3AUZA

Crystal structure of mre11 with manganese
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
316
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
total genus 99
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3auzA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3auzA01
3H68A 3QG5C 4IL1A 1MF8A 3KBPA 1U32A 3C9FA 3HVQA 4YKEA 4JA7A 3EGHA 4ZX2A 3QFMA 4H2IA 3ZTVA 4DSYA 2Z06A 2QFRA 4UT3B 3JYFA 3H60A 5INBA 5JJTA 2DFJA 1IT6A 3THOB 3N5UA 1SU1A 3P71C 1UTEA 1V73A 3V4YA 1T70A 1OIEA 3THNA 4G9JA 2O8GA 4FBKA 4J6OA 3ZU0A 3H69A 2KKNA 3H62B 1HPUA 1TCOA 2XMOA 4UWQA 2R17A 4H1YP 2Q8UA 1S3MA 3H66A 4DT2A 2Z1AA 3E7AA 4JA9A 5F3WA 4MOYA 3IVEA 4H2FA 5C1VA 3H64A 1S8EA 4TUGA 4FBWA 4H2GA 2WDDA 4M0VA 2AHDA 4WWLA 2QFPA 3E7BA 1M63A 2IE3C 1S70A 1FJMA 1AUIA 3DSDA 1KBPA 3DW8C 2WDEA 3QFKA 4HD0A 3FGAC 4FCXA 2HY1A 3RL3A 2HYPA 4V0VA 2BQ8X 1G5BA 1HO5A 4FBQA 3RQZA 4KKZA 4ORAA 4I5LC 3CK2A 3IB8A 1S95A 4UT3A 3K7VC 3K7WC 3AUZA 2BDXA 3PSOA 4LACC 5IOHA 1OI8A 1T71A 1S3NA 3T1IA 2Z72A 3TGHA 4Q7FA 3IB7A 2GJUA 4TUIA 1HP1A 3ICFA 2YVTA 2JOGA 1S3LA 4F0ZA 5DNYA 3LL8A 3H63A 4LU9A 4MP0A 5J28A 1NNWA 3RL4A 2NYLC 3AV0A 4ZVZA 1II7A 1UF3A 4LTYA 4ORBA 4V0XA 5B8IA 1USHA 2IAEC 1Z2WA 4O4KA 2USHA 2NYMC 1XM7A 5JPEA 5GTUA 1XZWA 2P6BA 3QFNA 2O8AA 4H1SA 4NZVA 2IE4C 5JPFA 1WARA 2NXFA 4I5NC 2CV9A 3PSNA 4O5GA 1WAO1 1OIDA 3QFOA 2A22A 4KBPA 2NPPC 2BCDA 2QJCA 4DHLA 4ORCA 3H61A 4XPNA 1Z2XA 5HPEA 1QFCA 1QHWA 4MOVA 4O43A 2WDCA 3C5WC 3EGGA 5EQVA 4O24A 2HYOA 3H67A 1JK7A 3RL5A 4IYPC 4OR9A 4UT2A 3GVEA 2WDFA 4B2OA 2ZBMA 3IVDA 1W24A 3DSCA 4V0WA 4H2BA
chains in the Genus database with same CATH superfamily
1KYQA 2NUFA 1NEIA 5AE2A 1A1KA 2JWOA 2EM4A 4ZYHA 3ZTVA 4GKKE 2L92A 4RH8A 3HXLA 2ENHA 2JOXA 2EMZA 2EN4A 3TQMA 1IT6A 3EPHA 3P71C 1UTEA 4JI6E 2NA2A 2YRMA 4KZSA 2UUBE 2UXCE 4OOGC 2MKNA 2ELYA 4WSGA 4UWQA 4DR5E 2R17A 1AH5A 2Q8UA 1S3MA 3H66A 2EM6A 2Z1AA 1SFEA 4H2FA 2DGCA 3LMLA 2LUPB 2YSPA 2YTNA 4NHRA 4M0VA 1WRJA 4WWLA 4I8OA 1BBOA 1XNRE 1AUIA 2L3JA 2WDEA 2LT7A 2HY1A 2G7HA 3RL3A 1G5BA 4F9CB 4FBQA 5A2QC 3RQZA 2JVAA 4AQYE 1AAYA 1QNTA 1WXRA 2EL4A 1N34E 2LTRA 2EOEA 5KL7A 5KL6A 5T6JA 1S95A 1SR9A 3K7VC 4X64E 2YTQA 1L4SA 2HJJA 4JI2E 3AUZA 5IOHA 1X49A 3PSOA 2K7IA 1T71A 3T1IA 4MLQA 2F4VE 4DUZE 2Z72A 3TGHA 2EN7A 4Q7FA 1EH6A 2GJUA 1PJTA 2D9HA 2JOGA 1LLMC 3VYXA 4R2SA 2L3CA 2FV4B 1NNWA 4F6MA 4LF6E 2YTEA 5KL4A 1YUIA 4LTYA 1UF3A 2YT4A 2IAEC 2EOOA 1Z2WA 2WBTA 5LMUE 2CPNA 2EM9A 1ZR9A 4L8NA 4NZVA 2IE4C 2DLKA 3C4TA 1FKAE 4I5NC 2CV9A 2N3GA 2E5LE 1WAO1 2EM2A 1HNXE 2EPZA 1OIDA 2MDGA 2BCDA 3MSWA 4DUYE 3VHTB 2EMGA 4R2PA 3F6GA 1X47A 2EM8A 4F2JC 1QFCA 2BB8A 4MOVA 2EL6A 2K4VA 2RSMA 5EQVA 1YSAC 1YYWA 2EPKX 5FLXC 2L2NA 4LF8E 5KL5A 2F8BA 4DR2E 3RL5A 1HNZE 4BCAA 2CSHA 2JYAA 4MLVA 5LMNE 3GVEA 4B2OA 4FK5C 2YSOA 1A1GA 2LVHA 2J7JA 2YU5A 2N8XA 3MHHC 3DSCA 2EMIA 2DXNA 2JR1A 2EMAA 2JOBA 2LJUA 3QG5C 2KOUA 2R1FA 4M30A 1MF8A 1TN9A 4LFAE 4JA7A 2RQLA 4ZX2A 1GTKA 1FJGE 2QFRA 4UT3B 2EP3A 2M9AA 4DR1E 4DV0E 3FLOA 3H60A 5JJTA 3F6HA 3LLHA 4LF4E 3THOB 4LFBE 3N5UA 3C6MA 4B3TE 1IQSA 2EN3A 2EPOA 2L33A 4GKJE 3THNA 4DV3E 1EKZA 4JI1E 2EN6A 4J6OA 1A1IA 2EMFA 3ZU0A 2EOFA 1TF3A 2XMOA 2L2MA 1RQ0A 4DT2A 3ECRA 2YTIA 4F9BB 2EM3A 1N36E 4JV5E 1T38A 2GHFA 2V86A 4TUGA 4DV5E 2WDDA 1GQEA 2IHR1 3J7Yp 2EPLX 1JK2A 2YPNA 3J81C 1FJMA 2ENAA 2YRHA 2JP9A 1T4NA 2LJHA 4HD0A 2EOYA 4FCXA 3HTXA 1YYKA 2HYPA 3J80C 1HO5A 4WXCA 4ORAA 3P1XA 5AE3A 4X62E 4R2DA 2EM5A 4M9VC 2YTGA 1KJKA 3DJWA 3JAMC 5KL3A 5CFFE 2LCEA 2HHHE 2V89A 4JI0E 2MC5A 1T39A 2EOJA 1OI8A 1YPNA 1S3NA 3IB7A 2EPPA 3ICFA 2YVTA 1X6FA 1PKPA 2UU9E 2MDRA 3K6QA 2EQ0A 4LF5E 5J28A 2CT1A 4BC7A 3AV0A 1PDAA 1Z1BA 4ZVZA 2ODRC 1XMQE 1USHA 1A1FA 2NYMC 2P6BA 1N32E 2ODRD 1P47A 2EPCA 3EPLA 1YYOA 2NXFA 1O0WA 1N3GA 2YWQA 2B3TB 3PSNA 4DV1E 3QFOA 5A6BD 2FTXB 3E0JA 2QJCA 4DHLA 4DKKA 2HC5A 2YTJA 4XPNA 1Z2XA 4X66E 5HPEA 2L2KB 1J5EE 4JI4E 1I94E 2UXBE 4X9JA 3EQ1A 2EORA 2GPIA 1ZAAC 4UT2A 2I9IA 3HQ1A 2ZBMA 3IVDA 3ADJA 2EM0A 4R03A 1EH8A 2RTXA 4H2BA 4MOYA 1DGCA 3H68A 4IL1A 2DLQA 3C4BA 4NXNE 3KBPA 4YKEA 3C9FA 3HVQA 3ZOQB 2LUQA 4F9AB 1HNWE 2YRKA 4M2ZA 3QFMA 4H2IA 4DSYA 2NUGA 2B7VA 2UXDE 2Z06A 4NXME 3JYFA 2VRDA 1X48A 4LF9E 2EPAA 4R8OA 3V4YA 2EOMA 5AC4A 1YUJA 4DR4E 1T70A 1OIEA 2EQ3A 4IS1C 4DR6E 4BC9A 4G9JA 1X3CA 3IWBA 2JPAA 4DV4E 2O8GA 3ADLA 2V85A 1A1JA 4WSPA 3H62B 2V8QB 1HPUA 3OTOE 4H1YP 5A6AA 1GZ6A 4R2RA 2DXLA 4JA9A 3BBGA 4BHCA 2EMXA 3H64A 2CTDA 1S8EA 4FBWA 4H2GA 2EOSA 2I13A 4BHBA 2AHDA 3E7BA 1M63A 1UBDC 2YTDA 3HPSA 2UUCE 1IBKE 4BBYA 1KBPA 4DR3E 2DRPA 3FGAC 2YTPA 1A1LA 2EL5A 2EPMX 4DR7E 2BQ8X 4YHHE 4V0VA 2EE8A 1G2FC 3KWRA 2ZOAA 4IJDA 2DMIA 4R2QA 2V83A 4HTGA 1UN6B 5AC5A 2EMHA 2FGGA 4KWYA 4UT3A 2EMYA 3K7WC 2LMZA 2YTOA 4WFTA 4WX9A 2EMWA 2BDXA 3EPJA 5KL2A 2EMLA 1EH7A 1X6HA 4LFCE 2N3HA 1WJPA 4F0ZA 2EOQA 2EPXA 2LV2A 5DNYA 1MGTA 1JK1A 3LL8A 3H63A 3L00A 1NCSA 4N4RB 2V88A 5AASA 3J7AG 3EPKA 3VYYA 2VE7C 3RL4A 2NYLC 5B8IA 4ORBA 1QU6A 1A1HA 4JI5E 4OX9E 1XM7A 5IT9C 1XZWA 2O8AA 4H1SA 2UUAE 1WARA 3M99B 3DF6A 3T1YE 3HPZA 2EWLA 2LO3A 2MC6A 4KBPA 4WPYA 2A22A 1WHNA 2NPPC 2DMYA 4Q28A 3VK6A 4JYAE 4DV2E 3H61A 2LE2A 2LBSB 1XMOE 1QHWA 2WDCA 4O24A 2LRSA 1N33E 2A25A 2EQ1A 4BMJA 1T4LB 3ADGA 2HYOA 4JI8E 3D03A 1JK7A 4IYPC 4WXDA 1RMDA 4OR9A 5IV8B 2DIXA 2E72A 2YEQA 4GEQB 4Q35B 1W24A 2HGHA 1X5WA 4V0WA 1X6EA 4P78A 3BF2A 2B7TA 1U32A 1PJQA 2L6MA 2V87A 2RPCA 3EGHA 4DV6E 2KONA 4KHPE 1PJSA 4DMIA 5A69A 2E1MA 2H36X 4JI3E 3RMPA 2EOIA 5INBA 1ZU1A 2DFJA 3JTZA 1G2DC 1SU1A 1IBME 1V73A 4YY3E 4F6NA 2EMCA 2ADRA 5A6KA 2EPRA 2M7QA 4F54A 4FBKA 1WHQA 4K0KE 3H69A 1T4OA 4R2EA 2KKNA 1TCOA 4DV7E 4L5NC 2EOXA 5TSEA 2L8TA 5LL6R 3E7AA 4RHBB 1ZBQA 5F3WA 5C1VA 3IVEA 4B3SE 3KZYA 1XNQE 2B9DA 1HR0E 2ENCA 3ADIA 2QFPA 1MEYC 2IE3C 4R2CA 1F2IG 1S70A 1DI2A 2BBGA 2EMKA 2RS6A 4GZNC 2GLIA 4LF7E 3DSDA 3DW8C 1TF6A 3QFKA 2ZM6E 5AE1A 2ZO9B 1RC7A 2EM7A 1J26A 2DSYA 2WCC3 1BBGA 4KKZA 4I5LC 2DB2A 2VQEE 3C6KA 2M1SA 3CK2A 3IB8A 2EZ6A 3IWCA 2MKDA 1STUA 2EPUA 4B3RE 2WBUA 4WYQB 2VQFE 2YZTA 4LACC 1UILA 3IWDA 1IMUA 2NABA 1YFHA 4ZYEA 4TUIA 3UK3C 1HP1A 4B3ME 2EN8A 1S3LA 2ELZA 4J8ZA 4X8WA 1BB8A 3OMLA 1B69A 3H09A 4LU9A 5ADZA 4MP0A 2EN1A 2R76A 3FIGA 4ZYDA 2WBSA 3JU0A 3T1HE 1II7A 2EPNA 4V0XA 4BS9A 1YZ9A 4O4KA 2USHA 5JPEA 5GTUA 2WZOA 3BIDA 2YTFA 2M4IA 3QFNA 2NUEA 5JPFA 1IBLE 4JI7E 2KHXA 2EOHA 2EOZA 2RS7A 2LTSA 5A6JA 5LLQA 4O5GA 1IQOA 5A6BA 2PRTA 4HEIA 2EMBA 4X65E 2EN2A 4P7DA 5IXMB 4ORCA 4R2AA 2JXPA 2RSIA 5IWAE 4O43A 1UHZA 3BGHA 3C5WC 3EGGA 4ZYGA 2JY9A 5BR8E 2EJ4A 1DQ3A 2VF1A 3H67A 2YU8A 1ZBTA 2WDFA 3KZZA 3MHSC
chains in the Genus database with same CATH topology
2NUFA 5AE2A 2JWOA 3ZTVA 4GKKE 2L92A 3HXLA 2JOXA 1IT6A 3P71C 1UTEA 4JI6E 2NA2A 4KZSA 2UUBE 2UXCE 4OOGC 4UWQA 4DR5E 2R17A 2Q8UA 1S3MA 3H66A 2Z1AA 4H2FA 3LMLA 2LUPB 4M0VA 4WWLA 4I8OA 1XNRE 1AUIA 2L3JA 2WDEA 2HY1A 2G7HA 3RL3A 1G5BA 4F9CB 4FBQA 5A2QC 3RQZA 2JVAA 4AQYE 1WXRA 1N34E 2LTRA 5T6JA 1S95A 1SR9A 3K7VC 4X64E 4JI2E 3AUZA 5IOHA 1X49A 3PSOA 1T71A 3T1IA 2F4VE 4DUZE 2Z72A 3TGHA 4Q7FA 2GJUA 2JOGA 3VYXA 2L3CA 2FV4B 1NNWA 4LF6E 4LTYA 1UF3A 2YT4A 2IAEC 1Z2WA 5LMUE 2CPNA 4L8NA 2IE4C 4NZVA 3C4TA 1FKAE 4I5NC 2CV9A 2N3GA 2E5LE 1WAO1 1HNXE 1OIDA 2BCDA 3MSWA 4DUYE 3F6GA 1X47A 1QFCA 4MOVA 2K4VA 2RSMA 5EQVA 1YYWA 5FLXC 2L2NA 4LF8E 2F8BA 4DR2E 3RL5A 1HNZE 4BCAA 5LMNE 3GVEA 4B2OA 3DSCA 2DXNA 2JOBA 2JR1A 4M30A 3QG5C 2KOUA 1MF8A 4LFAE 4JA7A 4ZX2A 1FJGE 2QFRA 4UT3B 4DR1E 4DV0E 3FLOA 3H60A 5JJTA 3F6HA 3LLHA 4LF4E 3THOB 4LFBE 3N5UA 4B3TE 2L33A 4GKJE 3THNA 4DV3E 1EKZA 4JI1E 4J6OA 3ZU0A 2XMOA 2L2MA 1RQ0A 4DT2A 4F9BB 1N36E 4JV5E 2V86A 4TUGA 4DV5E 2WDDA 1GQEA 2IHR1 3J7Yp 3J81C 1FJMA 1T4NA 2LJHA 4HD0A 4FCXA 3HTXA 1YYKA 2HYPA 3J80C 1HO5A 4ORAA 3P1XA 5AE3A 4X62E 3DJWA 3JAMC 5CFFE 2HHHE 2V89A 4JI0E 2MC5A 1OI8A 1S3NA 3IB7A 3ICFA 2YVTA 1PKPA 2UU9E 2MDRA 3K6QA 4LF5E 5J28A 4BC7A 3AV0A 4ZVZA 2ODRC 1XMQE 1USHA 2NYMC 2P6BA 1N32E 2ODRD 1YYOA 2NXFA 1O0WA 3PSNA 2B3TB 4DV1E 3QFOA 2FTXB 3E0JA 2QJCA 4DHLA 4DKKA 4XPNA 1Z2XA 4X66E 5HPEA 2L2KB 1J5EE 4JI4E 1I94E 2UXBE 4UT2A 3HQ1A 2ZBMA 3IVDA 3ADJA 4R03A 2RTXA 4H2BA 4MOYA 3H68A 4IL1A 4NXNE 3C4BA 3KBPA 4YKEA 3C9FA 3HVQA 3ZOQB 2LUQA 4F9AB 1HNWE 4M2ZA 3QFMA 4H2IA 4DSYA 2NUGA 2B7VA 2UXDE 2Z06A 4NXME 3JYFA 1X48A 4LF9E 4R8OA 3V4YA 1T70A 4DR4E 1OIEA 4DR6E 4BC9A 4G9JA 3IWBA 4DV4E 2O8GA 3ADLA 2V85A 4WSPA 3H62B 2V8QB 1HPUA 3OTOE 4H1YP 1GZ6A 2DXLA 4JA9A 3H64A 1S8EA 4FBWA 4H2GA 2AHDA 3E7BA 1M63A 3HPSA 2UUCE 1IBKE 4BBYA 1KBPA 4DR3E 3FGAC 4DR7E 2BQ8X 4YHHE 4V0VA 2ZOAA 3KWRA 2V83A 2FGGA 4UT3A 3K7WC 2LMZA 4WFTA 2BDXA 4LFCE 2N3HA 4F0ZA 5DNYA 3LL8A 3H63A 2V88A 5AASA 3J7AG 3VYYA 3RL4A 2VE7C 2NYLC 5B8IA 4ORBA 1QU6A 4OX9E 4JI5E 1XM7A 5IT9C 1XZWA 2O8AA 4H1SA 2UUAE 1WARA 3DF6A 3T1YE 3HPZA 2EWLA 2MC6A 4KBPA 4WPYA 2A22A 1WHNA 2NPPC 2DMYA 4Q28A 3VK6A 4JYAE 4DV2E 3H61A 2LE2A 2LBSB 1XMOE 1QHWA 2WDCA 1N33E 2LRSA 4O24A 4BMJA 1T4LB 3ADGA 2HYOA 4JI8E 3D03A 1JK7A 4IYPC 4OR9A 2DIXA 2YEQA 4GEQB 1W24A 4V0WA 4P78A 2B7TA 1U32A 2L6MA 2V87A 3EGHA 4DV6E 2KONA 4KHPE 4DMIA 2E1MA 2H36X 4JI3E 3RMPA 5INBA 2DFJA 3JTZA 1SU1A 1IBME 1V73A 4YY3E 2M7QA 4F54A 4FBKA 1WHQA 4K0KE 3H69A 1T4OA 2KKNA 1TCOA 4DV7E 4L5NC 2L8TA 5LL6R 3E7AA 1ZBQA 5F3WA 5C1VA 3IVEA 4B3SE 1XNQE 2B9DA 1HR0E 3ADIA 2QFPA 2IE3C 1S70A 1DI2A 2RS6A 3DSDA 4LF7E 3DW8C 3QFKA 2ZM6E 5AE1A 2ZO9B 1RC7A 1J26A 2DSYA 4KKZA 4I5LC 2DB2A 2VQEE 2M1SA 3CK2A 3IB8A 2EZ6A 3IWCA 1STUA 4B3RE 4WYQB 2VQFE 2YZTA 4LACC 1UILA 3IWDA 4TUIA 1HP1A 4B3ME 1S3LA 4J8ZA 4X8WA 3OMLA 3H09A 4LU9A 5ADZA 4MP0A 3FIGA 1II7A 3T1HE 3JU0A 4V0XA 4BS9A 1YZ9A 4O4KA 2USHA 5JPEA 5GTUA 2WZOA 3QFNA 2M4IA 2NUEA 5JPFA 1IBLE 4JI7E 2KHXA 2RS7A 2LTSA 4O5GA 4X65E 4P7DA 4ORCA 5IWAE 4O43A 1UHZA 3C5WC 3EGGA 2JY9A 5BR8E 1DQ3A 2VF1A 3H67A 1ZBTA 2WDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H68 A;  3QG5 C;  4IL1 A;  1MF8 A;  3KBP A;  1U32 A;  3C9F A;  3HVQ A;  4YKE A;  4JA7 A;  3EGH A;  4ZX2 A;  3QFM A;  4H2I A;  3ZTV A;  4DSY A;  2Z06 A;  2QFR A;  4UT3 B;  3JYF A;  3H60 A;  5INB A;  5JJT A;  2DFJ A;  1IT6 A;  3THO B;  3N5U A;  1SU1 A;  3P71 C;  1UTE A;  1V73 A;  3V4Y A;  1T70 A;  1OIE A;  3THN A;  4G9J A;  2O8G A;  4FBK A;  4J6O A;  3ZU0 A;  3H69 A;  2KKN A;  3H62 B;  1HPU A;  1TCO A;  2XMO A;  4UWQ A;  2R17 A;  4H1Y P;  2Q8U A;  1S3M A;  3H66 A;  4DT2 A;  2Z1A A;  3E7A A;  4JA9 A;  5F3W A;  4MOY A;  3IVE A;  4H2F A;  5C1V A;  3H64 A;  1S8E A;  4TUG A;  4FBW A;  4H2G A;  2WDD A;  4M0V A;  2AHD A;  4WWL A;  2QFP A;  3E7B A;  1M63 A;  2IE3 C;  1S70 A;  1FJM A;  1AUI A;  3DSD A;  1KBP A;  3DW8 C;  2WDE A;  3QFK A;  4HD0 A;  3FGA C;  4FCX A;  2HY1 A;  3RL3 A;  2HYP A;  4V0V A;  2BQ8 X;  1G5B A;  1HO5 A;  4FBQ A;  3RQZ A;  4KKZ A;  4ORA A;  4I5L C;  3CK2 A;  3IB8 A;  1S95 A;  4UT3 A;  3K7V C;  3K7W C;  3AUZ A;  2BDX A;  3PSO A;  4LAC C;  5IOH A;  1OI8 A;  1T71 A;  1S3N A;  3T1I A;  2Z72 A;  3TGH A;  4Q7F A;  3IB7 A;  2GJU A;  4TUI A;  1HP1 A;  3ICF A;  2YVT A;  2JOG A;  1S3L A;  4F0Z A;  5DNY A;  3LL8 A;  3H63 A;  4LU9 A;  4MP0 A;  5J28 A;  1NNW A;  3RL4 A;  2NYL C;  3AV0 A;  4ZVZ A;  1II7 A;  1UF3 A;  4LTY A;  4ORB A;  4V0X A;  5B8I A;  1USH A;  2IAE C;  1Z2W A;  4O4K A;  2USH A;  2NYM C;  1XM7 A;  5JPE A;  5GTU A;  1XZW A;  2P6B A;  3QFN A;  2O8A A;  4H1S A;  4NZV A;  2IE4 C;  5JPF A;  1WAR A;  2NXF A;  4I5N C;  2CV9 A;  3PSN A;  4O5G A;  1WAO 1;  1OID A;  3QFO A;  2A22 A;  4KBP A;  2NPP C;  2BCD A;  2QJC A;  4DHL A;  4ORC A;  3H61 A;  4XPN A;  1Z2X A;  5HPE A;  1QFC A;  1QHW A;  4MOV A;  4O43 A;  2WDC A;  3C5W C;  3EGG A;  5EQV A;  4O24 A;  2HYO A;  3H67 A;  1JK7 A;  3RL5 A;  4IYP C;  4OR9 A;  4UT2 A;  3GVE A;  2WDF A;  4B2O A;  2ZBM A;  3IVD A;  1W24 A;  3DSC A;  4V0W A;  4H2B A; 
#chains in the Genus database with same CATH topology
 1KYQ A;  2NUF A;  1NEI A;  5AE2 A;  1A1K A;  2JWO A;  2EM4 A;  4ZYH A;  3ZTV A;  4GKK E;  2L92 A;  4RH8 A;  3HXL A;  2ENH A;  2JOX A;  2EMZ A;  2EN4 A;  3TQM A;  1IT6 A;  3EPH A;  3P71 C;  1UTE A;  4JI6 E;  2NA2 A;  2YRM A;  4KZS A;  2UUB E;  2UXC E;  4OOG C;  2MKN A;  2ELY A;  4WSG A;  4UWQ A;  4DR5 E;  2R17 A;  1AH5 A;  2Q8U A;  1S3M A;  3H66 A;  2EM6 A;  2Z1A A;  1SFE A;  4H2F A;  2DGC A;  3LML A;  2LUP B;  2YSP A;  2YTN A;  4NHR A;  4M0V A;  1WRJ A;  4WWL A;  4I8O A;  1BBO A;  1XNR E;  1AUI A;  2L3J A;  2WDE A;  2LT7 A;  2HY1 A;  2G7H A;  3RL3 A;  1G5B A;  4F9C B;  4FBQ A;  5A2Q C;  3RQZ A;  2JVA A;  4AQY E;  1AAY A;  1QNT A;  1WXR A;  2EL4 A;  1N34 E;  2LTR A;  2EOE A;  5KL7 A;  5KL6 A;  5T6J A;  1S95 A;  1SR9 A;  3K7V C;  4X64 E;  2YTQ A;  1L4S A;  2HJJ A;  4JI2 E;  3AUZ A;  5IOH A;  1X49 A;  3PSO A;  2K7I A;  1T71 A;  3T1I A;  4MLQ A;  2F4V E;  4DUZ E;  2Z72 A;  3TGH A;  2EN7 A;  4Q7F A;  1EH6 A;  2GJU A;  1PJT A;  2D9H A;  2JOG A;  1LLM C;  3VYX A;  4R2S A;  2L3C A;  2FV4 B;  1NNW A;  4F6M A;  4LF6 E;  2YTE A;  5KL4 A;  1YUI A;  4LTY A;  1UF3 A;  2YT4 A;  2IAE C;  2EOO A;  1Z2W A;  2WBT A;  5LMU E;  2CPN A;  2EM9 A;  1ZR9 A;  4L8N A;  4NZV A;  2IE4 C;  2DLK A;  3C4T A;  1FKA E;  4I5N C;  2CV9 A;  2N3G A;  2E5L E;  1WAO 1;  2EM2 A;  1HNX E;  2EPZ A;  1OID A;  2MDG A;  2BCD A;  3MSW A;  4DUY E;  3VHT B;  2EMG A;  4R2P A;  3F6G A;  1X47 A;  2EM8 A;  4F2J C;  1QFC A;  2BB8 A;  4MOV A;  2EL6 A;  2K4V A;  2RSM A;  5EQV A;  1YSA C;  1YYW A;  2EPK X;  5FLX C;  2L2N A;  4LF8 E;  5KL5 A;  2F8B A;  4DR2 E;  3RL5 A;  1HNZ E;  4BCA A;  2CSH A;  2JYA A;  4MLV A;  5LMN E;  3GVE A;  4B2O A;  4FK5 C;  2YSO A;  1A1G A;  2LVH A;  2J7J A;  2YU5 A;  2N8X A;  3MHH C;  3DSC A;  2EMI A;  2DXN A;  2JR1 A;  2EMA A;  2JOB A;  2LJU A;  3QG5 C;  2KOU A;  2R1F A;  4M30 A;  1MF8 A;  1TN9 A;  4LFA E;  4JA7 A;  2RQL A;  4ZX2 A;  1GTK A;  1FJG E;  2QFR A;  4UT3 B;  2EP3 A;  2M9A A;  4DR1 E;  4DV0 E;  3FLO A;  3H60 A;  5JJT A;  3F6H A;  3LLH A;  4LF4 E;  3THO B;  4LFB E;  3N5U A;  3C6M A;  4B3T E;  1IQS A;  2EN3 A;  2EPO A;  2L33 A;  4GKJ E;  3THN A;  4DV3 E;  1EKZ A;  4JI1 E;  2EN6 A;  4J6O A;  1A1I A;  2EMF A;  3ZU0 A;  2EOF A;  1TF3 A;  2XMO A;  2L2M A;  1RQ0 A;  4DT2 A;  3ECR A;  2YTI A;  4F9B B;  2EM3 A;  1N36 E;  4JV5 E;  1T38 A;  2GHF A;  2V86 A;  4TUG A;  4DV5 E;  2WDD A;  1GQE A;  2IHR 1;  3J7Y p;  2EPL X;  1JK2 A;  2YPN A;  3J81 C;  1FJM A;  2ENA A;  2YRH A;  2JP9 A;  1T4N A;  2LJH A;  4HD0 A;  2EOY A;  4FCX A;  3HTX A;  1YYK A;  2HYP A;  3J80 C;  1HO5 A;  4WXC A;  4ORA A;  3P1X A;  5AE3 A;  4X62 E;  4R2D A;  2EM5 A;  4M9V C;  2YTG A;  1KJK A;  3DJW A;  3JAM C;  5KL3 A;  5CFF E;  2LCE A;  2HHH E;  2V89 A;  4JI0 E;  2MC5 A;  1T39 A;  2EOJ A;  1OI8 A;  1YPN A;  1S3N A;  3IB7 A;  2EPP A;  3ICF A;  2YVT A;  1X6F A;  1PKP A;  2UU9 E;  2MDR A;  3K6Q A;  2EQ0 A;  4LF5 E;  5J28 A;  2CT1 A;  4BC7 A;  3AV0 A;  1PDA A;  1Z1B A;  4ZVZ A;  2ODR C;  1XMQ E;  1USH A;  1A1F A;  2NYM C;  2P6B A;  1N32 E;  2ODR D;  1P47 A;  2EPC A;  3EPL A;  1YYO A;  2NXF A;  1O0W A;  1N3G A;  2YWQ A;  2B3T B;  3PSN A;  4DV1 E;  3QFO A;  5A6B D;  2FTX B;  3E0J A;  2QJC A;  4DHL A;  4DKK A;  2HC5 A;  2YTJ A;  4XPN A;  1Z2X A;  4X66 E;  5HPE A;  2L2K B;  1J5E E;  4JI4 E;  1I94 E;  2UXB E;  4X9J A;  3EQ1 A;  2EOR A;  2GPI A;  1ZAA C;  4UT2 A;  2I9I A;  3HQ1 A;  2ZBM A;  3IVD A;  3ADJ A;  2EM0 A;  4R03 A;  1EH8 A;  2RTX A;  4H2B A;  4MOY A;  1DGC A;  3H68 A;  4IL1 A;  2DLQ A;  3C4B A;  4NXN E;  3KBP A;  4YKE A;  3C9F A;  3HVQ A;  3ZOQ B;  2LUQ A;  4F9A B;  1HNW E;  2YRK A;  4M2Z A;  3QFM A;  4H2I A;  4DSY A;  2NUG A;  2B7V A;  2UXD E;  2Z06 A;  4NXM E;  3JYF A;  2VRD A;  1X48 A;  4LF9 E;  2EPA A;  4R8O A;  3V4Y A;  2EOM A;  5AC4 A;  1YUJ A;  4DR4 E;  1T70 A;  1OIE A;  2EQ3 A;  4IS1 C;  4DR6 E;  4BC9 A;  4G9J A;  1X3C A;  3IWB A;  2JPA A;  4DV4 E;  2O8G A;  3ADL A;  2V85 A;  1A1J A;  4WSP A;  3H62 B;  2V8Q B;  1HPU A;  3OTO E;  4H1Y P;  5A6A A;  1GZ6 A;  4R2R A;  2DXL A;  4JA9 A;  3BBG A;  4BHC A;  2EMX A;  3H64 A;  2CTD A;  1S8E A;  4FBW A;  4H2G A;  2EOS A;  2I13 A;  4BHB A;  2AHD A;  3E7B A;  1M63 A;  1UBD C;  2YTD A;  3HPS A;  2UUC E;  1IBK E;  4BBY A;  1KBP A;  4DR3 E;  2DRP A;  3FGA C;  2YTP A;  1A1L A;  2EL5 A;  2EPM X;  4DR7 E;  2BQ8 X;  4YHH E;  4V0V A;  2EE8 A;  1G2F C;  3KWR A;  2ZOA A;  4IJD A;  2DMI A;  4R2Q A;  2V83 A;  4HTG A;  1UN6 B;  5AC5 A;  2EMH A;  2FGG A;  4KWY A;  4UT3 A;  2EMY A;  3K7W C;  2LMZ A;  2YTO A;  4WFT A;  4WX9 A;  2EMW A;  2BDX A;  3EPJ A;  5KL2 A;  2EML A;  1EH7 A;  1X6H A;  4LFC E;  2N3H A;  1WJP A;  4F0Z A;  2EOQ A;  2EPX A;  2LV2 A;  5DNY A;  1MGT A;  1JK1 A;  3LL8 A;  3H63 A;  3L00 A;  1NCS A;  4N4R B;  2V88 A;  5AAS A;  3J7A G;  3EPK A;  3VYY A;  2VE7 C;  3RL4 A;  2NYL C;  5B8I A;  4ORB A;  1QU6 A;  1A1H A;  4JI5 E;  4OX9 E;  1XM7 A;  5IT9 C;  1XZW A;  2O8A A;  4H1S A;  2UUA E;  1WAR A;  3M99 B;  3DF6 A;  3T1Y E;  3HPZ A;  2EWL A;  2LO3 A;  2MC6 A;  4KBP A;  4WPY A;  2A22 A;  1WHN A;  2NPP C;  2DMY A;  4Q28 A;  3VK6 A;  4JYA E;  4DV2 E;  3H61 A;  2LE2 A;  2LBS B;  1XMO E;  1QHW A;  2WDC A;  4O24 A;  2LRS A;  1N33 E;  2A25 A;  2EQ1 A;  4BMJ A;  1T4L B;  3ADG A;  2HYO A;  4JI8 E;  3D03 A;  1JK7 A;  4IYP C;  4WXD A;  1RMD A;  4OR9 A;  5IV8 B;  2DIX A;  2E72 A;  2YEQ A;  4GEQ B;  4Q35 B;  1W24 A;  2HGH A;  1X5W A;  4V0W A;  1X6E A;  4P78 A;  3BF2 A;  2B7T A;  1U32 A;  1PJQ A;  2L6M A;  2V87 A;  2RPC A;  3EGH A;  4DV6 E;  2KON A;  4KHP E;  1PJS A;  4DMI A;  5A69 A;  2E1M A;  2H36 X;  4JI3 E;  3RMP A;  2EOI A;  5INB A;  1ZU1 A;  2DFJ A;  3JTZ A;  1G2D C;  1SU1 A;  1IBM E;  1V73 A;  4YY3 E;  4F6N A;  2EMC A;  2ADR A;  5A6K A;  2EPR A;  2M7Q A;  4F54 A;  4FBK A;  1WHQ A;  4K0K E;  3H69 A;  1T4O A;  4R2E A;  2KKN A;  1TCO A;  4DV7 E;  4L5N C;  2EOX A;  5TSE A;  2L8T A;  5LL6 R;  3E7A A;  4RHB B;  1ZBQ A;  5F3W A;  5C1V A;  3IVE A;  4B3S E;  3KZY A;  1XNQ E;  2B9D A;  1HR0 E;  2ENC A;  3ADI A;  2QFP A;  1MEY C;  2IE3 C;  4R2C A;  1F2I G;  1S70 A;  1DI2 A;  2BBG A;  2EMK A;  2RS6 A;  4GZN C;  2GLI A;  4LF7 E;  3DSD A;  3DW8 C;  1TF6 A;  3QFK A;  2ZM6 E;  5AE1 A;  2ZO9 B;  1RC7 A;  2EM7 A;  1J26 A;  2DSY A;  2WCC 3;  1BBG A;  4KKZ A;  4I5L C;  2DB2 A;  2VQE E;  3C6K A;  2M1S A;  3CK2 A;  3IB8 A;  2EZ6 A;  3IWC A;  2MKD A;  1STU A;  2EPU A;  4B3R E;  2WBU A;  4WYQ B;  2VQF E;  2YZT A;  4LAC C;  1UIL A;  3IWD A;  1IMU A;  2NAB A;  1YFH A;  4ZYE A;  4TUI A;  3UK3 C;  1HP1 A;  4B3M E;  2EN8 A;  1S3L A;  2ELZ A;  4J8Z A;  4X8W A;  1BB8 A;  3OML A;  1B69 A;  3H09 A;  4LU9 A;  5ADZ A;  4MP0 A;  2EN1 A;  2R76 A;  3FIG A;  4ZYD A;  2WBS A;  3JU0 A;  3T1H E;  1II7 A;  2EPN A;  4V0X A;  4BS9 A;  1YZ9 A;  4O4K A;  2USH A;  5JPE A;  5GTU A;  2WZO A;  3BID A;  2YTF A;  2M4I A;  3QFN A;  2NUE A;  5JPF A;  1IBL E;  4JI7 E;  2KHX A;  2EOH A;  2EOZ A;  2RS7 A;  2LTS A;  5A6J A;  5LLQ A;  4O5G A;  1IQO A;  5A6B A;  2PRT A;  4HEI A;  2EMB A;  4X65 E;  2EN2 A;  4P7D A;  5IXM B;  4ORC A;  4R2A A;  2JXP A;  2RSI A;  5IWA E;  4O43 A;  1UHZ A;  3BGH A;  3C5W C;  3EGG A;  4ZYG A;  2JY9 A;  5BR8 E;  2EJ4 A;  1DQ3 A;  2VF1 A;  3H67 A;  2YU8 A;  1ZBT A;  2WDF A;  3KZZ A;  3MHS C; 
#chains in the Genus database with same CATH homology
 2NUF A;  5AE2 A;  2JWO A;  3ZTV A;  4GKK E;  2L92 A;  3HXL A;  2JOX A;  1IT6 A;  3P71 C;  1UTE A;  4JI6 E;  2NA2 A;  4KZS A;  2UUB E;  2UXC E;  4OOG C;  4UWQ A;  4DR5 E;  2R17 A;  2Q8U A;  1S3M A;  3H66 A;  2Z1A A;  4H2F A;  3LML A;  2LUP B;  4M0V A;  4WWL A;  4I8O A;  1XNR E;  1AUI A;  2L3J A;  2WDE A;  2HY1 A;  2G7H A;  3RL3 A;  1G5B A;  4F9C B;  4FBQ A;  5A2Q C;  3RQZ A;  2JVA A;  4AQY E;  1WXR A;  1N34 E;  2LTR A;  5T6J A;  1S95 A;  1SR9 A;  3K7V C;  4X64 E;  4JI2 E;  3AUZ A;  5IOH A;  1X49 A;  3PSO A;  1T71 A;  3T1I A;  2F4V E;  4DUZ E;  2Z72 A;  3TGH A;  4Q7F A;  2GJU A;  2JOG A;  3VYX A;  2L3C A;  2FV4 B;  1NNW A;  4LF6 E;  4LTY A;  1UF3 A;  2YT4 A;  2IAE C;  1Z2W A;  5LMU E;  2CPN A;  4L8N A;  2IE4 C;  4NZV A;  3C4T A;  1FKA E;  4I5N C;  2CV9 A;  2N3G A;  2E5L E;  1WAO 1;  1HNX E;  1OID A;  2BCD A;  3MSW A;  4DUY E;  3F6G A;  1X47 A;  1QFC A;  4MOV A;  2K4V A;  2RSM A;  5EQV A;  1YYW A;  5FLX C;  2L2N A;  4LF8 E;  2F8B A;  4DR2 E;  3RL5 A;  1HNZ E;  4BCA A;  5LMN E;  3GVE A;  4B2O A;  3DSC A;  2DXN A;  2JOB A;  2JR1 A;  4M30 A;  3QG5 C;  2KOU A;  1MF8 A;  4LFA E;  4JA7 A;  4ZX2 A;  1FJG E;  2QFR A;  4UT3 B;  4DR1 E;  4DV0 E;  3FLO A;  3H60 A;  5JJT A;  3F6H A;  3LLH A;  4LF4 E;  3THO B;  4LFB E;  3N5U A;  4B3T E;  2L33 A;  4GKJ E;  3THN A;  4DV3 E;  1EKZ A;  4JI1 E;  4J6O A;  3ZU0 A;  2XMO A;  2L2M A;  1RQ0 A;  4DT2 A;  4F9B B;  1N36 E;  4JV5 E;  2V86 A;  4TUG A;  4DV5 E;  2WDD A;  1GQE A;  2IHR 1;  3J7Y p;  3J81 C;  1FJM A;  1T4N A;  2LJH A;  4HD0 A;  4FCX A;  3HTX A;  1YYK A;  2HYP A;  3J80 C;  1HO5 A;  4ORA A;  3P1X A;  5AE3 A;  4X62 E;  3DJW A;  3JAM C;  5CFF E;  2HHH E;  2V89 A;  4JI0 E;  2MC5 A;  1OI8 A;  1S3N A;  3IB7 A;  3ICF A;  2YVT A;  1PKP A;  2UU9 E;  2MDR A;  3K6Q A;  4LF5 E;  5J28 A;  4BC7 A;  3AV0 A;  4ZVZ A;  2ODR C;  1XMQ E;  1USH A;  2NYM C;  2P6B A;  1N32 E;  2ODR D;  1YYO A;  2NXF A;  1O0W A;  3PSN A;  2B3T B;  4DV1 E;  3QFO A;  2FTX B;  3E0J A;  2QJC A;  4DHL A;  4DKK A;  4XPN A;  1Z2X A;  4X66 E;  5HPE A;  2L2K B;  1J5E E;  4JI4 E;  1I94 E;  2UXB E;  4UT2 A;  3HQ1 A;  2ZBM A;  3IVD A;  3ADJ A;  4R03 A;  2RTX A;  4H2B A;  4MOY A;  3H68 A;  4IL1 A;  4NXN E;  3C4B A;  3KBP A;  4YKE A;  3C9F A;  3HVQ A;  3ZOQ B;  2LUQ A;  4F9A B;  1HNW E;  4M2Z A;  3QFM A;  4H2I A;  4DSY A;  2NUG A;  2B7V A;  2UXD E;  2Z06 A;  4NXM E;  3JYF A;  1X48 A;  4LF9 E;  4R8O A;  3V4Y A;  1T70 A;  4DR4 E;  1OIE A;  4DR6 E;  4BC9 A;  4G9J A;  3IWB A;  4DV4 E;  2O8G A;  3ADL A;  2V85 A;  4WSP A;  3H62 B;  2V8Q B;  1HPU A;  3OTO E;  4H1Y P;  1GZ6 A;  2DXL A;  4JA9 A;  3H64 A;  1S8E A;  4FBW A;  4H2G A;  2AHD A;  3E7B A;  1M63 A;  3HPS A;  2UUC E;  1IBK E;  4BBY A;  1KBP A;  4DR3 E;  3FGA C;  4DR7 E;  2BQ8 X;  4YHH E;  4V0V A;  2ZOA A;  3KWR A;  2V83 A;  2FGG A;  4UT3 A;  3K7W C;  2LMZ A;  4WFT A;  2BDX A;  4LFC E;  2N3H A;  4F0Z A;  5DNY A;  3LL8 A;  3H63 A;  2V88 A;  5AAS A;  3J7A G;  3VYY A;  3RL4 A;  2VE7 C;  2NYL C;  5B8I A;  4ORB A;  1QU6 A;  4OX9 E;  4JI5 E;  1XM7 A;  5IT9 C;  1XZW A;  2O8A A;  4H1S A;  2UUA E;  1WAR A;  3DF6 A;  3T1Y E;  3HPZ A;  2EWL A;  2MC6 A;  4KBP A;  4WPY A;  2A22 A;  1WHN A;  2NPP C;  2DMY A;  4Q28 A;  3VK6 A;  4JYA E;  4DV2 E;  3H61 A;  2LE2 A;  2LBS B;  1XMO E;  1QHW A;  2WDC A;  1N33 E;  2LRS A;  4O24 A;  4BMJ A;  1T4L B;  3ADG A;  2HYO A;  4JI8 E;  3D03 A;  1JK7 A;  4IYP C;  4OR9 A;  2DIX A;  2YEQ A;  4GEQ B;  1W24 A;  4V0W A;  4P78 A;  2B7T A;  1U32 A;  2L6M A;  2V87 A;  3EGH A;  4DV6 E;  2KON A;  4KHP E;  4DMI A;  2E1M A;  2H36 X;  4JI3 E;  3RMP A;  5INB A;  2DFJ A;  3JTZ A;  1SU1 A;  1IBM E;  1V73 A;  4YY3 E;  2M7Q A;  4F54 A;  4FBK A;  1WHQ A;  4K0K E;  3H69 A;  1T4O A;  2KKN A;  1TCO A;  4DV7 E;  4L5N C;  2L8T A;  5LL6 R;  3E7A A;  1ZBQ A;  5F3W A;  5C1V A;  3IVE A;  4B3S E;  1XNQ E;  2B9D A;  1HR0 E;  3ADI A;  2QFP A;  2IE3 C;  1S70 A;  1DI2 A;  2RS6 A;  3DSD A;  4LF7 E;  3DW8 C;  3QFK A;  2ZM6 E;  5AE1 A;  2ZO9 B;  1RC7 A;  1J26 A;  2DSY A;  4KKZ A;  4I5L C;  2DB2 A;  2VQE E;  2M1S A;  3CK2 A;  3IB8 A;  2EZ6 A;  3IWC A;  1STU A;  4B3R E;  4WYQ B;  2VQF E;  2YZT A;  4LAC C;  1UIL A;  3IWD A;  4TUI A;  1HP1 A;  4B3M E;  1S3L A;  4J8Z A;  4X8W A;  3OML A;  3H09 A;  4LU9 A;  5ADZ A;  4MP0 A;  3FIG A;  1II7 A;  3T1H E;  3JU0 A;  4V0X A;  4BS9 A;  1YZ9 A;  4O4K A;  2USH A;  5JPE A;  5GTU A;  2WZO A;  3QFN A;  2M4I A;  2NUE A;  5JPF A;  1IBL E;  4JI7 E;  2KHX A;  2RS7 A;  2LTS A;  4O5G A;  4X65 E;  4P7D A;  4ORC A;  5IWA E;  4O43 A;  1UHZ A;  3C5W C;  3EGG A;  2JY9 A;  5BR8 E;  1DQ3 A;  2VF1 A;  3H67 A;  1ZBT A;  2WDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...