3AUZA

Crystal structure of mre11 with manganese
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
316
structure length
316
Chain Sequence
b'RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
total genus 99
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3auzA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3auzA01
1OIDA 4UT2A 1T71A 1S3LA 3ICFA 3H60A 1S3MA 4JA7A 4LACC 2WDEA 4J6OA 4MP0A 2AHDA 4O43A 4MOVA 5GTUA 4IYPC 4ORAA 2GJUA 4XPNA 2HYPA 3QFOA 2Z72A 2Q8UA 2NYLC 4ORBA 5C1VA 1IT6A 2BQ8X 2HY1A 1II7A 3QFKA 4LTYA 4O4KA 5DNYA 3AV0A 1UTEA 3TGHA 4TUGA 5JJTA 3H63A 5HPEA 3DSCA 1HP1A 1M63A 3QG5C 4MOYA 1T70A 4M0VA 3THOB 3RQZA 4IL1A 2R17A 3KBPA 2P6BA 4O24A 1XZWA 3THNA 4KBPA 4HD0A 3DW8C 4H1YP 4V0WA 2A22A 1AUIA 4WWLA 2BCDA 2QFRA 3AUZA 4FBKA 3GVEA 2DFJA 3JYFA 4Q7FA 3E7AA 2CV9A 2IAEC 1QHWA 3H64A 3K7WC 3E7BA 1HO5A 3QFNA 1HPUA 3IVDA 1TCOA 3P71C 3QFMA 5IOHA 5J28A 3H69A 4H2FA 4FBQA 4ZX2A 1NNWA 2O8AA 5B8IA 3RL4A 5JPFA 4JA9A 4G9JA 3RL3A 2HYOA 1FJMA 4DHLA 1WAO1 2QJCA 3IVEA 2Z06A 2IE3C 2JOGA 3C5WC 3T1IA 4OR9A 4V0XA 4UT3A 2Z1AA 4TUIA 4UWQA 5F3WA 5JPEA 1Z2XA 3LL8A 3IB8A 1MF8A 2USHA 1S8EA 3K7VC 1XM7A 4I5LC 3HVQA 4H2IA 4H2GA 3H68A 1G5BA 3CK2A 3ZTVA 3H67A 1USHA 2BDXA 2KKNA 4LU9A 4NZVA 4F0ZA 3IB7A 4FCXA 1S70A 1UF3A 4KKZA 3H61A 5EQVA 1SU1A 2QFPA 1W24A 4I5NC 2WDCA 3RL5A 2YVTA 3H66A 4H1SA 2IE4C 1S95A 2ZBMA 3EGHA 3FGAC 4YKEA 2NXFA 2WDFA 3PSOA 4ORCA 1WARA 4DSYA 4V0VA 3V4YA 2NYMC 4H2BA 4ZVZA 3EGGA 4DT2A 1U32A 1OI8A 4UT3B 3DSDA 2XMOA 1S3NA 4B2OA 4O5GA 1JK7A 1KBPA 5INBA 3PSNA 1OIEA 2WDDA 3C9FA 2NPPC 3H62B 1V73A 1Z2WA 3N5UA 1QFCA 4FBWA 3ZU0A 2O8GA
chains in the Genus database with same CATH superfamily
1XNRE 4JI8E 2GLIA 1HNXE 1T71A 1IQSA 4OX9E 4JA7A 2LMZA 2V8QB 3C6KA 1HR0E 2L6MA 2EOYA 2AHDA 2LVHA 2N3HA 2ELYA 5TSEA 4LF8E 1A1LA 2NYLC 4BHBA 4DMIA 1IT6A 2HY1A 1II7A 2DXLA 1X48A 2MC6A 2MKNA 1A1GA 2EPZA 5JJTA 4RHBB 1EH7A 3DSCA 1HP1A 1M63A 4N4RB 3QG5C 4JI5E 3JAMC 1X47A 1MGTA 2I9IA 2EP3A 1UHZA 2LTRA 2L33A 1HNZE 2YT4A 2VRDA 3KZZA 5KL7A 4KBPA 2ZM6E 4F6NA 2DMIA 2YEQA 4H1YP 4V0WA 2N3GA 2V85A 4WWLA 1DQ3A 2MC5A 1IBME 1N32E 3HQ1A 1NEIA 2CV9A 4DR6E 2YTGA 3H64A 2M4IA 4JV5E 2LV2A 3IWDA 2YTJA 1HPUA 2EPXA 2LUQA 4DV1E 5J28A 2L2MA 4HTGA 4FBQA 4ZX2A 5T6JA 2B7TA 5B8IA 2FV4B 4YHHE 4G9JA 2L92A 1GTKA 4DR2E 5AC5A 3J7Yp 2HYOA 2EN1A 3ADIA 2RTXA 3IVEA 2EPRA 2YWQA 2JOGA 2YTDA 1YSAC 4L8NA 1J26A 4BMJA 5JPEA 3IB8A 3T1YE 4M30A 4DV3E 3KZYA 1S8EA 4DV0E 1YYKA 2GPIA 4X65E 3H68A 2EPOA 3OTOE 1RQ0A 1BB8A 1BBGA 3C6MA 2WBUA 2QFPA 4I5NC 4Q28A 4JI7E 1TN9A 4H1SA 2IE4C 4MLVA 1S95A 2EQ1A 2WCC3 2ZBMA 3EGHA 1ZBQA 2A25A 4NXNE 1F2IG 1UILA 3EGGA 3LMLA 4UT3B 3DSDA 2EM0A 1AAYA 1T38A 4HEIA 1OIEA 2B9DA 3L00A 4WSGA 1ZBTA 5KL6A 4WX9A 2I13A 4X66E 3ADJA 2EPCA 4DUYE 4JI6E 1A1HA 2EN4A 1S3LA 1A1JA 3ICFA 2HHHE 5LLQA 2JXPA 2V83A 3E0JA 3ZOQB 2YU5A 4O43A 2LO3A 1ZAAC 2EE8A 2NUEA 4ORAA 2GJUA 2EPMX 5AASA 3VYXA 3QFOA 4X8WA 3HPSA 4LF7E 2Z72A 2Q8UA 2EOSA 5LL6R 4IS1C 2DMYA 2EOZA 3QFKA 2YRKA 4O4KA 2EMAA 2ODRD 3HTXA 1UTEA 4J8ZA 5HPEA 4AQYE 5KL2A 1RMDA 4MOYA 2V88A 3K6QA 2UUBE 2EMXA 1T70A 1T4OA 4IL1A 2R17A 2EMYA 4YY3E 1WJPA 3ECRA 3THNA 1XZWA 2M1SA 3H09A 5IXMB 1G2FC 2CTDA 2BCDA 1X6FA 2EM4A 4BC9A 2DFJA 2RSIA 2YRMA 1UBDC 4LFBE 2HC5A 2MDRA 3K7WC 4F54A 3E7BA 4B3ME 2YRHA 1IBLE 3IVDA 2KHXA 2YTNA 2CT1A 5IOHA 3J80C 2EM5A 2EPAA 2EL6A 2LTSA 1A1IA 4X64E 2O8AA 3RL4A 5JPFA 4DR7E 4JA9A 3RL3A 4R2QA 2DRPA 2EJ4A 4K0KE 1STUA 4LF5E 1PDAA 1PKPA 3EPJA 2EOXA 4KZSA 2Z1AA 1O0WA 2V87A 2ZO9B 2N8XA 4DKKA 2VQFE 2L8TA 4WSPA 2EPLX 3VHTB 2EWLA 5A6BA 5F3WA 1EKZA 1TF6A 3LL8A 4JYAE 1EH6A 3T1HE 1XM7A 2LJHA 3F6GA 2JY9A 3HVQA 1MEYC 3CK2A 4DR4E 1UN6B 4LU9A 5CFFE 3DJWA 1IBKE 1USHA 2BDXA 2KKNA 2GHFA 2B3TB 2EOFA 3EPKA 1YYWA 4GEQB 4KKZA 4BHCA 2L3JA 5EQVA 2EPKX 1W24A 3EPHA 4NHRA 3RMPA 4R2SA 2EMZA 1HNWE 2M9AA 5IWAE 3H66A 2DIXA 3FIGA 2EN6A 3FGAC 2JYAA 2NXFA 4GKKE 4P7DA 1EH8A 4ZYGA 2L2NA 2NUFA 1X6HA 3V4YA 2LRSA 3P1XA 4H2BA 4ZVZA 4DT2A 2YPNA 1OI8A 1U32A 2XMOA 2MKDA 3JTZA 1L4SA 1JK7A 1N36E 1T39A 2EPNA 2EZ6A 2WDDA 3C9FA 2EOQA 3EQ1A 1WXRA 1A1KA 4DV2E 2EM9A 3H62B 3N5UA 4FBWA 2YTIA 2UXDE 2CPNA 4LFCE 1TF3A 1OIDA 2RSMA 2EOIA 2WBSA 1S3MA 2BBGA 2M7QA 2WDEA 4J6OA 2EOMA 4R03A 2ELZA 5GTUA 4MOVA 4B3SE 4IYPC 2EMWA 2K4VA 1WRJA 4F9AB 4XPNA 5IT9C 2EMFA 2HYPA 4KHPE 5AC4A 2R76A 4ZYHA 2RS6A 1YUJA 3KWRA 2EN8A 1SFEA 2E5LE 2ENCA 2BQ8X 1IMUA 4B3TE 4LTYA 4BBYA 5DNYA 1T4LB 3AV0A 3TGHA 3H63A 1Z1BA 1SR9A 2VE7C 2YZTA 2DXNA 1N34E 4IJDA 3RQZA 4F9CB 1A1FA 2BB8A 5A6JA 4WXDA 2A22A 5A2QC 3D03A 2EQ0A 2QFRA 2PRTA 4FBKA 3GVEA 3JYFA 2RPCA 4Q7FA 2K7IA 3E7AA 2YTPA 2IAEC 1QHWA 2LE2A 3OMLA 3DF6A 1HO5A 3BIDA 5KL4A 1YPNA 1TCOA 3QFMA 2YTFA 3H69A 2ODRC 4DR3E 5AE1A 1X6EA 2EN2A 4JI1E 1NNWA 2ENHA 5AE2A 2NABA 1XMOE 2ZOAA 3C4BA 4DHLA 2DLQA 2IHR1 2EM3A 3VK6A 5FLXC 2EOOA 1WAO1 1BBOA 1P47A 2DGCA 1AH5A 4LF9E 2Z06A 2IE3C 4DV4E 2EMBA 4OR9A 4RH8A 4UT3A 2JR1A 5KL3A 2EMKA 3FLOA 4JI3E 4R2DA 1QNTA 1MF8A 2USHA 3VYYA 2FTXB 2WBTA 5BR8E 2UXCE 1KJKA 4H2IA 1G5BA 4R2PA 2L3CA 4NZVA 3H67A 4F0ZA 2DSYA 1S70A 1UF3A 3H61A 2R1FA 2JOXA 1SU1A 4GZNC 1LLMC 2EM7A 3RL5A 4L5NC 4BS9A 4YKEA 2F4VE 4R2EA 2LCEA 3PSOA 1NCSA 1JK1A 4LF6E 1WARA 2EOJA 2EL4A 2JOBA 3M99B 4MLQA 2J7JA 2NYMC 1ZU1A 1GZ6A 2EMHA 3C4TA 4DR5E 3MHSC 2EOEA 2ENAA 4B3RE 3ADLA 4R2RA 4O5GA 1PJTA 1KBPA 3BGHA 3LLHA 2EMLA 2LBSB 5A6AA 4ZYDA 2NPPC 1G2DC 4DUZE 3MHHC 4WPYA 2E72A 1V73A 2DLKA 1Z2WA 2D9HA 3ZU0A 2L2KB 2O8GA 2EPPA 4UT2A 1X3CA 3H60A 2FGGA 2ADRA 4LACC 2RQLA 1RC7A 2NUGA 4MP0A 4R8OA 1KYQA 2EN3A 2DB2A 1WHQA 2MDGA 2V89A 5LMUE 2UU9E 2KOUA 1B69A 2G7HA 4ORBA 2E1MA 3F6HA 2UUAE 5C1VA 2WZOA 4F6MA 4X9JA 2EMCA 3BBGA 4OOGC 4TUGA 2H36X 1DI2A 2RS7A 1I94E 5IV8B 4I8OA 4M0VA 3THOB 2LT7A 1DGCA 1PJSA 3IWCA 1N3GA 4LF4E 4JI2E 2P6BA 4O24A 3KBPA 1XNQE 2HJJA 5A6BD 1XMQE 4R2CA 3TQMA 4HD0A 3DW8C 1YZ9A 1ZR9A 1AUIA 1X49A 3IWBA 3AUZA 5ADZA 2CSHA 2YSOA 4Q35B 1QU6A 2UXBE 2YTQA 2EMIA 4DV5E 3QFNA 3P71C 2NA2A 3ADGA 3UK3C 2EM6A 2VF1A 3J7AG 4H2FA 1PJQA 2EORA 4KWYA 4FK5C 1JK2A 2HGHA 5KL5A 4P78A 1FJMA 4WYQB 5LMNE 2F8BA 2QJCA 4M9VC 4M2ZA 1FJGE 3J81C 1GQEA 3C5WC 3T1IA 1IQOA 4WXCA 2V86A 4ZYEA 4DV7E 1T4NA 4V0XA 4R2AA 2JWOA 2EM8A 2EL5A 4TUIA 1YUIA 4UWQA 2LJUA 4X62E 1Z2XA 3K7VC 4I5LC 2YTEA 3JU0A 3MSWA 4H2GA 3ZTVA 2EMGA 4DR1E 2JVAA 3IB7A 4FCXA 2EN7A 5AE3A 1N33E 1X5WA 2WDCA 4F9BB 4JI0E 4WFTA 2YTOA 1FKAE 2YVTA 4JI4E 2B7VA 2EQ3A 3EPLA 2WDFA 4ORCA 2JPAA 1YFHA 4DSYA 5A69A 4V0VA 4F2JC 2EPUA 2EOHA 2VQEE 4LFAE 4BC7A 2YSPA 3BF2A 1J5EE 4GKJE 4NXME 2UUCE 1S3NA 4B2OA 3HPZA 3HXLA 2YU8A 5INBA 3PSNA 2EM2A 4BCAA 5A6KA 1YYOA 1WHNA 4DV6E 2KONA 2JP9A 1QFCA 2LUPB
chains in the Genus database with same CATH topology
1XNRE 4JI8E 1HNXE 1T71A 4OX9E 4JA7A 2LMZA 2V8QB 1HR0E 2L6MA 2AHDA 2N3HA 4LF8E 2NYLC 4DMIA 1IT6A 2HY1A 1II7A 2DXLA 1X48A 2MC6A 5JJTA 3DSCA 1M63A 1HP1A 4JI5E 3QG5C 3JAMC 1X47A 1UHZA 2LTRA 2L33A 1HNZE 2YT4A 4KBPA 2ZM6E 2YEQA 4H1YP 4V0WA 2N3GA 2V85A 4WWLA 1DQ3A 2MC5A 1IBME 1N32E 3HQ1A 2CV9A 4DR6E 3H64A 2M4IA 4JV5E 3IWDA 1HPUA 2LUQA 4DV1E 5J28A 2L2MA 4FBQA 4ZX2A 5T6JA 2B7TA 5B8IA 2FV4B 4YHHE 4G9JA 2L92A 4DR2E 2HYOA 3J7Yp 3ADIA 2RTXA 3IVEA 2JOGA 4L8NA 1J26A 4BMJA 5JPEA 3IB8A 3T1YE 4M30A 4DV3E 1S8EA 4DV0E 1YYKA 4X65E 3H68A 3OTOE 1RQ0A 2QFPA 4I5NC 4Q28A 4JI7E 4H1SA 2IE4C 1S95A 2ZBMA 3EGHA 1ZBQA 4NXNE 1UILA 3EGGA 3LMLA 4UT3B 3DSDA 1OIEA 2B9DA 1ZBTA 4X66E 3ADJA 4DUYE 4JI6E 1S3LA 3ICFA 2HHHE 2V83A 3E0JA 3ZOQB 4O43A 2NUEA 4ORAA 2GJUA 5AASA 3VYXA 3QFOA 4X8WA 3HPSA 4LF7E 2Z72A 2Q8UA 5LL6R 2DMYA 3QFKA 4O4KA 2ODRD 3HTXA 1UTEA 4J8ZA 5HPEA 4AQYE 4MOYA 2V88A 3K6QA 2UUBE 1T70A 1T4OA 4IL1A 2R17A 4YY3E 1XZWA 3THNA 2M1SA 3H09A 2BCDA 4BC9A 2DFJA 4LFBE 2MDRA 3K7WC 4F54A 3E7BA 4B3ME 1IBLE 3IVDA 2KHXA 5IOHA 3J80C 2LTSA 4X64E 2O8AA 3RL4A 5JPFA 4DR7E 4JA9A 3RL3A 4K0KE 1STUA 4LF5E 1PKPA 4KZSA 2Z1AA 1O0WA 2V87A 2ZO9B 4DKKA 2VQFE 2L8TA 4WSPA 1EKZA 5F3WA 2EWLA 3LL8A 4JYAE 3T1HE 1XM7A 2LJHA 3F6GA 2JY9A 3HVQA 3CK2A 4DR4E 4LU9A 5CFFE 3DJWA 1IBKE 1USHA 2BDXA 2KKNA 1YYWA 2B3TB 4KKZA 4GEQB 2L3JA 5EQVA 1W24A 3RMPA 1HNWE 5IWAE 3H66A 2DIXA 3FIGA 3FGAC 2NXFA 4GKKE 4P7DA 2L2NA 2NUFA 3V4YA 2LRSA 3P1XA 4H2BA 4ZVZA 4DT2A 1U32A 1OI8A 2XMOA 3JTZA 1JK7A 1N36E 2EZ6A 2WDDA 3C9FA 1WXRA 4DV2E 3H62B 3N5UA 4FBWA 2UXDE 2CPNA 4LFCE 1OIDA 2RSMA 1S3MA 2M7QA 2WDEA 4J6OA 4R03A 5GTUA 4MOVA 4B3SE 4IYPC 2K4VA 4F9AB 4XPNA 5IT9C 2HYPA 4KHPE 2RS6A 3KWRA 2E5LE 2BQ8X 4B3TE 4LTYA 4BBYA 5DNYA 1T4LB 3AV0A 3TGHA 3H63A 1SR9A 2VE7C 2YZTA 2DXNA 1N34E 3RQZA 4F9CB 2A22A 5A2QC 3D03A 2QFRA 4FBKA 3GVEA 3JYFA 4Q7FA 3E7AA 2IAEC 1QHWA 2LE2A 3OMLA 3DF6A 1HO5A 3QFMA 1TCOA 3H69A 2ODRC 4DR3E 5AE1A 4JI1E 1NNWA 5AE2A 1XMOE 2ZOAA 3C4BA 4DHLA 2IHR1 3VK6A 5FLXC 1WAO1 2Z06A 4LF9E 2IE3C 4DV4E 4OR9A 4UT3A 2JR1A 3FLOA 4JI3E 1MF8A 2USHA 3VYYA 2FTXB 5BR8E 2UXCE 4H2IA 1G5BA 2L3CA 3H67A 4NZVA 4F0ZA 2DSYA 1S70A 1UF3A 3H61A 2JOXA 1SU1A 3RL5A 4L5NC 4BS9A 4YKEA 2F4VE 3PSOA 4LF6E 1WARA 2JOBA 2NYMC 1GZ6A 3C4TA 4DR5E 4B3RE 3ADLA 4O5GA 1KBPA 3LLHA 2LBSB 2NPPC 4DUZE 4WPYA 1V73A 1Z2WA 3ZU0A 2L2KB 2O8GA 4UT2A 3H60A 2FGGA 4LACC 1RC7A 2NUGA 4MP0A 4R8OA 2DB2A 1WHQA 2V89A 5LMUE 2UU9E 2KOUA 2G7HA 4ORBA 2E1MA 3F6HA 2UUAE 5C1VA 2WZOA 4OOGC 4TUGA 2H36X 1DI2A 2RS7A 1I94E 4I8OA 4M0VA 3THOB 3IWCA 4LF4E 4JI2E 2P6BA 3KBPA 4O24A 1XNQE 1XMQE 4HD0A 3DW8C 1YZ9A 1AUIA 1X49A 3IWBA 3AUZA 5ADZA 1QU6A 2UXBE 4DV5E 3QFNA 3P71C 2NA2A 3ADGA 4H2FA 2VF1A 3J7AG 1FJMA 4P78A 4WYQB 5LMNE 2F8BA 2QJCA 4M2ZA 1FJGE 3J81C 1GQEA 3C5WC 3T1IA 4V0XA 2V86A 4DV7E 1T4NA 2JWOA 4TUIA 4UWQA 4X62E 1Z2XA 3K7VC 4I5LC 3JU0A 3MSWA 4H2GA 3ZTVA 4DR1E 2JVAA 3IB7A 4FCXA 5AE3A 1N33E 2WDCA 4F9BB 4JI0E 4WFTA 1FKAE 2YVTA 4JI4E 2B7VA 2WDFA 4ORCA 4DSYA 4V0VA 2VQEE 4LFAE 4BC7A 1J5EE 4GKJE 4NXME 2UUCE 1S3NA 4B2OA 3HPZA 3HXLA 5INBA 3PSNA 4BCAA 1YYOA 1WHNA 4DV6E 2KONA 1QFCA 2LUPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OID A;  4UT2 A;  1T71 A;  1S3L A;  3ICF A;  3H60 A;  1S3M A;  4JA7 A;  4LAC C;  2WDE A;  4J6O A;  4MP0 A;  2AHD A;  4O43 A;  4MOV A;  5GTU A;  4IYP C;  4ORA A;  2GJU A;  4XPN A;  2HYP A;  3QFO A;  2Z72 A;  2Q8U A;  2NYL C;  4ORB A;  5C1V A;  1IT6 A;  2BQ8 X;  2HY1 A;  1II7 A;  3QFK A;  4LTY A;  4O4K A;  5DNY A;  3AV0 A;  1UTE A;  3TGH A;  4TUG A;  5JJT A;  3H63 A;  5HPE A;  3DSC A;  1HP1 A;  1M63 A;  3QG5 C;  4MOY A;  1T70 A;  4M0V A;  3THO B;  3RQZ A;  4IL1 A;  2R17 A;  3KBP A;  2P6B A;  4O24 A;  1XZW A;  3THN A;  4KBP A;  4HD0 A;  3DW8 C;  4H1Y P;  4V0W A;  2A22 A;  1AUI A;  4WWL A;  2BCD A;  2QFR A;  3AUZ A;  4FBK A;  3GVE A;  2DFJ A;  3JYF A;  4Q7F A;  3E7A A;  2CV9 A;  2IAE C;  1QHW A;  3H64 A;  3K7W C;  3E7B A;  1HO5 A;  3QFN A;  1HPU A;  3IVD A;  1TCO A;  3P71 C;  3QFM A;  5IOH A;  5J28 A;  3H69 A;  4H2F A;  4FBQ A;  4ZX2 A;  1NNW A;  2O8A A;  5B8I A;  3RL4 A;  5JPF A;  4JA9 A;  4G9J A;  3RL3 A;  2HYO A;  1FJM A;  4DHL A;  1WAO 1;  2QJC A;  3IVE A;  2Z06 A;  2IE3 C;  2JOG A;  3C5W C;  3T1I A;  4OR9 A;  4V0X A;  4UT3 A;  2Z1A A;  4TUI A;  4UWQ A;  5F3W A;  5JPE A;  1Z2X A;  3LL8 A;  3IB8 A;  1MF8 A;  2USH A;  1S8E A;  3K7V C;  1XM7 A;  4I5L C;  3HVQ A;  4H2I A;  4H2G A;  3H68 A;  1G5B A;  3CK2 A;  3ZTV A;  3H67 A;  1USH A;  2BDX A;  2KKN A;  4LU9 A;  4NZV A;  4F0Z A;  3IB7 A;  4FCX A;  1S70 A;  1UF3 A;  4KKZ A;  3H61 A;  5EQV A;  1SU1 A;  2QFP A;  1W24 A;  4I5N C;  2WDC A;  3RL5 A;  2YVT A;  3H66 A;  4H1S A;  2IE4 C;  1S95 A;  2ZBM A;  3EGH A;  3FGA C;  4YKE A;  2NXF A;  2WDF A;  3PSO A;  4ORC A;  1WAR A;  4DSY A;  4V0V A;  3V4Y A;  2NYM C;  4H2B A;  4ZVZ A;  3EGG A;  4DT2 A;  1U32 A;  1OI8 A;  4UT3 B;  3DSD A;  2XMO A;  1S3N A;  4B2O A;  4O5G A;  1JK7 A;  1KBP A;  5INB A;  3PSN A;  1OIE A;  2WDD A;  3C9F A;  2NPP C;  3H62 B;  1V73 A;  1Z2W A;  3N5U A;  1QFC A;  4FBW A;  3ZU0 A;  2O8G A; 
#chains in the Genus database with same CATH topology
 1XNR E;  4JI8 E;  2GLI A;  1HNX E;  1T71 A;  1IQS A;  4OX9 E;  4JA7 A;  2LMZ A;  2V8Q B;  3C6K A;  1HR0 E;  2L6M A;  2EOY A;  2AHD A;  2LVH A;  2N3H A;  2ELY A;  5TSE A;  4LF8 E;  1A1L A;  2NYL C;  4BHB A;  4DMI A;  1IT6 A;  2HY1 A;  1II7 A;  2DXL A;  1X48 A;  2MC6 A;  2MKN A;  1A1G A;  2EPZ A;  5JJT A;  4RHB B;  1EH7 A;  3DSC A;  1HP1 A;  1M63 A;  4N4R B;  3QG5 C;  4JI5 E;  3JAM C;  1X47 A;  1MGT A;  2I9I A;  2EP3 A;  1UHZ A;  2LTR A;  2L33 A;  1HNZ E;  2YT4 A;  2VRD A;  3KZZ A;  5KL7 A;  4KBP A;  2ZM6 E;  4F6N A;  2DMI A;  2YEQ A;  4H1Y P;  4V0W A;  2N3G A;  2V85 A;  4WWL A;  1DQ3 A;  2MC5 A;  1IBM E;  1N32 E;  3HQ1 A;  1NEI A;  2CV9 A;  4DR6 E;  2YTG A;  3H64 A;  2M4I A;  4JV5 E;  2LV2 A;  3IWD A;  2YTJ A;  1HPU A;  2EPX A;  2LUQ A;  4DV1 E;  5J28 A;  2L2M A;  4HTG A;  4FBQ A;  4ZX2 A;  5T6J A;  2B7T A;  5B8I A;  2FV4 B;  4YHH E;  4G9J A;  2L92 A;  1GTK A;  4DR2 E;  5AC5 A;  3J7Y p;  2HYO A;  2EN1 A;  3ADI A;  2RTX A;  3IVE A;  2EPR A;  2YWQ A;  2JOG A;  2YTD A;  1YSA C;  4L8N A;  1J26 A;  4BMJ A;  5JPE A;  3IB8 A;  3T1Y E;  4M30 A;  4DV3 E;  3KZY A;  1S8E A;  4DV0 E;  1YYK A;  2GPI A;  4X65 E;  3H68 A;  2EPO A;  3OTO E;  1RQ0 A;  1BB8 A;  1BBG A;  3C6M A;  2WBU A;  2QFP A;  4I5N C;  4Q28 A;  4JI7 E;  1TN9 A;  4H1S A;  2IE4 C;  4MLV A;  1S95 A;  2EQ1 A;  2WCC 3;  2ZBM A;  3EGH A;  1ZBQ A;  2A25 A;  4NXN E;  1F2I G;  1UIL A;  3EGG A;  3LML A;  4UT3 B;  3DSD A;  2EM0 A;  1AAY A;  1T38 A;  4HEI A;  1OIE A;  2B9D A;  3L00 A;  4WSG A;  1ZBT A;  5KL6 A;  4WX9 A;  2I13 A;  4X66 E;  3ADJ A;  2EPC A;  4DUY E;  4JI6 E;  1A1H A;  2EN4 A;  1S3L A;  1A1J A;  3ICF A;  2HHH E;  5LLQ A;  2JXP A;  2V83 A;  3E0J A;  3ZOQ B;  2YU5 A;  4O43 A;  2LO3 A;  1ZAA C;  2EE8 A;  2NUE A;  4ORA A;  2GJU A;  2EPM X;  5AAS A;  3VYX A;  3QFO A;  4X8W A;  3HPS A;  4LF7 E;  2Z72 A;  2Q8U A;  2EOS A;  5LL6 R;  4IS1 C;  2DMY A;  2EOZ A;  3QFK A;  2YRK A;  4O4K A;  2EMA A;  2ODR D;  3HTX A;  1UTE A;  4J8Z A;  5HPE A;  4AQY E;  5KL2 A;  1RMD A;  4MOY A;  2V88 A;  3K6Q A;  2UUB E;  2EMX A;  1T70 A;  1T4O A;  4IL1 A;  2R17 A;  2EMY A;  4YY3 E;  1WJP A;  3ECR A;  3THN A;  1XZW A;  2M1S A;  3H09 A;  5IXM B;  1G2F C;  2CTD A;  2BCD A;  1X6F A;  2EM4 A;  4BC9 A;  2DFJ A;  2RSI A;  2YRM A;  1UBD C;  4LFB E;  2HC5 A;  2MDR A;  3K7W C;  4F54 A;  3E7B A;  4B3M E;  2YRH A;  1IBL E;  3IVD A;  2KHX A;  2YTN A;  2CT1 A;  5IOH A;  3J80 C;  2EM5 A;  2EPA A;  2EL6 A;  2LTS A;  1A1I A;  4X64 E;  2O8A A;  3RL4 A;  5JPF A;  4DR7 E;  4JA9 A;  3RL3 A;  4R2Q A;  2DRP A;  2EJ4 A;  4K0K E;  1STU A;  4LF5 E;  1PDA A;  1PKP A;  3EPJ A;  2EOX A;  4KZS A;  2Z1A A;  1O0W A;  2V87 A;  2ZO9 B;  2N8X A;  4DKK A;  2VQF E;  2L8T A;  4WSP A;  2EPL X;  3VHT B;  2EWL A;  5A6B A;  5F3W A;  1EKZ A;  1TF6 A;  3LL8 A;  4JYA E;  1EH6 A;  3T1H E;  1XM7 A;  2LJH A;  3F6G A;  2JY9 A;  3HVQ A;  1MEY C;  3CK2 A;  4DR4 E;  1UN6 B;  4LU9 A;  5CFF E;  3DJW A;  1IBK E;  1USH A;  2BDX A;  2KKN A;  2GHF A;  2B3T B;  2EOF A;  3EPK A;  1YYW A;  4GEQ B;  4KKZ A;  4BHC A;  2L3J A;  5EQV A;  2EPK X;  1W24 A;  3EPH A;  4NHR A;  3RMP A;  4R2S A;  2EMZ A;  1HNW E;  2M9A A;  5IWA E;  3H66 A;  2DIX A;  3FIG A;  2EN6 A;  3FGA C;  2JYA A;  2NXF A;  4GKK E;  4P7D A;  1EH8 A;  4ZYG A;  2L2N A;  2NUF A;  1X6H A;  3V4Y A;  2LRS A;  3P1X A;  4H2B A;  4ZVZ A;  4DT2 A;  2YPN A;  1OI8 A;  1U32 A;  2XMO A;  2MKD A;  3JTZ A;  1L4S A;  1JK7 A;  1N36 E;  1T39 A;  2EPN A;  2EZ6 A;  2WDD A;  3C9F A;  2EOQ A;  3EQ1 A;  1WXR A;  1A1K A;  4DV2 E;  2EM9 A;  3H62 B;  3N5U A;  4FBW A;  2YTI A;  2UXD E;  2CPN A;  4LFC E;  1TF3 A;  1OID A;  2RSM A;  2EOI A;  2WBS A;  1S3M A;  2BBG A;  2M7Q A;  2WDE A;  4J6O A;  2EOM A;  4R03 A;  2ELZ A;  5GTU A;  4MOV A;  4B3S E;  4IYP C;  2EMW A;  2K4V A;  1WRJ A;  4F9A B;  4XPN A;  5IT9 C;  2EMF A;  2HYP A;  4KHP E;  5AC4 A;  2R76 A;  4ZYH A;  2RS6 A;  1YUJ A;  3KWR A;  2EN8 A;  1SFE A;  2E5L E;  2ENC A;  2BQ8 X;  1IMU A;  4B3T E;  4LTY A;  4BBY A;  5DNY A;  1T4L B;  3AV0 A;  3TGH A;  3H63 A;  1Z1B A;  1SR9 A;  2VE7 C;  2YZT A;  2DXN A;  1N34 E;  4IJD A;  3RQZ A;  4F9C B;  1A1F A;  2BB8 A;  5A6J A;  4WXD A;  2A22 A;  5A2Q C;  3D03 A;  2EQ0 A;  2QFR A;  2PRT A;  4FBK A;  3GVE A;  3JYF A;  2RPC A;  4Q7F A;  2K7I A;  3E7A A;  2YTP A;  2IAE C;  1QHW A;  2LE2 A;  3OML A;  3DF6 A;  1HO5 A;  3BID A;  5KL4 A;  1YPN A;  1TCO A;  3QFM A;  2YTF A;  3H69 A;  2ODR C;  4DR3 E;  5AE1 A;  1X6E A;  2EN2 A;  4JI1 E;  1NNW A;  2ENH A;  5AE2 A;  2NAB A;  1XMO E;  2ZOA A;  3C4B A;  4DHL A;  2DLQ A;  2IHR 1;  2EM3 A;  3VK6 A;  5FLX C;  2EOO A;  1WAO 1;  1BBO A;  1P47 A;  2DGC A;  1AH5 A;  4LF9 E;  2Z06 A;  2IE3 C;  4DV4 E;  2EMB A;  4OR9 A;  4RH8 A;  4UT3 A;  2JR1 A;  5KL3 A;  2EMK A;  3FLO A;  4JI3 E;  4R2D A;  1QNT A;  1MF8 A;  2USH A;  3VYY A;  2FTX B;  2WBT A;  5BR8 E;  2UXC E;  1KJK A;  4H2I A;  1G5B A;  4R2P A;  2L3C A;  4NZV A;  3H67 A;  4F0Z A;  2DSY A;  1S70 A;  1UF3 A;  3H61 A;  2R1F A;  2JOX A;  1SU1 A;  4GZN C;  1LLM C;  2EM7 A;  3RL5 A;  4L5N C;  4BS9 A;  4YKE A;  2F4V E;  4R2E A;  2LCE A;  3PSO A;  1NCS A;  1JK1 A;  4LF6 E;  1WAR A;  2EOJ A;  2EL4 A;  2JOB A;  3M99 B;  4MLQ A;  2J7J A;  2NYM C;  1ZU1 A;  1GZ6 A;  2EMH A;  3C4T A;  4DR5 E;  3MHS C;  2EOE A;  2ENA A;  4B3R E;  3ADL A;  4R2R A;  4O5G A;  1PJT A;  1KBP A;  3BGH A;  3LLH A;  2EML A;  2LBS B;  5A6A A;  4ZYD A;  2NPP C;  1G2D C;  4DUZ E;  3MHH C;  4WPY A;  2E72 A;  1V73 A;  2DLK A;  1Z2W A;  2D9H A;  3ZU0 A;  2L2K B;  2O8G A;  2EPP A;  4UT2 A;  1X3C A;  3H60 A;  2FGG A;  2ADR A;  4LAC C;  2RQL A;  1RC7 A;  2NUG A;  4MP0 A;  4R8O A;  1KYQ A;  2EN3 A;  2DB2 A;  1WHQ A;  2MDG A;  2V89 A;  5LMU E;  2UU9 E;  2KOU A;  1B69 A;  2G7H A;  4ORB A;  2E1M A;  3F6H A;  2UUA E;  5C1V A;  2WZO A;  4F6M A;  4X9J A;  2EMC A;  3BBG A;  4OOG C;  4TUG A;  2H36 X;  1DI2 A;  2RS7 A;  1I94 E;  5IV8 B;  4I8O A;  4M0V A;  3THO B;  2LT7 A;  1DGC A;  1PJS A;  3IWC A;  1N3G A;  4LF4 E;  4JI2 E;  2P6B A;  4O24 A;  3KBP A;  1XNQ E;  2HJJ A;  5A6B D;  1XMQ E;  4R2C A;  3TQM A;  4HD0 A;  3DW8 C;  1YZ9 A;  1ZR9 A;  1AUI A;  1X49 A;  3IWB A;  3AUZ A;  5ADZ A;  2CSH A;  2YSO A;  4Q35 B;  1QU6 A;  2UXB E;  2YTQ A;  2EMI A;  4DV5 E;  3QFN A;  3P71 C;  2NA2 A;  3ADG A;  3UK3 C;  2EM6 A;  2VF1 A;  3J7A G;  4H2F A;  1PJQ A;  2EOR A;  4KWY A;  4FK5 C;  1JK2 A;  2HGH A;  5KL5 A;  4P78 A;  1FJM A;  4WYQ B;  5LMN E;  2F8B A;  2QJC A;  4M9V C;  4M2Z A;  1FJG E;  3J81 C;  1GQE A;  3C5W C;  3T1I A;  1IQO A;  4WXC A;  2V86 A;  4ZYE A;  4DV7 E;  1T4N A;  4V0X A;  4R2A A;  2JWO A;  2EM8 A;  2EL5 A;  4TUI A;  1YUI A;  4UWQ A;  2LJU A;  4X62 E;  1Z2X A;  3K7V C;  4I5L C;  2YTE A;  3JU0 A;  3MSW A;  4H2G A;  3ZTV A;  2EMG A;  4DR1 E;  2JVA A;  3IB7 A;  4FCX A;  2EN7 A;  5AE3 A;  1N33 E;  1X5W A;  2WDC A;  4F9B B;  4JI0 E;  4WFT A;  2YTO A;  1FKA E;  2YVT A;  4JI4 E;  2B7V A;  2EQ3 A;  3EPL A;  2WDF A;  4ORC A;  2JPA A;  1YFH A;  4DSY A;  5A69 A;  4V0V A;  4F2J C;  2EPU A;  2EOH A;  2VQE E;  4LFA E;  4BC7 A;  2YSP A;  3BF2 A;  1J5E E;  4GKJ E;  4NXM E;  2UUC E;  1S3N A;  4B2O A;  3HPZ A;  3HXL A;  2YU8 A;  5INB A;  3PSN A;  2EM2 A;  4BCA A;  5A6K A;  1YYO A;  1WHN A;  4DV6 E;  2KON A;  2JP9 A;  1QFC A;  2LUP B; 
#chains in the Genus database with same CATH homology
 1XNR E;  4JI8 E;  1HNX E;  1T71 A;  4OX9 E;  4JA7 A;  2LMZ A;  2V8Q B;  1HR0 E;  2L6M A;  2AHD A;  2N3H A;  4LF8 E;  2NYL C;  4DMI A;  1IT6 A;  2HY1 A;  1II7 A;  2DXL A;  1X48 A;  2MC6 A;  5JJT A;  3DSC A;  1M63 A;  1HP1 A;  4JI5 E;  3QG5 C;  3JAM C;  1X47 A;  1UHZ A;  2LTR A;  2L33 A;  1HNZ E;  2YT4 A;  4KBP A;  2ZM6 E;  2YEQ A;  4H1Y P;  4V0W A;  2N3G A;  2V85 A;  4WWL A;  1DQ3 A;  2MC5 A;  1IBM E;  1N32 E;  3HQ1 A;  2CV9 A;  4DR6 E;  3H64 A;  2M4I A;  4JV5 E;  3IWD A;  1HPU A;  2LUQ A;  4DV1 E;  5J28 A;  2L2M A;  4FBQ A;  4ZX2 A;  5T6J A;  2B7T A;  5B8I A;  2FV4 B;  4YHH E;  4G9J A;  2L92 A;  4DR2 E;  2HYO A;  3J7Y p;  3ADI A;  2RTX A;  3IVE A;  2JOG A;  4L8N A;  1J26 A;  4BMJ A;  5JPE A;  3IB8 A;  3T1Y E;  4M30 A;  4DV3 E;  1S8E A;  4DV0 E;  1YYK A;  4X65 E;  3H68 A;  3OTO E;  1RQ0 A;  2QFP A;  4I5N C;  4Q28 A;  4JI7 E;  4H1S A;  2IE4 C;  1S95 A;  2ZBM A;  3EGH A;  1ZBQ A;  4NXN E;  1UIL A;  3EGG A;  3LML A;  4UT3 B;  3DSD A;  1OIE A;  2B9D A;  1ZBT A;  4X66 E;  3ADJ A;  4DUY E;  4JI6 E;  1S3L A;  3ICF A;  2HHH E;  2V83 A;  3E0J A;  3ZOQ B;  4O43 A;  2NUE A;  4ORA A;  2GJU A;  5AAS A;  3VYX A;  3QFO A;  4X8W A;  3HPS A;  4LF7 E;  2Z72 A;  2Q8U A;  5LL6 R;  2DMY A;  3QFK A;  4O4K A;  2ODR D;  3HTX A;  1UTE A;  4J8Z A;  5HPE A;  4AQY E;  4MOY A;  2V88 A;  3K6Q A;  2UUB E;  1T70 A;  1T4O A;  4IL1 A;  2R17 A;  4YY3 E;  1XZW A;  3THN A;  2M1S A;  3H09 A;  2BCD A;  4BC9 A;  2DFJ A;  4LFB E;  2MDR A;  3K7W C;  4F54 A;  3E7B A;  4B3M E;  1IBL E;  3IVD A;  2KHX A;  5IOH A;  3J80 C;  2LTS A;  4X64 E;  2O8A A;  3RL4 A;  5JPF A;  4DR7 E;  4JA9 A;  3RL3 A;  4K0K E;  1STU A;  4LF5 E;  1PKP A;  4KZS A;  2Z1A A;  1O0W A;  2V87 A;  2ZO9 B;  4DKK A;  2VQF E;  2L8T A;  4WSP A;  1EKZ A;  5F3W A;  2EWL A;  3LL8 A;  4JYA E;  3T1H E;  1XM7 A;  2LJH A;  3F6G A;  2JY9 A;  3HVQ A;  3CK2 A;  4DR4 E;  4LU9 A;  5CFF E;  3DJW A;  1IBK E;  1USH A;  2BDX A;  2KKN A;  1YYW A;  2B3T B;  4KKZ A;  4GEQ B;  2L3J A;  5EQV A;  1W24 A;  3RMP A;  1HNW E;  5IWA E;  3H66 A;  2DIX A;  3FIG A;  3FGA C;  2NXF A;  4GKK E;  4P7D A;  2L2N A;  2NUF A;  3V4Y A;  2LRS A;  3P1X A;  4H2B A;  4ZVZ A;  4DT2 A;  1U32 A;  1OI8 A;  2XMO A;  3JTZ A;  1JK7 A;  1N36 E;  2EZ6 A;  2WDD A;  3C9F A;  1WXR A;  4DV2 E;  3H62 B;  3N5U A;  4FBW A;  2UXD E;  2CPN A;  4LFC E;  1OID A;  2RSM A;  1S3M A;  2M7Q A;  2WDE A;  4J6O A;  4R03 A;  5GTU A;  4MOV A;  4B3S E;  4IYP C;  2K4V A;  4F9A B;  4XPN A;  5IT9 C;  2HYP A;  4KHP E;  2RS6 A;  3KWR A;  2E5L E;  2BQ8 X;  4B3T E;  4LTY A;  4BBY A;  5DNY A;  1T4L B;  3AV0 A;  3TGH A;  3H63 A;  1SR9 A;  2VE7 C;  2YZT A;  2DXN A;  1N34 E;  3RQZ A;  4F9C B;  2A22 A;  5A2Q C;  3D03 A;  2QFR A;  4FBK A;  3GVE A;  3JYF A;  4Q7F A;  3E7A A;  2IAE C;  1QHW A;  2LE2 A;  3OML A;  3DF6 A;  1HO5 A;  3QFM A;  1TCO A;  3H69 A;  2ODR C;  4DR3 E;  5AE1 A;  4JI1 E;  1NNW A;  5AE2 A;  1XMO E;  2ZOA A;  3C4B A;  4DHL A;  2IHR 1;  3VK6 A;  5FLX C;  1WAO 1;  2Z06 A;  4LF9 E;  2IE3 C;  4DV4 E;  4OR9 A;  4UT3 A;  2JR1 A;  3FLO A;  4JI3 E;  1MF8 A;  2USH A;  3VYY A;  2FTX B;  5BR8 E;  2UXC E;  4H2I A;  1G5B A;  2L3C A;  3H67 A;  4NZV A;  4F0Z A;  2DSY A;  1S70 A;  1UF3 A;  3H61 A;  2JOX A;  1SU1 A;  3RL5 A;  4L5N C;  4BS9 A;  4YKE A;  2F4V E;  3PSO A;  4LF6 E;  1WAR A;  2JOB A;  2NYM C;  1GZ6 A;  3C4T A;  4DR5 E;  4B3R E;  3ADL A;  4O5G A;  1KBP A;  3LLH A;  2LBS B;  2NPP C;  4DUZ E;  4WPY A;  1V73 A;  1Z2W A;  3ZU0 A;  2L2K B;  2O8G A;  4UT2 A;  3H60 A;  2FGG A;  4LAC C;  1RC7 A;  2NUG A;  4MP0 A;  4R8O A;  2DB2 A;  1WHQ A;  2V89 A;  5LMU E;  2UU9 E;  2KOU A;  2G7H A;  4ORB A;  2E1M A;  3F6H A;  2UUA E;  5C1V A;  2WZO A;  4OOG C;  4TUG A;  2H36 X;  1DI2 A;  2RS7 A;  1I94 E;  4I8O A;  4M0V A;  3THO B;  3IWC A;  4LF4 E;  4JI2 E;  2P6B A;  3KBP A;  4O24 A;  1XNQ E;  1XMQ E;  4HD0 A;  3DW8 C;  1YZ9 A;  1AUI A;  1X49 A;  3IWB A;  3AUZ A;  5ADZ A;  1QU6 A;  2UXB E;  4DV5 E;  3QFN A;  3P71 C;  2NA2 A;  3ADG A;  4H2F A;  2VF1 A;  3J7A G;  1FJM A;  4P78 A;  4WYQ B;  5LMN E;  2F8B A;  2QJC A;  4M2Z A;  1FJG E;  3J81 C;  1GQE A;  3C5W C;  3T1I A;  4V0X A;  2V86 A;  4DV7 E;  1T4N A;  2JWO A;  4TUI A;  4UWQ A;  4X62 E;  1Z2X A;  3K7V C;  4I5L C;  3JU0 A;  3MSW A;  4H2G A;  3ZTV A;  4DR1 E;  2JVA A;  3IB7 A;  4FCX A;  5AE3 A;  1N33 E;  2WDC A;  4F9B B;  4JI0 E;  4WFT A;  1FKA E;  2YVT A;  4JI4 E;  2B7V A;  2WDF A;  4ORC A;  4DSY A;  4V0V A;  2VQE E;  4LFA E;  4BC7 A;  1J5E E;  4GKJ E;  4NXM E;  2UUC E;  1S3N A;  4B2O A;  3HPZ A;  3HXL A;  5INB A;  3PSN A;  4BCA A;  1YYO A;  1WHN A;  4DV6 E;  2KON A;  1QFC A;  2LUP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...