE4 C;  3H68 A;  4MOV A;  3N5U A;  4ZX2 A;  1V73 A;  3RL5 A;  1UTE A;  2HYO A;  1IT6 A;  1S95 A;  3H66 A;  2HYP A;  1FJM A;  1TCO A;  2ZBM A;  3K7W C;  1QHW A;  4XPN A;  1QFC A;  4WWL A;  3H64 A;  4UT3 A;  2BQ8 X;  2IE3 C;  4I5N C;  5JPE A;  1W24 A;  1Z2W A;  4FBQ A;  2XMO A;  4DT2 A;  1XZW A;  1G5B A;  2QFP A;  2WDC A;  3RQZ A;  4YKE A;  2Q8U A;  1S8E A;  4JA9 A;  4OR9 A;  3T1I A;  4Q7F A;  1MF8 A;  4J6O A;  3H62 B;  1KBP A;  1S3L A;  3E7B A;  3H60 A;  4FBW A;  4V0X A;  4I5L C;  5F3W A;  3LL8 A;  4TUG A;  2NXF A;  4O43 A;  1OI8 A;  3PSN A;  4H2B A;  3H61 A;  3AUZ A;  4ORC A;  1T70 A;  1SU1 A;  5DNY A;  4H2F A;  2JOG A;  2A22 A;  3QFM A;  4FBK A;  4ORA A;  2IAE C;  4UWQ A;  3QFO A;  1II7 A;  4O5G A;  4DSY A;  3RL3 A;  3DW8 C;  3P71 C;  1AUI A;  3FGA C;  1S3N A;  2R17 A;  1HO5 A;  3DSC A;  3THO B;  3IVE A;  3IVD A;  4LTY A;  4MP0 A;  3QFK A;  4MOY A;  5IOH A;  3E7A A;  4LU9 A;  5JPF A;  3JYF A;  3RL4 A;  5B8I A;  1S70 A;  2NYM C;  4M0V A;  4F0Z A;  3HVQ A;  3DSD A;  3EGH A;  2AHD A;  3K7V C;  4KKZ A;  3TGH A;  3IB8 A;  4JA7 A;  3AV0 A;  4O4K A;  1OIE A;  3H67 A;  3C9F A;  3PSO A;  4IL1 A;  4DHL A;  2USH A;  4FCX A;  5HPE A;  3QG5 C;  2BCD A;  2QJC A;  1WAR A;  2O8G A;  2KKN A;  2HY1 A;  3QFN A;  2WDD A;  3GVE A; 
#chains in the Genus database with same CATH topology
 1YUJ A;  2I13 A;  1HP1 A;  2WDF A;  4J8Z A;  2WBU A;  3THN A;  2EPO A;  4YHH E;  2EZ6 A;  2NUE A;  2UUA E;  1N32 E;  1WAO 1;  1HPU A;  2LCE A;  1X49 A;  2MC6 A;  5KL4 A;  4ORB A;  3T1Y E;  2DGC A;  1YYW A;  2DMI A;  4K0K E;  4Q28 A;  3T1H E;  1NNW A;  2VE7 C;  1X6H A;  3C4B A;  2CPN A;  3KWR A;  1S3M A;  3H63 A;  4H2G A;  2P6B A;  3ZTV A;  2NUG A;  3ZU0 A;  5JJT A;  1X6E A;  4OOG C;  2BB8 A;  2EQ0 A;  1U32 A;  2EPK X;  4O24 A;  2EL4 A;  1I94 E;  4WSG A;  2VRD A;  2JXP A;  2UXB E;  1XM7 A;  2Z1A A;  1PJQ A;  2RS7 A;  3VYX A;  2BDX A;  3HPS A;  4DR4 E;  3N5U A;  1QNT A;  1V73 A;  1A1I A;  2HYO A;  2RSM A;  3K6Q A;  3H66 A;  1B69 A;  2L33 A;  4NHR A;  2UUB E;  2ZBM A;  4XPN A;  2LVH A;  1QFC A;  4BHB A;  2V89 A;  4P78 A;  4UT3 A;  4JI5 E;  4I5N C;  2RTX A;  4DT2 A;  4WPY A;  1TN9 A;  2EN7 A;  2EQ1 A;  5AE1 A;  2MKN A;  3BGH A;  2QFP A;  1IBM E;  1GZ6 A;  2DIX A;  2Q8U A;  2EOE A;  1MF8 A;  4LF5 E;  1YZ9 A;  2L3C A;  4X62 E;  2FTX B;  4JV5 E;  1X48 A;  4HTG A;  4I5L C;  5F3W A;  4YY3 E;  5AAS A;  4TUG A;  3HXL A;  3J81 C;  2ZM6 E;  2NXF A;  1IBL E;  3ECR A;  4I8O A;  4DR6 E;  3LML A;  2DXL A;  2EM9 A;  2L6M A;  4X65 E;  2M9A A;  2EWL A;  2EMC A;  4ORC A;  4X8W A;  2A22 A;  4FBK A;  4UWQ A;  1II7 A;  2RS6 A;  4DSY A;  1J5E E;  1N33 E;  2EM0 A;  3HTX A;  4M9V C;  4F9B B;  5IT9 C;  3J7Y p;  5KL5 A;  1TF3 A;  1DI2 A;  2EE8 A;  1HO5 A;  3THO B;  3EPJ A;  3EPL A;  1G2F C;  3JYF A;  4X9J A;  1STU A;  3RL4 A;  5CFF E;  2N8X A;  2ZOA A;  2V85 A;  1S70 A;  2YSP A;  2VQE E;  3F6H A;  3HVQ A;  2MC5 A;  3K7V C;  1RQ0 A;  2JWO A;  5A2Q C;  1TF6 A;  5A69 A;  2YWQ A;  5A6K A;  5BR8 E;  1YPN A;  2ZO9 B;  4IJD A;  2USH A;  2LUQ A;  2EMF A;  4F6N A;  1YSA C;  2YTN A;  4BBY A;  2HY1 A;  4ZVZ A;  2WDD A;  4DV4 E;  4IYP C;  4X64 E;  4L8N A;  1A1F A;  2JVA A;  3IB7 A;  1JK2 A;  1WRJ A;  2LTR A;  4F2J C;  1JK7 A;  1USH A;  4TUI A;  2EN4 A;  2DLQ A;  1T4L B;  3IWC A;  3P1X A;  4LAC C;  5AE3 A;  2EOM A;  4BC9 A;  4BS9 A;  3ICF A;  2UXD E;  3V4Y A;  5LMN E;  1OID A;  1SFE A;  5KL7 A;  4UT2 A;  2YTF A;  4ZYH A;  4GKJ E;  1WJP A;  5KL6 A;  5C1V A;  2VF1 A;  1T4N A;  3H09 A;  1UIL A;  2K4V A;  1UF3 A;  2JYA A;  1BBO A;  3KZZ A;  5AE2 A;  2DFJ A;  2EN6 A;  4KBP A;  4H1S A;  2Z72 A;  2EPL X;  4DV6 E;  5EQV A;  1ZBQ A;  2FGG A;  3ADJ A;  2V83 A;  2EOS A;  3C6M A;  1IMU A;  4H2I A;  5AC4 A;  2IE4 C;  2LT7 A;  2MKD A;  2F8B A;  2YRK A;  1RC7 A;  3RL5 A;  2GPI A;  1IT6 A;  1GTK A;  1PJT A;  1FJM A;  1TCO A;  1HNX E;  3K7W C;  3E0J A;  2M7Q A;  4BHC A;  1N34 E;  4WWL A;  2BQ8 X;  3MHH C;  2IE3 C;  2XMO A;  2B7T A;  1XZW A;  3DJW A;  2JP9 A;  1A1G A;  2WDC A;  2R1F A;  4YKE A;  2LMZ A;  2NA2 A;  3IWB A;  1S8E A;  4JA9 A;  4Q7F A;  3H62 B;  2DB2 A;  4ZYD A;  1KBP A;  4LF8 E;  2EN1 A;  1UN6 B;  2IHR 1;  2EQ3 A;  4V0X A;  1ZBT A;  1NEI A;  1P47 A;  4GEQ B;  2EMA A;  3LL8 A;  2EOO A;  2EPP A;  1J26 A;  1OI8 A;  5FLX C;  2YTP A;  4NXN E;  3H61 A;  3AUZ A;  2L2M A;  2YTI A;  3EPK A;  4DUY E;  5DNY A;  5IV8 B;  2JOG A;  2YU8 A;  4R2Q A;  4O5G A;  4BCA A;  3RL3 A;  1WHN A;  4LFA E;  3DW8 C;  3P71 C;  3JAM C;  4FK5 C;  1T39 A;  1AUI A;  3FGA C;  2ENC A;  2LV2 A;  4OX9 E;  1F2I G;  2M1S A;  2V88 A;  2VQF E;  3VYY A;  2YSO A;  2EM5 A;  2BBG A;  3DSC A;  2H36 X;  1EH7 A;  2EMI A;  2KHX A;  4LTY A;  4MP0 A;  3QFK A;  2EM8 A;  4Q35 B;  4MOY A;  5IOH A;  3E7A A;  2HGH A;  2YU5 A;  2A25 A;  1ZR9 A;  2EOZ A;  1BBG A;  2NYM C;  4N4R B;  2EOR A;  4KWY A;  2G7H A;  1JK1 A;  4R2E A;  3TGH A;  3AV0 A;  1X47 A;  2WCC 3;  2EOJ A;  2EOQ A;  1OIE A;  1ZAA C;  2WZO A;  4ZYG A;  3PSO A;  2K7I A;  2BCD A;  2EPM X;  1WAR A;  4WSP A;  2O8G A;  4F0Z A;  4OR9 A;  3QFN A;  3H64 A;  4LFB E;  1YYK A;  3GVE A;  4B3S E;  3KBP A;  3C4T A;  2EOY A;  3EGG A;  3H69 A;  2EP3 A;  2UU9 E;  1O0W A;  4B2O A;  1DQ3 A;  2Z06 A;  1EH6 A;  3MSW A;  2NAB A;  2EM2 A;  5ADZ A;  4JI3 E;  2L3J A;  2GHF A;  1L4S A;  3FIG A;  2RSI A;  3JTZ A;  2EMW A;  2MDR A;  4IS1 C;  4DR7 E;  2EN8 A;  4DV7 E;  1A1H A;  2L2K B;  2YTO A;  4KZS A;  1YFH A;  2EML A;  4M30 A;  4M2Z A;  4NZV A;  2DXN A;  4G9J A;  1QU6 A;  2EOF A;  4WFT A;  2EMH A;  3HPZ A;  4DV0 E;  1G2D C;  2QFR A;  4MOV A;  1IQS A;  4ZX2 A;  1A1K A;  4DR1 E;  2DRP A;  2EMX A;  1UTE A;  1S95 A;  2EPN A;  2YPN A;  5IWA E;  2HYP A;  2EM4 A;  5KL3 A;  3FLO A;  2EM3 A;  4NXM E;  3BBG A;  4JI2 E;  4LF7 E;  1XMQ E;  2LJH A;  4B3M E;  2EOI A;  1BB8 A;  1GQE A;  2JOB A;  4FBQ A;  4RH8 A;  2EPA A;  4WX9 A;  3RQZ A;  2V87 A;  4P7D A;  3RMP A;  2N3H A;  2E1M A;  2YRH A;  1T4O A;  1AH5 A;  4B3R E;  5KL2 A;  4FBW A;  1DGC A;  3ADL A;  1YYO A;  1XMO E;  3OML A;  4GKK E;  1X3C A;  1XNQ E;  2I9I A;  5A6A A;  3MHS C;  2YRM A;  4DR3 E;  3PSN A;  4MLV A;  3EPH A;  1SR9 A;  4F9C B;  4DV2 E;  2EPU A;  2EOH A;  2D9H A;  1T70 A;  4H2F A;  2N3G A;  1PJS A;  4R03 A;  3QFM A;  4R2P A;  3LLH A;  1RMD A;  2IAE C;  2L8T A;  5AC5 A;  3QFO A;  2EM7 A;  2ODR C;  2ELY A;  1HR0 E;  2DLK A;  1HNW E;  2MDG A;  2LO3 A;  1S3N A;  2R17 A;  2YTD A;  2DSY A;  4RHB B;  3IVE A;  2LRS A;  1YUI A;  1KYQ A;  2EN2 A;  2V8Q B;  1IBK E;  2JPA A;  5JPF A;  5B8I A;  3J80 C;  2M4I A;  1UHZ A;  2ADR A;  2EN3 A;  4LF6 E;  2AHD A;  4KKZ A;  3BF2 A;  3IB8 A;  5A6B D;  2ODR D;  4JA7 A;  4KHP E;  2EM6 A;  4O4K A;  4X66 E;  2YTG A;  2RQL A;  1MGT A;  4R2C A;  4HEI A;  4DHL A;  2B9D A;  2WBT A;  1HNZ E;  5HPE A;  2B7V A;  3IWD A;  3QG5 C;  2B3T B;  2QJC A;  4JI8 E;  2EMK A;  4R2R A;  3ADI A;  2E72 A;  2LBS B;  3HQ1 A;  3CK2 A;  2E5L E;  2YVT A;  2UUC E;  4AQY E;  5J28 A;  3J7A G;  2GJU A;  1ZU1 A;  4V0W A;  3TQM A;  4V0V A;  5INB A;  2YZT A;  2NUF A;  1M63 A;  4JI1 E;  2HC5 A;  3DF6 A;  2F4V E;  4DMI A;  4ZYE A;  2CSH A;  4JI4 E;  2NYL C;  1T71 A;  4DKK A;  2YT4 A;  4DUZ E;  2UXC E;  3BID A;  2O8A A;  4DR2 E;  4F6M A;  2NPP C;  2ELZ A;  2CTD A;  2EMZ A;  2L92 A;  2CT1 A;  4LFC E;  1WHQ A;  1Z2X A;  2CV9 A;  5GTU A;  4MLQ A;  1PDA A;  2LJU A;  4R2A A;  4DV1 E;  4R8O A;  1N3G A;  2R76 A;  3VHT B;  2EMB A;  3C5W C;  4HD0 A;  4UT3 B;  2EMG A;  3ADG A;  3JU0 A;  2WDE A;  3H68 A;  3KZY A;  4H1Y P;  1LLM C;  1XNR E;  2EPZ A;  1UBD C;  1EKZ A;  2RPC A;  4R2S A;  2KOU A;  2V86 A;  2DMY A;  2KON A;  2EPX A;  3M99 B;  1QHW A;  3UK3 C;  2EL6 A;  1IQO A;  2J7J A;  4JI6 E;  2PRT A;  2JR1 A;  4L5N C;  1W24 A;  4JYA E;  4LF4 E;  1Z2W A;  5JPE A;  4BMJ A;  1N36 E;  1X6F A;  3D03 A;  3L00 A;  1G5B A;  4WYQ B;  1NCS A;  1KJK A;  3T1I A;  4J6O A;  4F9A B;  1S3L A;  3E7B A;  3H60 A;  3F6G A;  3VK6 A;  2ENA A;  2FV4 B;  1MEY C;  2LTS A;  1PKP A;  5T6J A;  1FKA E;  2YTE A;  4O43 A;  2JOX A;  2EOX A;  4F54 A;  4H2B A;  1FJG E;  5LL6 R;  4GZN C;  1SU1 A;  1X5W A;  5TSE A;  2EL5 A;  2EPR A;  4ORA A;  2LUP B;  2HJJ A;  4DR5 E;  4DV5 E;  2LE2 A;  4B3T E;  3EQ1 A;  4JI0 E;  5A6B A;  1WXR A;  5LLQ A;  2EPC A;  2YTQ A;  1A1J A;  4BC7 A;  4DV3 E;  3IVD A;  2HHH E;  4LF9 E;  4WXC A;  2EJ4 A;  4LU9 A;  5IXM B;  2L2N A;  2EMY A;  1EH8 A;  5A6J A;  2YTJ A;  4WXD A;  3C6K A;  2GLI A;  1T38 A;  2YEQ A;  4M0V A;  5LMU E;  4JI7 E;  3DSD A;  3EGH A;  3H67 A;  3C9F A;  1AAY A;  3OTO E;  1Z1B A;  4IL1 A;  4FCX A;  3ZOQ B;  2JY9 A;  4R2D A;  1A1L A;  2KKN A;  2ENH A;  2WBS A; 
#chains in the Genus database with same CATH homology
 1HP1 A;  2WDF A;  4J8Z A;  3THN A;  4YHH E;  2EZ6 A;  2NUE A;  2UUA E;  1N32 E;  1WAO 1;  1HPU A;  1X49 A;  2MC6 A;  4ORB A;  3T1Y E;  1YYW A;  4K0K E;  4Q28 A;  3T1H E;  1NNW A;  2VE7 C;  3C4B A;  2CPN A;  3KWR A;  1S3M A;  3H63 A;  4H2G A;  2P6B A;  3ZTV A;  2NUG A;  3ZU0 A;  5JJT A;  4OOG C;  1U32 A;  4O24 A;  1I94 E;  2UXB E;  1XM7 A;  2Z1A A;  2RS7 A;  3VYX A;  2BDX A;  3HPS A;  4DR4 E;  3N5U A;  1V73 A;  2HYO A;  2RSM A;  3K6Q A;  3H66 A;  2L33 A;  2UUB E;  2ZBM A;  4XPN A;  1QFC A;  2V89 A;  4P78 A;  4UT3 A;  4JI5 E;  4I5N C;  2RTX A;  4DT2 A;  4WPY A;  5AE1 A;  2QFP A;  1IBM E;  1GZ6 A;  2DIX A;  2Q8U A;  1MF8 A;  4LF5 E;  1YZ9 A;  2L3C A;  4X62 E;  2FTX B;  4JV5 E;  1X48 A;  4I5L C;  5F3W A;  4YY3 E;  5AAS A;  4TUG A;  3HXL A;  3J81 C;  2ZM6 E;  2NXF A;  1IBL E;  2DXL A;  4I8O A;  3LML A;  4DR6 E;  2L6M A;  4X65 E;  2EWL A;  4ORC A;  4X8W A;  2A22 A;  4FBK A;  4UWQ A;  1II7 A;  2RS6 A;  4DSY A;  1J5E E;  1N33 E;  3HTX A;  4F9B B;  5IT9 C;  3J7Y p;  1DI2 A;  1HO5 A;  3THO B;  3JYF A;  1STU A;  3RL4 A;  5CFF E;  2ZOA A;  2V85 A;  1S70 A;  2VQE E;  3F6H A;  3HVQ A;  2MC5 A;  3K7V C;  1RQ0 A;  2JWO A;  5A2Q C;  5BR8 E;  2ZO9 B;  2USH A;  2LUQ A;  4BBY A;  2HY1 A;  4ZVZ A;  2WDD A;  4DV4 E;  4IYP C;  4X64 E;  4L8N A;  2JVA A;  3IB7 A;  2LTR A;  1JK7 A;  1USH A;  4TUI A;  1T4L B;  3IWC A;  3P1X A;  4LAC C;  5AE3 A;  4BC9 A;  4BS9 A;  3ICF A;  2UXD E;  3V4Y A;  5LMN E;  1OID A;  4UT2 A;  4GKJ E;  5C1V A;  2VF1 A;  1T4N A;  3H09 A;  1UIL A;  2K4V A;  1UF3 A;  5AE2 A;  2DFJ A;  4KBP A;  4H1S A;  2Z72 A;  4DV6 E;  5EQV A;  1ZBQ A;  2FGG A;  3ADJ A;  2V83 A;  4H2I A;  2IE4 C;  2F8B A;  1RC7 A;  3RL5 A;  1IT6 A;  1FJM A;  1TCO A;  1HNX E;  3K7W C;  3E0J A;  2M7Q A;  1N34 E;  4WWL A;  2BQ8 X;  2IE3 C;  2XMO A;  2B7T A;  1XZW A;  3DJW A;  2WDC A;  4YKE A;  2LMZ A;  2NA2 A;  3IWB A;  1S8E A;  4JA9 A;  4Q7F A;  3H62 B;  2DB2 A;  1KBP A;  4LF8 E;  2IHR 1;  4V0X A;  1ZBT A;  4GEQ B;  3LL8 A;  1J26 A;  1OI8 A;  5FLX C;  4NXN E;  3H61 A;  3AUZ A;  2L2M A;  4DUY E;  5DNY A;  2JOG A;  4O5G A;  4BCA A;  3RL3 A;  1WHN A;  4LFA E;  3DW8 C;  3P71 C;  3JAM C;  1AUI A;  3FGA C;  4OX9 E;  2M1S A;  2V88 A;  2VQF E;  3VYY A;  3DSC A;  2H36 X;  2KHX A;  4LTY A;  4MP0 A;  3QFK A;  4MOY A;  5IOH A;  3E7A A;  2NYM C;  2G7H A;  3TGH A;  3AV0 A;  1X47 A;  1OIE A;  2WZO A;  3PSO A;  2BCD A;  1WAR A;  4WSP A;  2O8G A;  4F0Z A;  4OR9 A;  3QFN A;  3H64 A;  4LFB E;  1YYK A;  3GVE A;  4B3S E;  3KBP A;  3C4T A;  3EGG A;  3H69 A;  2UU9 E;  1O0W A;  4B2O A;  1DQ3 A;  2Z06 A;  3MSW A;  5ADZ A;  4JI3 E;  2L3J A;  3FIG A;  3JTZ A;  4DR7 E;  2MDR A;  4DV7 E;  2L2K B;  4KZS A;  4M30 A;  4M2Z A;  4NZV A;  2DXN A;  4G9J A;  1QU6 A;  4WFT A;  3HPZ A;  4DV0 E;  2QFR A;  4MOV A;  4ZX2 A;  4DR1 E;  1UTE A;  1S95 A;  2HYP A;  5IWA E;  3FLO A;  4NXM E;  4JI2 E;  4LF7 E;  1XMQ E;  2LJH A;  4B3M E;  1GQE A;  2JOB A;  4FBQ A;  3RQZ A;  2V87 A;  4P7D A;  3RMP A;  2N3H A;  2E1M A;  1T4O A;  4B3R E;  4FBW A;  3ADL A;  1YYO A;  1XMO E;  3OML A;  4GKK E;  1XNQ E;  4DR3 E;  3PSN A;  1SR9 A;  4F9C B;  4DV2 E;  1T70 A;  4H2F A;  2N3G A;  4R03 A;  3QFM A;  3LLH A;  2IAE C;  2L8T A;  3QFO A;  2ODR C;  1HR0 E;  1HNW E;  1S3N A;  2R17 A;  2DSY A;  3IVE A;  2LRS A;  2V8Q B;  1IBK E;  5JPF A;  5B8I A;  3J80 C;  2M4I A;  1UHZ A;  4LF6 E;  2AHD A;  4KKZ A;  3IB8 A;  2ODR D;  4JA7 A;  4KHP E;  4O4K A;  4X66 E;  4DHL A;  2B9D A;  1HNZ E;  5HPE A;  2B7V A;  3IWD A;  3QG5 C;  2B3T B;  2QJC A;  4JI8 E;  3ADI A;  2LBS B;  3HQ1 A;  3CK2 A;  2E5L E;  2YVT A;  2UUC E;  4AQY E;  5J28 A;  3J7A G;  2GJU A;  4V0W A;  5INB A;  4V0V A;  2YZT A;  2NUF A;  1M63 A;  4JI1 E;  3DF6 A;  2F4V E;  4DMI A;  4JI4 E;  2NYL C;  1T71 A;  4DKK A;  2YT4 A;  4DUZ E;  2UXC E;  2O8A A;  4DR2 E;  2NPP C;  2L92 A;  4LFC E;  1Z2X A;  1WHQ A;  2CV9 A;  5GTU A;  4DV1 E;  4R8O A;  3C5W C;  4HD0 A;  4UT3 B;  3ADG A;  2WDE A;  3JU0 A;  3H68 A;  4H1Y P;  1XNR E;  1EKZ A;  2KOU A;  2V86 A;  2DMY A;  2KON A;  1QHW A;  4JI6 E;  2JR1 A;  4L5N C;  1W24 A;  1Z2W A;  4LF4 E;  4JYA E;  5JPE A;  4BMJ A;  1N36 E;  3D03 A;  1G5B A;  4WYQ B;  3T1I A;  4J6O A;  4F9A B;  1S3L A;  3E7B A;  3H60 A;  3F6G A;  3VK6 A;  2FV4 B;  2LTS A;  1PKP A;  5T6J A;  1FKA E;  4O43 A;  2JOX A;  4F54 A;  4H2B A;  1FJG E;  5LL6 R;  1SU1 A;  4ORA A;  2LUP B;  4DR5 E;  4DV5 E;  2LE2 A;  4B3T E;  4JI0 E;  1WXR A;  4BC7 A;  4DV3 E;  3IVD A;  2HHH E;  4LF9 E;  4LU9 A;  2L2N A;  2YEQ A;  4M0V A;  5LMU E;  4JI7 E;  3DSD A;  3EGH A;  3H67 A;  3C9F A;  3OTO E;  4IL1 A;  4FCX A;  3ZOQ B;  2JY9 A;  2KKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...