3AUZA

Crystal structure of mre11 with manganese
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
316
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
molecule keywords DNA double-strand break repair protein mre11
total genus 99
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3auzA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3auzA01
3DW8C 3H64A 4UWQA 1II7A 2GJUA 2QJCA 3H62B 3RL4A 4UT2A 3ZTVA 3IVDA 3H63A 1TCOA 3CK2A 1HPUA 4FBKA 4I5LC 2NYLC 3EGGA 1QFCA 3IVEA 4Q7FA 3RL5A 3HVQA 5HPEA 1UF3A 1OIDA 4H1SA 4MP0A 4G9JA 1S3NA 3QFMA 4O4KA 1T71A 4LTYA 4B2OA 2KKNA 2WDDA 4DHLA 3EGHA 4FBWA 1SU1A 1S3MA 1XM7A 4UT3B 3H67A 2Z06A 4O43A 4MOVA 2CV9A 2ZBMA 2WDEA 3AUZA 3H69A 2NXFA 3H66A 4NZVA 1OIEA 3AV0A 3THNA 4JA9A 5INBA 2JOGA 4DT2A 2QFPA 2IE3C 3JYFA 4YKEA 2A22A 1XZWA 1G5BA 1WARA 2BCDA 3GVEA 3THOB 4ZX2A 1S3LA 3K7WC 5JPEA 4H2GA 4V0XA 3LL8A 3QFNA 4ORBA 1HP1A 4KKZA 5DNYA 1Z2WA 2Q8UA 1S8EA 3P71C 4V0WA 1HO5A 2DFJA 3H68A 4V0VA 4H2FA 3DSCA 2O8GA 2BDXA 3FGAC 4KBPA 4TUIA 4J6OA 3PSOA 5J28A 1KBPA 4JA7A 4ORCA 3H61A 4LU9A 1WAO1 4IYPC 2HYOA 3ZU0A 3H60A 1MF8A 5EQVA 4H1YP 4ZVZA 3RQZA 3TGHA 3QG5C 3IB8A 5GTUA 4XPNA 3QFKA 4O5GA 2BQ8X 1NNWA 2Z1AA 2P6BA 3T1IA 3C5WC 1T70A 2HY1A 4FBQA 4O24A 2WDFA 2YVTA 1Z2XA 2USHA 3V4YA 1IT6A 5IOHA 4TUGA 2IE4C 3N5UA 2QFRA 3K7VC 4IL1A 4F0ZA 1QHWA 1U32A 1S95A 2NPPC 2WDCA 3PSNA 4OR9A 2IAEC 5F3WA 3QFOA 4HD0A 2O8AA 1USHA 3IB7A 4H2BA 4LACC 3RL3A 4FCXA 3ICFA 4WWLA 1FJMA 1W24A 2R17A 1OI8A 2XMOA 3C9FA 1JK7A 2HYPA 5JJTA 1V73A 3E7AA 2Z72A 1AUIA 2AHDA 4H2IA 5C1VA 1UTEA 2NYMC 4I5NC 4M0VA 4MOYA 5B8IA 3E7BA 1M63A 4ORAA 3DSDA 3KBPA 4UT3A 4DSYA 1S70A 5JPFA
chains in the Genus database with same CATH superfamily
3DW8C 2BB8A 1TN9A 5FLXC 1I94E 2JOBA 2EZ6A 3H62B 4RH8A 2V8QB 3OTOE 3IWCA 1JK2A 2E72A 4J8ZA 4WSGA 1EH8A 4I5LC 2YSPA 3EGGA 5KL5A 2MKNA 5IT9C 3IVEA 2LUPB 2F4VE 3HVQA 2EE8A 4I8OA 1OIDA 4DV5E 2EMYA 4ZYDA 2EMAA 5KL4A 2LVHA 4O4KA 2EM2A 2L2NA 2WDDA 2EPAA 1YYWA 1S3MA 2HJJA 3BBGA 1IMUA 3H67A 1X6HA 2EOJA 5A69A 2HGHA 2JPAA 4B3TE 1T39A 4BHBA 1BB8A 4MOVA 1ZU1A 1J5EE 2ZBMA 2EN4A 2M9AA 2L3CA 2NXFA 4NZVA 3BF2A 1J26A 1WRJA 1SFEA 4DV2E 1X6EA 2ENHA 4GEQB 4P78A 2UUBE 2A22A 1WARA 1YUIA 3THOB 1S3LA 5JPEA 1WHQA 1FKAE 4X9JA 1Z1BA 4H2GA 1ZR9A 4GZNC 3LMLA 2RS6A 4BBYA 2DIXA 1XMOE 4LF8E 1Z2WA 4V0WA 2EMIA 2EPNA 2DFJA 1A1GA 3ADJA 2EPCA 1UILA 2YSOA 4JA7A 4DR1E 4LU9A 4IYPC 1TF3A 2WBTA 1MF8A 2DMIA 2LUQA 4H1YP 2N8XA 2GHFA 2YTIA 4XPNA 4WYQB 3QFKA 2YPNA 2ODRC 4O5GA 2BQ8X 1NNWA 5IXMB 4B3RE 1GQEA 4O24A 1T70A 2RSMA 3ADLA 4DMIA 3JU0A 1T4LB 4WXDA 3IWDA 4F9AB 3HTXA 1Z2XA 5IOHA 1T4NA 1BBOA 1YUJA 2IE4C 3N5UA 3TQMA 2LV2A 2NUGA 4R2PA 4IL1A 1S95A 2NPPC 3L00A 3FLOA 2WZOA 1PJTA 1LLMC 4R2SA 1HNZE 2E5LE 2L92A 3QFOA 2RS7A 1P47A 2O8AA 2L6MA 4JI1E 4X64E 1A1JA 2G7HA 4R2RA 4FCXA 4KHPE 4N4RB 4WWLA 2GLIA 1UHZA 3C9FA 2EM5A 1JK7A 2R1FA 2FGGA 3F6GA 4WXCA 2Z72A 2JXPA 1AUIA 1EH7A 5C1VA 1FJGE 1UTEA 3E7BA 2RTXA 3IWBA 1PJQA 1M63A 2EM3A 4DUZE 2MC6A 2R76A 1A1KA 2EPMX 1X3CA 2ZO9B 3EQ1A 2LCEA 2ZM6E 1STUA 4DV0E 1N32E 2EM7A 5IWAE 2GJUA 2QJCA 3EPKA 4JV5E 3RL4A 3MSWA 2EMWA 4UT2A 4ZYEA 3IVDA 3CK2A 1HPUA 1G2DC 1BBGA 2NUFA 4FBKA 1X49A 1QFCA 4M9VC 4JI7E 2ELYA 2NUEA 4Q7FA 2EWLA 3E0JA 5HPEA 4MP0A 3C4BA 2B3TB 4DR6E 1RQ0A 3ECRA 2DRPA 2IHR1 2LTSA 3T1HE 2ADRA 4LTYA 3LLHA 2LBSB 4DR2E 4R2DA 4UT3B 1XM7A 2EMXA 2LO3A 2YWQA 5AE3A 4LFCE 2HHHE 4JI5E 2EMKA 5T6JA 2YT4A 4O43A 2LJUA 2WDEA 3AUZA 2EM8A 2M4IA 3H69A 3H66A 2H36X 4R8OA 2CTDA 2MC5A 2RPCA 2YU8A 3THNA 1XMQE 4LF9E 5INBA 2IE3C 2V87A 2LT7A 3H09A 4X65E 3JYFA 1PJSA 3VYXA 1G5BA 1YYOA 3GVEA 4ZX2A 1N33E 2M7QA 2L3JA 5AC5A 4X8WA 1YSAC 1WXRA 1QNTA 2N3HA 4ORBA 3JAMC 2E1MA 2JWOA 1ZAAC 1YFHA 4V0VA 2EM0A 5AE1A 2EMHA 4TUIA 1YZ9A 3PSOA 1X48A 3EPHA 4WX9A 4ORCA 1IBME 3HPSA 2YTEA 1WAO1 4DV1E 2HYOA 3ZU0A 2EOYA 2WCC3 4GKKE 2KHXA 2EL6A 3RQZA 3TGHA 2B7TA 3QG5C 2VQFE 4WPYA 1PDAA 4BMJA 4JI2E 3J7Yp 4Q28A 4WSPA 2Z1AA 2EJ4A 2P6BA 2V89A 3C5WC 2HC5A 2WDFA 2YVTA 2YU5A 3J7AG 2N3GA 4FK5C 3BIDA 2FV4B 2EPZA 2YRHA 1NEIA 3HPZA 5KL6A 4LFAE 1QHWA 2EN2A 1IQOA 3M99B 3PSNA 1T4OA 2IAEC 1A1LA 2MDGA 1N34E 5LMNE 5F3WA 1RMDA 4WFTA 4R03A 4H2BA 5AASA 3K6QA 2EN3A 2EPPA 4JI8E 2EOOA 1FJMA 2R17A 2EMZA 4M30A 3HQ1A 1UN6B 5JJTA 5A6AA 2JY9A 5LL6R 1JK1A 2EQ3A 2EMFA 1AAYA 1IQSA 2AHDA 4H2IA 2YTNA 4I5NC 3KWRA 2EOHA 4MOYA 1EKZA 2I9IA 1DGCA 4F9CB 1XNRE 4ORAA 3KBPA 3DSDA 4UT3A 2EOXA 2YTOA 2EORA 1GTKA 3HXLA 4OOGC 2K4VA 1II7A 2DB2A 1L4SA 2V83A 3ZOQB 4DUYE 2EOIA 5A6KA 2YZTA 2EPLX 2NYLC 3RL5A 4LFBE 4BS9A 1UF3A 4MLQA 5A6BD 1QU6A 2MKDA 1S3NA 4P7DA 4F6MA 4YHHE 3DF6A 1T71A 4B2OA 5LMUE 2B7VA 2KKNA 2M1SA 4X66E 2EP3A 1SU1A 4FBWA 4DHLA 2EN7A 1TF6A 4YY3E 2Z06A 2UXBE 2V85A 2CV9A 1UBDC 2YTFA 5ADZA 3AV0A 3T1YE 2QFPA 4OX9E 4YKEA 3C6KA 1DI2A 1XZWA 2BCDA 3K7WC 4BCAA 2ELZA 2L33A 4B3SE 2EM6A 4LF4E 3LL8A 1YPNA 1X6FA 1HP1A 2EQ1A 4KKZA 5DNYA 2YTPA 1S8EA 3P71C 1WJPA 4K0KE 4GKJE 3H68A 1X5WA 1HR0E 4H2FA 3MHHC 3DSCA 2EQ0A 2EPUA 3FGAC 3VK6A 1A1HA 4J6OA 5J28A 1N3GA 4ZYHA 4Q35B 2NA2A 3P1XA 2JYAA 3H61A 3EPLA 2YTQA 2L2MA 1HNWE 3D03A 4NHRA 4DR4E 4DV3E 2DGCA 2PRTA 5EQVA 4X62E 2LMZA 5A6BA 3EPJA 3IB8A 5GTUA 1GZ6A 3J81C 4HTGA 3FIGA 5KL2A 3DJWA 2UXCE 2EPRA 2KONA 2ODRD 2FTXB 4FBQA 1MEYC 2L8TA 3V4YA 2USHA 4R2AA 1IT6A 3J80C 2QFRA 3K7VC 1IBKE 2GPIA 2EOEA 1U32A 2JOXA 5TSEA 1KJKA 4IJDA 2DSYA 2L2KB 1IBLE 2RQLA 1USHA 4LACC 4NXME 3RL3A 2EPXA 4R2EA 2KOUA 1MGTA 2EL5A 1OI8A 2XMOA 3JTZA 2EL4A 5CFFE 3E7AA 2NYMC 5B8IA 2WBSA 4MLVA 1A1IA 4DV7E 5JPFA 2DXNA 3KZZA 2LRSA 2EOSA 2EMBA 2V88A 3H64A 4UWQA 2EOQA 1AH5A 5AE2A 5LLQA 2V86A 3ZTVA 2EOFA 3VHTB 4F54A 4LF6E 2EOMA 2JR1A 1TCOA 3H63A 3ADGA 1ZBTA 2F8BA 1DQ3A 4DR5E 2LE2A 2YTDA 2YEQA 2UUCE 4H1SA 2LTRA 2EMCA 2NABA 4G9JA 4BHCA 3QFMA 4NXNE 4F2JC 2EN8A 3F6HA 2EMGA 1X47A 5IV8B 4KZSA 1YYKA 3EGHA 4JI3E 3OMLA 4HEIA 1XNQE 2VQEE 2UXDE 4DR3E 2UUAE 2ZOAA 2EPOA 2YRMA 4DR7E 2CPNA 4DV6E 1OIEA 2EOZA 4JA9A 2J7JA 4JYAE 2JOGA 4DT2A 4DKKA 2DMYA 2VRDA 1A1FA 2A25A 2EM4A 2VE7C 2EM9A 2MDRA 2ENAA 4BC9A 4V0XA 4JI0E 4LF7E 4RHBB 2EPKX 2K7IA 4KWYA 3QFNA 1PKPA 2Q8UA 2ENCA 1HO5A 3UK3C 1T38A 2DLKA 2JP9A 2CSHA 1O0WA 2O8GA 2DLQA 1NCSA 2BDXA 4KBPA 2CT1A 1EH6A 2VF1A 1KBPA 4M2ZA 4F9BB 4B3ME 4LF5E 4BC7A 2DXLA 1SR9A 2YTJA 5BR8E 2RSIA 3H60A 5KL7A 4R2CA 4AQYE 1RC7A 4ZVZA 2UU9E 5A2QC 1HNXE 4IS1C 5A6JA 3KZYA 2B9DA 1KYQA 3T1IA 2HY1A 3C6MA 2I13A 2EN1A 4ZYGA 4TUGA 4L8NA 4L5NC 3ADIA 3C4TA 4F0ZA 2YRKA 3VYYA 2EMLA 5AC4A 4JI6E 2WDCA 4OR9A 3MHSC 3BGHA 2YTGA 4HD0A 3IB7A 1B69A 2D9HA 2JVAA 1N36E 3ICFA 2WBUA 1W24A 1WHNA 2EN6A 1G2FC 2HYPA 1V73A 1F2IG 2LJHA 4JI4E 4R2QA 2BBGA 4M0VA 4DV4E 3RMPA 1ZBQA 4F6NA 4DSYA 5KL3A 1S70A
chains in the Genus database with same CATH topology
3DW8C 5FLXC 1I94E 2JOBA 2EZ6A 3H62B 2V8QB 3OTOE 3IWCA 4J8ZA 4I5LC 3EGGA 3IVEA 5IT9C 2LUPB 2F4VE 3HVQA 4I8OA 1OIDA 4DV5E 4O4KA 2L2NA 2WDDA 1YYWA 1S3MA 3H67A 4B3TE 4MOVA 1J5EE 2ZBMA 2L3CA 2NXFA 4NZVA 1J26A 4DV2E 4GEQB 4P78A 2UUBE 2A22A 1WARA 3THOB 1S3LA 5JPEA 1WHQA 1FKAE 4H2GA 3LMLA 2RS6A 4BBYA 2DIXA 1XMOE 4LF8E 1Z2WA 4V0WA 2DFJA 3ADJA 1UILA 4JA7A 4DR1E 4LU9A 4IYPC 1MF8A 2LUQA 4H1YP 4XPNA 4WYQB 3QFKA 2ODRC 4O5GA 2BQ8X 1NNWA 4B3RE 1GQEA 1T70A 4O24A 2RSMA 3ADLA 4DMIA 3JU0A 1Z2XA 1T4LB 3HTXA 3IWDA 4F9AB 5IOHA 1T4NA 2IE4C 3N5UA 2NUGA 4IL1A 1S95A 2NPPC 3FLOA 2WZOA 1HNZE 2E5LE 2L92A 3QFOA 2RS7A 2O8AA 2L6MA 4JI1E 4X64E 2G7HA 4FCXA 4KHPE 4WWLA 1UHZA 3C9FA 1JK7A 2FGGA 3F6GA 2Z72A 1AUIA 5C1VA 1FJGE 1UTEA 3E7BA 2RTXA 3IWBA 1M63A 4DUZE 2MC6A 2ZO9B 2ZM6E 1STUA 4DV0E 1N32E 5IWAE 2GJUA 2QJCA 4JV5E 3RL4A 3MSWA 4UT2A 3IVDA 3CK2A 1HPUA 2NUFA 4FBKA 1X49A 1QFCA 4JI7E 2NUEA 4Q7FA 2EWLA 3E0JA 5HPEA 4MP0A 3C4BA 2B3TB 4DR6E 1RQ0A 2IHR1 2LTSA 3T1HE 4LTYA 3LLHA 2LBSB 4DR2E 4UT3B 1XM7A 5AE3A 4LFCE 2HHHE 4JI5E 5T6JA 2YT4A 4O43A 2WDEA 3AUZA 2M4IA 3H69A 3H66A 2H36X 4R8OA 2MC5A 1XMQE 4LF9E 3THNA 5INBA 2IE3C 2V87A 3JYFA 3H09A 4X65E 3VYXA 1G5BA 1YYOA 3GVEA 4ZX2A 1N33E 2M7QA 2L3JA 4X8WA 1WXRA 2N3HA 4ORBA 3JAMC 2E1MA 2JWOA 4V0VA 5AE1A 4TUIA 1YZ9A 3PSOA 1X48A 4ORCA 1IBME 3HPSA 1WAO1 4DV1E 2HYOA 3ZU0A 4GKKE 2KHXA 3RQZA 3TGHA 2B7TA 3QG5C 2VQFE 4WPYA 4BMJA 4JI2E 3J7Yp 4Q28A 4WSPA 2Z1AA 2P6BA 2V89A 3C5WC 2WDFA 2YVTA 3J7AG 2N3GA 2FV4B 3HPZA 4LFAE 1QHWA 3PSNA 1T4OA 2IAEC 1N34E 5LMNE 5F3WA 4WFTA 4R03A 4H2BA 5AASA 3K6QA 4JI8E 1FJMA 2R17A 4M30A 3HQ1A 5JJTA 2JY9A 5LL6R 2AHDA 4H2IA 4I5NC 3KWRA 4MOYA 1EKZA 4F9CB 1XNRE 4ORAA 3KBPA 3DSDA 4UT3A 3HXLA 4OOGC 2K4VA 1II7A 2DB2A 2V83A 3ZOQB 4DUYE 2YZTA 2NYLC 3RL5A 4LFBE 4BS9A 1UF3A 1QU6A 1S3NA 4P7DA 4YHHE 3DF6A 1T71A 4B2OA 5LMUE 2B7VA 2KKNA 2M1SA 4X66E 4FBWA 1SU1A 4DHLA 4YY3E 2Z06A 2UXBE 2V85A 2CV9A 5ADZA 3AV0A 3T1YE 2QFPA 4OX9E 4YKEA 1DI2A 1XZWA 2BCDA 3K7WC 4BCAA 2L33A 4B3SE 4LF4E 3LL8A 1HP1A 4KKZA 5DNYA 3P71C 1S8EA 4K0KE 4GKJE 3H68A 4H2FA 1HR0E 3DSCA 3FGAC 3VK6A 4J6OA 5J28A 2NA2A 3P1XA 3H61A 2L2MA 1HNWE 3D03A 4DR4E 4DV3E 5EQVA 4X62E 2LMZA 3IB8A 5GTUA 1GZ6A 3J81C 3FIGA 3DJWA 2UXCE 2KONA 2ODRD 2FTXB 4FBQA 2L8TA 3V4YA 2USHA 1IT6A 3J80C 2QFRA 3K7VC 1IBKE 1U32A 2JOXA 2DSYA 2L2KB 1IBLE 1USHA 4LACC 4NXME 3RL3A 2KOUA 1OI8A 2XMOA 3JTZA 5CFFE 3E7AA 2NYMC 5B8IA 4DV7E 5JPFA 2DXNA 2LRSA 2V88A 3H64A 4UWQA 5AE2A 2V86A 3ZTVA 4F54A 4LF6E 2JR1A 1TCOA 3H63A 3ADGA 1ZBTA 2F8BA 1DQ3A 4DR5E 2LE2A 2YEQA 2UUCE 4H1SA 2LTRA 4G9JA 3QFMA 4NXNE 3F6HA 1X47A 4KZSA 1YYKA 3EGHA 4JI3E 3OMLA 1XNQE 2VQEE 2UXDE 4DR3E 2UUAE 2ZOAA 4DR7E 2CPNA 4DV6E 1OIEA 4JA9A 4JYAE 2JOGA 4DT2A 4DKKA 2DMYA 2VE7C 2MDRA 4BC9A 4V0XA 4JI0E 4LF7E 3QFNA 1PKPA 2Q8UA 1HO5A 1O0WA 2O8GA 2BDXA 4KBPA 2VF1A 1KBPA 4M2ZA 4F9BB 4B3ME 4LF5E 4BC7A 2DXLA 1SR9A 5BR8E 3H60A 4AQYE 1RC7A 4ZVZA 2UU9E 5A2QC 1HNXE 2B9DA 3T1IA 2HY1A 4TUGA 4L8NA 4L5NC 3ADIA 3C4TA 4F0ZA 3VYYA 4JI6E 2WDCA 4OR9A 4HD0A 3IB7A 2JVAA 1N36E 3ICFA 1W24A 1WHNA 2HYPA 1V73A 2LJHA 4JI4E 4DV4E 4M0VA 3RMPA 1ZBQA 4DSYA 1S70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DW8 C;  3H64 A;  4UWQ A;  1II7 A;  2GJU A;  2QJC A;  3H62 B;  3RL4 A;  4UT2 A;  3ZTV A;  3IVD A;  3H63 A;  1TCO A;  3CK2 A;  1HPU A;  4FBK A;  4I5L C;  2NYL C;  3EGG A;  1QFC A;  3IVE A;  4Q7F A;  3RL5 A;  3HVQ A;  5HPE A;  1UF3 A;  1OID A;  4H1S A;  4MP0 A;  4G9J A;  1S3N A;  3QFM A;  4O4K A;  1T71 A;  4LTY A;  4B2O A;  2KKN A;  2WDD A;  4DHL A;  3EGH A;  4FBW A;  1SU1 A;  1S3M A;  1XM7 A;  4UT3 B;  3H67 A;  2Z06 A;  4O43 A;  4MOV A;  2CV9 A;  2ZBM A;  2WDE A;  3AUZ A;  3H69 A;  2NXF A;  3H66 A;  4NZV A;  1OIE A;  3AV0 A;  3THN A;  4JA9 A;  5INB A;  2JOG A;  4DT2 A;  2QFP A;  2IE3 C;  3JYF A;  4YKE A;  2A22 A;  1XZW A;  1G5B A;  1WAR A;  2BCD A;  3GVE A;  3THO B;  4ZX2 A;  1S3L A;  3K7W C;  5JPE A;  4H2G A;  4V0X A;  3LL8 A;  3QFN A;  4ORB A;  1HP1 A;  4KKZ A;  5DNY A;  1Z2W A;  2Q8U A;  1S8E A;  3P71 C;  4V0W A;  1HO5 A;  2DFJ A;  3H68 A;  4V0V A;  4H2F A;  3DSC A;  2O8G A;  2BDX A;  3FGA C;  4KBP A;  4TUI A;  4J6O A;  3PSO A;  5J28 A;  1KBP A;  4JA7 A;  4ORC A;  3H61 A;  4LU9 A;  1WAO 1;  4IYP C;  2HYO A;  3ZU0 A;  3H60 A;  1MF8 A;  5EQV A;  4H1Y P;  4ZVZ A;  3RQZ A;  3TGH A;  3QG5 C;  3IB8 A;  5GTU A;  4XPN A;  3QFK A;  4O5G A;  2BQ8 X;  1NNW A;  2Z1A A;  2P6B A;  3T1I A;  3C5W C;  1T70 A;  2HY1 A;  4FBQ A;  4O24 A;  2WDF A;  2YVT A;  1Z2X A;  2USH A;  3V4Y A;  1IT6 A;  5IOH A;  4TUG A;  2IE4 C;  3N5U A;  2QFR A;  3K7V C;  4IL1 A;  4F0Z A;  1QHW A;  1U32 A;  1S95 A;  2NPP C;  2WDC A;  3PSN A;  4OR9 A;  2IAE C;  5F3W A;  3QFO A;  4HD0 A;  2O8A A;  1USH A;  3IB7 A;  4H2B A;  4LAC C;  3RL3 A;  4FCX A;  3ICF A;  4WWL A;  1FJM A;  1W24 A;  2R17 A;  1OI8 A;  2XMO A;  3C9F A;  1JK7 A;  2HYP A;  5JJT A;  1V73 A;  3E7A A;  2Z72 A;  1AUI A;  2AHD A;  4H2I A;  5C1V A;  1UTE A;  2NYM C;  4I5N C;  4M0V A;  4MOY A;  5B8I A;  3E7B A;  1M63 A;  4ORA A;  3DSD A;  3KBP A;  4UT3 A;  4DSY A;  1S70 A;  5JPF A; 
#chains in the Genus database with same CATH topology
 3DW8 C;  2BB8 A;  1TN9 A;  5FLX C;  1I94 E;  2JOB A;  2EZ6 A;  3H62 B;  4RH8 A;  2V8Q B;  3OTO E;  3IWC A;  1JK2 A;  2E72 A;  4J8Z A;  4WSG A;  1EH8 A;  4I5L C;  2YSP A;  3EGG A;  5KL5 A;  2MKN A;  5IT9 C;  3IVE A;  2LUP B;  2F4V E;  3HVQ A;  2EE8 A;  4I8O A;  1OID A;  4DV5 E;  2EMY A;  4ZYD A;  2EMA A;  5KL4 A;  2LVH A;  4O4K A;  2EM2 A;  2L2N A;  2WDD A;  2EPA A;  1YYW A;  1S3M A;  2HJJ A;  3BBG A;  1IMU A;  3H67 A;  1X6H A;  2EOJ A;  5A69 A;  2HGH A;  2JPA A;  4B3T E;  1T39 A;  4BHB A;  1BB8 A;  4MOV A;  1ZU1 A;  1J5E E;  2ZBM A;  2EN4 A;  2M9A A;  2L3C A;  2NXF A;  4NZV A;  3BF2 A;  1J26 A;  1WRJ A;  1SFE A;  4DV2 E;  1X6E A;  2ENH A;  4GEQ B;  4P78 A;  2UUB E;  2A22 A;  1WAR A;  1YUI A;  3THO B;  1S3L A;  5JPE A;  1WHQ A;  1FKA E;  4X9J A;  1Z1B A;  4H2G A;  1ZR9 A;  4GZN C;  3LML A;  2RS6 A;  4BBY A;  2DIX A;  1XMO E;  4LF8 E;  1Z2W A;  4V0W A;  2EMI A;  2EPN A;  2DFJ A;  1A1G A;  3ADJ A;  2EPC A;  1UIL A;  2YSO A;  4JA7 A;  4DR1 E;  4LU9 A;  4IYP C;  1TF3 A;  2WBT A;  1MF8 A;  2DMI A;  2LUQ A;  4H1Y P;  2N8X A;  2GHF A;  2YTI A;  4XPN A;  4WYQ B;  3QFK A;  2YPN A;  2ODR C;  4O5G A;  2BQ8 X;  1NNW A;  5IXM B;  4B3R E;  1GQE A;  4O24 A;  1T70 A;  2RSM A;  3ADL A;  4DMI A;  3JU0 A;  1T4L B;  4WXD A;  3IWD A;  4F9A B;  3HTX A;  1Z2X A;  5IOH A;  1T4N A;  1BBO A;  1YUJ A;  2IE4 C;  3N5U A;  3TQM A;  2LV2 A;  2NUG A;  4R2P A;  4IL1 A;  1S95 A;  2NPP C;  3L00 A;  3FLO A;  2WZO A;  1PJT A;  1LLM C;  4R2S A;  1HNZ E;  2E5L E;  2L92 A;  3QFO A;  2RS7 A;  1P47 A;  2O8A A;  2L6M A;  4JI1 E;  4X64 E;  1A1J A;  2G7H A;  4R2R A;  4FCX A;  4KHP E;  4N4R B;  4WWL A;  2GLI A;  1UHZ A;  3C9F A;  2EM5 A;  1JK7 A;  2R1F A;  2FGG A;  3F6G A;  4WXC A;  2Z72 A;  2JXP A;  1AUI A;  1EH7 A;  5C1V A;  1FJG E;  1UTE A;  3E7B A;  2RTX A;  3IWB A;  1PJQ A;  1M63 A;  2EM3 A;  4DUZ E;  2MC6 A;  2R76 A;  1A1K A;  2EPM X;  1X3C A;  2ZO9 B;  3EQ1 A;  2LCE A;  2ZM6 E;  1STU A;  4DV0 E;  1N32 E;  2EM7 A;  5IWA E;  2GJU A;  2QJC A;  3EPK A;  4JV5 E;  3RL4 A;  3MSW A;  2EMW A;  4UT2 A;  4ZYE A;  3IVD A;  3CK2 A;  1HPU A;  1G2D C;  1BBG A;  2NUF A;  4FBK A;  1X49 A;  1QFC A;  4M9V C;  4JI7 E;  2ELY A;  2NUE A;  4Q7F A;  2EWL A;  3E0J A;  5HPE A;  4MP0 A;  3C4B A;  2B3T B;  4DR6 E;  1RQ0 A;  3ECR A;  2DRP A;  2IHR 1;  2LTS A;  3T1H E;  2ADR A;  4LTY A;  3LLH A;  2LBS B;  4DR2 E;  4R2D A;  4UT3 B;  1XM7 A;  2EMX A;  2LO3 A;  2YWQ A;  5AE3 A;  4LFC E;  2HHH E;  4JI5 E;  2EMK A;  5T6J A;  2YT4 A;  4O43 A;  2LJU A;  2WDE A;  3AUZ A;  2EM8 A;  2M4I A;  3H69 A;  3H66 A;  2H36 X;  4R8O A;  2CTD A;  2MC5 A;  2RPC A;  2YU8 A;  3THN A;  1XMQ E;  4LF9 E;  5INB A;  2IE3 C;  2V87 A;  2LT7 A;  3H09 A;  4X65 E;  3JYF A;  1PJS A;  3VYX A;  1G5B A;  1YYO A;  3GVE A;  4ZX2 A;  1N33 E;  2M7Q A;  2L3J A;  5AC5 A;  4X8W A;  1YSA C;  1WXR A;  1QNT A;  2N3H A;  4ORB A;  3JAM C;  2E1M A;  2JWO A;  1ZAA C;  1YFH A;  4V0V A;  2EM0 A;  5AE1 A;  2EMH A;  4TUI A;  1YZ9 A;  3PSO A;  1X48 A;  3EPH A;  4WX9 A;  4ORC A;  1IBM E;  3HPS A;  2YTE A;  1WAO 1;  4DV1 E;  2HYO A;  3ZU0 A;  2EOY A;  2WCC 3;  4GKK E;  2KHX A;  2EL6 A;  3RQZ A;  3TGH A;  2B7T A;  3QG5 C;  2VQF E;  4WPY A;  1PDA A;  4BMJ A;  4JI2 E;  3J7Y p;  4Q28 A;  4WSP A;  2Z1A A;  2EJ4 A;  2P6B A;  2V89 A;  3C5W C;  2HC5 A;  2WDF A;  2YVT A;  2YU5 A;  3J7A G;  2N3G A;  4FK5 C;  3BID A;  2FV4 B;  2EPZ A;  2YRH A;  1NEI A;  3HPZ A;  5KL6 A;  4LFA E;  1QHW A;  2EN2 A;  1IQO A;  3M99 B;  3PSN A;  1T4O A;  2IAE C;  1A1L A;  2MDG A;  1N34 E;  5LMN E;  5F3W A;  1RMD A;  4WFT A;  4R03 A;  4H2B A;  5AAS A;  3K6Q A;  2EN3 A;  2EPP A;  4JI8 E;  2EOO A;  1FJM A;  2R17 A;  2EMZ A;  4M30 A;  3HQ1 A;  1UN6 B;  5JJT A;  5A6A A;  2JY9 A;  5LL6 R;  1JK1 A;  2EQ3 A;  2EMF A;  1AAY A;  1IQS A;  2AHD A;  4H2I A;  2YTN A;  4I5N C;  3KWR A;  2EOH A;  4MOY A;  1EKZ A;  2I9I A;  1DGC A;  4F9C B;  1XNR E;  4ORA A;  3KBP A;  3DSD A;  4UT3 A;  2EOX A;  2YTO A;  2EOR A;  1GTK A;  3HXL A;  4OOG C;  2K4V A;  1II7 A;  2DB2 A;  1L4S A;  2V83 A;  3ZOQ B;  4DUY E;  2EOI A;  5A6K A;  2YZT A;  2EPL X;  2NYL C;  3RL5 A;  4LFB E;  4BS9 A;  1UF3 A;  4MLQ A;  5A6B D;  1QU6 A;  2MKD A;  1S3N A;  4P7D A;  4F6M A;  4YHH E;  3DF6 A;  1T71 A;  4B2O A;  5LMU E;  2B7V A;  2KKN A;  2M1S A;  4X66 E;  2EP3 A;  1SU1 A;  4FBW A;  4DHL A;  2EN7 A;  1TF6 A;  4YY3 E;  2Z06 A;  2UXB E;  2V85 A;  2CV9 A;  1UBD C;  2YTF A;  5ADZ A;  3AV0 A;  3T1Y E;  2QFP A;  4OX9 E;  4YKE A;  3C6K A;  1DI2 A;  1XZW A;  2BCD A;  3K7W C;  4BCA A;  2ELZ A;  2L33 A;  4B3S E;  2EM6 A;  4LF4 E;  3LL8 A;  1YPN A;  1X6F A;  1HP1 A;  2EQ1 A;  4KKZ A;  5DNY A;  2YTP A;  1S8E A;  3P71 C;  1WJP A;  4K0K E;  4GKJ E;  3H68 A;  1X5W A;  1HR0 E;  4H2F A;  3MHH C;  3DSC A;  2EQ0 A;  2EPU A;  3FGA C;  3VK6 A;  1A1H A;  4J6O A;  5J28 A;  1N3G A;  4ZYH A;  4Q35 B;  2NA2 A;  3P1X A;  2JYA A;  3H61 A;  3EPL A;  2YTQ A;  2L2M A;  1HNW E;  3D03 A;  4NHR A;  4DR4 E;  4DV3 E;  2DGC A;  2PRT A;  5EQV A;  4X62 E;  2LMZ A;  5A6B A;  3EPJ A;  3IB8 A;  5GTU A;  1GZ6 A;  3J81 C;  4HTG A;  3FIG A;  5KL2 A;  3DJW A;  2UXC E;  2EPR A;  2KON A;  2ODR D;  2FTX B;  4FBQ A;  1MEY C;  2L8T A;  3V4Y A;  2USH A;  4R2A A;  1IT6 A;  3J80 C;  2QFR A;  3K7V C;  1IBK E;  2GPI A;  2EOE A;  1U32 A;  2JOX A;  5TSE A;  1KJK A;  4IJD A;  2DSY A;  2L2K B;  1IBL E;  2RQL A;  1USH A;  4LAC C;  4NXM E;  3RL3 A;  2EPX A;  4R2E A;  2KOU A;  1MGT A;  2EL5 A;  1OI8 A;  2XMO A;  3JTZ A;  2EL4 A;  5CFF E;  3E7A A;  2NYM C;  5B8I A;  2WBS A;  4MLV A;  1A1I A;  4DV7 E;  5JPF A;  2DXN A;  3KZZ A;  2LRS A;  2EOS A;  2EMB A;  2V88 A;  3H64 A;  4UWQ A;  2EOQ A;  1AH5 A;  5AE2 A;  5LLQ A;  2V86 A;  3ZTV A;  2EOF A;  3VHT B;  4F54 A;  4LF6 E;  2EOM A;  2JR1 A;  1TCO A;  3H63 A;  3ADG A;  1ZBT A;  2F8B A;  1DQ3 A;  4DR5 E;  2LE2 A;  2YTD A;  2YEQ A;  2UUC E;  4H1S A;  2LTR A;  2EMC A;  2NAB A;  4G9J A;  4BHC A;  3QFM A;  4NXN E;  4F2J C;  2EN8 A;  3F6H A;  2EMG A;  1X47 A;  5IV8 B;  4KZS A;  1YYK A;  3EGH A;  4JI3 E;  3OML A;  4HEI A;  1XNQ E;  2VQE E;  2UXD E;  4DR3 E;  2UUA E;  2ZOA A;  2EPO A;  2YRM A;  4DR7 E;  2CPN A;  4DV6 E;  1OIE A;  2EOZ A;  4JA9 A;  2J7J A;  4JYA E;  2JOG A;  4DT2 A;  4DKK A;  2DMY A;  2VRD A;  1A1F A;  2A25 A;  2EM4 A;  2VE7 C;  2EM9 A;  2MDR A;  2ENA A;  4BC9 A;  4V0X A;  4JI0 E;  4LF7 E;  4RHB B;  2EPK X;  2K7I A;  4KWY A;  3QFN A;  1PKP A;  2Q8U A;  2ENC A;  1HO5 A;  3UK3 C;  1T38 A;  2DLK A;  2JP9 A;  2CSH A;  1O0W A;  2O8G A;  2DLQ A;  1NCS A;  2BDX A;  4KBP A;  2CT1 A;  1EH6 A;  2VF1 A;  1KBP A;  4M2Z A;  4F9B B;  4B3M E;  4LF5 E;  4BC7 A;  2DXL A;  1SR9 A;  2YTJ A;  5BR8 E;  2RSI A;  3H60 A;  5KL7 A;  4R2C A;  4AQY E;  1RC7 A;  4ZVZ A;  2UU9 E;  5A2Q C;  1HNX E;  4IS1 C;  5A6J A;  3KZY A;  2B9D A;  1KYQ A;  3T1I A;  2HY1 A;  3C6M A;  2I13 A;  2EN1 A;  4ZYG A;  4TUG A;  4L8N A;  4L5N C;  3ADI A;  3C4T A;  4F0Z A;  2YRK A;  3VYY A;  2EML A;  5AC4 A;  4JI6 E;  2WDC A;  4OR9 A;  3MHS C;  3BGH A;  2YTG A;  4HD0 A;  3IB7 A;  1B69 A;  2D9H A;  2JVA A;  1N36 E;  3ICF A;  2WBU A;  1W24 A;  1WHN A;  2EN6 A;  1G2F C;  2HYP A;  1V73 A;  1F2I G;  2LJH A;  4JI4 E;  4R2Q A;  2BBG A;  4M0V A;  4DV4 E;  3RMP A;  1ZBQ A;  4F6N A;  4DSY A;  5KL3 A;  1S70 A; 
#chains in the Genus database with same CATH homology
 3DW8 C;  5FLX C;  1I94 E;  2JOB A;  2EZ6 A;  3H62 B;  2V8Q B;  3OTO E;  3IWC A;  4J8Z A;  4I5L C;  3EGG A;  3IVE A;  5IT9 C;  2LUP B;  2F4V E;  3HVQ A;  4I8O A;  1OID A;  4DV5 E;  4O4K A;  2L2N A;  2WDD A;  1YYW A;  1S3M A;  3H67 A;  4B3T E;  4MOV A;  1J5E E;  2ZBM A;  2L3C A;  2NXF A;  4NZV A;  1J26 A;  4DV2 E;  4GEQ B;  4P78 A;  2UUB E;  2A22 A;  1WAR A;  3THO B;  1S3L A;  5JPE A;  1WHQ A;  1FKA E;  4H2G A;  3LML A;  2RS6 A;  4BBY A;  2DIX A;  1XMO E;  4LF8 E;  1Z2W A;  4V0W A;  2DFJ A;  3ADJ A;  1UIL A;  4JA7 A;  4DR1 E;  4LU9 A;  4IYP C;  1MF8 A;  2LUQ A;  4H1Y P;  4XPN A;  4WYQ B;  3QFK A;  2ODR C;  4O5G A;  2BQ8 X;  1NNW A;  4B3R E;  1GQE A;  1T70 A;  4O24 A;  2RSM A;  3ADL A;  4DMI A;  3JU0 A;  1Z2X A;  1T4L B;  3HTX A;  3IWD A;  4F9A B;  5IOH A;  1T4N A;  2IE4 C;  3N5U A;  2NUG A;  4IL1 A;  1S95 A;  2NPP C;  3FLO A;  2WZO A;  1HNZ E;  2E5L E;  2L92 A;  3QFO A;  2RS7 A;  2O8A A;  2L6M A;  4JI1 E;  4X64 E;  2G7H A;  4FCX A;  4KHP E;  4WWL A;  1UHZ A;  3C9F A;  1JK7 A;  2FGG A;  3F6G A;  2Z72 A;  1AUI A;  5C1V A;  1FJG E;  1UTE A;  3E7B A;  2RTX A;  3IWB A;  1M63 A;  4DUZ E;  2MC6 A;  2ZO9 B;  2ZM6 E;  1STU A;  4DV0 E;  1N32 E;  5IWA E;  2GJU A;  2QJC A;  4JV5 E;  3RL4 A;  3MSW A;  4UT2 A;  3IVD A;  3CK2 A;  1HPU A;  2NUF A;  4FBK A;  1X49 A;  1QFC A;  4JI7 E;  2NUE A;  4Q7F A;  2EWL A;  3E0J A;  5HPE A;  4MP0 A;  3C4B A;  2B3T B;  4DR6 E;  1RQ0 A;  2IHR 1;  2LTS A;  3T1H E;  4LTY A;  3LLH A;  2LBS B;  4DR2 E;  4UT3 B;  1XM7 A;  5AE3 A;  4LFC E;  2HHH E;  4JI5 E;  5T6J A;  2YT4 A;  4O43 A;  2WDE A;  3AUZ A;  2M4I A;  3H69 A;  3H66 A;  2H36 X;  4R8O A;  2MC5 A;  1XMQ E;  4LF9 E;  3THN A;  5INB A;  2IE3 C;  2V87 A;  3JYF A;  3H09 A;  4X65 E;  3VYX A;  1G5B A;  1YYO A;  3GVE A;  4ZX2 A;  1N33 E;  2M7Q A;  2L3J A;  4X8W A;  1WXR A;  2N3H A;  4ORB A;  3JAM C;  2E1M A;  2JWO A;  4V0V A;  5AE1 A;  4TUI A;  1YZ9 A;  3PSO A;  1X48 A;  4ORC A;  1IBM E;  3HPS A;  1WAO 1;  4DV1 E;  2HYO A;  3ZU0 A;  4GKK E;  2KHX A;  3RQZ A;  3TGH A;  2B7T A;  3QG5 C;  2VQF E;  4WPY A;  4BMJ A;  4JI2 E;  3J7Y p;  4Q28 A;  4WSP A;  2Z1A A;  2P6B A;  2V89 A;  3C5W C;  2WDF A;  2YVT A;  3J7A G;  2N3G A;  2FV4 B;  3HPZ A;  4LFA E;  1QHW A;  3PSN A;  1T4O A;  2IAE C;  1N34 E;  5LMN E;  5F3W A;  4WFT A;  4R03 A;  4H2B A;  5AAS A;  3K6Q A;  4JI8 E;  1FJM A;  2R17 A;  4M30 A;  3HQ1 A;  5JJT A;  2JY9 A;  5LL6 R;  2AHD A;  4H2I A;  4I5N C;  3KWR A;  4MOY A;  1EKZ A;  4F9C B;  1XNR E;  4ORA A;  3KBP A;  3DSD A;  4UT3 A;  3HXL A;  4OOG C;  2K4V A;  1II7 A;  2DB2 A;  2V83 A;  3ZOQ B;  4DUY E;  2YZT A;  2NYL C;  3RL5 A;  4LFB E;  4BS9 A;  1UF3 A;  1QU6 A;  1S3N A;  4P7D A;  4YHH E;  3DF6 A;  1T71 A;  4B2O A;  5LMU E;  2B7V A;  2KKN A;  2M1S A;  4X66 E;  4FBW A;  1SU1 A;  4DHL A;  4YY3 E;  2Z06 A;  2UXB E;  2V85 A;  2CV9 A;  5ADZ A;  3AV0 A;  3T1Y E;  2QFP A;  4OX9 E;  4YKE A;  1DI2 A;  1XZW A;  2BCD A;  3K7W C;  4BCA A;  2L33 A;  4B3S E;  4LF4 E;  3LL8 A;  1HP1 A;  4KKZ A;  5DNY A;  3P71 C;  1S8E A;  4K0K E;  4GKJ E;  3H68 A;  4H2F A;  1HR0 E;  3DSC A;  3FGA C;  3VK6 A;  4J6O A;  5J28 A;  2NA2 A;  3P1X A;  3H61 A;  2L2M A;  1HNW E;  3D03 A;  4DR4 E;  4DV3 E;  5EQV A;  4X62 E;  2LMZ A;  3IB8 A;  5GTU A;  1GZ6 A;  3J81 C;  3FIG A;  3DJW A;  2UXC E;  2KON A;  2ODR D;  2FTX B;  4FBQ A;  2L8T A;  3V4Y A;  2USH A;  1IT6 A;  3J80 C;  2QFR A;  3K7V C;  1IBK E;  1U32 A;  2JOX A;  2DSY A;  2L2K B;  1IBL E;  1USH A;  4LAC C;  4NXM E;  3RL3 A;  2KOU A;  1OI8 A;  2XMO A;  3JTZ A;  5CFF E;  3E7A A;  2NYM C;  5B8I A;  4DV7 E;  5JPF A;  2DXN A;  2LRS A;  2V88 A;  3H64 A;  4UWQ A;  5AE2 A;  2V86 A;  3ZTV A;  4F54 A;  4LF6 E;  2JR1 A;  1TCO A;  3H63 A;  3ADG A;  1ZBT A;  2F8B A;  1DQ3 A;  4DR5 E;  2LE2 A;  2YEQ A;  2UUC E;  4H1S A;  2LTR A;  4G9J A;  3QFM A;  4NXN E;  3F6H A;  1X47 A;  4KZS A;  1YYK A;  3EGH A;  4JI3 E;  3OML A;  1XNQ E;  2VQE E;  2UXD E;  4DR3 E;  2UUA E;  2ZOA A;  4DR7 E;  2CPN A;  4DV6 E;  1OIE A;  4JA9 A;  4JYA E;  2JOG A;  4DT2 A;  4DKK A;  2DMY A;  2VE7 C;  2MDR A;  4BC9 A;  4V0X A;  4JI0 E;  4LF7 E;  3QFN A;  1PKP A;  2Q8U A;  1HO5 A;  1O0W A;  2O8G A;  2BDX A;  4KBP A;  2VF1 A;  1KBP A;  4M2Z A;  4F9B B;  4B3M E;  4LF5 E;  4BC7 A;  2DXL A;  1SR9 A;  5BR8 E;  3H60 A;  4AQY E;  1RC7 A;  4ZVZ A;  2UU9 E;  5A2Q C;  1HNX E;  2B9D A;  3T1I A;  2HY1 A;  4TUG A;  4L8N A;  4L5N C;  3ADI A;  3C4T A;  4F0Z A;  3VYY A;  4JI6 E;  2WDC A;  4OR9 A;  4HD0 A;  3IB7 A;  2JVA A;  1N36 E;  3ICF A;  1W24 A;  1WHN A;  2HYP A;  1V73 A;  2LJH A;  4JI4 E;  4DV4 E;  4M0V A;  3RMP A;  1ZBQ A;  4DSY A;  1S70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...