3AV0A

Crystal structure of mre11-rad50 bound to atp s
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
369
structure length
369
Chain Sequence
b'GSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDNVDIESLNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
total genus 101
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3av0A03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3av0A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3av0A01
4FBKA 4IL1A 3QFNA 3H60A 4Q7FA 3HVQA 3QFOA 3GVEA 1OIEA 2P6BA 2NYLC 1HO5A 1SU1A 3PSOA 2QFRA 4LTYA 1Z2XA 4MOYA 4O24A 4UWQA 3RL5A 3H69A 5HPEA 3IVEA 4MP0A 3THNA 3AUZA 2Z1AA 5IOHA 3LL8A 3N5UA 3RQZA 1HP1A 1S3MA 2HYPA 5JPEA 1S95A 2JOGA 2IAEC 1KBPA 4M0VA 5F3WA 4FBQA 3C9FA 3V4YA 4FBWA 3H66A 2Q8UA 4DHLA 3RL4A 2O8GA 2WDDA 1II7A 3TGHA 2NXFA 1S3NA 3FGAC 5INBA 1UTEA 4TUIA 1XZWA 2WDFA 2A22A 3H67A 4I5LC 4B2OA 4HD0A 4H1SA 4OR9A 5DNYA 2Z06A 4LU9A 4XPNA 1Z2WA 4F0ZA 5J28A 4FCXA 4TUGA 4LACC 4H1YP 4V0XA 3C5WC 1QHWA 3CK2A 5EQVA 2QFPA 4H2GA 4ZX2A 5B8IA 1T71A 1OIDA 2HY1A 2YVTA 2CV9A 4JA7A 2NYMC 3E7AA 1FJMA 3E7BA 3QFMA 3RL3A 3H64A 1OI8A 3T1IA 2QJCA 1USHA 1V73A 2BCDA 1S70A 3AV0A 4NZVA 3P71C 4ORBA 3KBPA 3H68A 3H63A 4H2FA 4H2IA 1G5BA 1S3LA 5JJTA 1XM7A 4O43A 2HYOA 4ORCA 1U32A 2USHA 3H62B 4KBPA 3EGHA 3EGGA 3H61A 4I5NC 4WWLA 2WDCA 3IB7A 3THOB 1M63A 2BDXA 2Z72A 4UT3A 2GJUA 4V0WA 2ZBMA 1MF8A 1TCOA 3DW8C 5GTUA 3PSNA 5C1VA 1W24A 2R17A 3IB8A 4UT3B 4IYPC 3ZU0A 4V0VA 4MOVA 3QFKA 1HPUA 4JA9A 3ICFA 3QG5C 2BQ8X 2WDEA 1JK7A 1QFCA 4KKZA 3K7VC 3IVDA 4DT2A 3JYFA 4G9JA 3DSDA 1AUIA 2IE4C 1S8EA 4YKEA 4H2BA 4O5GA 2O8AA 4ZVZA 1IT6A 1UF3A 2NPPC 2XMOA 4O4KA 4DSYA 3K7WC 4UT2A 1WARA 2DFJA 2KKNA 4ORAA 2IE3C 1WAO1 3DSCA 1T70A 3ZTVA 2AHDA 5JPFA 4J6OA 1NNWA
chains in the Genus database with same CATH superfamily
2K47A 4JI4M 4DMIA 1DV0A 1GJTA 4DV7M 3J7AG 3GLFB 4M30A 5IOHA 2ENCA 1T4NA 2M60A 4OX9E 1KBPA 2Z7JA 3FUVA 4DV3E 1GABA 1IXZA 1QZEA 4BB9A 2XZFA 2MC6A 4DV6M 4WW0A 1Z2WA 3TPZA 2DMYA 1WIVA 2UXCM 1TDZA 3HPSA 1JR3E 1WXRA 1L8QA 2CV9A 1FJMA 3E7BA 1WXQA 3UK6A 1FJGM 2CRUA 2UXDE 4GHLA 5EXXA 5KQ8A 1NVMA 4Z6YA 2V83A 3EPHA 3W0LB 2K6BA 3VLFB 2QP9X 5KL2A 2D7GA 5EP1A 2MKDA 3IB7A 2BDXA 2YTDA 4Q35B 2DAMA 1JK1A 2Z72A 4L78A 4JN6A 4LJ6A 4HTGA 5LL6R 1T43A 2DAIA 1QAMA 4YHHE 2BNKA 3GPUA 3B7NA 3ADGA 3ICFA 4OVZB 3IHPA 2L2MA 2FFJA 4BHBA 2ADRA 1UILA 3VDPA 1WGNA 1EE8A 1YFHA 2UU9M 2Y0TA 3HU2A 4REZA 2L7IA 1D0MA 3E0JA 4NC6A 3TE6A 3GVEA 2YSOA 1XC8A 4LTYA 4CGYB 1SXJE 2M4IA 2Z1AA 4NHRA 2ZAOA 2BB8A 2E72A 4B08A 1IM2A 4QHTA 1X48A 2Z8YM 2JOBA 2EA0A 1N33M 2WZJA 2EMWA 3VDUA 3SYKA 2EM6A 3L29A 5AC4A 5AC5A 3QAUA 2JXPA 4XGIA 1PJQA 1J5EE 3QYEA 2Z4SA 2HGHA 3LMLA 1RU3A 5KO3A 4MGKE 3RGPA 3JR5A 4B3ME 3E7AA 2LVQD 3JAMS 3HJQA 2MDRA 4LJ5A 1OI8A 1N34E 4L5NC 2DRPA 2YTPA 4X64E 4MGIE 1O0WA 2M9AA 1XXHA 4X66M 1NV8A 2WBTA 1N32E 2MGWA 2UU9E 2YZTA 1TR8A 2H1RA 3H61A 2R46A 2EOHA 2DI0A 4DR1M 4RHBB 2RS6A 5ITXA 2ELYA 2B7VA 2EMZA 2R17A 3B74A 2ZOAA 3U6CA 1MGTA 2XF3A 1IBLE 3MJ5A 1WJ7A 3U60A 4YKEA 4LJAA 1A1FA 1T38A 2JY9A 5IV8B 3J7Yp 4IBJA 4K0KM 4DSYA 1JR3A 1WARA 1JB0F 1F2IG 1TN9A 2Z3XA 3J27B 2XEPA 5JPFA 1R7RA 2WSEF 1GQEA 4O24A 2KZSA 4AQYM 1D0LA 1OTRA 3BOSA 5LMUE 4FK5C 1SXJC 3RQZA 2JOGA 1NHGC 3L2AA 4FBQA 2VDBB 2O8GA 1NNUC 4TUIA 3H67A 4GMQA 5IXMB 5FLXC 2WCC3 2EORA 2HC5A 2Z4RA 2LTSA 4R2RA 1QDTA 3FYCA 2EPCA 5ITRA 3C4TA 4IBEA 5EQVA 2EQ1A 1R6BX 1VDDA 1JR3D 2EMKA 4DV1M 3F6HA 2RGOA 4WX9A 2F5OA 4DR6M 3H64A 4UN2B 4WXDA 2R6FA 1USHA 4Q28A 2LBSB 4DV0M 3FE3A 3VHTB 4R2CA 4B7HA 1YYWA 1PGYA 2YRKA 4WXCA 4B3RM 1NO1A 2EOXA 4LCBA 2YEQA 4MGZE 1IFYA 3U6MA 1IMUA 3D8LA 1TCOA 3I4YA 1R4GA 3NWLA 2EL6A 1S3SA 1DGHB 2O01F 4ZYHA 3QFKA 5KPTA 1IN8A 3K92A 2CEAA 4AG5A 4DR2E 4BHCA 3E9SA 3C58A 4G9JA 2FE8A 1NJGA 2LV2A 2O5RA 2R62A 2G5GX 1IT6A 4LFAE 2NPPC 5A69A 4GEWA 4CHTB 1NEIA 4B7GA 2DLQA 2UXBM 4GZNC 5BR8M 4KWYA 2NUEA 2M5ZA 4DV2M 3SFZA 2EUCA 4DV1E 3C4BA 2DAKA 3TWKA 4G3OA 2Y20A 3FD9A 4X8WA 4R2SA 3IVEA 2F4VE 4DR6E 4MP0A 3THNA 3L00A 5JPEA 2F5SA 2YTIA 2F8BA 5LMNM 2WDDA 2QBYA 3LLHA 4X65E 3KFUG 2NQ8C 3BGHA 1T3TA 4JI2M 2DSYA 4L8RC 4GHAA 4MGHA 2YTQA 3T15A 1L2DA 4JI7E 2O25A 2YTOA 2EO2A 3RE8A 3SASA 3RL3A 1P3QQ 3TWMA 3L26A 3HGIA 4BC9A 4MB7A 1XMOM 4R2EA 2BCDA 3FTDA 3P71C 3HY5A 2JUJA 1VQ1A 4OU7A 2HYOA 4DR4E 4ZYEA 4LF5M 3MHSC 3FUTA 2UUBM 4I5NC 4WWLA 4P78A 1QYRA 1G8PA 5A6AA 3VYYA 5A2QC 1XNQM 1G4AE 1MF8A 1JQJC 3ZOQB 5EQTA 2KDLA 2B7TA 4JA9A 3VK8A 1G2FC 2WDEA 3J2PB 1TH4A 3LVWA 4PD2A 2LO3A 3JYFA 2LWXA 4RF1A 1AUIA 2DHRA 2EE8A 1BB8A 1N36M 3EIHA 5IT9S 2V6ZM 5LMNE 1UF3A 2L3CA 2L4FA 5A6JA 2NABA 3U6QA 1ZAEA 3M6AA 1TTEA 1DO2A 2EKKA 4JI2E 3U5ZB 1A1JA 2KW0A 3FTCA 2EPKX 3B7ZA 1L4SA 4ANRA 1UBDC 2VQEE 3KSXA 2DIXA 4R2QA 1HJPA 3IWBA 3U6DA 1HT1E 2KRKA 4DBGB 5ITTA 1VEKA 2HYPA 2R18A 3T1HE 2KZUA 1LTMA 4M0VA 3BBZA 3U6PA 2JY5A 1HNXM 2K7IA 4F6NA 4L4UA 1KSFX 3P1XA 1ZMVA 2MH8A 4DV5E 3HX3A 4QHSA 2EPLX 2EKFA 1A1LA 2GHFA 2JY7A 2KHHA 4ZPXA 3J7BA 4IIWA 4B3SM 1IY0A 3HJ8A 4BLCA 2ODRC 4JI0E 5EJCA 1ZR9A 2Q2EB 2C5RA 3MK6A 3J80C 2V88A 3THOB 2JOXA 4NXNM 4AI6A 1J09A 4LF7M 2XSZA 1Q02A 5ITQA 1IY2A 2R1FA 2I13A 5KL5A 1SR9A 4HL4A 4GKKE 1GO5A 4GRIA 4D80A 1TH2A 4M2ZA 3C9PA 2VE7C 2EPPA 8CATA 4O5GA 1KFVA 1EH6A 3SARA 2B9DA 3KP1E 4O4KA 1QAOA 2WBUA 1X47A 3J7AS 2KNZA 4BCAA 5CFFE 3GLFE 1N77A 2UUAE 4F6MA 3J81C 1HO5A 3RL5A 3R9XB 3GRRA 2EN2A 1UN6B 3DZDA 1NHWC 4QOSA 2UUCM 3EPKA 5FSWA 1V34A 2B3TA 3UGJA 2HAKA 1EFUB 4LF8E 2XSZD 3K2LA 3U6OA 3C6MA 2DZOB 3HTXA 1OFHA 2CSHA 2BWBA 2A22A 4JYAM 4PDGA 4WSPA 4LRTA 3IECA 2Z06A 3F92A 4D82A 4FCXA 2EOEA 4TUGA 2YU8A 2V1CA 1HQCA 4LF7E 2C99A 2GPIA 4ZX2A 2HHHM 1OIDA 3U61A 4DR7M 3MMPA 3KOWE 4JI6M 2HWJA 4LJ9A 2G7HA 4IBKA 2JWOA 2RPCA 4M9VC 3HHYA 2ODRD 3H68A 3M99B 1XM7A 2RQLA 1U32A 1N3GA 2GLIA 1X3CA 3TWLA 2C96A 2QENA 1DGFA 4MGYE 4F2LA 3ADJA 1E9RA 3DW8C 5GTUA 3PFIA 1AH5A 3GLIA 2M1SA 1J7KA 2R0IA 1PJIA 3E46A 1X37A 4CIZA 1HQYE 4G4OA 3L25A 2QCUA 1XXHB 1QNTA 2YU5A 2EN6A 2EM0A 5GKNA 1VEGA 5FTMA 3HXLA 4N4RB 4JI4E 1IXSA 4BMJA 1TDHA 2EM3A 4W5WA 3VYXA 2LTUA 3LQQA 2J5YA 3H4MA 3AFHA 4DV7E 4IBIA 2KNAA 2LRSA 3QFOA 2N8XA 5T6JA 2DENA 1GVNA 2AHMA 4DR7E 3OTOM 4GH9A 2VF8A 2EPOA 4RH8A 3N5UA 4LF4M 1Z1BA 2QZ4A 2VQFM 3U60B 3KSJA 3CF2A 3LMMA 1AAYA 3W67A 2Q8UA 3KXEC 3AJIB 4DV6E 1HR0M 3GRYA 4X9JA 2UXCE 1MX0A 4H1SA 3B9PA 3KS8A 4LU9A 2F5QA 4KLNA 3GRVA 5J28A 2EWLA 4V0XA 4G4QA 1FJGE 1XMQM 4DUZM 4JA7A 3MHVC 3QFMA 2JR1A 4DUYM 3BBGA 4LZZA 1V73A 4AG6A 2EPUA 1ZU1A 1S3LA 4ORCA 4LRSA 2EOIA 2KHXA 3EGGA 3FTFA 4FCTA 4YY3M 1XHBA 2GJUA 1Z5BA 2EQ0A 3HHZA 1PDAA 4DR3M 3K6QA 2V1UA 2H5XA 2EPZA 3GLHE 1KYQA 5IWAM 4R3DA 4GKJM 1OJLA 1XNRM 2DXLA 3SAWA 4G4RA 2EOZA 5FLXS 3IG8A 1N78A 1GJSA 3DFZA 3K7WC 4UT2A 3H09A 4QNMA 4PCZA 1T70A 2JXNA 4AZFA 3AOEC 3FTEA 2EZ6A 3OMLA 2R4JA 1G41A 4XK8F 4KT0F 3KP0E 4DUYE 3EPLA 2EM8A 3L28A 4FWHA 3T1YM 3HPZA 2DXIA 2A25A 2LCEA 1N33E 4Y28F 4L8NA 2EN4A 2QPAA 1X6EA 1ZMUA 4B2OA 4M9XA 2F5PA 2ZM6M 2DHYA 2EMLA 2JPAA 4OR9A 4RF0A 1SFEA 2MC5A 2LVAA 4DR3E 3BF2A 2DLKA 5DFLA 2NYMC 3I51A 2L6MA 3LQRA 4X66E 4FCVA 3C6KA 3U6EA 2EMBA 3LCUA 1AUAA 3KBPA 3H63A 2QBYB 2K4VA 4FWDA 3JR4A 2USHA 2FV4B 2L8TA 4DR1E 2EN1A 3H4JA 3B89A 1TF0B 1HNZM 4V0WA 4IBDA 4UT3B 3ZU0A 1B69A 5AE3A 2JP9A 1IN7A 1PKPA 2MKNA 4F2JC 1Z59A 2EMIA 1V33A 5KL7A 4K0KE 1EIJA 1TF6A 4R03A 1RC7A 3AOGA 2DNAA 3VKHA 2J7NA 2XLJA 2JNHA 2MDGA 4DV4M 1SXJA 1WAO1 2EMHA 3E4RA 1EH8A 4FBKA 1OAIA 3U6SA 3HWSA 4GC5A 2ZO9B 3FUWA 4AQYE 2CP8A 4LJ7A 1SU1A 2H36X 2R45A 4L15A 2I9IA 2J7OA 4R7GA 3AUZA 4LJ4A 5IZ7D 5ITYA 2LVHA 3C9FA 3GLGE 1WJPA 2JWSA 2FTXB 1IBKM 3CF6E 2N3HA 4II7A 4JXJA 2CV1A 1Z6TA 4M9SA 3WHLA 1G59A 4LJ8A 4HLQA 4P16A 3GLHA 2EN3A 5AE2A 1OKSA 1YPNA 2JA2A 2VRDA 2LTRA 5E26A 3DJWA 2YTEA 2CUZA 1SXJD 2EM7A 1E32A 2I7PA 4DV0E 4B3TM 1S70A 4B3RE 2N35A 4A3VB 5EP3A 4O43A 5AE1A 1TGUA 1BBGA 1I94M 2EP3A 2QSFX 4JI8M 4UT3A 3ECRA 2DXNA 2JZ1A 3DOAA 2WZOA 1A1IA 5LLQA 1YUIA 4JV5M 3QG5C 2EM4A 1JK7A 1OIZA 1VDLA 3FUUA 1QFCA 3C3DA 1F4IA 3ADIA 5KPRA 2QQ8A 1S8EA 3LCVB 3K9OA 2L2NA 2V87A 1IQOA 2YR0A 2UXBE 3GQ3A 1E9SA 1ZMWA 5BR8E 3W0FA 4FCWA 4J6OA 2EOJA 1X5WA 2RS7A 1ZBTA 4DV2E 2KRUA 2CPNA 2E5LM 2YT4A 5L8RF 1OIEA 2EMCA 4LY6A 4KHPM 4MOYA 4WYQB 1YYOA 4LF6M 3AL0C 1HP1A 2IAEC 5KPZA 3V4YA 3J80S 2JZ0A 1KYIA 3SMPA 5KL3A 2Y0QA 3RL4A 1TH3A 1II7A 3ZQJA 5INBA 3THGA 2WDFA 2LHCA 4I5LC 2J7JA 1I94E 2EOSA 4LF9M 3GQ5A 2C9OA 4QNRA 1ORYB 3HHXA 2ZTDA 2BWEA 3JU0A 1T71A 2YVTA 1NY5A 3KOYE 2L33A 2V89A 1Q39A 1XMOE 1VEJA 5H37D 4D81A 1CUKA 2B3TB 4IJEA 3SAUA 4L6V6 4MM3B 4ORBA 1ZV1A 5TSEA 4H2IA 1XWIA 4LF5E 3CF0A 1HNWM 2UUBE 4G4NA 1KJKA 4LGMA 4F54A 3GPXA 4KBPA 1XNQE 4TUWA 4OW0A 4PT5A 1WHQA 2CV0A 2WDCA 1M63A 1NJFA 3AKZA 4AW4A 2EPAA 1W24A 5EP2A 4IYPC 4V0VA 3U61B 3TQSA 2EM9A 3NBIA 2BQ8X 3GLGA 1Z5AA 1DQ3A 1N36E 4KKZA 4DR5M 4LF6E 2IE4C 3EIEA 5KL6A 1IBMM 1WHCA 2R65A 1BBOA 2XMOA 3A42A 1Z5CA 1T6OA 1OAOC 4ORAA 2IE3C 5FTKA 1NNWA 2LHGA 1WHNA 3QFNA 3GLIB 3RFWA 4EIWA 1R2YA 2BBGA 2QFRA 1IY1A 1Z2XA 3UMMA 3H69A 1HT2E 2XFTA 5BPVA 3KOXE 2EM5A 5EXPA 1S95A 4KO8A 1HNXE 1UFZA 1H6UA 3I01M 2VIIA 4OX9M 3TL4X 2LXEA 3FGAC 5JI3E 3KZYA 2D9HA 4DV3M 1GKIA 4GIPA 1IXSB 1DGBA 1ZBQA 1P47A 2YNMD 2MJ5B 4XPNA 2YWQA 1QQWA 3SHFA 1QHWA 4IBCA 1DO0A 2NUGA 2CE7A 4B3SE 1YUBA 2NA2A 5B8IA 4JI3M 2EOOA 4JI5M 2EOQA 4QOZC 2LE2A 3KDSE 2FNAA 3HU3A 1SG9A 3QWLA 3EPJA 3QYBA 2XFSA 3FRIA 4I8OA 4DR5E 4NRWA 1D2NA 1J26A 1WRJA 1IBME 2HJJA 2ENHA 4PDIA 3E21A 4NXNE 5FTNA 2M7QA 2EL5A 2ZTCA 1QDRA 1NCSA 4R8OA 3V76A 4MOVA 1EKZA 3CTWB 3U6LA 2YRHA 4YHHM 1C1KA 2LNHC 1IN4A 3IVDA 4DT2A 1DI2A 1IXRC 2LVPC 4GC9A 1OIPA 5ITXE 1X49A 2CT1A 4I81A 2K9DA 2EOFA 2YQZA 2NUFA 3IWDA 3CGWA 4IBFA 1QAQA 4NXMM 1W5TA 3GPYA 1OFIA 4BBAA 4Q7FA 2ZBKB 2JVAA 2V86A 3A45A 4JI3E 4JI5E 2UUCE 1IQPA 5EP4A 2X4AA 2EM2A 4IJFA 4MH0E 4WPYA 2LH0A 4JYAE 2C9CA 2G3QA 4S12A 4F9BB 1XZWA 2BJWA 2MR9A 4Z8XA 3T6PA 4LACC 2HHHE 3C5WC 4JI6E 4H2GA 4JI1M 4KZSA 5DYIA 2EPXA 1YZ9A 2CV2A 2JP7A 1J5EM 4WSGA 2F5NA 3GPPA 1G71A 2DGCA 1NV9A 3GQ4A 3FRHA 4B3MM 1A1HA 1MJGM 1DGGA 2GNOA 1IQSA 3NBXX 4NZVA 4IBGA 1N34M 4X64M 3ZCBB 3HHWA 3L27A 1RQ0A 4ZYDA 4F1IA 4NXME 1R2ZA 2DZNB 1N32M 4NOOB 2DWZB 4L16A 1YLAA 3PNYA 3RGSA 1X6FA 3WHKA 1GTKA 2V8QB 3KOZE 2DWLA 1QVRA 2CTDA 3GLFA 4H2BA 2L92A 1IBLM 1PRBA 2DFJA 3FLOA 4FVMA 3A98B 3ZTVA 1L1TA 1G2DC 4IL1A 5JI2E 2DAGA 1DGCA 3OTOE 2YTJA 2OQ4A 4JI1E 2NYLC 1YSAC 1PM5A 3ILKA 4LFBM 4LF4E 2VQFE 3KVWA 3HU1A 3PVSA 1YE9A 4DKKA 1OQYA 5LMUM 2ELZA 1G3IA 4F9CB 1HR0E 2KXEA 2CHGA 2LBCA 4NSRA 1SXJB 3RMPA 1MN3A 4HD0A 2DMIA 3KS4A 4RKUF 5IREB 1C7YA 4LGYA 3DA1A 2EOMA 1XMQE 2K0BX 4DUZE 3CK2A 2QFPA 1WGLA 3T38A 3I4VA 1L1ZA 2DVWB 3SHGB 2YTNA 4R2DA 4M9ZA 4OVZA 2LJUA 1A1KA 4Q7JA 3VK6A 2CHQA 2OOAA 2L4EA 3GP1A 4ZYGA 2KA6B 3MHHC 4R2AA 1Y8GA 4RNAA 4YY3E 3HKPA 1QUTA 1BVSA 2IHR1 2D7EA 2EN7A 4WURA 3GLHB 3M0EA 3PSNA 3FIGA 5IWAE 1PJTA 4LFBE 4GKJE 1XNRE 2EMAA 2DWNA 5KQDA 4FWGA 2EMYA 3AOEA 3JAMC 4KODA 2O8AA 4DR2M 2HL7A 2QHOB 4LG2A 1GZ6A 2JY6B 4IBBA 4LFAM 3DSCA 2DKLA 1AIPC 5C18A 1FNNA 2YTGA 3IWCA 1PJSA 2LVOC 2EPNA 1STUA 2P6BA 2FH0A 2MROB 1QANA 3T1YE 5HPEA 4BBYA 4P7DA 2N3GA 1QUSA 4NRVA 3D03A 1LV7A 3HQ1A 2F4VM 1N75A 5F3WA 3EQ1A 3KZZA 2ZM6E 1S3NA 5EXTA 5FTLA 5EXSA 3BIDA 2X49A 1LLMC 5DNYA 2RGHA 4F0ZA 2CFOA 4LFCM 3DF6A 4X65M 4H1YP 2L09A 1ZAAC 2RSMA 5KL4A 2A5YB 4FW9A 1Q3CA 3ZC7B 2JY8A 2HY1A 4NSOB 4JI7M 3UJNA 2FGGA 2YPNA 3AV0A 5A2QS 3Q8XA 5ITUA 4BC7A 4IJDA 1G5BA 4AKIA 1FKAE 2QNJA 2X8AA 3H62B 5AASA 1HNZE 3EGHA 3K1JA 2RTXA 2CHVA 4DR4M 5C1BA 3SC3A 1GL6A 3FKEA 4J8ZA 2ERCA 1Q3BA 3PXGA 1MEYC 3HZJA 3JTZA 4OOGC 4CISA 2HCBA 3SBJA 3SATA 3FYDA 3A46A 4R2PA 1K3XA 2RKOA 3DSDA 1JK2A 2DWMA 3VK7A 2L6OA 4ZVZA 4DV4E 5A6BA 1IN5A 3LVVA 2PRTA 2KONA 2EPMX 3MSWA 2RRUA 4B7FA 2L3JA 1ZQ9A 4LFCE 2EJ4A 3H60A 2EPRA 1K82A 2LVNC 3PSOA 2XH9A 4MLQA 2D7HA 4R71A 3GLGB 2V85A 1X6HA 3ADLA 2EN8A 2L7HA 2VQEM 3LL8A 1S3MA 2FS1A 1IBKE 4X62M 1YUJA 4AKGA 1W5SA 3Q8GA 3GO8A 3TGHA 3T1HM 2NXFA 1UTEA 1TF3A 2EOYA 1YYKA 4AKHA 3B7QA 3KW6A 2EMXA 3UK3C 3K9PA 1E94E 4F9AB 2LUQA 5E6JA 5A6BD 4DV5M 1DGHA 2I7NA 4BS9A 4B3TE 1D0KA 3T1IA 2QJCA 4NL4H 3SYLA 2L2KB 4WP2A 4H2FA 1QU6A 5JJTA 1I4WA 4JI8E 2ZAMA 4JI0M 3W68A 2G8LA 2OPFA 1A1GA 2W82A 1NSFA 2EQ3A 2LT7A 2ZBMA 4JV5E 1QZMA 1R5LA 3IB8A 2R76A 3M7GA 1T4OA 2YSPA 2XGNA 1HPUA 3TQMA 4I5SA 2Y21A 3PNVA 3BXWA 4GKKM 2KNVA 4X62E 2EJSA 4IS1C 1PJJA 3J81S 3GLIE 1XB2B 1IN6A 2E5LE 4LZJA 5ADZA 2LUPB 1T4LB 4P17A 2BJVA 4KHPE 1V92A 2LMZA 2UUAM 2E1MA 3D8BA 3HVQA 4UWQA 2WSCF 2P5TA 2KOUA 3F6GA 2XZUA 1T39A 2EL4A 4GEQB 2HKJA 3SAVA 2YFQA 2LJHA 3SMSA 4FBWA 2FOIC 3H66A 4DHLA 2ENAA 2VF1A 5A6KA 4LF9E 3K8ZA 4LF8M 2R4EA 5IT9C 1MU5A 7CATA 4XBOA 4M0WA 3VKGA 4M0DA 2APLA 3UZUA 1NNJA 1VG5A 4HEIA 2EMFA 3C3EA 3KWRA 2GQFA 2DZLA 4MLVA 2KEBA 1EH7A 2EMGA 2DAEA 2L2DA 1HNWE 3FUXA 3GRUA 2OOBA 4GITA 1GL7A 2OO9A 1RMDA 2ZANA 3LW5F 4ITQA 1UHZA 2VF7A 1L2BA 3I04M 3HJSA 5DYGA 2C98A 2WSFF 3U5ZA 1UM8A 4CJ6A 3R8FA 2WBSA 5C1VA 3ZH9B 4FD2A 4HEOA 4WFTA 2JYAA 2YTFA 2RSIA 3K7VC 2UXDM 3IG5A 2YRMA 2R44A 5FTJA 4I4LA 2DB2A 1A5TA 1WR1B 1GLNA 2CWBA 1K3WA 1L2CA 2KKNA 4G6ZA 1NY6A 1XXHE 3VFDA 2AHDA 1YSYA
chains in the Genus database with same CATH topology
2K47A 4JI4M 4DMIA 4DV7M 3J7AG 3GLFB 4M30A 5IOHA 1T4NA 2M60A 4OX9E 1KBPA 2Z7JA 3FUVA 4DV3E 1IXZA 4BB9A 2XZFA 2MC6A 4DV6M 4WW0A 1Z2WA 3TPZA 2DMYA 2UXCM 3HPSA 1TDZA 1WXRA 1L8QA 2CV9A 1FJMA 3E7BA 1WXQA 3UK6A 1FJGM 2UXDE 4GHLA 5EXXA 5KQ8A 1NVMA 4Z6YA 2V83A 3W0LB 3VLFB 2QP9X 2D7GA 5EP1A 3IB7A 2BDXA 2Z72A 4L78A 4JN6A 4LJ6A 5LL6R 1QAMA 4YHHE 2BNKA 3GPUA 3ADGA 3ICFA 4OVZB 2L2MA 2FFJA 1UILA 3VDPA 1EE8A 2UU9M 2Y0TA 3HU2A 4REZA 2L7IA 3E0JA 3TE6A 3GVEA 1XC8A 4LTYA 4CGYB 1SXJE 2M4IA 2Z1AA 2ZAOA 4B08A 1IM2A 4QHTA 1X48A 2JOBA 2EA0A 1N33M 3VDUA 3SYKA 3L29A 3QAUA 4XGIA 1J5EE 2Z4SA 3LMLA 5KO3A 4MGKE 3RGPA 3JR5A 4B3ME 3E7AA 3JAMS 3HJQA 2MDRA 4LJ5A 1OI8A 1N34E 4L5NC 4X64E 4MGIE 1O0WA 1XXHA 4X66M 1N32E 2UU9E 2YZTA 2H1RA 3H61A 2R46A 4DR1M 5ITXA 2RS6A 2B7VA 2R17A 2ZOAA 3U6CA 2XF3A 1IBLE 3MJ5A 3U60A 4YKEA 4LJAA 2JY9A 3J7Yp 4IBJA 4K0KM 4DSYA 1JR3A 1WARA 2Z3XA 3J27B 2XEPA 5JPFA 1R7RA 1GQEA 4O24A 2KZSA 4AQYM 3BOSA 5LMUE 1SXJC 3RQZA 2JOGA 1NHGC 3L2AA 4FBQA 2O8GA 1NNUC 4TUIA 3H67A 4GMQA 5FLXC 2Z4RA 2LTSA 3FYCA 5ITRA 3C4TA 4IBEA 5EQVA 1R6BX 1VDDA 1JR3D 4DV1M 3F6HA 2RGOA 2F5OA 4DR6M 3H64A 1USHA 4Q28A 2LBSB 4DV0M 4B7HA 1YYWA 4B3RM 4LCBA 2YEQA 4MGZE 3U6MA 3D8LA 1TCOA 3I4YA 3NWLA 1S3SA 1DGHB 3QFKA 5KPTA 1IN8A 3K92A 2CEAA 4AG5A 4DR2E 3E9SA 3C58A 4G9JA 2FE8A 1NJGA 2O5RA 2R62A 2G5GX 1IT6A 4LFAE 2NPPC 4CHTB 4B7GA 2UXBM 5BR8M 2NUEA 2M5ZA 4DV2M 3SFZA 2EUCA 4DV1E 3C4BA 3TWKA 2Y20A 3FD9A 4X8WA 3IVEA 2F4VE 4DR6E 4MP0A 3THNA 5JPEA 2F5SA 2F8BA 5LMNM 2WDDA 2QBYA 3LLHA 4X65E 3KFUG 2NQ8C 1T3TA 4JI2M 2DSYA 4L8RC 4GHAA 4MGHA 3T15A 1L2DA 4JI7E 2EO2A 3RE8A 3SASA 3RL3A 3TWMA 3L26A 3HGIA 4BC9A 4MB7A 1XMOM 2BCDA 3FTDA 3P71C 4OU7A 2HYOA 4DR4E 4LF5M 3FUTA 2UUBM 4I5NC 4WWLA 4P78A 1QYRA 1G8PA 3VYYA 5A2QC 1XNQM 1G4AE 1MF8A 1JQJC 3ZOQB 5EQTA 2B7TA 4JA9A 3VK8A 2WDEA 3J2PB 1TH4A 3LVWA 4PD2A 3JYFA 2LWXA 4RF1A 1AUIA 2DHRA 1N36M 3EIHA 5IT9S 2V6ZM 5LMNE 1UF3A 2L3CA 3U6QA 1ZAEA 3M6AA 1DO2A 4JI2E 3U5ZB 2KW0A 3FTCA 2VQEE 3KSXA 2DIXA 3IWBA 3U6DA 1HT1E 2KRKA 5ITTA 2HYPA 2R18A 3T1HE 2KZUA 4M0VA 3U6PA 1HNXM 4L4UA 1KSFX 3P1XA 4DV5E 4QHSA 4ZPXA 3J7BA 4IIWA 4B3SM 1IY0A 3HJ8A 4BLCA 2ODRC 4JI0E 5EJCA 2Q2EB 2C5RA 3MK6A 3J80C 2V88A 3THOB 2JOXA 4NXNM 4AI6A 1J09A 4LF7M 2XSZA 5ITQA 1IY2A 1SR9A 4HL4A 4GKKE 4GRIA 4D80A 1TH2A 4M2ZA 2VE7C 8CATA 4O5GA 1KFVA 3SARA 2B9DA 3KP1E 4O4KA 1QAOA 1X47A 3J7AS 4BCAA 5CFFE 1N77A 2UUAE 3J81C 1HO5A 3RL5A 3R9XB 3GRRA 3DZDA 1NHWC 4QOSA 2UUCM 5FSWA 3UGJA 4LF8E 2XSZD 3K2LA 3U6OA 2DZOB 3HTXA 1OFHA 2A22A 4JYAM 4PDGA 4WSPA 4LRTA 2Z06A 4D82A 4FCXA 4TUGA 2V1CA 1HQCA 4LF7E 2C99A 4ZX2A 2HHHM 1OIDA 3U61A 4DR7M 3KOWE 4JI6M 4LJ9A 2G7HA 4IBKA 2JWOA 3HHYA 2ODRD 3H68A 1XM7A 1U32A 3TWLA 2C96A 2QENA 3ADJA 1DGFA 4MGYE 5GTUA 1E9RA 3DW8C 3PFIA 3GLIA 2M1SA 1J7KA 1PJIA 1X37A 1HQYE 4G4OA 3L25A 2QCUA 1XXHB 5GKNA 5FTMA 3HXLA 4JI4E 4BMJA 1TDHA 4W5WA 3VYXA 3LQQA 3H4MA 3AFHA 4DV7E 4IBIA 2LRSA 3QFOA 5T6JA 1GVNA 2AHMA 4DR7E 3OTOM 4GH9A 3N5UA 4LF4M 2QZ4A 2VQFM 3U60B 3KSJA 3CF2A 3LMMA 2Q8UA 3KXEC 3AJIB 4DV6E 1HR0M 3GRYA 2UXCE 1MX0A 4H1SA 3B9PA 3KS8A 4LU9A 2F5QA 4KLNA 3GRVA 5J28A 2EWLA 4V0XA 4G4QA 1FJGE 1XMQM 4DUZM 4JA7A 3MHVC 3QFMA 2JR1A 4DUYM 4LZZA 1V73A 4AG6A 1S3LA 4ORCA 4LRSA 2KHXA 3EGGA 3FTFA 4FCTA 4YY3M 1XHBA 2GJUA 1Z5BA 3HHZA 4DR3M 3K6QA 2V1UA 5IWAM 4R3DA 4GKJM 1OJLA 1XNRM 2DXLA 3SAWA 4G4RA 5FLXS 3IG8A 1N78A 3DFZA 3K7WC 4UT2A 3H09A 4QNMA 4PCZA 1T70A 4AZFA 3AOEC 3FTEA 2EZ6A 3OMLA 2R4JA 1G41A 3KP0E 4DUYE 3L28A 4FWHA 3T1YM 3HPZA 2DXIA 1N33E 4L8NA 2QPAA 4B2OA 4M9XA 2F5PA 2ZM6M 4OR9A 4RF0A 2MC5A 4DR3E 2NYMC 3I51A 2L6MA 3LQRA 4X66E 4FCVA 3U6EA 3KBPA 3H63A 2QBYB 2K4VA 4FWDA 3JR4A 2USHA 2FV4B 2L8TA 4DR1E 1HNZM 4V0WA 4IBDA 4UT3B 3ZU0A 5AE3A 1IN7A 1PKPA 1Z59A 4K0KE 4R03A 1RC7A 3AOGA 3VKHA 2J7NA 2XLJA 4DV4M 1SXJA 1WAO1 3E4RA 4FBKA 3U6SA 3HWSA 4GC5A 2ZO9B 3FUWA 4AQYE 4LJ7A 1SU1A 2H36X 2R45A 4L15A 2J7OA 4R7GA 3AUZA 4LJ4A 5IZ7D 5ITYA 3C9FA 2FTXB 1IBKM 3CF6E 2N3HA 4II7A 4JXJA 2CV1A 1Z6TA 4M9SA 3WHLA 1G59A 4LJ8A 4HLQA 4P16A 3GLHA 5AE2A 2JA2A 2LTRA 5E26A 3DJWA 2CUZA 1SXJD 1E32A 2I7PA 4DV0E 4B3TM 1S70A 4B3RE 4A3VB 5EP3A 4O43A 5AE1A 1TGUA 1I94M 4JI8M 4UT3A 2DXNA 3DOAA 2WZOA 4JV5M 3QG5C 1JK7A 3FUUA 1QFCA 3ADIA 5KPRA 1S8EA 2L2NA 2V87A 2YR0A 2UXBE 3GQ3A 1E9SA 5BR8E 3W0FA 4FCWA 4J6OA 2RS7A 1ZBTA 4DV2E 2KRUA 2CPNA 2E5LM 2YT4A 1OIEA 4LY6A 4KHPM 4MOYA 4WYQB 1YYOA 4LF6M 3AL0C 1HP1A 2IAEC 5KPZA 3V4YA 3J80S 1KYIA 3SMPA 2Y0QA 3RL4A 1TH3A 1II7A 5INBA 3THGA 2WDFA 4I5LC 1I94E 4LF9M 3GQ5A 2C9OA 4QNRA 1ORYB 3HHXA 3JU0A 1T71A 2YVTA 1NY5A 3KOYE 2L33A 2V89A 1Q39A 1XMOE 5H37D 4D81A 2B3TB 4IJEA 3SAUA 4MM3B 4ORBA 4H2IA 1XWIA 4LF5E 3CF0A 1HNWM 2UUBE 4G4NA 4LGMA 4F54A 3GPXA 4KBPA 1XNQE 4TUWA 4OW0A 4PT5A 1WHQA 2CV0A 2WDCA 1M63A 1NJFA 3AKZA 4AW4A 1W24A 5EP2A 4IYPC 4V0VA 3U61B 3TQSA 3NBIA 2BQ8X 3GLGA 1Z5AA 1DQ3A 1N36E 4KKZA 4DR5M 4LF6E 2IE4C 3EIEA 1IBMM 2R65A 2XMOA 3A42A 1Z5CA 4ORAA 2IE3C 5FTKA 1NNWA 1WHNA 3QFNA 3GLIB 3RFWA 4EIWA 1R2YA 2QFRA 1IY1A 1Z2XA 3H69A 3UMMA 1HT2E 2XFTA 5BPVA 3KOXE 5EXPA 1S95A 4KO8A 1HNXE 1H6UA 2VIIA 4OX9M 3TL4X 2LXEA 3FGAC 5JI3E 4DV3M 1GKIA 4GIPA 1IXSB 1DGBA 1ZBQA 2YNMD 4XPNA 1QQWA 3SHFA 1QHWA 4IBCA 1DO0A 2NUGA 2CE7A 4B3SE 1YUBA 2NA2A 5B8IA 4JI3M 4JI5M 4QOZC 2LE2A 3KDSE 2FNAA 3HU3A 3QWLA 2XFSA 4I8OA 4DR5E 4NRWA 1D2NA 1J26A 1IBME 4PDIA 4NXNE 5FTNA 2M7QA 4R8OA 4MOVA 1EKZA 3CTWB 3U6LA 4YHHM 1C1KA 2LNHC 1IN4A 3IVDA 4DT2A 1DI2A 1IXRC 4GC9A 5ITXE 1X49A 4I81A 2YQZA 2NUFA 3IWDA 4NXMM 4IBFA 1QAQA 1W5TA 3GPYA 1OFIA 4BBAA 4Q7FA 2ZBKB 2JVAA 2V86A 3A45A 4JI3E 4JI5E 2UUCE 1IQPA 5EP4A 2X4AA 4IJFA 4MH0E 4WPYA 2LH0A 4JYAE 2C9CA 4S12A 4F9BB 1XZWA 2BJWA 4Z8XA 4LACC 2HHHE 3C5WC 4JI6E 4H2GA 4JI1M 4KZSA 5DYIA 1YZ9A 2CV2A 1J5EM 2F5NA 3GPPA 3GQ4A 4B3MM 1DGGA 4NZVA 4IBGA 1N34M 4X64M 3ZCBB 3HHWA 3L27A 1RQ0A 4NXME 1R2ZA 2DZNB 1N32M 4NOOB 2DWZB 4L16A 3PNYA 3RGSA 3WHKA 2V8QB 3KOZE 2DWLA 1QVRA 3GLFA 4H2BA 2L92A 1IBLM 2DFJA 3FLOA 4FVMA 3A98B 3ZTVA 1L1TA 4IL1A 5JI2E 3OTOE 2OQ4A 4JI1E 2NYLC 1PM5A 3ILKA 4LFBM 4LF4E 2VQFE 3KVWA 3HU1A 3PVSA 1YE9A 4DKKA 5LMUM 1HR0E 1G3IA 4F9CB 2KXEA 2CHGA 4NSRA 1SXJB 3RMPA 4HD0A 3KS4A 5IREB 4LGYA 3DA1A 1XMQE 4DUZE 3CK2A 2QFPA 3T38A 3I4VA 1L1ZA 2DVWB 3SHGB 4M9ZA 4OVZA 3VK6A 2CHQA 3GP1A 2KA6B 4RNAA 4YY3E 3HKPA 2IHR1 2D7EA 4WURA 3GLHB 3M0EA 3PSNA 3FIGA 5IWAE 4LFBE 4GKJE 1XNRE 2DWNA 5KQDA 4FWGA 3AOEA 3JAMC 4KODA 2O8AA 4DR2M 2HL7A 4LG2A 1GZ6A 4IBBA 4LFAM 3DSCA 5C18A 1FNNA 3IWCA 1STUA 2P6BA 1QANA 3T1YE 5HPEA 4BBYA 4P7DA 2N3GA 4NRVA 3D03A 1LV7A 3HQ1A 2F4VM 1N75A 5F3WA 2ZM6E 1S3NA 5EXTA 5FTLA 5EXSA 2X49A 5DNYA 2RGHA 4F0ZA 2CFOA 4LFCM 3DF6A 4X65M 4H1YP 2L09A 2RSMA 2A5YB 4FW9A 1Q3CA 3ZC7B 2HY1A 4NSOB 4JI7M 3UJNA 2FGGA 3AV0A 5A2QS 3Q8XA 5ITUA 4BC7A 1G5BA 4AKIA 1FKAE 2X8AA 3H62B 5AASA 1HNZE 3EGHA 3K1JA 2RTXA 2CHVA 4DR4M 5C1BA 3SC3A 1GL6A 3FKEA 4J8ZA 2ERCA 1Q3BA 3PXGA 3JTZA 4OOGC 4CISA 2HCBA 3SBJA 3SATA 3FYDA 3A46A 1K3XA 2RKOA 3DSDA 2DWMA 3VK7A 2L6OA 4ZVZA 4DV4E 1IN5A 3LVVA 2KONA 3MSWA 4B7FA 2L3JA 1ZQ9A 4LFCE 3H60A 1K82A 3PSOA 2XH9A 2D7HA 3GLGB 2V85A 3ADLA 2L7HA 2VQEM 3LL8A 1S3MA 1IBKE 4X62M 4AKGA 1W5SA 3GO8A 3TGHA 3T1HM 2NXFA 1UTEA 1YYKA 4AKHA 3KW6A 1E94E 4F9AB 2LUQA 5E6JA 4DV5M 1DGHA 2I7NA 4BS9A 4B3TE 3T1IA 2QJCA 4NL4H 3SYLA 2L2KB 4H2FA 1QU6A 5JJTA 1I4WA 4JI8E 2ZAMA 4JI0M 2G8LA 2OPFA 2W82A 1NSFA 2ZBMA 4JV5E 1QZMA 3IB8A 3M7GA 1T4OA 2XGNA 1HPUA 4I5SA 2Y21A 3PNVA 4GKKM 4X62E 1PJJA 3J81S 1IN6A 2E5LE 4LZJA 5ADZA 2LUPB 1T4LB 2BJVA 4KHPE 2LMZA 2UUAM 2E1MA 3D8BA 3HVQA 4UWQA 2P5TA 2KOUA 3F6GA 2XZUA 4GEQB 2HKJA 3SAVA 2YFQA 2LJHA 4FBWA 3SMSA 2FOIC 3H66A 4DHLA 2VF1A 4LF9E 3K8ZA 4LF8M 2R4EA 5IT9C 1MU5A 7CATA 4XBOA 4M0WA 3VKGA 4M0DA 3UZUA 1NNJA 3KWRA 2KEBA 1HNWE 3FUXA 3GRUA 4GITA 1GL7A 2ZANA 4ITQA 1UHZA 1L2BA 3HJSA 5DYGA 2C98A 3U5ZA 1UM8A 3R8FA 5C1VA 3ZH9B 4FD2A 4WFTA 3K7VC 2UXDM 3IG5A 5FTJA 4I4LA 2DB2A 1GLNA 1K3WA 1L2CA 2KKNA 4G6ZA 1NY6A 3VFDA 2AHDA 1YSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBK A;  4IL1 A;  3QFN A;  3H60 A;  4Q7F A;  3HVQ A;  3QFO A;  3GVE A;  1OIE A;  2P6B A;  2NYL C;  1HO5 A;  1SU1 A;  3PSO A;  2QFR A;  4LTY A;  1Z2X A;  4MOY A;  4O24 A;  4UWQ A;  3RL5 A;  3H69 A;  5HPE A;  3IVE A;  4MP0 A;  3THN A;  3AUZ A;  2Z1A A;  5IOH A;  3LL8 A;  3N5U A;  3RQZ A;  1HP1 A;  1S3M A;  2HYP A;  5JPE A;  1S95 A;  2JOG A;  2IAE C;  1KBP A;  4M0V A;  5F3W A;  4FBQ A;  3C9F A;  3V4Y A;  4FBW A;  3H66 A;  2Q8U A;  4DHL A;  3RL4 A;  2O8G A;  2WDD A;  1II7 A;  3TGH A;  2NXF A;  1S3N A;  3FGA C;  5INB A;  1UTE A;  4TUI A;  1XZW A;  2WDF A;  2A22 A;  3H67 A;  4I5L C;  4B2O A;  4HD0 A;  4H1S A;  4OR9 A;  5DNY A;  2Z06 A;  4LU9 A;  4XPN A;  1Z2W A;  4F0Z A;  5J28 A;  4FCX A;  4TUG A;  4LAC C;  4H1Y P;  4V0X A;  3C5W C;  1QHW A;  3CK2 A;  5EQV A;  2QFP A;  4H2G A;  4ZX2 A;  5B8I A;  1T71 A;  1OID A;  2HY1 A;  2YVT A;  2CV9 A;  4JA7 A;  2NYM C;  3E7A A;  1FJM A;  3E7B A;  3QFM A;  3RL3 A;  3H64 A;  1OI8 A;  3T1I A;  2QJC A;  1USH A;  1V73 A;  2BCD A;  1S70 A;  3AV0 A;  4NZV A;  3P71 C;  4ORB A;  3KBP A;  3H68 A;  3H63 A;  4H2F A;  4H2I A;  1G5B A;  1S3L A;  5JJT A;  1XM7 A;  4O43 A;  2HYO A;  4ORC A;  1U32 A;  2USH A;  3H62 B;  4KBP A;  3EGH A;  3EGG A;  3H61 A;  4I5N C;  4WWL A;  2WDC A;  3IB7 A;  3THO B;  1M63 A;  2BDX A;  2Z72 A;  4UT3 A;  2GJU A;  4V0W A;  2ZBM A;  1MF8 A;  1TCO A;  3DW8 C;  5GTU A;  3PSN A;  5C1V A;  1W24 A;  2R17 A;  3IB8 A;  4UT3 B;  4IYP C;  3ZU0 A;  4V0V A;  4MOV A;  3QFK A;  1HPU A;  4JA9 A;  3ICF A;  3QG5 C;  2BQ8 X;  2WDE A;  1JK7 A;  1QFC A;  4KKZ A;  3K7V C;  3IVD A;  4DT2 A;  3JYF A;  4G9J A;  3DSD A;  1AUI A;  2IE4 C;  1S8E A;  4YKE A;  4H2B A;  4O5G A;  2O8A A;  4ZVZ A;  1IT6 A;  1UF3 A;  2NPP C;  2XMO A;  4O4K A;  4DSY A;  3K7W C;  4UT2 A;  1WAR A;  2DFJ A;  2KKN A;  4ORA A;  2IE3 C;  1WAO 1;  3DSC A;  1T70 A;  3ZTV A;  2AHD A;  5JPF A;  4J6O A;  1NNW A; 
#chains in the Genus database with same CATH topology
 2K47 A;  4JI4 M;  4DMI A;  1DV0 A;  1GJT A;  4DV7 M;  3J7A G;  3GLF B;  4M30 A;  5IOH A;  2ENC A;  1T4N A;  2M60 A;  4OX9 E;  1KBP A;  2Z7J A;  3FUV A;  4DV3 E;  1GAB A;  1IXZ A;  1QZE A;  4BB9 A;  2XZF A;  2MC6 A;  4DV6 M;  4WW0 A;  1Z2W A;  3TPZ A;  2DMY A;  1WIV A;  2UXC M;  1TDZ A;  3HPS A;  1JR3 E;  1WXR A;  1L8Q A;  2CV9 A;  1FJM A;  3E7B A;  1WXQ A;  3UK6 A;  1FJG M;  2CRU A;  2UXD E;  4GHL A;  5EXX A;  5KQ8 A;  1NVM A;  4Z6Y A;  2V83 A;  3EPH A;  3W0L B;  2K6B A;  3VLF B;  2QP9 X;  5KL2 A;  2D7G A;  5EP1 A;  2MKD A;  3IB7 A;  2BDX A;  2YTD A;  4Q35 B;  2DAM A;  1JK1 A;  2Z72 A;  4L78 A;  4JN6 A;  4LJ6 A;  4HTG A;  5LL6 R;  1T43 A;  2DAI A;  1QAM A;  4YHH E;  2BNK A;  3GPU A;  3B7N A;  3ADG A;  3ICF A;  4OVZ B;  3IHP A;  2L2M A;  2FFJ A;  4BHB A;  2ADR A;  1UIL A;  3VDP A;  1WGN A;  1EE8 A;  1YFH A;  2UU9 M;  2Y0T A;  3HU2 A;  4REZ A;  2L7I A;  1D0M A;  3E0J A;  4NC6 A;  3TE6 A;  3GVE A;  2YSO A;  1XC8 A;  4LTY A;  4CGY B;  1SXJ E;  2M4I A;  2Z1A A;  4NHR A;  2ZAO A;  2BB8 A;  2E72 A;  4B08 A;  1IM2 A;  4QHT A;  1X48 A;  2Z8Y M;  2JOB A;  2EA0 A;  1N33 M;  2WZJ A;  2EMW A;  3VDU A;  3SYK A;  2EM6 A;  3L29 A;  5AC4 A;  5AC5 A;  3QAU A;  2JXP A;  4XGI A;  1PJQ A;  1J5E E;  3QYE A;  2Z4S A;  2HGH A;  3LML A;  1RU3 A;  5KO3 A;  4MGK E;  3RGP A;  3JR5 A;  4B3M E;  3E7A A;  2LVQ D;  3JAM S;  3HJQ A;  2MDR A;  4LJ5 A;  1OI8 A;  1N34 E;  4L5N C;  2DRP A;  2YTP A;  4X64 E;  4MGI E;  1O0W A;  2M9A A;  1XXH A;  4X66 M;  1NV8 A;  2WBT A;  1N32 E;  2MGW A;  2UU9 E;  2YZT A;  1TR8 A;  2H1R A;  3H61 A;  2R46 A;  2EOH A;  2DI0 A;  4DR1 M;  4RHB B;  2RS6 A;  5ITX A;  2ELY A;  2B7V A;  2EMZ A;  2R17 A;  3B74 A;  2ZOA A;  3U6C A;  1MGT A;  2XF3 A;  1IBL E;  3MJ5 A;  1WJ7 A;  3U60 A;  4YKE A;  4LJA A;  1A1F A;  1T38 A;  2JY9 A;  5IV8 B;  3J7Y p;  4IBJ A;  4K0K M;  4DSY A;  1JR3 A;  1WAR A;  1JB0 F;  1F2I G;  1TN9 A;  2Z3X A;  3J27 B;  2XEP A;  5JPF A;  1R7R A;  2WSE F;  1GQE A;  4O24 A;  2KZS A;  4AQY M;  1D0L A;  1OTR A;  3BOS A;  5LMU E;  4FK5 C;  1SXJ C;  3RQZ A;  2JOG A;  1NHG C;  3L2A A;  4FBQ A;  2VDB B;  2O8G A;  1NNU C;  4TUI A;  3H67 A;  4GMQ A;  5IXM B;  5FLX C;  2WCC 3;  2EOR A;  2HC5 A;  2Z4R A;  2LTS A;  4R2R A;  1QDT A;  3FYC A;  2EPC A;  5ITR A;  3C4T A;  4IBE A;  5EQV A;  2EQ1 A;  1R6B X;  1VDD A;  1JR3 D;  2EMK A;  4DV1 M;  3F6H A;  2RGO A;  4WX9 A;  2F5O A;  4DR6 M;  3H64 A;  4UN2 B;  4WXD A;  2R6F A;  1USH A;  4Q28 A;  2LBS B;  4DV0 M;  3FE3 A;  3VHT B;  4R2C A;  4B7H A;  1YYW A;  1PGY A;  2YRK A;  4WXC A;  4B3R M;  1NO1 A;  2EOX A;  4LCB A;  2YEQ A;  4MGZ E;  1IFY A;  3U6M A;  1IMU A;  3D8L A;  1TCO A;  3I4Y A;  1R4G A;  3NWL A;  2EL6 A;  1S3S A;  1DGH B;  2O01 F;  4ZYH A;  3QFK A;  5KPT A;  1IN8 A;  3K92 A;  2CEA A;  4AG5 A;  4DR2 E;  4BHC A;  3E9S A;  3C58 A;  4G9J A;  2FE8 A;  1NJG A;  2LV2 A;  2O5R A;  2R62 A;  2G5G X;  1IT6 A;  4LFA E;  2NPP C;  5A69 A;  4GEW A;  4CHT B;  1NEI A;  4B7G A;  2DLQ A;  2UXB M;  4GZN C;  5BR8 M;  4KWY A;  2NUE A;  2M5Z A;  4DV2 M;  3SFZ A;  2EUC A;  4DV1 E;  3C4B A;  2DAK A;  3TWK A;  4G3O A;  2Y20 A;  3FD9 A;  4X8W A;  4R2S A;  3IVE A;  2F4V E;  4DR6 E;  4MP0 A;  3THN A;  3L00 A;  5JPE A;  2F5S A;  2YTI A;  2F8B A;  5LMN M;  2WDD A;  2QBY A;  3LLH A;  4X65 E;  3KFU G;  2NQ8 C;  3BGH A;  1T3T A;  4JI2 M;  2DSY A;  4L8R C;  4GHA A;  4MGH A;  2YTQ A;  3T15 A;  1L2D A;  4JI7 E;  2O25 A;  2YTO A;  2EO2 A;  3RE8 A;  3SAS A;  3RL3 A;  1P3Q Q;  3TWM A;  3L26 A;  3HGI A;  4BC9 A;  4MB7 A;  1XMO M;  4R2E A;  2BCD A;  3FTD A;  3P71 C;  3HY5 A;  2JUJ A;  1VQ1 A;  4OU7 A;  2HYO A;  4DR4 E;  4ZYE A;  4LF5 M;  3MHS C;  3FUT A;  2UUB M;  4I5N C;  4WWL A;  4P78 A;  1QYR A;  1G8P A;  5A6A A;  3VYY A;  5A2Q C;  1XNQ M;  1G4A E;  1MF8 A;  1JQJ C;  3ZOQ B;  5EQT A;  2KDL A;  2B7T A;  4JA9 A;  3VK8 A;  1G2F C;  2WDE A;  3J2P B;  1TH4 A;  3LVW A;  4PD2 A;  2LO3 A;  3JYF A;  2LWX A;  4RF1 A;  1AUI A;  2DHR A;  2EE8 A;  1BB8 A;  1N36 M;  3EIH A;  5IT9 S;  2V6Z M;  5LMN E;  1UF3 A;  2L3C A;  2L4F A;  5A6J A;  2NAB A;  3U6Q A;  1ZAE A;  3M6A A;  1TTE A;  1DO2 A;  2EKK A;  4JI2 E;  3U5Z B;  1A1J A;  2KW0 A;  3FTC A;  2EPK X;  3B7Z A;  1L4S A;  4ANR A;  1UBD C;  2VQE E;  3KSX A;  2DIX A;  4R2Q A;  1HJP A;  3IWB A;  3U6D A;  1HT1 E;  2KRK A;  4DBG B;  5ITT A;  1VEK A;  2HYP A;  2R18 A;  3T1H E;  2KZU A;  1LTM A;  4M0V A;  3BBZ A;  3U6P A;  2JY5 A;  1HNX M;  2K7I A;  4F6N A;  4L4U A;  1KSF X;  3P1X A;  1ZMV A;  2MH8 A;  4DV5 E;  3HX3 A;  4QHS A;  2EPL X;  2EKF A;  1A1L A;  2GHF A;  2JY7 A;  2KHH A;  4ZPX A;  3J7B A;  4IIW A;  4B3S M;  1IY0 A;  3HJ8 A;  4BLC A;  2ODR C;  4JI0 E;  5EJC A;  1ZR9 A;  2Q2E B;  2C5R A;  3MK6 A;  3J80 C;  2V88 A;  3THO B;  2JOX A;  4NXN M;  4AI6 A;  1J09 A;  4LF7 M;  2XSZ A;  1Q02 A;  5ITQ A;  1IY2 A;  2R1F A;  2I13 A;  5KL5 A;  1SR9 A;  4HL4 A;  4GKK E;  1GO5 A;  4GRI A;  4D80 A;  1TH2 A;  4M2Z A;  3C9P A;  2VE7 C;  2EPP A;  8CAT A;  4O5G A;  1KFV A;  1EH6 A;  3SAR A;  2B9D A;  3KP1 E;  4O4K A;  1QAO A;  2WBU A;  1X47 A;  3J7A S;  2KNZ A;  4BCA A;  5CFF E;  3GLF E;  1N77 A;  2UUA E;  4F6M A;  3J81 C;  1HO5 A;  3RL5 A;  3R9X B;  3GRR A;  2EN2 A;  1UN6 B;  3DZD A;  1NHW C;  4QOS A;  2UUC M;  3EPK A;  5FSW A;  1V34 A;  2B3T A;  3UGJ A;  2HAK A;  1EFU B;  4LF8 E;  2XSZ D;  3K2L A;  3U6O A;  3C6M A;  2DZO B;  3HTX A;  1OFH A;  2CSH A;  2BWB A;  2A22 A;  4JYA M;  4PDG A;  4WSP A;  4LRT A;  3IEC A;  2Z06 A;  3F92 A;  4D82 A;  4FCX A;  2EOE A;  4TUG A;  2YU8 A;  2V1C A;  1HQC A;  4LF7 E;  2C99 A;  2GPI A;  4ZX2 A;  2HHH M;  1OID A;  3U61 A;  4DR7 M;  3MMP A;  3KOW E;  4JI6 M;  2HWJ A;  4LJ9 A;  2G7H A;  4IBK A;  2JWO A;  2RPC A;  4M9V C;  3HHY A;  2ODR D;  3H68 A;  3M99 B;  1XM7 A;  2RQL A;  1U32 A;  1N3G A;  2GLI A;  1X3C A;  3TWL A;  2C96 A;  2QEN A;  1DGF A;  4MGY E;  4F2L A;  3ADJ A;  1E9R A;  3DW8 C;  5GTU A;  3PFI A;  1AH5 A;  3GLI A;  2M1S A;  1J7K A;  2R0I A;  1PJI A;  3E46 A;  1X37 A;  4CIZ A;  1HQY E;  4G4O A;  3L25 A;  2QCU A;  1XXH B;  1QNT A;  2YU5 A;  2EN6 A;  2EM0 A;  5GKN A;  1VEG A;  5FTM A;  3HXL A;  4N4R B;  4JI4 E;  1IXS A;  4BMJ A;  1TDH A;  2EM3 A;  4W5W A;  3VYX A;  2LTU A;  3LQQ A;  2J5Y A;  3H4M A;  3AFH A;  4DV7 E;  4IBI A;  2KNA A;  2LRS A;  3QFO A;  2N8X A;  5T6J A;  2DEN A;  1GVN A;  2AHM A;  4DR7 E;  3OTO M;  4GH9 A;  2VF8 A;  2EPO A;  4RH8 A;  3N5U A;  4LF4 M;  1Z1B A;  2QZ4 A;  2VQF M;  3U60 B;  3KSJ A;  3CF2 A;  3LMM A;  1AAY A;  3W67 A;  2Q8U A;  3KXE C;  3AJI B;  4DV6 E;  1HR0 M;  3GRY A;  4X9J A;  2UXC E;  1MX0 A;  4H1S A;  3B9P A;  3KS8 A;  4LU9 A;  2F5Q A;  4KLN A;  3GRV A;  5J28 A;  2EWL A;  4V0X A;  4G4Q A;  1FJG E;  1XMQ M;  4DUZ M;  4JA7 A;  3MHV C;  3QFM A;  2JR1 A;  4DUY M;  3BBG A;  4LZZ A;  1V73 A;  4AG6 A;  2EPU A;  1ZU1 A;  1S3L A;  4ORC A;  4LRS A;  2EOI A;  2KHX A;  3EGG A;  3FTF A;  4FCT A;  4YY3 M;  1XHB A;  2GJU A;  1Z5B A;  2EQ0 A;  3HHZ A;  1PDA A;  4DR3 M;  3K6Q A;  2V1U A;  2H5X A;  2EPZ A;  3GLH E;  1KYQ A;  5IWA M;  4R3D A;  4GKJ M;  1OJL A;  1XNR M;  2DXL A;  3SAW A;  4G4R A;  2EOZ A;  5FLX S;  3IG8 A;  1N78 A;  1GJS A;  3DFZ A;  3K7W C;  4UT2 A;  3H09 A;  4QNM A;  4PCZ A;  1T70 A;  2JXN A;  4AZF A;  3AOE C;  3FTE A;  2EZ6 A;  3OML A;  2R4J A;  1G41 A;  4XK8 F;  4KT0 F;  3KP0 E;  4DUY E;  3EPL A;  2EM8 A;  3L28 A;  4FWH A;  3T1Y M;  3HPZ A;  2DXI A;  2A25 A;  2LCE A;  1N33 E;  4Y28 F;  4L8N A;  2EN4 A;  2QPA A;  1X6E A;  1ZMU A;  4B2O A;  4M9X A;  2F5P A;  2ZM6 M;  2DHY A;  2EML A;  2JPA A;  4OR9 A;  4RF0 A;  1SFE A;  2MC5 A;  2LVA A;  4DR3 E;  3BF2 A;  2DLK A;  5DFL A;  2NYM C;  3I51 A;  2L6M A;  3LQR A;  4X66 E;  4FCV A;  3C6K A;  3U6E A;  2EMB A;  3LCU A;  1AUA A;  3KBP A;  3H63 A;  2QBY B;  2K4V A;  4FWD A;  3JR4 A;  2USH A;  2FV4 B;  2L8T A;  4DR1 E;  2EN1 A;  3H4J A;  3B89 A;  1TF0 B;  1HNZ M;  4V0W A;  4IBD A;  4UT3 B;  3ZU0 A;  1B69 A;  5AE3 A;  2JP9 A;  1IN7 A;  1PKP A;  2MKN A;  4F2J C;  1Z59 A;  2EMI A;  1V33 A;  5KL7 A;  4K0K E;  1EIJ A;  1TF6 A;  4R03 A;  1RC7 A;  3AOG A;  2DNA A;  3VKH A;  2J7N A;  2XLJ A;  2JNH A;  2MDG A;  4DV4 M;  1SXJ A;  1WAO 1;  2EMH A;  3E4R A;  1EH8 A;  4FBK A;  1OAI A;  3U6S A;  3HWS A;  4GC5 A;  2ZO9 B;  3FUW A;  4AQY E;  2CP8 A;  4LJ7 A;  1SU1 A;  2H36 X;  2R45 A;  4L15 A;  2I9I A;  2J7O A;  4R7G A;  3AUZ A;  4LJ4 A;  5IZ7 D;  5ITY A;  2LVH A;  3C9F A;  3GLG E;  1WJP A;  2JWS A;  2FTX B;  1IBK M;  3CF6 E;  2N3H A;  4II7 A;  4JXJ A;  2CV1 A;  1Z6T A;  4M9S A;  3WHL A;  1G59 A;  4LJ8 A;  4HLQ A;  4P16 A;  3GLH A;  2EN3 A;  5AE2 A;  1OKS A;  1YPN A;  2JA2 A;  2VRD A;  2LTR A;  5E26 A;  3DJW A;  2YTE A;  2CUZ A;  1SXJ D;  2EM7 A;  1E32 A;  2I7P A;  4DV0 E;  4B3T M;  1S70 A;  4B3R E;  2N35 A;  4A3V B;  5EP3 A;  4O43 A;  5AE1 A;  1TGU A;  1BBG A;  1I94 M;  2EP3 A;  2QSF X;  4JI8 M;  4UT3 A;  3ECR A;  2DXN A;  2JZ1 A;  3DOA A;  2WZO A;  1A1I A;  5LLQ A;  1YUI A;  4JV5 M;  3QG5 C;  2EM4 A;  1JK7 A;  1OIZ A;  1VDL A;  3FUU A;  1QFC A;  3C3D A;  1F4I A;  3ADI A;  5KPR A;  2QQ8 A;  1S8E A;  3LCV B;  3K9O A;  2L2N A;  2V87 A;  1IQO A;  2YR0 A;  2UXB E;  3GQ3 A;  1E9S A;  1ZMW A;  5BR8 E;  3W0F A;  4FCW A;  4J6O A;  2EOJ A;  1X5W A;  2RS7 A;  1ZBT A;  4DV2 E;  2KRU A;  2CPN A;  2E5L M;  2YT4 A;  5L8R F;  1OIE A;  2EMC A;  4LY6 A;  4KHP M;  4MOY A;  4WYQ B;  1YYO A;  4LF6 M;  3AL0 C;  1HP1 A;  2IAE C;  5KPZ A;  3V4Y A;  3J80 S;  2JZ0 A;  1KYI A;  3SMP A;  5KL3 A;  2Y0Q A;  3RL4 A;  1TH3 A;  1II7 A;  3ZQJ A;  5INB A;  3THG A;  2WDF A;  2LHC A;  4I5L C;  2J7J A;  1I94 E;  2EOS A;  4LF9 M;  3GQ5 A;  2C9O A;  4QNR A;  1ORY B;  3HHX A;  2ZTD A;  2BWE A;  3JU0 A;  1T71 A;  2YVT A;  1NY5 A;  3KOY E;  2L33 A;  2V89 A;  1Q39 A;  1XMO E;  1VEJ A;  5H37 D;  4D81 A;  1CUK A;  2B3T B;  4IJE A;  3SAU A;  4L6V 6;  4MM3 B;  4ORB A;  1ZV1 A;  5TSE A;  4H2I A;  1XWI A;  4LF5 E;  3CF0 A;  1HNW M;  2UUB E;  4G4N A;  1KJK A;  4LGM A;  4F54 A;  3GPX A;  4KBP A;  1XNQ E;  4TUW A;  4OW0 A;  4PT5 A;  1WHQ A;  2CV0 A;  2WDC A;  1M63 A;  1NJF A;  3AKZ A;  4AW4 A;  2EPA A;  1W24 A;  5EP2 A;  4IYP C;  4V0V A;  3U61 B;  3TQS A;  2EM9 A;  3NBI A;  2BQ8 X;  3GLG A;  1Z5A A;  1DQ3 A;  1N36 E;  4KKZ A;  4DR5 M;  4LF6 E;  2IE4 C;  3EIE A;  5KL6 A;  1IBM M;  1WHC A;  2R65 A;  1BBO A;  2XMO A;  3A42 A;  1Z5C A;  1T6O A;  1OAO C;  4ORA A;  2IE3 C;  5FTK A;  1NNW A;  2LHG A;  1WHN A;  3QFN A;  3GLI B;  3RFW A;  4EIW A;  1R2Y A;  2BBG A;  2QFR A;  1IY1 A;  1Z2X A;  3UMM A;  3H69 A;  1HT2 E;  2XFT A;  5BPV A;  3KOX E;  2EM5 A;  5EXP A;  1S95 A;  4KO8 A;  1HNX E;  1UFZ A;  1H6U A;  3I01 M;  2VII A;  4OX9 M;  3TL4 X;  2LXE A;  3FGA C;  5JI3 E;  3KZY A;  2D9H A;  4DV3 M;  1GKI A;  4GIP A;  1IXS B;  1DGB A;  1ZBQ A;  1P47 A;  2YNM D;  2MJ5 B;  4XPN A;  2YWQ A;  1QQW A;  3SHF A;  1QHW A;  4IBC A;  1DO0 A;  2NUG A;  2CE7 A;  4B3S E;  1YUB A;  2NA2 A;  5B8I A;  4JI3 M;  2EOO A;  4JI5 M;  2EOQ A;  4QOZ C;  2LE2 A;  3KDS E;  2FNA A;  3HU3 A;  1SG9 A;  3QWL A;  3EPJ A;  3QYB A;  2XFS A;  3FRI A;  4I8O A;  4DR5 E;  4NRW A;  1D2N A;  1J26 A;  1WRJ A;  1IBM E;  2HJJ A;  2ENH A;  4PDI A;  3E21 A;  4NXN E;  5FTN A;  2M7Q A;  2EL5 A;  2ZTC A;  1QDR A;  1NCS A;  4R8O A;  3V76 A;  4MOV A;  1EKZ A;  3CTW B;  3U6L A;  2YRH A;  4YHH M;  1C1K A;  2LNH C;  1IN4 A;  3IVD A;  4DT2 A;  1DI2 A;  1IXR C;  2LVP C;  4GC9 A;  1OIP A;  5ITX E;  1X49 A;  2CT1 A;  4I81 A;  2K9D A;  2EOF A;  2YQZ A;  2NUF A;  3IWD A;  3CGW A;  4IBF A;  1QAQ A;  4NXM M;  1W5T A;  3GPY A;  1OFI A;  4BBA A;  4Q7F A;  2ZBK B;  2JVA A;  2V86 A;  3A45 A;  4JI3 E;  4JI5 E;  2UUC E;  1IQP A;  5EP4 A;  2X4A A;  2EM2 A;  4IJF A;  4MH0 E;  4WPY A;  2LH0 A;  4JYA E;  2C9C A;  2G3Q A;  4S12 A;  4F9B B;  1XZW A;  2BJW A;  2MR9 A;  4Z8X A;  3T6P A;  4LAC C;  2HHH E;  3C5W C;  4JI6 E;  4H2G A;  4JI1 M;  4KZS A;  5DYI A;  2EPX A;  1YZ9 A;  2CV2 A;  2JP7 A;  1J5E M;  4WSG A;  2F5N A;  3GPP A;  1G71 A;  2DGC A;  1NV9 A;  3GQ4 A;  3FRH A;  4B3M M;  1A1H A;  1MJG M;  1DGG A;  2GNO A;  1IQS A;  3NBX X;  4NZV A;  4IBG A;  1N34 M;  4X64 M;  3ZCB B;  3HHW A;  3L27 A;  1RQ0 A;  4ZYD A;  4F1I A;  4NXM E;  1R2Z A;  2DZN B;  1N32 M;  4NOO B;  2DWZ B;  4L16 A;  1YLA A;  3PNY A;  3RGS A;  1X6F A;  3WHK A;  1GTK A;  2V8Q B;  3KOZ E;  2DWL A;  1QVR A;  2CTD A;  3GLF A;  4H2B A;  2L92 A;  1IBL M;  1PRB A;  2DFJ A;  3FLO A;  4FVM A;  3A98 B;  3ZTV A;  1L1T A;  1G2D C;  4IL1 A;  5JI2 E;  2DAG A;  1DGC A;  3OTO E;  2YTJ A;  2OQ4 A;  4JI1 E;  2NYL C;  1YSA C;  1PM5 A;  3ILK A;  4LFB M;  4LF4 E;  2VQF E;  3KVW A;  3HU1 A;  3PVS A;  1YE9 A;  4DKK A;  1OQY A;  5LMU M;  2ELZ A;  1G3I A;  4F9C B;  1HR0 E;  2KXE A;  2CHG A;  2LBC A;  4NSR A;  1SXJ B;  3RMP A;  1MN3 A;  4HD0 A;  2DMI A;  3KS4 A;  4RKU F;  5IRE B;  1C7Y A;  4LGY A;  3DA1 A;  2EOM A;  1XMQ E;  2K0B X;  4DUZ E;  3CK2 A;  2QFP A;  1WGL A;  3T38 A;  3I4V A;  1L1Z A;  2DVW B;  3SHG B;  2YTN A;  4R2D A;  4M9Z A;  4OVZ A;  2LJU A;  1A1K A;  4Q7J A;  3VK6 A;  2CHQ A;  2OOA A;  2L4E A;  3GP1 A;  4ZYG A;  2KA6 B;  3MHH C;  4R2A A;  1Y8G A;  4RNA A;  4YY3 E;  3HKP A;  1QUT A;  1BVS A;  2IHR 1;  2D7E A;  2EN7 A;  4WUR A;  3GLH B;  3M0E A;  3PSN A;  3FIG A;  5IWA E;  1PJT A;  4LFB E;  4GKJ E;  1XNR E;  2EMA A;  2DWN A;  5KQD A;  4FWG A;  2EMY A;  3AOE A;  3JAM C;  4KOD A;  2O8A A;  4DR2 M;  2HL7 A;  2QHO B;  4LG2 A;  1GZ6 A;  2JY6 B;  4IBB A;  4LFA M;  3DSC A;  2DKL A;  1AIP C;  5C18 A;  1FNN A;  2YTG A;  3IWC A;  1PJS A;  2LVO C;  2EPN A;  1STU A;  2P6B A;  2FH0 A;  2MRO B;  1QAN A;  3T1Y E;  5HPE A;  4BBY A;  4P7D A;  2N3G A;  1QUS A;  4NRV A;  3D03 A;  1LV7 A;  3HQ1 A;  2F4V M;  1N75 A;  5F3W A;  3EQ1 A;  3KZZ A;  2ZM6 E;  1S3N A;  5EXT A;  5FTL A;  5EXS A;  3BID A;  2X49 A;  1LLM C;  5DNY A;  2RGH A;  4F0Z A;  2CFO A;  4LFC M;  3DF6 A;  4X65 M;  4H1Y P;  2L09 A;  1ZAA C;  2RSM A;  5KL4 A;  2A5Y B;  4FW9 A;  1Q3C A;  3ZC7 B;  2JY8 A;  2HY1 A;  4NSO B;  4JI7 M;  3UJN A;  2FGG A;  2YPN A;  3AV0 A;  5A2Q S;  3Q8X A;  5ITU A;  4BC7 A;  4IJD A;  1G5B A;  4AKI A;  1FKA E;  2QNJ A;  2X8A A;  3H62 B;  5AAS A;  1HNZ E;  3EGH A;  3K1J A;  2RTX A;  2CHV A;  4DR4 M;  5C1B A;  3SC3 A;  1GL6 A;  3FKE A;  4J8Z A;  2ERC A;  1Q3B A;  3PXG A;  1MEY C;  3HZJ A;  3JTZ A;  4OOG C;  4CIS A;  2HCB A;  3SBJ A;  3SAT A;  3FYD A;  3A46 A;  4R2P A;  1K3X A;  2RKO A;  3DSD A;  1JK2 A;  2DWM A;  3VK7 A;  2L6O A;  4ZVZ A;  4DV4 E;  5A6B A;  1IN5 A;  3LVV A;  2PRT A;  2KON A;  2EPM X;  3MSW A;  2RRU A;  4B7F A;  2L3J A;  1ZQ9 A;  4LFC E;  2EJ4 A;  3H60 A;  2EPR A;  1K82 A;  2LVN C;  3PSO A;  2XH9 A;  4MLQ A;  2D7H A;  4R71 A;  3GLG B;  2V85 A;  1X6H A;  3ADL A;  2EN8 A;  2L7H A;  2VQE M;  3LL8 A;  1S3M A;  2FS1 A;  1IBK E;  4X62 M;  1YUJ A;  4AKG A;  1W5S A;  3Q8G A;  3GO8 A;  3TGH A;  3T1H M;  2NXF A;  1UTE A;  1TF3 A;  2EOY A;  1YYK A;  4AKH A;  3B7Q A;  3KW6 A;  2EMX A;  3UK3 C;  3K9P A;  1E94 E;  4F9A B;  2LUQ A;  5E6J A;  5A6B D;  4DV5 M;  1DGH A;  2I7N A;  4BS9 A;  4B3T E;  1D0K A;  3T1I A;  2QJC A;  4NL4 H;  3SYL A;  2L2K B;  4WP2 A;  4H2F A;  1QU6 A;  5JJT A;  1I4W A;  4JI8 E;  2ZAM A;  4JI0 M;  3W68 A;  2G8L A;  2OPF A;  1A1G A;  2W82 A;  1NSF A;  2EQ3 A;  2LT7 A;  2ZBM A;  4JV5 E;  1QZM A;  1R5L A;  3IB8 A;  2R76 A;  3M7G A;  1T4O A;  2YSP A;  2XGN A;  1HPU A;  3TQM A;  4I5S A;  2Y21 A;  3PNV A;  3BXW A;  4GKK M;  2KNV A;  4X62 E;  2EJS A;  4IS1 C;  1PJJ A;  3J81 S;  3GLI E;  1XB2 B;  1IN6 A;  2E5L E;  4LZJ A;  5ADZ A;  2LUP B;  1T4L B;  4P17 A;  2BJV A;  4KHP E;  1V92 A;  2LMZ A;  2UUA M;  2E1M A;  3D8B A;  3HVQ A;  4UWQ A;  2WSC F;  2P5T A;  2KOU A;  3F6G A;  2XZU A;  1T39 A;  2EL4 A;  4GEQ B;  2HKJ A;  3SAV A;  2YFQ A;  2LJH A;  3SMS A;  4FBW A;  2FOI C;  3H66 A;  4DHL A;  2ENA A;  2VF1 A;  5A6K A;  4LF9 E;  3K8Z A;  4LF8 M;  2R4E A;  5IT9 C;  1MU5 A;  7CAT A;  4XBO A;  4M0W A;  3VKG A;  4M0D A;  2APL A;  3UZU A;  1NNJ A;  1VG5 A;  4HEI A;  2EMF A;  3C3E A;  3KWR A;  2GQF A;  2DZL A;  4MLV A;  2KEB A;  1EH7 A;  2EMG A;  2DAE A;  2L2D A;  1HNW E;  3FUX A;  3GRU A;  2OOB A;  4GIT A;  1GL7 A;  2OO9 A;  1RMD A;  2ZAN A;  3LW5 F;  4ITQ A;  1UHZ A;  2VF7 A;  1L2B A;  3I04 M;  3HJS A;  5DYG A;  2C98 A;  2WSF F;  3U5Z A;  1UM8 A;  4CJ6 A;  3R8F A;  2WBS A;  5C1V A;  3ZH9 B;  4FD2 A;  4HEO A;  4WFT A;  2JYA A;  2YTF A;  2RSI A;  3K7V C;  2UXD M;  3IG5 A;  2YRM A;  2R44 A;  5FTJ A;  4I4L A;  2DB2 A;  1A5T A;  1WR1 B;  1GLN A;  2CWB A;  1K3W A;  1L2C A;  2KKN A;  4G6Z A;  1NY6 A;  1XXH E;  3VFD A;  2AHD A;  1YSY A; 
#chains in the Genus database with same CATH homology
 2K47 A;  4JI4 M;  4DMI A;  4DV7 M;  3J7A G;  3GLF B;  4M30 A;  5IOH A;  1T4N A;  2M60 A;  4OX9 E;  1KBP A;  2Z7J A;  3FUV A;  4DV3 E;  1IXZ A;  4BB9 A;  2XZF A;  2MC6 A;  4DV6 M;  4WW0 A;  1Z2W A;  3TPZ A;  2DMY A;  2UXC M;  3HPS A;  1TDZ A;  1WXR A;  1L8Q A;  2CV9 A;  1FJM A;  3E7B A;  1WXQ A;  3UK6 A;  1FJG M;  2UXD E;  4GHL A;  5EXX A;  5KQ8 A;  1NVM A;  4Z6Y A;  2V83 A;  3W0L B;  3VLF B;  2QP9 X;  2D7G A;  5EP1 A;  3IB7 A;  2BDX A;  2Z72 A;  4L78 A;  4JN6 A;  4LJ6 A;  5LL6 R;  1QAM A;  4YHH E;  2BNK A;  3GPU A;  3ADG A;  3ICF A;  4OVZ B;  2L2M A;  2FFJ A;  1UIL A;  3VDP A;  1EE8 A;  2UU9 M;  2Y0T A;  3HU2 A;  4REZ A;  2L7I A;  3E0J A;  3TE6 A;  3GVE A;  1XC8 A;  4LTY A;  4CGY B;  1SXJ E;  2M4I A;  2Z1A A;  2ZAO A;  4B08 A;  1IM2 A;  4QHT A;  1X48 A;  2JOB A;  2EA0 A;  1N33 M;  3VDU A;  3SYK A;  3L29 A;  3QAU A;  4XGI A;  1J5E E;  2Z4S A;  3LML A;  5KO3 A;  4MGK E;  3RGP A;  3JR5 A;  4B3M E;  3E7A A;  3JAM S;  3HJQ A;  2MDR A;  4LJ5 A;  1OI8 A;  1N34 E;  4L5N C;  4X64 E;  4MGI E;  1O0W A;  1XXH A;  4X66 M;  1N32 E;  2UU9 E;  2YZT A;  2H1R A;  3H61 A;  2R46 A;  4DR1 M;  5ITX A;  2RS6 A;  2B7V A;  2R17 A;  2ZOA A;  3U6C A;  2XF3 A;  1IBL E;  3MJ5 A;  3U60 A;  4YKE A;  4LJA A;  2JY9 A;  3J7Y p;  4IBJ A;  4K0K M;  4DSY A;  1JR3 A;  1WAR A;  2Z3X A;  3J27 B;  2XEP A;  5JPF A;  1R7R A;  1GQE A;  4O24 A;  2KZS A;  4AQY M;  3BOS A;  5LMU E;  1SXJ C;  3RQZ A;  2JOG A;  1NHG C;  3L2A A;  4FBQ A;  2O8G A;  1NNU C;  4TUI A;  3H67 A;  4GMQ A;  5FLX C;  2Z4R A;  2LTS A;  3FYC A;  5ITR A;  3C4T A;  4IBE A;  5EQV A;  1R6B X;  1VDD A;  1JR3 D;  4DV1 M;  3F6H A;  2RGO A;  2F5O A;  4DR6 M;  3H64 A;  1USH A;  4Q28 A;  2LBS B;  4DV0 M;  4B7H A;  1YYW A;  4B3R M;  4LCB A;  2YEQ A;  4MGZ E;  3U6M A;  3D8L A;  1TCO A;  3I4Y A;  3NWL A;  1S3S A;  1DGH B;  3QFK A;  5KPT A;  1IN8 A;  3K92 A;  2CEA A;  4AG5 A;  4DR2 E;  3E9S A;  3C58 A;  4G9J A;  2FE8 A;  1NJG A;  2O5R A;  2R62 A;  2G5G X;  1IT6 A;  4LFA E;  2NPP C;  4CHT B;  4B7G A;  2UXB M;  5BR8 M;  2NUE A;  2M5Z A;  4DV2 M;  3SFZ A;  2EUC A;  4DV1 E;  3C4B A;  3TWK A;  2Y20 A;  3FD9 A;  4X8W A;  3IVE A;  2F4V E;  4DR6 E;  4MP0 A;  3THN A;  5JPE A;  2F5S A;  2F8B A;  5LMN M;  2WDD A;  2QBY A;  3LLH A;  4X65 E;  3KFU G;  2NQ8 C;  1T3T A;  4JI2 M;  2DSY A;  4L8R C;  4GHA A;  4MGH A;  3T15 A;  1L2D A;  4JI7 E;  2EO2 A;  3RE8 A;  3SAS A;  3RL3 A;  3TWM A;  3L26 A;  3HGI A;  4BC9 A;  4MB7 A;  1XMO M;  2BCD A;  3FTD A;  3P71 C;  4OU7 A;  2HYO A;  4DR4 E;  4LF5 M;  3FUT A;  2UUB M;  4I5N C;  4WWL A;  4P78 A;  1QYR A;  1G8P A;  3VYY A;  5A2Q C;  1XNQ M;  1G4A E;  1MF8 A;  1JQJ C;  3ZOQ B;  5EQT A;  2B7T A;  4JA9 A;  3VK8 A;  2WDE A;  3J2P B;  1TH4 A;  3LVW A;  4PD2 A;  3JYF A;  2LWX A;  4RF1 A;  1AUI A;  2DHR A;  1N36 M;  3EIH A;  5IT9 S;  2V6Z M;  5LMN E;  1UF3 A;  2L3C A;  3U6Q A;  1ZAE A;  3M6A A;  1DO2 A;  4JI2 E;  3U5Z B;  2KW0 A;  3FTC A;  2VQE E;  3KSX A;  2DIX A;  3IWB A;  3U6D A;  1HT1 E;  2KRK A;  5ITT A;  2HYP A;  2R18 A;  3T1H E;  2KZU A;  4M0V A;  3U6P A;  1HNX M;  4L4U A;  1KSF X;  3P1X A;  4DV5 E;  4QHS A;  4ZPX A;  3J7B A;  4IIW A;  4B3S M;  1IY0 A;  3HJ8 A;  4BLC A;  2ODR C;  4JI0 E;  5EJC A;  2Q2E B;  2C5R A;  3MK6 A;  3J80 C;  2V88 A;  3THO B;  2JOX A;  4NXN M;  4AI6 A;  1J09 A;  4LF7 M;  2XSZ A;  5ITQ A;  1IY2 A;  1SR9 A;  4HL4 A;  4GKK E;  4GRI A;  4D80 A;  1TH2 A;  4M2Z A;  2VE7 C;  8CAT A;  4O5G A;  1KFV A;  3SAR A;  2B9D A;  3KP1 E;  4O4K A;  1QAO A;  1X47 A;  3J7A S;  4BCA A;  5CFF E;  1N77 A;  2UUA E;  3J81 C;  1HO5 A;  3RL5 A;  3R9X B;  3GRR A;  3DZD A;  1NHW C;  4QOS A;  2UUC M;  5FSW A;  3UGJ A;  4LF8 E;  2XSZ D;  3K2L A;  3U6O A;  2DZO B;  3HTX A;  1OFH A;  2A22 A;  4JYA M;  4PDG A;  4WSP A;  4LRT A;  2Z06 A;  4D82 A;  4FCX A;  4TUG A;  2V1C A;  1HQC A;  4LF7 E;  2C99 A;  4ZX2 A;  2HHH M;  1OID A;  3U61 A;  4DR7 M;  3KOW E;  4JI6 M;  4LJ9 A;  2G7H A;  4IBK A;  2JWO A;  3HHY A;  2ODR D;  3H68 A;  1XM7 A;  1U32 A;  3TWL A;  2C96 A;  2QEN A;  3ADJ A;  1DGF A;  4MGY E;  5GTU A;  1E9R A;  3DW8 C;  3PFI A;  3GLI A;  2M1S A;  1J7K A;  1PJI A;  1X37 A;  1HQY E;  4G4O A;  3L25 A;  2QCU A;  1XXH B;  5GKN A;  5FTM A;  3HXL A;  4JI4 E;  4BMJ A;  1TDH A;  4W5W A;  3VYX A;  3LQQ A;  3H4M A;  3AFH A;  4DV7 E;  4IBI A;  2LRS A;  3QFO A;  5T6J A;  1GVN A;  2AHM A;  4DR7 E;  3OTO M;  4GH9 A;  3N5U A;  4LF4 M;  2QZ4 A;  2VQF M;  3U60 B;  3KSJ A;  3CF2 A;  3LMM A;  2Q8U A;  3KXE C;  3AJI B;  4DV6 E;  1HR0 M;  3GRY A;  2UXC E;  1MX0 A;  4H1S A;  3B9P A;  3KS8 A;  4LU9 A;  2F5Q A;  4KLN A;  3GRV A;  5J28 A;  2EWL A;  4V0X A;  4G4Q A;  1FJG E;  1XMQ M;  4DUZ M;  4JA7 A;  3MHV C;  3QFM A;  2JR1 A;  4DUY M;  4LZZ A;  1V73 A;  4AG6 A;  1S3L A;  4ORC A;  4LRS A;  2KHX A;  3EGG A;  3FTF A;  4FCT A;  4YY3 M;  1XHB A;  2GJU A;  1Z5B A;  3HHZ A;  4DR3 M;  3K6Q A;  2V1U A;  5IWA M;  4R3D A;  4GKJ M;  1OJL A;  1XNR M;  2DXL A;  3SAW A;  4G4R A;  5FLX S;  3IG8 A;  1N78 A;  3DFZ A;  3K7W C;  4UT2 A;  3H09 A;  4QNM A;  4PCZ A;  1T70 A;  4AZF A;  3AOE C;  3FTE A;  2EZ6 A;  3OML A;  2R4J A;  1G41 A;  3KP0 E;  4DUY E;  3L28 A;  4FWH A;  3T1Y M;  3HPZ A;  2DXI A;  1N33 E;  4L8N A;  2QPA A;  4B2O A;  4M9X A;  2F5P A;  2ZM6 M;  4OR9 A;  4RF0 A;  2MC5 A;  4DR3 E;  2NYM C;  3I51 A;  2L6M A;  3LQR A;  4X66 E;  4FCV A;  3U6E A;  3KBP A;  3H63 A;  2QBY B;  2K4V A;  4FWD A;  3JR4 A;  2USH A;  2FV4 B;  2L8T A;  4DR1 E;  1HNZ M;  4V0W A;  4IBD A;  4UT3 B;  3ZU0 A;  5AE3 A;  1IN7 A;  1PKP A;  1Z59 A;  4K0K E;  4R03 A;  1RC7 A;  3AOG A;  3VKH A;  2J7N A;  2XLJ A;  4DV4 M;  1SXJ A;  1WAO 1;  3E4R A;  4FBK A;  3U6S A;  3HWS A;  4GC5 A;  2ZO9 B;  3FUW A;  4AQY E;  4LJ7 A;  1SU1 A;  2H36 X;  2R45 A;  4L15 A;  2J7O A;  4R7G A;  3AUZ A;  4LJ4 A;  5IZ7 D;  5ITY A;  3C9F A;  2FTX B;  1IBK M;  3CF6 E;  2N3H A;  4II7 A;  4JXJ A;  2CV1 A;  1Z6T A;  4M9S A;  3WHL A;  1G59 A;  4LJ8 A;  4HLQ A;  4P16 A;  3GLH A;  5AE2 A;  2JA2 A;  2LTR A;  5E26 A;  3DJW A;  2CUZ A;  1SXJ D;  1E32 A;  2I7P A;  4DV0 E;  4B3T M;  1S70 A;  4B3R E;  4A3V B;  5EP3 A;  4O43 A;  5AE1 A;  1TGU A;  1I94 M;  4JI8 M;  4UT3 A;  2DXN A;  3DOA A;  2WZO A;  4JV5 M;  3QG5 C;  1JK7 A;  3FUU A;  1QFC A;  3ADI A;  5KPR A;  1S8E A;  2L2N A;  2V87 A;  2YR0 A;  2UXB E;  3GQ3 A;  1E9S A;  5BR8 E;  3W0F A;  4FCW A;  4J6O A;  2RS7 A;  1ZBT A;  4DV2 E;  2KRU A;  2CPN A;  2E5L M;  2YT4 A;  1OIE A;  4LY6 A;  4KHP M;  4MOY A;  4WYQ B;  1YYO A;  4LF6 M;  3AL0 C;  1HP1 A;  2IAE C;  5KPZ A;  3V4Y A;  3J80 S;  1KYI A;  3SMP A;  2Y0Q A;  3RL4 A;  1TH3 A;  1II7 A;  5INB A;  3THG A;  2WDF A;  4I5L C;  1I94 E;  4LF9 M;  3GQ5 A;  2C9O A;  4QNR A;  1ORY B;  3HHX A;  3JU0 A;  1T71 A;  2YVT A;  1NY5 A;  3KOY E;  2L33 A;  2V89 A;  1Q39 A;  1XMO E;  5H37 D;  4D81 A;  2B3T B;  4IJE A;  3SAU A;  4MM3 B;  4ORB A;  4H2I A;  1XWI A;  4LF5 E;  3CF0 A;  1HNW M;  2UUB E;  4G4N A;  4LGM A;  4F54 A;  3GPX A;  4KBP A;  1XNQ E;  4TUW A;  4OW0 A;  4PT5 A;  1WHQ A;  2CV0 A;  2WDC A;  1M63 A;  1NJF A;  3AKZ A;  4AW4 A;  1W24 A;  5EP2 A;  4IYP C;  4V0V A;  3U61 B;  3TQS A;  3NBI A;  2BQ8 X;  3GLG A;  1Z5A A;  1DQ3 A;  1N36 E;  4KKZ A;  4DR5 M;  4LF6 E;  2IE4 C;  3EIE A;  1IBM M;  2R65 A;  2XMO A;  3A42 A;  1Z5C A;  4ORA A;  2IE3 C;  5FTK A;  1NNW A;  1WHN A;  3QFN A;  3GLI B;  3RFW A;  4EIW A;  1R2Y A;  2QFR A;  1IY1 A;  1Z2X A;  3H69 A;  3UMM A;  1HT2 E;  2XFT A;  5BPV A;  3KOX E;  5EXP A;  1S95 A;  4KO8 A;  1HNX E;  1H6U A;  2VII A;  4OX9 M;  3TL4 X;  2LXE A;  3FGA C;  5JI3 E;  4DV3 M;  1GKI A;  4GIP A;  1IXS B;  1DGB A;  1ZBQ A;  2YNM D;  4XPN A;  1QQW A;  3SHF A;  1QHW A;  4IBC A;  1DO0 A;  2NUG A;  2CE7 A;  4B3S E;  1YUB A;  2NA2 A;  5B8I A;  4JI3 M;  4JI5 M;  4QOZ C;  2LE2 A;  3KDS E;  2FNA A;  3HU3 A;  3QWL A;  2XFS A;  4I8O A;  4DR5 E;  4NRW A;  1D2N A;  1J26 A;  1IBM E;  4PDI A;  4NXN E;  5FTN A;  2M7Q A;  4R8O A;  4MOV A;  1EKZ A;  3CTW B;  3U6L A;  4YHH M;  1C1K A;  2LNH C;  1IN4 A;  3IVD A;  4DT2 A;  1DI2 A;  1IXR C;  4GC9 A;  5ITX E;  1X49 A;  4I81 A;  2YQZ A;  2NUF A;  3IWD A;  4NXM M;  4IBF A;  1QAQ A;  1W5T A;  3GPY A;  1OFI A;  4BBA A;  4Q7F A;  2ZBK B;  2JVA A;  2V86 A;  3A45 A;  4JI3 E;  4JI5 E;  2UUC E;  1IQP A;  5EP4 A;  2X4A A;  4IJF A;  4MH0 E;  4WPY A;  2LH0 A;  4JYA E;  2C9C A;  4S12 A;  4F9B B;  1XZW A;  2BJW A;  4Z8X A;  4LAC C;  2HHH E;  3C5W C;  4JI6 E;  4H2G A;  4JI1 M;  4KZS A;  5DYI A;  1YZ9 A;  2CV2 A;  1J5E M;  2F5N A;  3GPP A;  3GQ4 A;  4B3M M;  1DGG A;  4NZV A;  4IBG A;  1N34 M;  4X64 M;  3ZCB B;  3HHW A;  3L27 A;  1RQ0 A;  4NXM E;  1R2Z A;  2DZN B;  1N32 M;  4NOO B;  2DWZ B;  4L16 A;  3PNY A;  3RGS A;  3WHK A;  2V8Q B;  3KOZ E;  2DWL A;  1QVR A;  3GLF A;  4H2B A;  2L92 A;  1IBL M;  2DFJ A;  3FLO A;  4FVM A;  3A98 B;  3ZTV A;  1L1T A;  4IL1 A;  5JI2 E;  3OTO E;  2OQ4 A;  4JI1 E;  2NYL C;  1PM5 A;  3ILK A;  4LFB M;  4LF4 E;  2VQF E;  3KVW A;  3HU1 A;  3PVS A;  1YE9 A;  4DKK A;  5LMU M;  1HR0 E;  1G3I A;  4F9C B;  2KXE A;  2CHG A;  4NSR A;  1SXJ B;  3RMP A;  4HD0 A;  3KS4 A;  5IRE B;  4LGY A;  3DA1 A;  1XMQ E;  4DUZ E;  3CK2 A;  2QFP A;  3T38 A;  3I4V A;  1L1Z A;  2DVW B;  3SHG B;  4M9Z A;  4OVZ A;  3VK6 A;  2CHQ A;  3GP1 A;  2KA6 B;  4RNA A;  4YY3 E;  3HKP A;  2IHR 1;  2D7E A;  4WUR A;  3GLH B;  3M0E A;  3PSN A;  3FIG A;  5IWA E;  4LFB E;  4GKJ E;  1XNR E;  2DWN A;  5KQD A;  4FWG A;  3AOE A;  3JAM C;  4KOD A;  2O8A A;  4DR2 M;  2HL7 A;  4LG2 A;  1GZ6 A;  4IBB A;  4LFA M;  3DSC A;  5C18 A;  1FNN A;  3IWC A;  1STU A;  2P6B A;  1QAN A;  3T1Y E;  5HPE A;  4BBY A;  4P7D A;  2N3G A;  4NRV A;  3D03 A;  1LV7 A;  3HQ1 A;  2F4V M;  1N75 A;  5F3W A;  2ZM6 E;  1S3N A;  5EXT A;  5FTL A;  5EXS A;  2X49 A;  5DNY A;  2RGH A;  4F0Z A;  2CFO A;  4LFC M;  3DF6 A;  4X65 M;  4H1Y P;  2L09 A;  2RSM A;  2A5Y B;  4FW9 A;  1Q3C A;  3ZC7 B;  2HY1 A;  4NSO B;  4JI7 M;  3UJN A;  2FGG A;  3AV0 A;  5A2Q S;  3Q8X A;  5ITU A;  4BC7 A;  1G5B A;  4AKI A;  1FKA E;  2X8A A;  3H62 B;  5AAS A;  1HNZ E;  3EGH A;  3K1J A;  2RTX A;  2CHV A;  4DR4 M;  5C1B A;  3SC3 A;  1GL6 A;  3FKE A;  4J8Z A;  2ERC A;  1Q3B A;  3PXG A;  3JTZ A;  4OOG C;  4CIS A;  2HCB A;  3SBJ A;  3SAT A;  3FYD A;  3A46 A;  1K3X A;  2RKO A;  3DSD A;  2DWM A;  3VK7 A;  2L6O A;  4ZVZ A;  4DV4 E;  1IN5 A;  3LVV A;  2KON A;  3MSW A;  4B7F A;  2L3J A;  1ZQ9 A;  4LFC E;  3H60 A;  1K82 A;  3PSO A;  2XH9 A;  2D7H A;  3GLG B;  2V85 A;  3ADL A;  2L7H A;  2VQE M;  3LL8 A;  1S3M A;  1IBK E;  4X62 M;  4AKG A;  1W5S A;  3GO8 A;  3TGH A;  3T1H M;  2NXF A;  1UTE A;  1YYK A;  4AKH A;  3KW6 A;  1E94 E;  4F9A B;  2LUQ A;  5E6J A;  4DV5 M;  1DGH A;  2I7N A;  4BS9 A;  4B3T E;  3T1I A;  2QJC A;  4NL4 H;  3SYL A;  2L2K B;  4H2F A;  1QU6 A;  5JJT A;  1I4W A;  4JI8 E;  2ZAM A;  4JI0 M;  2G8L A;  2OPF A;  2W82 A;  1NSF A;  2ZBM A;  4JV5 E;  1QZM A;  3IB8 A;  3M7G A;  1T4O A;  2XGN A;  1HPU A;  4I5S A;  2Y21 A;  3PNV A;  4GKK M;  4X62 E;  1PJJ A;  3J81 S;  1IN6 A;  2E5L E;  4LZJ A;  5ADZ A;  2LUP B;  1T4L B;  2BJV A;  4KHP E;  2LMZ A;  2UUA M;  2E1M A;  3D8B A;  3HVQ A;  4UWQ A;  2P5T A;  2KOU A;  3F6G A;  2XZU A;  4GEQ B;  2HKJ A;  3SAV A;  2YFQ A;  2LJH A;  4FBW A;  3SMS A;  2FOI C;  3H66 A;  4DHL A;  2VF1 A;  4LF9 E;  3K8Z A;  4LF8 M;  2R4E A;  5IT9 C;  1MU5 A;  7CAT A;  4XBO A;  4M0W A;  3VKG A;  4M0D A;  3UZU A;  1NNJ A;  3KWR A;  2KEB A;  1HNW E;  3FUX A;  3GRU A;  4GIT A;  1GL7 A;  2ZAN A;  4ITQ A;  1UHZ A;  1L2B A;  3HJS A;  5DYG A;  2C98 A;  3U5Z A;  1UM8 A;  3R8F A;  5C1V A;  3ZH9 B;  4FD2 A;  4WFT A;  3K7V C;  2UXD M;  3IG5 A;  5FTJ A;  4I4L A;  2DB2 A;  1GLN A;  1K3W A;  1L2C A;  2KKN A;  4G6Z A;  1NY6 A;  3VFD A;  2AHD A;  1YSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...