3AUZA

Crystal structure of mre11 with manganese
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
316
Chain Sequence
b'RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
total genus 99
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3auzA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3auzA01
2NPPC 5JJTA 3CK2A 2CV9A 1UTEA 3PSOA 4UT2A 5DNYA 4FBWA 2JOGA 3GVEA 2Z1AA 3EGHA 3QG5C 2Z06A 3N5UA 1QHWA 2IE4C 3QFOA 4V0VA 1S3MA 4G9JA 4F0ZA 5HPEA 3K7VC 4O4KA 2KKNA 4XPNA 5EQVA 3DSCA 4LACC 1M63A 4FCXA 4H1YP 2DFJA 4DSYA 1WARA 3H60A 4JA9A 3IVEA 5C1VA 1OIDA 3P71C 3RL3A 3T1IA 4KBPA 3DSDA 3H62B 4ORCA 3H66A 3ICFA 4V0WA 2R17A 4I5NC 5J28A 1HPUA 3HVQA 1JK7A 1T70A 1OIEA 3ZTVA 1UF3A 2WDCA 3QFNA 4O5GA 4HD0A 2WDEA 1QFCA 4YKEA 1OI8A 1S95A 3QFMA 4MOYA 2BDXA 4UWQA 2QFPA 3QFKA 1HO5A 4M0VA 1Z2WA 4H2FA 5F3WA 2HYPA 4OR9A 4H2GA 4JA7A 1NNWA 4TUGA 4ORBA 4V0XA 3IB7A 4H1SA 3AV0A 4DT2A 4ORAA 1V73A 4TUIA 2USHA 3H67A 1T71A 5B8IA 4ZVZA 2O8AA 2Q8UA 4B2OA 3E7AA 2AHDA 3THNA 2BQ8X 1FJMA 3H63A 5JPEA 4FBQA 3KBPA 3IVDA 4DHLA 4WWLA 1S3LA 4MOVA 5INBA 4O43A 4MP0A 3H68A 2O8GA 3H61A 3AUZA 1II7A 2WDFA 1XZWA 1HP1A 3RL5A 3THOB 1S8EA 4IYPC 4H2IA 1U32A 2HY1A 1S3NA 2GJUA 1SU1A 3ZU0A 1TCOA 3E7BA 5JPFA 4KKZA 4FBKA 3DW8C 3RL4A 2QJCA 3V4YA 4NZVA 2IE3C 3JYFA 3EGGA 2A22A 3FGAC 2NYMC 1AUIA 3LL8A 5IOHA 4O24A 3PSNA 2QFRA 2ZBMA 4UT3B 2NYLC 2NXFA 4LU9A 2P6BA 3H64A 1KBPA 1IT6A 2Z72A 4H2BA 1G5BA 4LTYA 2XMOA 3IB8A 3RQZA 2IAEC 4J6OA 2HYOA 3C5WC 4I5LC 4IL1A 4UT3A 2YVTA 3TGHA 4Q7FA 1USHA 3K7WC 5GTUA 1S70A 1XM7A 1WAO1 2BCDA 1MF8A 3H69A 1Z2XA 3C9FA 4ZX2A 1W24A 2WDDA
chains in the Genus database with same CATH superfamily
2YTFA 5T6JA 4LF7E 2EMAA 2DSYA 2CV9A 3BGHA 2EMBA 3RMPA 4MLQA 4NXME 2Z1AA 2YTPA 2YU5A 1DI2A 4L8NA 2J7JA 2EM0A 2HC5A 1G2DC 1KYQA 4DR4E 4WPYA 1YSAC 2MKNA 4F0ZA 1BB8A 2EN7A 2EMXA 5HPEA 5IV8B 4XPNA 2V89A 3DSCA 2JR1A 1RMDA 3IVEA 3RL3A 2DLQA 4DV1E 4KBPA 4DV3E 1GTKA 2EM3A 2E72A 2LE2A 4R2EA 1A1JA 2ENAA 1YYOA 1X49A 1PJTA 4F9CB 3HVQA 2EN6A 1JK7A 4BMJA 1T70A 2DXNA 1OIEA 3LMLA 2GLIA 1UF3A 2L33A 3VYXA 3ZTVA 3QFNA 3EPKA 4HD0A 2RPCA 4DR2E 1A1IA 2EOEA 1OI8A 1S95A 3QFMA 1N33E 2L3JA 1EH6A 3QFKA 2B7TA 2DLKA 3C6KA 2JXPA 2LCEA 3MSWA 4OR9A 4JA7A 1QU6A 4TUGA 1WRJA 4V0XA 5KL4A 2EPMX 4R8OA 3F6GA 2LV2A 1PJQA 4TUIA 2I9IA 4F54A 2LVHA 1HNZE 4B3ME 5IWAE 4BS9A 2MDRA 2G7HA 1SFEA 3THNA 2YTDA 2EE8A 1X5WA 2BQ8X 1ZBQA 3HXLA 3KWRA 1A1HA 1A1LA 4K0KE 1RC7A 3IVDA 2YRHA 4FK5C 1S3LA 2DB2A 4MOVA 3J81C 4JI5E 5A6KA 4O43A 2RSIA 1YZ9A 2EOJA 2RSMA 3ECRA 1YUJA 2B3TB 2JP9A 2JYAA 2N8XA 3H61A 1TF3A 1II7A 1T4OA 4Q35B 1RQ0A 4YY3E 3T1YE 3THOB 1YYKA 1S8EA 4LF6E 2WBUA 1SU1A 3ZU0A 2B9DA 3TQMA 3DW8C 2CSHA 3K6QA 3OTOE 2EQ1A 1LLMC 3JYFA 3EGGA 5KL5A 3FGAC 1AUIA 5IOHA 2F4VE 3PSNA 2LTSA 2EOXA 2EMIA 1Z1BA 2KOUA 2NXFA 2YWQA 2Z72A 1IT6A 1X6HA 3VYYA 2DXLA 2YEQA 2EM2A 2IAEC 2N3GA 2UXCE 2EPRA 5KL2A 4IL1A 2YVTA 1UBDC 1USHA 3K7WC 3JAMC 5LMNE 1S70A 4X62E 2V85A 1YUIA 4BBYA 1WAO1 3HQ1A 4B3SE 5A6BD 1WHQA 1G2FC 4ZX2A 2EWLA 2VQFE 3UK3C 4WSGA 4DR5E 4MLVA 4IJDA 4P7DA 3EPJA 4X66E 4UT2A 2ENCA 2EN1A 2EOMA 1P47A 3EGHA 2ADRA 4JI3E 2Z06A 1QHWA 3ADJA 3EQ1A 2V83A 3QFOA 2K7IA 4G9JA 1KJKA 4F9AB 2MC6A 2YT4A 2A25A 3K7VC 2JOBA 5EQVA 2CT1A 4M9VC 4LACC 4H1YP 3DJWA 4RH8A 5C1VA 2EQ3A 3T1IA 4OX9E 4KHPE 1ZU1A 4JI0E 4X9JA 4ORCA 5CFFE 4DR7E 3H66A 2LT7A 2CPNA 2EPKX 5AE3A 2YPNA 2LMZA 2I13A 5A6BA 2WDCA 4LFAE 4JI1E 1A1GA 4ZYDA 2UXBE 1X48A 4BC7A 1WHNA 4JI8E 2HGHA 2R1FA 1BBGA 2KHXA 4KWYA 3HPSA 1HO5A 1Z2WA 2YSOA 2RTXA 4H2FA 5F3WA 2HYPA 2L92A 1X3CA 5AE1A 2ZM6E 1TF6A 4H1SA 2EOIA 2WBTA 4R2CA 1UN6B 5BR8E 1V73A 2USHA 1T71A 2EOSA 1BBOA 2Q8UA 4WSPA 4F6MA 4B2OA 2EN2A 2DMIA 2EPNA 1T38A 3H63A 2EOFA 5JPEA 3KBPA 2DGCA 4B3TE 1ZR9A 3FIGA 4R2SA 2FGGA 4AQYE 5INBA 2ELYA 5TSEA 5A69A 4OOGC 3C6MA 2NUFA 3IWDA 2WDFA 3KZYA 3OMLA 3RL5A 5A6AA 2L8TA 1IQOA 4JI6E 2B7VA 2EL4A 2EPLX 4WYQB 2UUAE 2GJUA 5KL3A 2JY9A 4NXNE 2QJCA 2HHHE 1F2IG 2YTJA 4NZVA 4WXDA 1YPNA 2EM5A 4R2AA 2VQEE 4GKKE 3ADIA 2NYMC 4O24A 4X64E 2QFRA 2ZBMA 2LUPB 2NYLC 4BHBA 2P6BA 5IXMB 1EKZA 1X6EA 1XMQE 2EMZA 2UU9E 4J6OA 2EZ6A 4HTGA 2HYOA 2FTXB 3C5WC 4DR3E 1HNXE 4UT3A 4ZYEA 3TGHA 2EPPA 2YTQA 2BCDA 2YZTA 1UHZA 1N32E 1Z2XA 4BCAA 2EM7A 1EH7A 4DUZE 2WDDA 2JWOA 4M30A 4WXCA 1ZBTA 2NPPC 5KL6A 4F6NA 1UTEA 3PSOA 1T39A 3QG5C 3N5UA 2ODRC 1IBME 2IE4C 2N3HA 4V0VA 3VHTB 1S3MA 2KONA 4LF4E 3IWBA 4O4KA 2V88A 5AASA 4F2JC 1M63A 4DR6E 2YTNA 4FCXA 2EQ0A 3P71C 1X47A 4BHCA 4J8ZA 3H62B 3ADGA 1XNRE 4X65E 4DMIA 2EN3A 2R17A 5AE2A 1T4LB 2UUBE 1HPUA 4JV5E 2BB8A 2CTDA 2EPXA 1IBKE 4YHHE 4O5GA 2NUGA 2EN4A 2WDEA 2E1MA 4YKEA 4MOYA 2EP3A 3BBGA 3M99B 1O0WA 2QFPA 5KL7A 4M0VA 1PJSA 1PDAA 4H2GA 1NNWA 4F9BB 4ORBA 2M9AA 4LFBE 3AV0A 4DT2A 1PKPA 4DV2E 3H67A 2PRTA 5B8IA 1HR0E 1NCSA 2DMYA 2JPAA 3E7AA 2MDGA 4KZSA 4DKKA 2AHDA 2MKDA 2YRMA 3D03A 2WBSA 4GEQB 1FJMA 3C4TA 2JOXA 2L3CA 1TN9A 4FBQA 4DHLA 1WXRA 5LLQA 3C4BA 2UXDE 2EPZA 1A1FA 1YYWA 2EM8A 4MP0A 1STUA 2YRKA 4M2ZA 2O8GA 2EOHA 3T1HE 2LJHA 1XZWA 2YTGA 3MHHC 1HP1A 1WJPA 4IYPC 2EJ4A 1EH8A 1U32A 1S3NA 2HY1A 3J80C 1TCOA 5JPFA 1N36E 2DIXA 1YFHA 2YU8A 2EPUA 4LFCE 2IE3C 2A22A 2GPIA 4DR1E 2JVAA 4R2DA 2ENHA 1KBPA 4JYAE 4H2BA 4LTYA 1MEYC 3F6HA 3IB8A 2EMGA 2VRDA 1B69A 4I5LC 4L5NC 2VE7C 5AC5A 2DRPA 2V8QB 4GKJE 3KZZA 5GTUA 1N34E 2D9HA 5AC4A 2EL6A 1MF8A 5LMUE 4WX9A 2EMYA 4BC9A 1A1KA 3P1XA 2RS6A 1UILA 3ZOQB 5JJTA 5ADZA 3CK2A 3J7Yp 2EMCA 3ADLA 3JTZA 5DNYA 4FBWA 5IT9C 2JOGA 3GVEA 2K4VA 1DGCA 4X8WA 4JI2E 2GHFA 5A2QC 4HEIA 3EPLA 1AAYA 2R76A 1T4NA 2EPOA 2MC5A 4LF9E 2ZO9B 3HPZA 2KKNA 4JI7E 2V87A 4P78A 4ZYHA 2L6MA 2DFJA 4WFTA 1WARA 3H60A 4JA9A 4DSYA 1OIDA 2L2MA 3DSDA 2M7QA 3JU0A 2BBGA 3ICFA 4V0WA 3EPHA 4I5NC 5J28A 3LLHA 1DQ3A 2EOYA 3BIDA 4ZYGA 2IHR1 1IQSA 2EN8A 2EPAA 2EM9A 2EOOA 1QFCA 1GZ6A 2EORA 2LRSA 1J26A 2FV4B 2BDXA 2HJJA 4UWQA 2YTEA 2L2KB 1IBLE 1L4SA 3E0JA 4LF5E 1MGTA 2EMLA 4DV6E 1HNWE 4I8OA 1XMOE 3IWCA 2NUEA 3IB7A 1X6FA 4ORAA 2NA2A 4JI4E 2LTRA 4Q28A 4R2QA 2WZOA 4ZVZA 2O8AA 2YTIA 2WCC3 2UUCE 4R03A 4DV0E 4LF8E 2NABA 2EMHA 2LO3A 2RS7A 2LJUA 4B3RE 4WWLA 3H09A 1XNQE 3HTXA 1NEIA 4DV5E 3H68A 3AUZA 1I94E 1IMUA 2H36X 1JK1A 2V86A 4GZNC 2M4IA 3FLOA 4H2IA 1FKAE 2RQLA 3E7BA 4KKZA 2EL5A 4R2PA 4FBKA 3VK6A 4DV4E 3RL4A 1AH5A 3V4YA 2YSPA 2EM6A 4R2RA 2LUQA 4N4RB 1ZAAC 3LL8A 2YTOA 4DUYE 1N3GA 4RHBB 4UT3B 3L00A 1QNTA 2ZOAA 4LU9A 1FJGE 5FLXC 3H64A 2EOQA 2ODRD 1JK2A 5LL6R 1G5BA 2EMKA 3BF2A 1GQEA 2XMOA 5A6JA 3RQZA 2EM4A 1J5EE 2EOZA 2F8BA 2EPCA 4DV7E 3DF6A 4Q7FA 2EMFA 3MHSC 2LBSB 3J7AG 2EMWA 4NHRA 2VF1A 1XM7A 1SR9A 2ELZA 2E5LE 3H69A 4IS1C 3C9FA 2L2NA 1W24A 2M1SA
chains in the Genus database with same CATH topology
5T6JA 4LF7E 2DSYA 2CV9A 3RMPA 4NXME 2Z1AA 1DI2A 4L8NA 4DR4E 4WPYA 4F0ZA 5HPEA 4XPNA 2V89A 3DSCA 2JR1A 3IVEA 3RL3A 4DV1E 4KBPA 4DV3E 2LE2A 1YYOA 1X49A 4F9CB 3HVQA 1JK7A 4BMJA 1T70A 2DXNA 1OIEA 3LMLA 3ZTVA 1UF3A 2L33A 3VYXA 3QFNA 4HD0A 4DR2E 1OI8A 1S95A 3QFMA 1N33E 2L3JA 3QFKA 2B7TA 3MSWA 4OR9A 4JA7A 1QU6A 4TUGA 4V0XA 4R8OA 3F6GA 4TUIA 4F54A 1HNZE 4B3ME 5IWAE 4BS9A 2MDRA 2G7HA 3THNA 2BQ8X 1ZBQA 3HXLA 3KWRA 4K0KE 1RC7A 3IVDA 1S3LA 2DB2A 4MOVA 3J81C 4JI5E 4O43A 1YZ9A 2RSMA 2B3TB 3H61A 1II7A 1T4OA 1RQ0A 4YY3E 3T1YE 3THOB 1YYKA 1S8EA 4LF6E 1SU1A 3ZU0A 2B9DA 3DW8C 3K6QA 3OTOE 3JYFA 3EGGA 3FGAC 1AUIA 5IOHA 2F4VE 3PSNA 2LTSA 2KOUA 2L2NA 2NXFA 2Z72A 1IT6A 3VYYA 2DXLA 2YEQA 2IAEC 2N3GA 2UXCE 4IL1A 2YVTA 1USHA 3K7WC 3JAMC 5LMNE 1S70A 4X62E 2V85A 1WAO1 3HQ1A 4B3SE 1WHQA 4ZX2A 2VQFE 2EWLA 4DR5E 4P7DA 4X66E 4UT2A 3EGHA 4JI3E 2Z06A 1QHWA 3ADJA 3QFOA 2V83A 4G9JA 4F9AB 2MC6A 2YT4A 3K7VC 2JOBA 5EQVA 4LACC 4H1YP 3DJWA 5C1VA 3T1IA 4OX9E 4KHPE 4JI0E 4ORCA 5CFFE 4DR7E 3H66A 2CPNA 5AE3A 2LMZA 2WDCA 4LFAE 4JI1E 2UXBE 1X48A 4BC7A 1WHNA 4JI8E 2KHXA 1HO5A 3HPSA 1Z2WA 4H2FA 2RTXA 5F3WA 2HYPA 2L92A 5AE1A 2ZM6E 4H1SA 1V73A 5BR8E 2USHA 1T71A 4WSPA 2Q8UA 4B2OA 3H63A 5JPEA 3KBPA 4B3TE 3FIGA 2FGGA 4AQYE 5INBA 4OOGC 2NUFA 3IWDA 2WDFA 3OMLA 3RL5A 2L8TA 4JI6E 2B7VA 4WYQB 2UUAE 2GJUA 2JY9A 4NXNE 2QJCA 2HHHE 4NZVA 4GKKE 2VQEE 3ADIA 2NYMC 4X64E 4O24A 2QFRA 2ZBMA 2LUPB 2NYLC 2P6BA 1EKZA 1XMQE 2UU9E 4J6OA 2EZ6A 2HYOA 2FTXB 3C5WC 4DR3E 1HNXE 4UT3A 3TGHA 2BCDA 2YZTA 1UHZA 1N32E 1Z2XA 4BCAA 4DUZE 2WDDA 4M30A 2JWOA 1ZBTA 2NPPC 1UTEA 3PSOA 3QG5C 3N5UA 2ODRC 1IBME 2IE4C 2N3HA 4V0VA 1S3MA 2KONA 4LF4E 3IWBA 4O4KA 2V88A 5AASA 1M63A 4DR6E 4FCXA 3P71C 1X47A 4J8ZA 3H62B 3ADGA 1XNRE 4X65E 4DMIA 2R17A 5AE2A 1T4LB 2UUBE 1HPUA 4JV5E 1IBKE 4YHHE 4O5GA 2NUGA 2WDEA 2E1MA 4YKEA 4MOYA 1O0WA 2QFPA 4M0VA 4H2GA 1NNWA 4F9BB 4ORBA 4LFBE 3AV0A 4DT2A 1PKPA 4DV2E 3H67A 5B8IA 1HR0E 2DMYA 3E7AA 4DKKA 4KZSA 2AHDA 3D03A 4GEQB 1FJMA 3C4TA 2JOXA 2L3CA 4FBQA 4DHLA 1WXRA 3C4BA 2UXDE 1YYWA 4MP0A 1STUA 4M2ZA 2O8GA 3T1HE 2LJHA 1XZWA 1HP1A 4IYPC 1U32A 1S3NA 2HY1A 3J80C 1TCOA 5JPFA 1N36E 2DIXA 4LFCE 2IE3C 2A22A 4DR1E 2JVAA 1KBPA 4JYAE 4H2BA 4LTYA 3F6HA 3IB8A 4I5LC 4L5NC 2VE7C 2V8QB 4GKJE 5GTUA 1N34E 1MF8A 5LMUE 4BC9A 3P1XA 2RS6A 1UILA 3ZOQB 5JJTA 5ADZA 3CK2A 3J7Yp 3ADLA 3JTZA 5DNYA 4FBWA 5IT9C 2JOGA 3GVEA 2K4VA 4X8WA 4JI2E 5A2QC 1T4NA 2MC5A 4LF9E 2ZO9B 3HPZA 2KKNA 4JI7E 2V87A 4P78A 4DSYA 2L6MA 2DFJA 4WFTA 1WARA 3H60A 4JA9A 1OIDA 2L2MA 3DSDA 2M7QA 3JU0A 3ICFA 4V0WA 4I5NC 5J28A 3LLHA 1DQ3A 2IHR1 1QFCA 1GZ6A 2LRSA 1J26A 2FV4B 2BDXA 4UWQA 2L2KB 1IBLE 3E0JA 4LF5E 4DV6E 1HNWE 4I8OA 1XMOE 3IWCA 2NUEA 3IB7A 4ORAA 2NA2A 4JI4E 2LTRA 4Q28A 2WZOA 4ZVZA 2O8AA 2UUCE 4R03A 4DV0E 4LF8E 2RS7A 4B3RE 4WWLA 3H09A 1XNQE 3HTXA 4DV5E 3H68A 3AUZA 1I94E 2H36X 2V86A 2M4IA 3FLOA 4H2IA 1FKAE 3E7BA 4KKZA 4FBKA 3VK6A 4DV4E 3RL4A 3V4YA 2LUQA 3LL8A 4DUYE 4UT3B 2ZOAA 4LU9A 1FJGE 5FLXC 3H64A 2ODRD 1G5BA 5LL6R 1GQEA 2XMOA 3RQZA 1J5EE 2F8BA 4DV7E 3DF6A 4Q7FA 3J7AG 2LBSB 2VF1A 1XM7A 1SR9A 2E5LE 3H69A 3C9FA 4BBYA 1W24A 2M1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPP C;  5JJT A;  3CK2 A;  2CV9 A;  1UTE A;  3PSO A;  4UT2 A;  5DNY A;  4FBW A;  2JOG A;  3GVE A;  2Z1A A;  3EGH A;  3QG5 C;  2Z06 A;  3N5U A;  1QHW A;  2IE4 C;  3QFO A;  4V0V A;  1S3M A;  4G9J A;  4F0Z A;  5HPE A;  3K7V C;  4O4K A;  2KKN A;  4XPN A;  5EQV A;  3DSC A;  4LAC C;  1M63 A;  4FCX A;  4H1Y P;  2DFJ A;  4DSY A;  1WAR A;  3H60 A;  4JA9 A;  3IVE A;  5C1V A;  1OID A;  3P71 C;  3RL3 A;  3T1I A;  4KBP A;  3DSD A;  3H62 B;  4ORC A;  3H66 A;  3ICF A;  4V0W A;  2R17 A;  4I5N C;  5J28 A;  1HPU A;  3HVQ A;  1JK7 A;  1T70 A;  1OIE A;  3ZTV A;  1UF3 A;  2WDC A;  3QFN A;  4O5G A;  4HD0 A;  2WDE A;  1QFC A;  4YKE A;  1OI8 A;  1S95 A;  3QFM A;  4MOY A;  2BDX A;  4UWQ A;  2QFP A;  3QFK A;  1HO5 A;  4M0V A;  1Z2W A;  4H2F A;  5F3W A;  2HYP A;  4OR9 A;  4H2G A;  4JA7 A;  1NNW A;  4TUG A;  4ORB A;  4V0X A;  3IB7 A;  4H1S A;  3AV0 A;  4DT2 A;  4ORA A;  1V73 A;  4TUI A;  2USH A;  3H67 A;  1T71 A;  5B8I A;  4ZVZ A;  2O8A A;  2Q8U A;  4B2O A;  3E7A A;  2AHD A;  3THN A;  2BQ8 X;  1FJM A;  3H63 A;  5JPE A;  4FBQ A;  3KBP A;  3IVD A;  4DHL A;  4WWL A;  1S3L A;  4MOV A;  5INB A;  4O43 A;  4MP0 A;  3H68 A;  2O8G A;  3H61 A;  3AUZ A;  1II7 A;  2WDF A;  1XZW A;  1HP1 A;  3RL5 A;  3THO B;  1S8E A;  4IYP C;  4H2I A;  1U32 A;  2HY1 A;  1S3N A;  2GJU A;  1SU1 A;  3ZU0 A;  1TCO A;  3E7B A;  5JPF A;  4KKZ A;  4FBK A;  3DW8 C;  3RL4 A;  2QJC A;  3V4Y A;  4NZV A;  2IE3 C;  3JYF A;  3EGG A;  2A22 A;  3FGA C;  2NYM C;  1AUI A;  3LL8 A;  5IOH A;  4O24 A;  3PSN A;  2QFR A;  2ZBM A;  4UT3 B;  2NYL C;  2NXF A;  4LU9 A;  2P6B A;  3H64 A;  1KBP A;  1IT6 A;  2Z72 A;  4H2B A;  1G5B A;  4LTY A;  2XMO A;  3IB8 A;  3RQZ A;  2IAE C;  4J6O A;  2HYO A;  3C5W C;  4I5L C;  4IL1 A;  4UT3 A;  2YVT A;  3TGH A;  4Q7F A;  1USH A;  3K7W C;  5GTU A;  1S70 A;  1XM7 A;  1WAO 1;  2BCD A;  1MF8 A;  3H69 A;  1Z2X A;  3C9F A;  4ZX2 A;  1W24 A;  2WDD A; 
#chains in the Genus database with same CATH topology
 2YTF A;  5T6J A;  4LF7 E;  2EMA A;  2DSY A;  2CV9 A;  3BGH A;  2EMB A;  3RMP A;  4MLQ A;  4NXM E;  2Z1A A;  2YTP A;  2YU5 A;  1DI2 A;  4L8N A;  2J7J A;  2EM0 A;  2HC5 A;  1G2D C;  1KYQ A;  4DR4 E;  4WPY A;  1YSA C;  2MKN A;  4F0Z A;  1BB8 A;  2EN7 A;  2EMX A;  5HPE A;  5IV8 B;  4XPN A;  2V89 A;  3DSC A;  2JR1 A;  1RMD A;  3IVE A;  3RL3 A;  2DLQ A;  4DV1 E;  4KBP A;  4DV3 E;  1GTK A;  2EM3 A;  2E72 A;  2LE2 A;  4R2E A;  1A1J A;  2ENA A;  1YYO A;  1X49 A;  1PJT A;  4F9C B;  3HVQ A;  2EN6 A;  1JK7 A;  4BMJ A;  1T70 A;  2DXN A;  1OIE A;  3LML A;  2GLI A;  1UF3 A;  2L33 A;  3VYX A;  3ZTV A;  3QFN A;  3EPK A;  4HD0 A;  2RPC A;  4DR2 E;  1A1I A;  2EOE A;  1OI8 A;  1S95 A;  3QFM A;  1N33 E;  2L3J A;  1EH6 A;  3QFK A;  2B7T A;  2DLK A;  3C6K A;  2JXP A;  2LCE A;  3MSW A;  4OR9 A;  4JA7 A;  1QU6 A;  4TUG A;  1WRJ A;  4V0X A;  5KL4 A;  2EPM X;  4R8O A;  3F6G A;  2LV2 A;  1PJQ A;  4TUI A;  2I9I A;  4F54 A;  2LVH A;  1HNZ E;  4B3M E;  5IWA E;  4BS9 A;  2MDR A;  2G7H A;  1SFE A;  3THN A;  2YTD A;  2EE8 A;  1X5W A;  2BQ8 X;  1ZBQ A;  3HXL A;  3KWR A;  1A1H A;  1A1L A;  4K0K E;  1RC7 A;  3IVD A;  2YRH A;  4FK5 C;  1S3L A;  2DB2 A;  4MOV A;  3J81 C;  4JI5 E;  5A6K A;  4O43 A;  2RSI A;  1YZ9 A;  2EOJ A;  2RSM A;  3ECR A;  1YUJ A;  2B3T B;  2JP9 A;  2JYA A;  2N8X A;  3H61 A;  1TF3 A;  1II7 A;  1T4O A;  4Q35 B;  1RQ0 A;  4YY3 E;  3T1Y E;  3THO B;  1YYK A;  1S8E A;  4LF6 E;  2WBU A;  1SU1 A;  3ZU0 A;  2B9D A;  3TQM A;  3DW8 C;  2CSH A;  3K6Q A;  3OTO E;  2EQ1 A;  1LLM C;  3JYF A;  3EGG A;  5KL5 A;  3FGA C;  1AUI A;  5IOH A;  2F4V E;  3PSN A;  2LTS A;  2EOX A;  2EMI A;  1Z1B A;  2KOU A;  2NXF A;  2YWQ A;  2Z72 A;  1IT6 A;  1X6H A;  3VYY A;  2DXL A;  2YEQ A;  2EM2 A;  2IAE C;  2N3G A;  2UXC E;  2EPR A;  5KL2 A;  4IL1 A;  2YVT A;  1UBD C;  1USH A;  3K7W C;  3JAM C;  5LMN E;  1S70 A;  4X62 E;  2V85 A;  1YUI A;  4BBY A;  1WAO 1;  3HQ1 A;  4B3S E;  5A6B D;  1WHQ A;  1G2F C;  4ZX2 A;  2EWL A;  2VQF E;  3UK3 C;  4WSG A;  4DR5 E;  4MLV A;  4IJD A;  4P7D A;  3EPJ A;  4X66 E;  4UT2 A;  2ENC A;  2EN1 A;  2EOM A;  1P47 A;  3EGH A;  2ADR A;  4JI3 E;  2Z06 A;  1QHW A;  3ADJ A;  3EQ1 A;  2V83 A;  3QFO A;  2K7I A;  4G9J A;  1KJK A;  4F9A B;  2MC6 A;  2YT4 A;  2A25 A;  3K7V C;  2JOB A;  5EQV A;  2CT1 A;  4M9V C;  4LAC C;  4H1Y P;  3DJW A;  4RH8 A;  5C1V A;  2EQ3 A;  3T1I A;  4OX9 E;  4KHP E;  1ZU1 A;  4JI0 E;  4X9J A;  4ORC A;  5CFF E;  4DR7 E;  3H66 A;  2LT7 A;  2CPN A;  2EPK X;  5AE3 A;  2YPN A;  2LMZ A;  2I13 A;  5A6B A;  2WDC A;  4LFA E;  4JI1 E;  1A1G A;  4ZYD A;  2UXB E;  1X48 A;  4BC7 A;  1WHN A;  4JI8 E;  2HGH A;  2R1F A;  1BBG A;  2KHX A;  4KWY A;  3HPS A;  1HO5 A;  1Z2W A;  2YSO A;  2RTX A;  4H2F A;  5F3W A;  2HYP A;  2L92 A;  1X3C A;  5AE1 A;  2ZM6 E;  1TF6 A;  4H1S A;  2EOI A;  2WBT A;  4R2C A;  1UN6 B;  5BR8 E;  1V73 A;  2USH A;  1T71 A;  2EOS A;  1BBO A;  2Q8U A;  4WSP A;  4F6M A;  4B2O A;  2EN2 A;  2DMI A;  2EPN A;  1T38 A;  3H63 A;  2EOF A;  5JPE A;  3KBP A;  2DGC A;  4B3T E;  1ZR9 A;  3FIG A;  4R2S A;  2FGG A;  4AQY E;  5INB A;  2ELY A;  5TSE A;  5A69 A;  4OOG C;  3C6M A;  2NUF A;  3IWD A;  2WDF A;  3KZY A;  3OML A;  3RL5 A;  5A6A A;  2L8T A;  1IQO A;  4JI6 E;  2B7V A;  2EL4 A;  2EPL X;  4WYQ B;  2UUA E;  2GJU A;  5KL3 A;  2JY9 A;  4NXN E;  2QJC A;  2HHH E;  1F2I G;  2YTJ A;  4NZV A;  4WXD A;  1YPN A;  2EM5 A;  4R2A A;  2VQE E;  4GKK E;  3ADI A;  2NYM C;  4O24 A;  4X64 E;  2QFR A;  2ZBM A;  2LUP B;  2NYL C;  4BHB A;  2P6B A;  5IXM B;  1EKZ A;  1X6E A;  1XMQ E;  2EMZ A;  2UU9 E;  4J6O A;  2EZ6 A;  4HTG A;  2HYO A;  2FTX B;  3C5W C;  4DR3 E;  1HNX E;  4UT3 A;  4ZYE A;  3TGH A;  2EPP A;  2YTQ A;  2BCD A;  2YZT A;  1UHZ A;  1N32 E;  1Z2X A;  4BCA A;  2EM7 A;  1EH7 A;  4DUZ E;  2WDD A;  2JWO A;  4M30 A;  4WXC A;  1ZBT A;  2NPP C;  5KL6 A;  4F6N A;  1UTE A;  3PSO A;  1T39 A;  3QG5 C;  3N5U A;  2ODR C;  1IBM E;  2IE4 C;  2N3H A;  4V0V A;  3VHT B;  1S3M A;  2KON A;  4LF4 E;  3IWB A;  4O4K A;  2V88 A;  5AAS A;  4F2J C;  1M63 A;  4DR6 E;  2YTN A;  4FCX A;  2EQ0 A;  3P71 C;  1X47 A;  4BHC A;  4J8Z A;  3H62 B;  3ADG A;  1XNR E;  4X65 E;  4DMI A;  2EN3 A;  2R17 A;  5AE2 A;  1T4L B;  2UUB E;  1HPU A;  4JV5 E;  2BB8 A;  2CTD A;  2EPX A;  1IBK E;  4YHH E;  4O5G A;  2NUG A;  2EN4 A;  2WDE A;  2E1M A;  4YKE A;  4MOY A;  2EP3 A;  3BBG A;  3M99 B;  1O0W A;  2QFP A;  5KL7 A;  4M0V A;  1PJS A;  1PDA A;  4H2G A;  1NNW A;  4F9B B;  4ORB A;  2M9A A;  4LFB E;  3AV0 A;  4DT2 A;  1PKP A;  4DV2 E;  3H67 A;  2PRT A;  5B8I A;  1HR0 E;  1NCS A;  2DMY A;  2JPA A;  3E7A A;  2MDG A;  4KZS A;  4DKK A;  2AHD A;  2MKD A;  2YRM A;  3D03 A;  2WBS A;  4GEQ B;  1FJM A;  3C4T A;  2JOX A;  2L3C A;  1TN9 A;  4FBQ A;  4DHL A;  1WXR A;  5LLQ A;  3C4B A;  2UXD E;  2EPZ A;  1A1F A;  1YYW A;  2EM8 A;  4MP0 A;  1STU A;  2YRK A;  4M2Z A;  2O8G A;  2EOH A;  3T1H E;  2LJH A;  1XZW A;  2YTG A;  3MHH C;  1HP1 A;  1WJP A;  4IYP C;  2EJ4 A;  1EH8 A;  1U32 A;  1S3N A;  2HY1 A;  3J80 C;  1TCO A;  5JPF A;  1N36 E;  2DIX A;  1YFH A;  2YU8 A;  2EPU A;  4LFC E;  2IE3 C;  2A22 A;  2GPI A;  4DR1 E;  2JVA A;  4R2D A;  2ENH A;  1KBP A;  4JYA E;  4H2B A;  4LTY A;  1MEY C;  3F6H A;  3IB8 A;  2EMG A;  2VRD A;  1B69 A;  4I5L C;  4L5N C;  2VE7 C;  5AC5 A;  2DRP A;  2V8Q B;  4GKJ E;  3KZZ A;  5GTU A;  1N34 E;  2D9H A;  5AC4 A;  2EL6 A;  1MF8 A;  5LMU E;  4WX9 A;  2EMY A;  4BC9 A;  1A1K A;  3P1X A;  2RS6 A;  1UIL A;  3ZOQ B;  5JJT A;  5ADZ A;  3CK2 A;  3J7Y p;  2EMC A;  3ADL A;  3JTZ A;  5DNY A;  4FBW A;  5IT9 C;  2JOG A;  3GVE A;  2K4V A;  1DGC A;  4X8W A;  4JI2 E;  2GHF A;  5A2Q C;  4HEI A;  3EPL A;  1AAY A;  2R76 A;  1T4N A;  2EPO A;  2MC5 A;  4LF9 E;  2ZO9 B;  3HPZ A;  2KKN A;  4JI7 E;  2V87 A;  4P78 A;  4ZYH A;  2L6M A;  2DFJ A;  4WFT A;  1WAR A;  3H60 A;  4JA9 A;  4DSY A;  1OID A;  2L2M A;  3DSD A;  2M7Q A;  3JU0 A;  2BBG A;  3ICF A;  4V0W A;  3EPH A;  4I5N C;  5J28 A;  3LLH A;  1DQ3 A;  2EOY A;  3BID A;  4ZYG A;  2IHR 1;  1IQS A;  2EN8 A;  2EPA A;  2EM9 A;  2EOO A;  1QFC A;  1GZ6 A;  2EOR A;  2LRS A;  1J26 A;  2FV4 B;  2BDX A;  2HJJ A;  4UWQ A;  2YTE A;  2L2K B;  1IBL E;  1L4S A;  3E0J A;  4LF5 E;  1MGT A;  2EML A;  4DV6 E;  1HNW E;  4I8O A;  1XMO E;  3IWC A;  2NUE A;  3IB7 A;  1X6F A;  4ORA A;  2NA2 A;  4JI4 E;  2LTR A;  4Q28 A;  4R2Q A;  2WZO A;  4ZVZ A;  2O8A A;  2YTI A;  2WCC 3;  2UUC E;  4R03 A;  4DV0 E;  4LF8 E;  2NAB A;  2EMH A;  2LO3 A;  2RS7 A;  2LJU A;  4B3R E;  4WWL A;  3H09 A;  1XNQ E;  3HTX A;  1NEI A;  4DV5 E;  3H68 A;  3AUZ A;  1I94 E;  1IMU A;  2H36 X;  1JK1 A;  2V86 A;  4GZN C;  2M4I A;  3FLO A;  4H2I A;  1FKA E;  2RQL A;  3E7B A;  4KKZ A;  2EL5 A;  4R2P A;  4FBK A;  3VK6 A;  4DV4 E;  3RL4 A;  1AH5 A;  3V4Y A;  2YSP A;  2EM6 A;  4R2R A;  2LUQ A;  4N4R B;  1ZAA C;  3LL8 A;  2YTO A;  4DUY E;  1N3G A;  4RHB B;  4UT3 B;  3L00 A;  1QNT A;  2ZOA A;  4LU9 A;  1FJG E;  5FLX C;  3H64 A;  2EOQ A;  2ODR D;  1JK2 A;  5LL6 R;  1G5B A;  2EMK A;  3BF2 A;  1GQE A;  2XMO A;  5A6J A;  3RQZ A;  2EM4 A;  1J5E E;  2EOZ A;  2F8B A;  2EPC A;  4DV7 E;  3DF6 A;  4Q7F A;  2EMF A;  3MHS C;  2LBS B;  3J7A G;  2EMW A;  4NHR A;  2VF1 A;  1XM7 A;  1SR9 A;  2ELZ A;  2E5L E;  3H69 A;  4IS1 C;  3C9F A;  2L2N A;  1W24 A;  2M1S A; 
#chains in the Genus database with same CATH homology
 5T6J A;  4LF7 E;  2DSY A;  2CV9 A;  3RMP A;  4NXM E;  2Z1A A;  1DI2 A;  4L8N A;  4DR4 E;  4WPY A;  4F0Z A;  5HPE A;  4XPN A;  2V89 A;  3DSC A;  2JR1 A;  3IVE A;  3RL3 A;  4DV1 E;  4KBP A;  4DV3 E;  2LE2 A;  1YYO A;  1X49 A;  4F9C B;  3HVQ A;  1JK7 A;  4BMJ A;  1T70 A;  2DXN A;  1OIE A;  3LML A;  3ZTV A;  1UF3 A;  2L33 A;  3VYX A;  3QFN A;  4HD0 A;  4DR2 E;  1OI8 A;  1S95 A;  3QFM A;  1N33 E;  2L3J A;  3QFK A;  2B7T A;  3MSW A;  4OR9 A;  4JA7 A;  1QU6 A;  4TUG A;  4V0X A;  4R8O A;  3F6G A;  4TUI A;  4F54 A;  1HNZ E;  4B3M E;  5IWA E;  4BS9 A;  2MDR A;  2G7H A;  3THN A;  2BQ8 X;  1ZBQ A;  3HXL A;  3KWR A;  4K0K E;  1RC7 A;  3IVD A;  1S3L A;  2DB2 A;  4MOV A;  3J81 C;  4JI5 E;  4O43 A;  1YZ9 A;  2RSM A;  2B3T B;  3H61 A;  1II7 A;  1T4O A;  1RQ0 A;  4YY3 E;  3T1Y E;  3THO B;  1YYK A;  1S8E A;  4LF6 E;  1SU1 A;  3ZU0 A;  2B9D A;  3DW8 C;  3K6Q A;  3OTO E;  3JYF A;  3EGG A;  3FGA C;  1AUI A;  5IOH A;  2F4V E;  3PSN A;  2LTS A;  2KOU A;  2L2N A;  2NXF A;  2Z72 A;  1IT6 A;  3VYY A;  2DXL A;  2YEQ A;  2IAE C;  2N3G A;  2UXC E;  4IL1 A;  2YVT A;  1USH A;  3K7W C;  3JAM C;  5LMN E;  1S70 A;  4X62 E;  2V85 A;  1WAO 1;  3HQ1 A;  4B3S E;  1WHQ A;  4ZX2 A;  2VQF E;  2EWL A;  4DR5 E;  4P7D A;  4X66 E;  4UT2 A;  3EGH A;  4JI3 E;  2Z06 A;  1QHW A;  3ADJ A;  3QFO A;  2V83 A;  4G9J A;  4F9A B;  2MC6 A;  2YT4 A;  3K7V C;  2JOB A;  5EQV A;  4LAC C;  4H1Y P;  3DJW A;  5C1V A;  3T1I A;  4OX9 E;  4KHP E;  4JI0 E;  4ORC A;  5CFF E;  4DR7 E;  3H66 A;  2CPN A;  5AE3 A;  2LMZ A;  2WDC A;  4LFA E;  4JI1 E;  2UXB E;  1X48 A;  4BC7 A;  1WHN A;  4JI8 E;  2KHX A;  1HO5 A;  3HPS A;  1Z2W A;  4H2F A;  2RTX A;  5F3W A;  2HYP A;  2L92 A;  5AE1 A;  2ZM6 E;  4H1S A;  1V73 A;  5BR8 E;  2USH A;  1T71 A;  4WSP A;  2Q8U A;  4B2O A;  3H63 A;  5JPE A;  3KBP A;  4B3T E;  3FIG A;  2FGG A;  4AQY E;  5INB A;  4OOG C;  2NUF A;  3IWD A;  2WDF A;  3OML A;  3RL5 A;  2L8T A;  4JI6 E;  2B7V A;  4WYQ B;  2UUA E;  2GJU A;  2JY9 A;  4NXN E;  2QJC A;  2HHH E;  4NZV A;  4GKK E;  2VQE E;  3ADI A;  2NYM C;  4X64 E;  4O24 A;  2QFR A;  2ZBM A;  2LUP B;  2NYL C;  2P6B A;  1EKZ A;  1XMQ E;  2UU9 E;  4J6O A;  2EZ6 A;  2HYO A;  2FTX B;  3C5W C;  4DR3 E;  1HNX E;  4UT3 A;  3TGH A;  2BCD A;  2YZT A;  1UHZ A;  1N32 E;  1Z2X A;  4BCA A;  4DUZ E;  2WDD A;  4M30 A;  2JWO A;  1ZBT A;  2NPP C;  1UTE A;  3PSO A;  3QG5 C;  3N5U A;  2ODR C;  1IBM E;  2IE4 C;  2N3H A;  4V0V A;  1S3M A;  2KON A;  4LF4 E;  3IWB A;  4O4K A;  2V88 A;  5AAS A;  1M63 A;  4DR6 E;  4FCX A;  3P71 C;  1X47 A;  4J8Z A;  3H62 B;  3ADG A;  1XNR E;  4X65 E;  4DMI A;  2R17 A;  5AE2 A;  1T4L B;  2UUB E;  1HPU A;  4JV5 E;  1IBK E;  4YHH E;  4O5G A;  2NUG A;  2WDE A;  2E1M A;  4YKE A;  4MOY A;  1O0W A;  2QFP A;  4M0V A;  4H2G A;  1NNW A;  4F9B B;  4ORB A;  4LFB E;  3AV0 A;  4DT2 A;  1PKP A;  4DV2 E;  3H67 A;  5B8I A;  1HR0 E;  2DMY A;  3E7A A;  4DKK A;  4KZS A;  2AHD A;  3D03 A;  4GEQ B;  1FJM A;  3C4T A;  2JOX A;  2L3C A;  4FBQ A;  4DHL A;  1WXR A;  3C4B A;  2UXD E;  1YYW A;  4MP0 A;  1STU A;  4M2Z A;  2O8G A;  3T1H E;  2LJH A;  1XZW A;  1HP1 A;  4IYP C;  1U32 A;  1S3N A;  2HY1 A;  3J80 C;  1TCO A;  5JPF A;  1N36 E;  2DIX A;  4LFC E;  2IE3 C;  2A22 A;  4DR1 E;  2JVA A;  1KBP A;  4JYA E;  4H2B A;  4LTY A;  3F6H A;  3IB8 A;  4I5L C;  4L5N C;  2VE7 C;  2V8Q B;  4GKJ E;  5GTU A;  1N34 E;  1MF8 A;  5LMU E;  4BC9 A;  3P1X A;  2RS6 A;  1UIL A;  3ZOQ B;  5JJT A;  5ADZ A;  3CK2 A;  3J7Y p;  3ADL A;  3JTZ A;  5DNY A;  4FBW A;  5IT9 C;  2JOG A;  3GVE A;  2K4V A;  4X8W A;  4JI2 E;  5A2Q C;  1T4N A;  2MC5 A;  4LF9 E;  2ZO9 B;  3HPZ A;  2KKN A;  4JI7 E;  2V87 A;  4P78 A;  4DSY A;  2L6M A;  2DFJ A;  4WFT A;  1WAR A;  3H60 A;  4JA9 A;  1OID A;  2L2M A;  3DSD A;  2M7Q A;  3JU0 A;  3ICF A;  4V0W A;  4I5N C;  5J28 A;  3LLH A;  1DQ3 A;  2IHR 1;  1QFC A;  1GZ6 A;  2LRS A;  1J26 A;  2FV4 B;  2BDX A;  4UWQ A;  2L2K B;  1IBL E;  3E0J A;  4LF5 E;  4DV6 E;  1HNW E;  4I8O A;  1XMO E;  3IWC A;  2NUE A;  3IB7 A;  4ORA A;  2NA2 A;  4JI4 E;  2LTR A;  4Q28 A;  2WZO A;  4ZVZ A;  2O8A A;  2UUC E;  4R03 A;  4DV0 E;  4LF8 E;  2RS7 A;  4B3R E;  4WWL A;  3H09 A;  1XNQ E;  3HTX A;  4DV5 E;  3H68 A;  3AUZ A;  1I94 E;  2H36 X;  2V86 A;  2M4I A;  3FLO A;  4H2I A;  1FKA E;  3E7B A;  4KKZ A;  4FBK A;  3VK6 A;  4DV4 E;  3RL4 A;  3V4Y A;  2LUQ A;  3LL8 A;  4DUY E;  4UT3 B;  2ZOA A;  4LU9 A;  1FJG E;  5FLX C;  3H64 A;  2ODR D;  1G5B A;  5LL6 R;  1GQE A;  2XMO A;  3RQZ A;  1J5E E;  2F8B A;  4DV7 E;  3DF6 A;  4Q7F A;  3J7A G;  2LBS B;  2VF1 A;  1XM7 A;  1SR9 A;  2E5L E;  3H69 A;  3C9F A;  4BBY A;  1W24 A;  2M1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...