3AV0A

Crystal structure of mre11-rad50 bound to atp s
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
369
structure length
369
Chain Sequence
GSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDNVDIESLNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
total genus 101
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3av0A03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3av0A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3av0A01
3IVDA 5JJTA 2O8AA 3KBPA 3H68A 1T70A 4H2FA 1XZWA 4JA9A 1UTEA 4ORBA 5IOHA 5C1VA 4KBPA 3RL4A 4H1YP 3E7BA 3K7WC 3THNA 2NYLC 4UT3A 4I5NC 4LACC 4ZVZA 4V0XA 3H64A 1V73A 2A22A 4ZX2A 2WDCA 2HY1A 1JK7A 1QHWA 3E7AA 4I5LC 2NXFA 1S70A 4TUIA 3V4YA 3GVEA 3H69A 3HVQA 5DNYA 2P6BA 3QFNA 4H1SA 5B8IA 2JOGA 3N5UA 4O43A 2Z06A 2Z72A 2IE4C 2YVTA 2HYPA 3IB8A 3QFKA 4IL1A 2BQ8X 1QFCA 5JPFA 1USHA 2DFJA 1Z2WA 3H66A 5F3WA 1NNWA 4FCXA 1OIEA 2O8GA 4DT2A 2WDEA 1HO5A 4UT3B 3RQZA 1T71A 4OR9A 3RL3A 4MP0A 3ZU0A 4B2OA 3EGHA 4O5GA 1SU1A 3H63A 2IE3C 3DW8C 3ZTVA 1UF3A 1OIDA 4JA7A 2Q8UA 3QFMA 1G5BA 5INBA 4G9JA 2QFRA 2Z1AA 1WARA 3PSNA 2WDFA 3H61A 4IYPC 1S95A 2AHDA 1S3LA 4V0WA 4KKZA 4Q7FA 5GTUA 3CK2A 4O4KA 3FGAC 3DSDA 4J6OA 3H62B 4HD0A 2KKNA 1KBPA 2HYOA 2WDDA 1S3NA 4H2IA 2BDXA 4TUGA 4ORAA 1TCOA 5J28A 3QFOA 5HPEA 2BCDA 3JYFA 1U32A 4UWQA 2CV9A 3EGGA 3AV0A 4DHLA 4F0ZA 3DSCA 1AUIA 1XM7A 3T1IA 1IT6A 1HP1A 4H2GA 4MOVA 4LU9A 4DSYA 1S3MA 2QJCA 2QFPA 4M0VA 3ICFA 3LL8A 3RL5A 2NYMC 1W24A 4WWLA 2NPPC 3C5WC 4FBQA 2USHA 1FJMA 2IAEC 2ZBMA 1OI8A 4FBWA 4YKEA 3H60A 4O24A 3TGHA 1Z2XA 3QG5C 2XMOA 4H2BA 1M63A 2GJUA 4UT2A 5JPEA 3K7VC 1S8EA 5EQVA 2R17A 1WAO1 3H67A 3IVEA 4LTYA 4MOYA 1HPUA 3IB7A 1MF8A 3P71C 1II7A 3C9FA 4NZVA 3PSOA 3THOB 4XPNA 3AUZA 4FBKA 4V0VA 4ORCA
chains in the Genus database with same CATH superfamily
1YSAC 3LCUA 4X66E 1D0LA 2EOXA 1OFIA 1A1GA 1Z5BA 5C1BA 2V83A 2EOQA 3RL4A 3K7WC 4ZVZA 4D81A 3U6PA 4KHPE 2WBSA 3GLIB 2KEBA 3EPKA 2B3TB 4DR1E 2JYAA 1IN8A 1A1KA 4GEQB 4RF0A 3TQMA 4IBKA 2EJ4A 4B2OA 4GHLA 3A98B 4W5WA 1T39A 1X3CA 4LFCE 1WARA 1GTKA 2MJ5B 2EMKA 4Q7FA 3MHHC 2EQ0A 4IBGA 2EPZA 4WSGA 4Z8XA 4L8NA 4DV2E 1XMQM 2L92A 1IY1A 3EPHA 1Z59A 2L2DA 2R4EA 3GO8A 3K9OA 4WWLA 1TH3A 2NPPC 4DV4E 4FBQA 2DMYA 4JI6M 5E6JA 1NNUC 4JI2M 1N33E 5IWAM 3VHTB 1M63A 1DO0A 5FTKA 2L2KB 3D03A 4DR2E 4M9ZA 4WSPA 1DGHA 2VQEE 3KDSE 1UM8A 2KNVA 2JY8A 4WFTA 2XGNA 2YNMD 3LVWA 4YY3M 4B3SM 3HU1A 3BGHA 4X65M 1Q3BA 3QYBA 2FOIC 1QQWA 4NC6A 3IVDA 1IY0A 1Q02A 1E32A 1KYQA 2B7TA 1Z5CA 4FW9A 3THNA 2NYLC 2EQ1A 3VDUA 4GMQA 3F6GA 1X6HA 3KW6A 1YZ9A 2RSIA 3HHYA 4Y28F 2Z4RA 2P6BA 2K0BX 3I01M 3U61A 1PKPA 2N3HA 2K9DA 1FJGE 2ZANA 2EPOA 3I4VA 3KFUG 3DFZA 2LO3A 4NXME 2CFOA 2EOOA 4MP0A 2EL5A 4G4RA 2RRUA 1X5WA 2JP7A 4LF4M 2JY6B 2WDFA 3C9PA 2F5OA 4M30A 2ADRA 3CTWB 1NY6A 4KKZA 4MH0E 3U61B 1T4OA 3CK2A 4IS1C 4DV6E 2JOBA 1NHGC 2BWBA 2Y0QA 1NO1A 4CJ6A 4DR4E 1U32A 4IJDA 2EM5A 2V6ZM 3A45A 4JI4M 2XSZD 2QJCA 2QFPA 2USHA 2MROB 2EKFA 3RFWA 2GJUA 2I7NA 4DV3E 1TH2A 4BC7A 1IBME 3J2PB 5LMUM 1QAOA 3H67A 4DV0M 4AQYM 3IB7A 2Q2EB 4PDIA 1QUTA 1MF8A 3KWRA 5KO3A 3P71C 4HEOA 4DV5E 2O5RA 1YYWA 5EP2A 2EPXA 3LCVB 1T70A 3VYXA 2K6BA 4JA9A 2I9IA 4IBDA 4UT3A 2RQLA 3W0LB 4NL4H 4V0XA 2WZOA 4X62E 3C4BA 3K1JA 4NRWA 3E7AA 2YWQA 5EJCA 2WBTA 4JYAM 3PVSA 4F9CB 7CATA 4CGYB 3IHPA 1ZR9A 2EPAA 1TN9A 5A69A 3OMLA 3KSJA 4R2CA 4UT3B 2CHGA 5AE1A 2H5XA 3AKZA 4OX9E 1OIDA 1IY2A 5KQDA 5T6JA 2MDGA 4LF5E 2H1RA 2ZBKB 1AH5A 3TQSA 4LJAA 3GRRA 3LLHA 1KBPA 2JNHA 2ZTDA 3GRVA 4BS9A 2F5NA 4WXDA 3T1HE 4K0KM 4CISA 4JN6A 5ITXE 2KXEA 1XM7A 3FUUA 1HP1A 3MJ5A 2K4VA 2LCEA 2LJUA 2JUJA 1XNQM 3KS8A 1ZAAC 3GPXA 1WHQA 2KHHA 1GKIA 4LF6E 2OOAA 4O24A 4JV5E 2M7QA 2JXPA 4H2BA 2F5PA 1R5LA 4UT2A 4CIZA 1HQCA 2YTQA 3SC3A 2R62A 1GQEA 1II7A 1GJTA 1X37A 1N32E 2EOFA 5KL4A 1J26A 4F9AB 1HNZE 2EN8A 2EL6A 2RSMA 2O8AA 3WHLA 3J81C 2UU9M 3EPJA 4KT0F 1TR8A 2KRUA 1C7YA 4GH9A 1OAOC 1K3XA 4MGYE 2YSOA 2V1UA 1IM2A 3FYDA 2QNJA 3K8ZA 4TUIA 1XMOE 2VF1A 4H1SA 4BBYA 5B8IA 4JI5M 2FE8A 4F1IA 1V33A 3N5UA 2Z06A 1HJPA 2LVPC 1O0WA 1HNWM 3ADIA 3MHVC 2HJJA 4JI7M 5KQ8A 1T43A 2EN1A 5KL5A 1NNWA 2ENAA 2I7PA 4DT2A 1GL6A 2KW0A 2NUEA 4JI0M 4R2EA 2VF8A 4CHTB 3PSNA 5IREB 1IN7A 2VQFM 3DSDA 1TDZA 3H62B 4HD0A 2D7HA 4R2SA 2BDXA 2UUCM 2WZJA 2G5GX 5HPEA 5ITXA 3OTOM 5AASA 4F0ZA 2Z3XA 4LF8M 4L6V6 2MGWA 1P3QQ 3ICFA 5EP3A 1A1FA 4JI6E 2R18A 2ZBMA 2ODRD 4JI2E 5IWAE 3E0JA 4KO8A 1UILA 5BR8M 4FCVA 3L25A 2Z7JA 2J7OA 3HPSA 5EQVA 3ILKA 1R7RA 3RGSA 3SMSA 2DLKA 4P17A 4DKKA 3U6QA 2CSHA 5IT9C 2L7HA 2EE8A 1OJLA 1TH4A 4X65E 1PJQA 2B7VA 2JZ0A 2R76A 4P7DA 2XFSA 2D7EA 4GKJM 1JR3D 2I13A 3T38A 2HWJA 4L5NC 3TWMA 4LGMA 3A46A 2R4JA 1G4AE 2D7GA 1NV8A 3H69A 3QFNA 4DMIA 2E5LM 3KZYA 3K2LA 3BOSA 4B3TM 2EO2A 2EQ3A 4OVZA 3FRIA 4DUZM 4HLQA 3U6MA 3QYEA 4DR6M 3ZU0A 2QZ4A 2BNKA 3Q8XA 2EOZA 3L00A 3J81S 4LF4E 5FTMA 2LBCA 4V0WA 4R7GA 2EMXA 2EMHA 2EL4A 1GABA 3UJNA 5ITYA 1NNJA 2WDDA 4OVZB 1DO2A 1N34M 3V76A 2N35A 4GIPA 1XNRM 2DAMA 2FS1A 2LUPB 2G7HA 3DJWA 4JI4E 1ZAEA 2CV1A 4GC5A 2QBYA 2DMIA 3ZQJA 3FUWA 2WSCF 2L4FA 3C5WC 2GQFA 2EOHA 2YU8A 3SMPA 2L6OA 1LV7A 2EOSA 5FLXC 5LMUE 2EKKA 3UK6A 4DV0E 2V85A 4AQYE 4PDGA 1ZBQA 3T15A 3L2AA 2RPCA 2DXLA 2DKLA 2W82A 3F6HA 3DA1A 1IMUA 3PSOA 2QBYB 3FD9A 1B69A 4G3OA 2XLJA 4I4LA 2DAGA 3SYLA 3L29A 5GKNA 2RTXA 2VIIA 1GO5A 4LCBA 1WRJA 1BVSA 1X49A 5IOHA 1Q3CA 1V73A 4FCTA 4JI8E 4GHAA 3IECA 2YRHA 1TGUA 2QHOB 1TTEA 4LRSA 3LQQA 2GHFA 4JYAE 3GVEA 1NEIA 1RMDA 1WIVA 2CEAA 1PJJA 2R46A 2JWOA 2Z72A 2APLA 3QFKA 1MX0A 4DUYM 3HKPA 3H4MA 2KDLA 2DFJA 2G8LA 3JR4A 1L4SA 4WURA 5ITQA 1HO5A 5IT9S 2EA0A 2L33A 1UF3A 4GRIA 3FTDA 2QFRA 2RS7A 2LMZA 4JI1M 4JXJA 3JR5A 3K6QA 1MGTA 2YPNA 1PJTA 3E46A 5LL6R 2ELZA 3CF0A 4ORAA 3T1YM 2EMZA 1QZEA 5KL3A 4K0KE 2EM2A 2UUBE 2ENHA 3UMMA 2XF3A 2ELYA 3M0EA 4GITA 3K92A 3LL8A 3CF6E 4KODA 3T6PA 2Y0TA 1YYKA 5IZ7D 1J5EE 5AE3A 4G6ZA 3FE3A 4LTYA 2LWXA 2LVNC 4MOYA 4DR5E 4AW4A 1VQ1A 3E9SA 1G41A 2CWBA 3U60A 2NA2A 5KL2A 2CHQA 3AOGA 3J80C 3DZDA 4XPNA 2FNAA 1CUKA 2EN2A 1G2DC 4QHSA 2EM9A 2V1CA 5FSWA 2DXIA 3IWBA 3J27B 1QAQA 1A1JA 2CPNA 3K9PA 4ZX2A 3PNVA 2HC5A 3BF2A 3U60B 4WW0A 4X8WA 1ZBTA 4ZYEA 5FLXS 4P16A 2EORA 4O43A 3IWDA 1HNWE 2IE4C 3KP0E 5BPVA 4JI7E 4MB7A 3FUXA 2CRUA 4II7A 3U6CA 4GKKE 1ZU1A 2UUAM 1SFEA 1LTMA 2EPLX 3C6MA 4KZSA 2OO9A 3SFZA 3EGHA 4JI0E 3DW8C 1W5SA 3SBJA 3DOAA 4L78A 2DRPA 2VQFE 1V34A 2DLQA 2VE7C 1IQPA 1A1HA 2C96A 2UUCE 3KOZE 4ZPXA 2R45A 3HJSA 2BB8A 4UWQA 3OTOE 4LF7M 4LF8E 1AUIA 2BJWA 2GLIA 2IHR1 1TF6A 2NYMC 1W24A 2UXBM 1FJMA 4IJFA 4F6MA 4NRVA 5JI3E 4B3RM 4J8ZA 2EMFA 1IBKM 2F4VE 4IBCA 5BR8E 1H6UA 1IQSA 2GPIA 1HT1E 2FFJA 3GQ4A 1N75A 2R17A 1EIJA 4LJ9A 1STUA 1DGCA 1E9RA 1UBDC 4DV7E 1OIZA 3GPUA 2FH0A 1XWIA 5LLQA 3F92A 1OTRA 5AC4A 3FIGA 3KBPA 2M4IA 1HR0M 4RNAA 4WX9A 1N3GA 4BHCA 4IBEA 1BBOA 1T4NA 3HQ1A 2L09A 2NXFA 2DIXA 3L27A 2EM4A 3VFDA 4EIWA 2E5LE 4X9JA 1L2CA 2JY9A 4DV1M 3C3EA 3SATA 2BBGA 5JPFA 3KOWE 3B7QA 4DUZE 4LJ6A 2DXNA 4LFAM 4DR6E 1QZMA 3J80S 2HHHM 3H63A 4JA7A 1G5BA 1IXZA 3H61A 5H37D 4O4KA 5AE2A 2MH8A 4IJEA 1T3TA 2DAIA 2L2NA 4RF1A 1X47A 3GLHE 1N34E 2LV2A 1PRBA 2YSPA 2YTGA 3D8LA 4I5SA 2DSYA 1QNTA 3EIHA 3E4RA 5CFFE 4R3DA 2XZFA 2J5YA 3KOXE 5FTNA 1YYOA 1EKZA 5L8RF 2X49A 2EOMA 4FBWA 4X66M 1S3SA 2FGGA 3BBGA 2J7NA 2MDRA 3FTCA 2EMAA 4BCAA 1VEGA 2OPFA 1RQ0A 1UHZA 3IVEA 4FCWA 2DZOB 4MGIE 4LJ5A 3R8FA 3C9FA 4NZVA 1D2NA 3VK8A 2XSZA 2V87A 2O25A 4F6NA 1VDLA 3NBIA 1A5TA 4FWGA 3H68A 3HU3A 1A1LA 4QOZC 3U5ZA 4KBPA 5LMNM 3FYCA 3EQ1A 1YUIA 2EOYA 1LLMC 2ZM6M 4UN2B 3KP1E 1VEJA 1QAMA 2KZSA 4QHTA 3SAVA 2NUGA 4R2QA 4DUYE 2R1FA 4XGIA 3GRUA 3BIDA 3I51A 3U5ZB 2C98A 2WDEA 2LH0A 2KHXA 3HZJA 3GPPA 2H36X 1OKSA 3FLOA 4JI1E 3SASA 1S95A 2N3GA 5A6KA 3C4TA 2YTJA 2K7IA 4ZYGA 3VKHA 4WPYA 1BB8A 3UK3C 2KKNA 3GLHA 4WP2A 1L2BA 4R2RA 3U6LA 3HXLA 4MLVA 2KRKA 4B7HA 4R03A 3R9XB 1JB0F 4ZYHA 1WJPA 4QOSA 1SXJD 1Z1BA 3RL5A 1N36M 3KSXA 4R2DA 1RU3A 2QQ8A 1DV0A 3H60A 3FTEA 4MGZE 3W0FA 2YTNA 3MMPA 3EIEA 2XEPA 2DHRA 2EMLA 4MLQA 3GLHB 1XMQE 3J7BA 3LMLA 2EM6A 4YHHM 2EM0A 2EM8A 4B3MM 4AKIA 1EH8A 1IFYA 2EPPA 1IBLM 1C1KA 3U6DA 2CHVA 5ITRA 2YEQA 3L28A 2CTDA 5A6BA 4RKUF 2EP3A 3HTXA 4JI3M 1NJGA 1EE8A 2YTIA 1UTEA 4ORBA 2LHCA 4G4NA 1XXHA 2M9AA 2MC6A 4FVMA 4F9BB 1JK7A 3H4JA 2DHYA 1ZMUA 2EOJA 1IN5A 1VEKA 3HVQA 4B7GA 4YY3E 4B3SE 4ZYDA 1XHBA 3HJ8A 3IB8A 3LQRA 2VF7A 3P1XA 2UUAE 1NCSA 2V86A 4PCZA 2O8GA 3RQZA 1T71A 1FKAE 3NWLA 1XXHB 2MKNA 5DFLA 3SYKA 4N4RB 1T38A 1ZMWA 3B89A 1E9SA 3QAUA 1S3LA 3ZH9B 2DZLA 2Z8YM 5GTUA 1NJFA 2EPCA 4IBBA 3IG5A 4KLNA 4NXNM 2HGHA 2JY7A 2F5QA 2B9DA 4LF7E 2YTOA 3VKGA 1WHCA 2M1SA 1J7KA 2UXDM 4LG2A 1S3MA 4WYQB 2LTSA 4QNMA 1OI8A 1IBKE 3JAMC 3QG5C 3HGIA 4R2PA 2XMOA 1YE9A 3ZOQB 2KNZA 2YRMA 4X64M 1WAO1 1HQYE 2G3QA 2MKDA 2QCUA 2YRKA 3ECRA 1QDRA 2Y21A 1Y8GA 5DYIA 2EZ6A 3SAWA 2C5RA 4A3VB 3VYYA 4M9XA 4V0VA 3NBXX 2YFQA 4OU7A 4L8RC 1HR0E 4B7FA 4H2FA 3B9PA 3KVWA 1XZWA 1G2FC 4I5NC 3ZC7B 2WDCA 3DF6A 1ORYB 2BWEA 1MU5A 3GLGE 4NSOB 4LZJA 2JOGA 3B74A 2LXEA 4DV1E 2YVTA 4IBJA 2BQ8X 4BBAA 1USHA 1Z2WA 1I4WA 2WBUA 3T1HM 2L3CA 4OR9A 1MN3A 1BBGA 2ZO9B 4DR7M 2JXNA 2Z1AA 5EXTA 1NVMA 4LRTA 4I81A 3ZCBB 4LF6M 4DR3M 2EPUA 1V92A 4JV5M 3FGAC 4IBFA 1JK1A 2EPMX 3M99B 1S3NA 1TCOA 2JR1A 1QU6A 1W5TA 3FTFA 3DSCA 2EJSA 2CT1A 2C9OA 2KA6B 3EPLA 1YPNA 3TWLA 2DGCA 2CV2A 1EFUB 1HNZM 4BC9A 2EPRA 2IAEC 4YKEA 4QNRA 2M60A 1YUJA 2N8XA 2F8BA 1L2DA 1Z6TA 2EPKX 4TUWA 5ITUA 1R4GA 4F2JC 1TDHA 2EN7A 1UN6B 1XMOM 1GVNA 1XNQE 5DYGA 3THOB 1JQJC 3QWLA 5ADZA 3BXWA 4MGKE 3TL4X 5LMNE 1OFHA 4D82A 3ADGA 4MGHA 3MK6A 2EOEA 3H64A 3SHFA 2ZM6E 2CP8A 1QHWA 3GLGA 1S70A 3JAMS 2YZTA 3UGJA 2EMIA 4MM3B 3J7Yp 2O01F 1OQYA 5C18A 4REZA 2UU9E 3ADJA 3RL3A 3B7NA 2MR9A 1IQOA 2RKOA 4Z6YA 1QDTA 1DQ3A 2EMYA 2R6FA 3GLGB 3JTZA 4M2ZA 1AAYA 4JI5E 2E72A 1T6OA 3TWKA 1R6BX 2P5TA 5A6JA 5EQTA 2EMCA 4M9SA 3L26A 2BCDA 4LFBM 1NHWC 1JK2A 2QP9X 2CV9A 4PD2A 3LMMA 1IT6A 4L4UA 3HY5A 3HWSA 4WXCA 4D80A 1N36E 4FD2A 3TGHA 4RH8A 1GLNA 5EXXA 1PDAA 2YTDA 3ADLA 2UXCM 3K7VC 3TE6A 3THGA 2EN4A 2DVWB 1DGHB 4YHHE 2R44A 4LF9M 4B3ME 1HNXM 1IBLE 1QUSA 1I94M 2JWSA 3UZUA 2RS6A 2QSFX 1MJGM 5EXPA 1QVRA 5TSEA 2YTFA 1G71A 5IXMB 5JJTA 2M5ZA 3CGWA 4JI3E 5KL6A 1EH6A 1YLAA 4BLCA 2EMGA 2EWLA 3PFIA 3VDPA 3RMPA 2HY1A 1L1ZA 2L2MA 2OQ4A 1KJKA 2R0IA 5DNYA 3I04M 3W68A 1F2IG 4F2LA 2HAKA 4NHRA 2EOIA 2E1MA 3KS4A 4FCXA 2CE7A 1IN6A 1AUAA 4GKJE 1AIPC 1SU1A 1G8PA 4ANRA 3FUTA 2Q8UA 1YFHA 2LHGA 4PT5A 2YU5A 2QPAA 1F4IA 1GZ6A 2QENA 2CV0A 3HHXA 4B3TE 3FUVA 1OAIA 1PGYA 2DWLA 3GP1A 4NXNE 3D8BA 2PRTA 3EGGA 3AV0A 4DHLA 2UXDE 4L15A 5E26A 1PJSA 1IN4A 2YR0A 8CATA 2VRDA 2NQ8C 2EM7A 1WHNA 1IXRC 2JVAA 1VDDA 1X6EA 1WXRA 4X64E 2LJHA 4LGYA 4R71A 1HPUA 4JI8M 1MEYC 1XNRE 1Q39A 1ZQ9A 2EN6A 1KSFX 3M6AA 2LNHC 1TF0B 2V89A 1PM5A 3TPZA 3U6SA 1G59A 3ZTVA 4NSRA 2EUCA 2LE2A 3VK7A 2WSFF 4M0WA 2EPNA 2KNAA 2AHMA 1K82A 3E7BA 4H1YP 3MHSC 4Q7JA 3PXGA 4KHPM 3SAUA 3M7GA 4XK8F 4HTGA 2NUFA 3KOYE 1VG5A 3V4YA 2ERCA 1K3WA 2DI0A 3J7AS 2WCC3 3HU2A 1PJIA 2L6MA 3AOEA 2Z4SA 4DR1M 1DGGA 3GQ3A 2DWMA 5F3WA 1X48A 4L16A 1OIEA 2UUBM 4AG5A 1DGFA 1XB2B 1XXHE 5A2QC 4OOGC 1SR9A 4DR7E 1WJ7A 4G9JA 1KFVA 4LFCM 4Q28A 3IWCA 4IYPC 2ENCA 4DR3E 5A6BD 4GEWA 2JPAA 2LVQD 1D0KA 4J6OA 2DENA 2J7JA 3AOEC 5EXSA 1J5EM 2EMWA 2HKJA 1NSFA 2YT4A 4DV2M 5J28A 3QFOA 5JI2E 1YUBA 1UFZA 2JOXA 4HEIA 1ZMVA 4DR5M 1WXQA 3C3DA 3I4YA 3J7AG 2LVOC 4IBIA 4DV4M 5FTJA 1N78A 4XBOA 1N33M 5JPEA 4FWDA 5KL7A 2DAKA 2GNOA 2X8AA 3GPYA 3T1YE 2RGOA 4AG6A 1N77A 3RGPA 4DR2M 2KONA 2V8QB 3U6EA 2VQEM 2XFTA 4LJ7A 3CF2A 1GJSA 2HL7A 4FBKA 1SXJE 3HX3A 1RC7A 3HHZA 1Z5AA 1XC8A 2NABA 4GKKM 5KPZA 2D9HA 2Y20A 5C1VA 4LACC 1J09A 1WGNA 3U6OA 2ZTCA 2L8TA 3GQ5A 1WR1B 2LVHA 3Q8GA 2LT7A 3RE8A 1T4LB 1FNNA 4FK5C 4AI6A 4BHBA 1DGBA 2JA2A 1NY5A 4IL1A 1QFCA 1NV9A 1FJGM 3H66A 2LTUA 1G3IA 1X6FA 1WGLA 4AKGA 1P47A 4G4QA 1E94E 5FTLA 4NXMM 3H09A 4KWYA 4O5GA 2IE3C 2JP9A 3QFMA 4R8OA 3BBZA 4LZZA 2KOUA 2AHDA 1QANA 3MSWA 3HHWA 2R65A 2L4EA 4LY6A 1SG9A 4S12A 2F4VM 2EN3A 4DV6M 2HYOA 2RGHA 4G4OA 3PNYA 4TUGA 4M9VC 1OIPA 4LFBE 3VLFB 3JYFA 4DR4M 1DI2A 3VK6A 4NOOB 3GLFE 3T1IA 1TF3A 2A25A 2ZOAA 2BJVA 1JR3E 4MOVA 4LU9A 4DV7M 1R2YA 3B7ZA 3HPZA 4DSYA 2ZAOA 3A42A 1IXSA 4GZNC 3AJIB 3SARA 2L7IA 2UXCE 2DNAA 4DV3M 5A2QS 1S8EA 1IBMM 1QYRA 3AFHA 4LF9E 1HNXE 4I8OA 1EH7A 1D0MA 3GLIE 1I94E 3E21A 4Q35B 5A6AA 4DV5M 4LJ4A 2C99A 4P78A 1SXJA 3WHKA 2UXBE 2F5SA 3AUZA 4ITQA 2X4AA 1IXSB 2EMBA 4B3RE 2DWNA 3HJQA 4AZFA 2A5YB 4HL4A 3GRYA 4R2AA 4GC9A 2EM3A 2A22A 2LVAA 4X62M 2YTPA 4I5LC 5ITTA 1L1TA 1KYIA 5IV8B 2LBSB 3W67A 2YTEA 2DB2A 2FV4B 1SXJB 1SXJC 2HYPA 2OOBA 2KZUA 4LJ8A 4B08A 4IIWA 2LTRA 1GL7A 1ZV1A 2DWZB 3IG8A 1YSYA 2VDBB 2XZUA 4OX9M 5INBA 4AKHA 4LF5M 2JZ1A 5KPTA 2XH9A 4BMJA 3AL0C 4RHBB 2L3JA 2C9CA 2CUZA 4H2IA 4FWHA 3KXEC 2ODRC 2MC5A 2DAEA 1R2ZA 4LFAE 2LUQA 2JY5A 1HT2E 2HHHE 3GLFA 2ZAMA 3FKEA 3FRHA 2V88A 1JR3A 4H2GA 5AC5A 3LW5F 4M0VA 2FTXB 3KZZA 1Z2XA 2HCBA 2LRSA 5EP1A 1A1IA 3LVVA 2YQZA 3C6KA 5KPRA 2DZNB 4M0DA 3GLFB 4OW0A 4BB9A 3JU0A 3GLIA 4F54A 3SHGB 1N32M 1L8QA 3C58A 2B3TA 2K47A 5EP4A 2WSEF 4DBGB 4ORCA
chains in the Genus database with same CATH topology
4X66E 1OFIA 1Z5BA 5C1BA 2V83A 3RL4A 3K7WC 4ZVZA 4D81A 3U6PA 4KHPE 3GLIB 2KEBA 2B3TB 4DR1E 1IN8A 4GEQB 4RF0A 4IBKA 4B2OA 4GHLA 3A98B 4W5WA 4LFCE 1WARA 4Q7FA 4IBGA 4Z8XA 4L8NA 4DV2E 1XMQM 2L92A 1IY1A 1Z59A 2R4EA 3GO8A 4WWLA 1TH3A 2NPPC 4DV4E 4FBQA 2DMYA 4JI6M 5E6JA 1NNUC 4JI2M 1N33E 5IWAM 1M63A 1DO0A 5FTKA 2L2KB 3D03A 4DR2E 4M9ZA 4WSPA 1DGHA 2VQEE 3KDSE 1UM8A 4WFTA 2XGNA 2YNMD 3LVWA 4YY3M 4B3SM 3HU1A 4X65M 1Q3BA 3IVDA 2FOIC 1QQWA 1IY0A 1E32A 2B7TA 1Z5CA 4FW9A 3THNA 2NYLC 3VDUA 4GMQA 3F6GA 3KW6A 1YZ9A 3HHYA 2Z4RA 2P6BA 3U61A 1PKPA 2N3HA 1FJGE 2ZANA 3I4VA 3KFUG 3DFZA 4NXME 2CFOA 4MP0A 4G4RA 4LF4M 2WDFA 2F5OA 4M30A 3CTWB 1NY6A 4KKZA 4MH0E 3U61B 1T4OA 3CK2A 4DV6E 2JOBA 1NHGC 2Y0QA 4DR4E 1U32A 2V6ZM 3A45A 4JI4M 2XSZD 2QJCA 2QFPA 2USHA 3RFWA 2GJUA 2I7NA 4DV3E 1TH2A 4BC7A 1IBME 3J2PB 5LMUM 1QAOA 3H67A 4DV0M 4AQYM 3IB7A 2Q2EB 4PDIA 1MF8A 3KWRA 5KO3A 3P71C 4DV5E 2O5RA 1YYWA 5EP2A 1T70A 3VYXA 4JA9A 4IBDA 4UT3A 3W0LB 4NL4H 4V0XA 2WZOA 4X62E 3C4BA 3K1JA 4NRWA 3E7AA 5EJCA 4JYAM 3PVSA 4F9CB 7CATA 4CGYB 3OMLA 3KSJA 4UT3B 2CHGA 5AE1A 4OX9E 3AKZA 1OIDA 1IY2A 5KQDA 5T6JA 4LF5E 2H1RA 2ZBKB 3TQSA 4LJAA 3GRRA 3LLHA 1KBPA 3GRVA 4BS9A 2F5NA 3T1HE 4K0KM 4CISA 4JN6A 5ITXE 2KXEA 1XM7A 3FUUA 1HP1A 3MJ5A 2K4VA 1XNQM 3KS8A 3GPXA 1WHQA 1GKIA 4LF6E 4JV5E 4O24A 2M7QA 4H2BA 2F5PA 4UT2A 1HQCA 3SC3A 2R62A 1GQEA 1II7A 1X37A 1N32E 1J26A 4F9AB 1HNZE 2RSMA 2O8AA 3WHLA 3J81C 2UU9M 2KRUA 4GH9A 1K3XA 4MGYE 2V1UA 1IM2A 3FYDA 3K8ZA 4TUIA 1XMOE 2VF1A 4H1SA 4BBYA 5B8IA 4JI5M 2FE8A 3N5UA 2Z06A 1O0WA 1HNWM 3ADIA 3MHVC 4JI7M 5KQ8A 1NNWA 2I7PA 4DT2A 1GL6A 2KW0A 2NUEA 4JI0M 4CHTB 3PSNA 5IREB 1IN7A 2VQFM 3DSDA 1TDZA 3H62B 4HD0A 2D7HA 2BDXA 2UUCM 2G5GX 5HPEA 5ITXA 3OTOM 5AASA 4F0ZA 2Z3XA 4LF8M 3ICFA 5EP3A 4JI6E 2R18A 2ZBMA 2ODRD 4JI2E 5IWAE 3E0JA 4KO8A 1UILA 5BR8M 4FCVA 3L25A 2Z7JA 2J7OA 3HPSA 5EQVA 3ILKA 1R7RA 3RGSA 3SMSA 4DKKA 3U6QA 5IT9C 2L7HA 1OJLA 1TH4A 4X65E 2B7VA 4P7DA 2XFSA 2D7EA 4GKJM 1JR3D 3T38A 4L5NC 3TWMA 4LGMA 3A46A 2R4JA 1G4AE 2D7GA 3H69A 3QFNA 4DMIA 2E5LM 3K2LA 3BOSA 4B3TM 2EO2A 4OVZA 4DUZM 4HLQA 3U6MA 4DR6M 3ZU0A 2QZ4A 2BNKA 3Q8XA 3J81S 4LF4E 5FTMA 4V0WA 4R7GA 3UJNA 5ITYA 1NNJA 2WDDA 4OVZB 1DO2A 1N34M 4GIPA 1XNRM 2LUPB 2G7HA 3DJWA 4JI4E 1ZAEA 2CV1A 4GC5A 2QBYA 3FUWA 3C5WC 3SMPA 2L6OA 1LV7A 5FLXC 5LMUE 3UK6A 4DV0E 2V85A 4AQYE 4PDGA 1ZBQA 3T15A 3L2AA 2DXLA 2W82A 3F6HA 3DA1A 3PSOA 2QBYB 3FD9A 2XLJA 4I4LA 3L29A 5GKNA 3SYLA 2RTXA 2VIIA 4LCBA 1X49A 5IOHA 1Q3CA 1V73A 4FCTA 4JI8E 4GHAA 1TGUA 4JYAE 4LRSA 3LQQA 3GVEA 2CEAA 1PJJA 2R46A 2JWOA 2Z72A 3QFKA 1MX0A 4DUYM 3HKPA 3H4MA 2DFJA 2G8LA 3JR4A 4WURA 5ITQA 1HO5A 5IT9S 2EA0A 2L33A 1UF3A 4GRIA 3FTDA 2QFRA 2RS7A 2LMZA 4JI1M 4JXJA 3JR5A 3K6QA 5LL6R 3CF0A 4ORAA 3T1YM 4K0KE 2UUBE 3UMMA 2XF3A 3M0EA 4GITA 3K92A 3LL8A 3CF6E 4KODA 2Y0TA 1YYKA 5IZ7D 1J5EE 5AE3A 4G6ZA 4LTYA 2LWXA 4MOYA 4DR5E 4AW4A 3E9SA 1G41A 3U60A 2NA2A 2CHQA 3AOGA 3J80C 3DZDA 4XPNA 2FNAA 4QHSA 2V1CA 5FSWA 2DXIA 3IWBA 3J27B 1QAQA 2CPNA 4ZX2A 3PNVA 3U60B 4WW0A 4X8WA 1ZBTA 5FLXS 4P16A 4O43A 3IWDA 1HNWE 2IE4C 3KP0E 5BPVA 4JI7E 4MB7A 3FUXA 4II7A 3U6CA 4GKKE 2UUAM 4KZSA 3SFZA 3EGHA 4JI0E 3DW8C 1W5SA 3SBJA 3DOAA 4L78A 2VQFE 2VE7C 1IQPA 2C96A 2UUCE 3KOZE 4ZPXA 2R45A 3HJSA 4UWQA 3OTOE 4LF7M 4LF8E 1AUIA 2BJWA 2IHR1 2NYMC 1W24A 2UXBM 1FJMA 4IJFA 4NRVA 5JI3E 4B3RM 4J8ZA 1IBKM 2F4VE 4IBCA 5BR8E 1H6UA 1HT1E 2FFJA 3GQ4A 1N75A 2R17A 4LJ9A 1STUA 1E9RA 4DV7E 3GPUA 1XWIA 3FIGA 3KBPA 2M4IA 1HR0M 4RNAA 4IBEA 1T4NA 3HQ1A 2L09A 2NXFA 2DIXA 3L27A 3VFDA 4EIWA 2E5LE 1L2CA 2JY9A 4DV1M 3SATA 5JPFA 3KOWE 4DUZE 4LJ6A 2DXNA 4LFAM 4DR6E 1QZMA 3J80S 2HHHM 3H63A 4JA7A 1G5BA 1IXZA 3H61A 5H37D 4O4KA 5AE2A 4IJEA 1T3TA 2L2NA 4RF1A 1X47A 1N34E 3D8LA 4I5SA 2DSYA 3EIHA 3E4RA 5CFFE 4R3DA 2XZFA 3KOXE 5FTNA 1YYOA 1EKZA 4FBWA 2X49A 4X66M 1S3SA 2FGGA 2J7NA 2MDRA 3FTCA 4BCAA 2OPFA 1RQ0A 1UHZA 3IVEA 4FCWA 2DZOB 4MGIE 4LJ5A 3R8FA 3C9FA 4NZVA 1D2NA 3VK8A 2XSZA 2V87A 3NBIA 4FWGA 3H68A 3HU3A 4QOZC 3U5ZA 4KBPA 5LMNM 3FYCA 2ZM6M 3KP1E 1QAMA 2KZSA 4QHTA 3SAVA 2NUGA 4DUYE 4XGIA 3GRUA 3I51A 3U5ZB 2C98A 2WDEA 2LH0A 2KHXA 3GPPA 2H36X 3FLOA 4JI1E 3SASA 1S95A 2N3GA 3C4TA 3VKHA 4WPYA 2KKNA 3GLHA 1L2BA 3U6LA 3HXLA 2KRKA 4B7HA 4R03A 3R9XB 4QOSA 1SXJD 3RL5A 1N36M 3KSXA 3H60A 3FTEA 4MGZE 3W0FA 3EIEA 2XEPA 2DHRA 3GLHB 1XMQE 3J7BA 3LMLA 4YHHM 4B3MM 4AKIA 1IBLM 1C1KA 3U6DA 2CHVA 5ITRA 2YEQA 3L28A 3HTXA 4JI3M 1NJGA 1EE8A 1UTEA 4ORBA 4G4NA 1XXHA 2MC6A 4FVMA 4F9BB 1JK7A 1IN5A 3HVQA 4B7GA 4YY3E 4B3SE 1XHBA 3HJ8A 3IB8A 3LQRA 3P1XA 2UUAE 2V86A 4PCZA 2O8GA 3RQZA 1T71A 1FKAE 3NWLA 1XXHB 3SYKA 1E9SA 3QAUA 1S3LA 3ZH9B 5GTUA 1NJFA 4IBBA 3IG5A 4KLNA 4NXNM 2F5QA 2B9DA 4LF7E 3VKGA 2M1SA 1J7KA 2UXDM 4LG2A 1S3MA 4WYQB 2LTSA 4QNMA 1OI8A 1IBKE 3JAMC 3QG5C 3HGIA 2XMOA 1YE9A 3ZOQB 4X64M 1WAO1 1HQYE 2QCUA 2Y21A 5DYIA 2EZ6A 3SAWA 2C5RA 4A3VB 3VYYA 4M9XA 4V0VA 2YFQA 4OU7A 4L8RC 1HR0E 4B7FA 4H2FA 3B9PA 3KVWA 1XZWA 4I5NC 3ZC7B 2WDCA 3DF6A 1ORYB 1MU5A 4NSOB 4LZJA 2JOGA 2LXEA 4DV1E 2YVTA 4IBJA 2BQ8X 4BBAA 1USHA 1Z2WA 1I4WA 3T1HM 2L3CA 4OR9A 2ZO9B 4DR7M 2Z1AA 5EXTA 1NVMA 4LRTA 4I81A 3ZCBB 4LF6M 4DR3M 4JV5M 3FGAC 4IBFA 1S3NA 1TCOA 2JR1A 1QU6A 1W5TA 3FTFA 3DSCA 2C9OA 2KA6B 3TWLA 2CV2A 1HNZM 4BC9A 2IAEC 4YKEA 4QNRA 2M60A 2F8BA 1L2DA 1Z6TA 4TUWA 5ITUA 1TDHA 1XMOM 1GVNA 1XNQE 5DYGA 3THOB 1JQJC 3QWLA 5ADZA 4MGKE 3TL4X 5LMNE 1OFHA 4D82A 3ADGA 4MGHA 3MK6A 3H64A 3SHFA 2ZM6E 1QHWA 3GLGA 1S70A 3JAMS 2YZTA 3UGJA 4MM3B 3J7Yp 5C18A 4REZA 2UU9E 3ADJA 3RL3A 2RKOA 4Z6YA 1DQ3A 3JTZA 3GLGB 4M2ZA 4JI5E 3TWKA 1R6BX 2P5TA 5EQTA 4M9SA 3L26A 2BCDA 4LFBM 1NHWC 2QP9X 2CV9A 4PD2A 3LMMA 1IT6A 4L4UA 3HWSA 4D80A 1N36E 4FD2A 3TGHA 1GLNA 5EXXA 3ADLA 2UXCM 3K7VC 3TE6A 3THGA 2DVWB 1DGHB 4YHHE 4LF9M 4B3ME 1HNXM 1IBLE 1I94M 3UZUA 2RS6A 5EXPA 1QVRA 5JJTA 2M5ZA 4JI3E 4BLCA 2EWLA 3PFIA 3VDPA 3RMPA 2HY1A 1L1ZA 2L2MA 2OQ4A 5DNYA 2E1MA 3KS4A 4FCXA 2CE7A 1IN6A 4GKJE 1SU1A 1G8PA 3FUTA 2Q8UA 4PT5A 2QPAA 1GZ6A 2QENA 2CV0A 3HHXA 4B3TE 3FUVA 2DWLA 3GP1A 4NXNE 3D8BA 3EGGA 3AV0A 4DHLA 2UXDE 4L15A 5E26A 1IN4A 2YR0A 8CATA 2NQ8C 1WHNA 1IXRC 2JVAA 1VDDA 1WXRA 4X64E 2LJHA 4LGYA 1HPUA 4JI8M 1XNRE 1Q39A 1ZQ9A 1KSFX 3M6AA 2LNHC 2V89A 1PM5A 3TPZA 3U6SA 1G59A 3ZTVA 4NSRA 2EUCA 2LE2A 3VK7A 4M0WA 2AHMA 1K82A 3E7BA 4H1YP 3PXGA 4KHPM 3SAUA 3M7GA 2NUFA 3KOYE 3V4YA 2ERCA 1K3WA 3J7AS 3HU2A 1PJIA 2L6MA 3AOEA 2Z4SA 4DR1M 1DGGA 3GQ3A 2DWMA 5F3WA 1X48A 4L16A 1OIEA 2UUBM 4AG5A 1DGFA 5A2QC 4OOGC 1SR9A 4DR7E 4G9JA 1KFVA 4LFCM 4Q28A 3IWCA 4IYPC 4DR3E 4J6OA 3AOEC 5EXSA 1J5EM 2HKJA 1NSFA 2YT4A 4DV2M 5J28A 3QFOA 5JI2E 1YUBA 2JOXA 4DR5M 1WXQA 3I4YA 3J7AG 4IBIA 4DV4M 5FTJA 1N78A 4XBOA 1N33M 5JPEA 4FWDA 2X8AA 3GPYA 3T1YE 2RGOA 4AG6A 1N77A 3RGPA 4DR2M 2KONA 2V8QB 3U6EA 2VQEM 2XFTA 4LJ7A 3CF2A 2HL7A 4FBKA 1SXJE 1RC7A 3HHZA 1Z5AA 1XC8A 4GKKM 5KPZA 2Y20A 5C1VA 4LACC 1J09A 3U6OA 2L8TA 3GQ5A 3RE8A 1T4LB 1FNNA 4AI6A 1DGBA 2JA2A 1NY5A 4IL1A 1QFCA 1FJGM 3H66A 1G3IA 4AKGA 4G4QA 1E94E 5FTLA 4NXMM 3H09A 4O5GA 2IE3C 3QFMA 4R8OA 4LZZA 2KOUA 2AHDA 3MSWA 3HHWA 2R65A 4LY6A 4S12A 2F4VM 4DV6M 2HYOA 2RGHA 4G4OA 3PNYA 4TUGA 4LFBE 3VLFB 3JYFA 4DR4M 1DI2A 3VK6A 4NOOB 3T1IA 2ZOAA 2BJVA 4MOVA 4LU9A 4DV7M 1R2YA 3HPZA 4DSYA 2ZAOA 3A42A 3AJIB 3SARA 2L7IA 2UXCE 4DV3M 5A2QS 1S8EA 1IBMM 1QYRA 3AFHA 4LF9E 1HNXE 4I8OA 1I94E 4DV5M 4LJ4A 2C99A 4P78A 1SXJA 3WHKA 2UXBE 2F5SA 3AUZA 4ITQA 2X4AA 1IXSB 4B3RE 2DWNA 3HJQA 4AZFA 2A5YB 4HL4A 3GRYA 4GC9A 2A22A 4X62M 4I5LC 5ITTA 1L1TA 1KYIA 2LBSB 2DB2A 2FV4B 1SXJB 1SXJC 2HYPA 2KZUA 4LJ8A 4B08A 4IIWA 2LTRA 1GL7A 2DWZB 3IG8A 1YSYA 2XZUA 4OX9M 5INBA 4AKHA 4LF5M 5KPTA 2XH9A 4BMJA 3AL0C 2L3JA 2C9CA 2CUZA 4H2IA 4FWHA 3KXEC 2ODRC 2MC5A 1R2ZA 4LFAE 2LUQA 1HT2E 2HHHE 3GLFA 2ZAMA 3FKEA 2V88A 1JR3A 4H2GA 4M0VA 2FTXB 1Z2XA 2HCBA 2LRSA 5EP1A 3LVVA 2YQZA 5KPRA 2DZNB 4M0DA 3GLFB 4OW0A 4BB9A 3JU0A 3GLIA 4F54A 3SHGB 1N32M 1L8QA 3C58A 2K47A 5EP4A 1QANA 4ORCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVD A;  5JJT A;  2O8A A;  3KBP A;  3H68 A;  1T70 A;  4H2F A;  1XZW A;  4JA9 A;  1UTE A;  4ORB A;  5IOH A;  5C1V A;  4KBP A;  3RL4 A;  4H1Y P;  3E7B A;  3K7W C;  3THN A;  2NYL C;  4UT3 A;  4I5N C;  4LAC C;  4ZVZ A;  4V0X A;  3H64 A;  1V73 A;  2A22 A;  4ZX2 A;  2WDC A;  2HY1 A;  1JK7 A;  1QHW A;  3E7A A;  4I5L C;  2NXF A;  1S70 A;  4TUI A;  3V4Y A;  3GVE A;  3H69 A;  3HVQ A;  5DNY A;  2P6B A;  3QFN A;  4H1S A;  5B8I A;  2JOG A;  3N5U A;  4O43 A;  2Z06 A;  2Z72 A;  2IE4 C;  2YVT A;  2HYP A;  3IB8 A;  3QFK A;  4IL1 A;  2BQ8 X;  1QFC A;  5JPF A;  1USH A;  2DFJ A;  1Z2W A;  3H66 A;  5F3W A;  1NNW A;  4FCX A;  1OIE A;  2O8G A;  4DT2 A;  2WDE A;  1HO5 A;  4UT3 B;  3RQZ A;  1T71 A;  4OR9 A;  3RL3 A;  4MP0 A;  3ZU0 A;  4B2O A;  3EGH A;  4O5G A;  1SU1 A;  3H63 A;  2IE3 C;  3DW8 C;  3ZTV A;  1UF3 A;  1OID A;  4JA7 A;  2Q8U A;  3QFM A;  1G5B A;  5INB A;  4G9J A;  2QFR A;  2Z1A A;  1WAR A;  3PSN A;  2WDF A;  3H61 A;  4IYP C;  1S95 A;  2AHD A;  1S3L A;  4V0W A;  4KKZ A;  4Q7F A;  5GTU A;  3CK2 A;  4O4K A;  3FGA C;  3DSD A;  4J6O A;  3H62 B;  4HD0 A;  2KKN A;  1KBP A;  2HYO A;  2WDD A;  1S3N A;  4H2I A;  2BDX A;  4TUG A;  4ORA A;  1TCO A;  5J28 A;  3QFO A;  5HPE A;  2BCD A;  3JYF A;  1U32 A;  4UWQ A;  2CV9 A;  3EGG A;  3AV0 A;  4DHL A;  4F0Z A;  3DSC A;  1AUI A;  1XM7 A;  3T1I A;  1IT6 A;  1HP1 A;  4H2G A;  4MOV A;  4LU9 A;  4DSY A;  1S3M A;  2QJC A;  2QFP A;  4M0V A;  3ICF A;  3LL8 A;  3RL5 A;  2NYM C;  1W24 A;  4WWL A;  2NPP C;  3C5W C;  4FBQ A;  2USH A;  1FJM A;  2IAE C;  2ZBM A;  1OI8 A;  4FBW A;  4YKE A;  3H60 A;  4O24 A;  3TGH A;  1Z2X A;  3QG5 C;  2XMO A;  4H2B A;  1M63 A;  2GJU A;  4UT2 A;  5JPE A;  3K7V C;  1S8E A;  5EQV A;  2R17 A;  1WAO 1;  3H67 A;  3IVE A;  4LTY A;  4MOY A;  1HPU A;  3IB7 A;  1MF8 A;  3P71 C;  1II7 A;  3C9F A;  4NZV A;  3PSO A;  3THO B;  4XPN A;  3AUZ A;  4FBK A;  4V0V A;  4ORC A; 
#chains in the Genus database with same CATH topology
 1YSA C;  3LCU A;  4X66 E;  1D0L A;  2EOX A;  1OFI A;  1A1G A;  1Z5B A;  5C1B A;  2V83 A;  2EOQ A;  3RL4 A;  3K7W C;  4ZVZ A;  4D81 A;  3U6P A;  4KHP E;  2WBS A;  3GLI B;  2KEB A;  3EPK A;  2B3T B;  4DR1 E;  2JYA A;  1IN8 A;  1A1K A;  4GEQ B;  4RF0 A;  3TQM A;  4IBK A;  2EJ4 A;  4B2O A;  4GHL A;  3A98 B;  4W5W A;  1T39 A;  1X3C A;  4LFC E;  1WAR A;  1GTK A;  2MJ5 B;  2EMK A;  4Q7F A;  3MHH C;  2EQ0 A;  4IBG A;  2EPZ A;  4WSG A;  4Z8X A;  4L8N A;  4DV2 E;  1XMQ M;  2L92 A;  1IY1 A;  3EPH A;  1Z59 A;  2L2D A;  2R4E A;  3GO8 A;  3K9O A;  4WWL A;  1TH3 A;  2NPP C;  4DV4 E;  4FBQ A;  2DMY A;  4JI6 M;  5E6J A;  1NNU C;  4JI2 M;  1N33 E;  5IWA M;  3VHT B;  1M63 A;  1DO0 A;  5FTK A;  2L2K B;  3D03 A;  4DR2 E;  4M9Z A;  4WSP A;  1DGH A;  2VQE E;  3KDS E;  1UM8 A;  2KNV A;  2JY8 A;  4WFT A;  2XGN A;  2YNM D;  3LVW A;  4YY3 M;  4B3S M;  3HU1 A;  3BGH A;  4X65 M;  1Q3B A;  3QYB A;  2FOI C;  1QQW A;  4NC6 A;  3IVD A;  1IY0 A;  1Q02 A;  1E32 A;  1KYQ A;  2B7T A;  1Z5C A;  4FW9 A;  3THN A;  2NYL C;  2EQ1 A;  3VDU A;  4GMQ A;  3F6G A;  1X6H A;  3KW6 A;  1YZ9 A;  2RSI A;  3HHY A;  4Y28 F;  2Z4R A;  2P6B A;  2K0B X;  3I01 M;  3U61 A;  1PKP A;  2N3H A;  2K9D A;  1FJG E;  2ZAN A;  2EPO A;  3I4V A;  3KFU G;  3DFZ A;  2LO3 A;  4NXM E;  2CFO A;  2EOO A;  4MP0 A;  2EL5 A;  4G4R A;  2RRU A;  1X5W A;  2JP7 A;  4LF4 M;  2JY6 B;  2WDF A;  3C9P A;  2F5O A;  4M30 A;  2ADR A;  3CTW B;  1NY6 A;  4KKZ A;  4MH0 E;  3U61 B;  1T4O A;  3CK2 A;  4IS1 C;  4DV6 E;  2JOB A;  1NHG C;  2BWB A;  2Y0Q A;  1NO1 A;  4CJ6 A;  4DR4 E;  1U32 A;  4IJD A;  2EM5 A;  2V6Z M;  3A45 A;  4JI4 M;  2XSZ D;  2QJC A;  2QFP A;  2USH A;  2MRO B;  2EKF A;  3RFW A;  2GJU A;  2I7N A;  4DV3 E;  1TH2 A;  4BC7 A;  1IBM E;  3J2P B;  5LMU M;  1QAO A;  3H67 A;  4DV0 M;  4AQY M;  3IB7 A;  2Q2E B;  4PDI A;  1QUT A;  1MF8 A;  3KWR A;  5KO3 A;  3P71 C;  4HEO A;  4DV5 E;  2O5R A;  1YYW A;  5EP2 A;  2EPX A;  3LCV B;  1T70 A;  3VYX A;  2K6B A;  4JA9 A;  2I9I A;  4IBD A;  4UT3 A;  2RQL A;  3W0L B;  4NL4 H;  4V0X A;  2WZO A;  4X62 E;  3C4B A;  3K1J A;  4NRW A;  3E7A A;  2YWQ A;  5EJC A;  2WBT A;  4JYA M;  3PVS A;  4F9C B;  7CAT A;  4CGY B;  3IHP A;  1ZR9 A;  2EPA A;  1TN9 A;  5A69 A;  3OML A;  3KSJ A;  4R2C A;  4UT3 B;  2CHG A;  5AE1 A;  2H5X A;  3AKZ A;  4OX9 E;  1OID A;  1IY2 A;  5KQD A;  5T6J A;  2MDG A;  4LF5 E;  2H1R A;  2ZBK B;  1AH5 A;  3TQS A;  4LJA A;  3GRR A;  3LLH A;  1KBP A;  2JNH A;  2ZTD A;  3GRV A;  4BS9 A;  2F5N A;  4WXD A;  3T1H E;  4K0K M;  4CIS A;  4JN6 A;  5ITX E;  2KXE A;  1XM7 A;  3FUU A;  1HP1 A;  3MJ5 A;  2K4V A;  2LCE A;  2LJU A;  2JUJ A;  1XNQ M;  3KS8 A;  1ZAA C;  3GPX A;  1WHQ A;  2KHH A;  1GKI A;  4LF6 E;  2OOA A;  4O24 A;  4JV5 E;  2M7Q A;  2JXP A;  4H2B A;  2F5P A;  1R5L A;  4UT2 A;  4CIZ A;  1HQC A;  2YTQ A;  3SC3 A;  2R62 A;  1GQE A;  1II7 A;  1GJT A;  1X37 A;  1N32 E;  2EOF A;  5KL4 A;  1J26 A;  4F9A B;  1HNZ E;  2EN8 A;  2EL6 A;  2RSM A;  2O8A A;  3WHL A;  3J81 C;  2UU9 M;  3EPJ A;  4KT0 F;  1TR8 A;  2KRU A;  1C7Y A;  4GH9 A;  1OAO C;  1K3X A;  4MGY E;  2YSO A;  2V1U A;  1IM2 A;  3FYD A;  2QNJ A;  3K8Z A;  4TUI A;  1XMO E;  2VF1 A;  4H1S A;  4BBY A;  5B8I A;  4JI5 M;  2FE8 A;  4F1I A;  1V33 A;  3N5U A;  2Z06 A;  1HJP A;  2LVP C;  1O0W A;  1HNW M;  3ADI A;  3MHV C;  2HJJ A;  4JI7 M;  5KQ8 A;  1T43 A;  2EN1 A;  5KL5 A;  1NNW A;  2ENA A;  2I7P A;  4DT2 A;  1GL6 A;  2KW0 A;  2NUE A;  4JI0 M;  4R2E A;  2VF8 A;  4CHT B;  3PSN A;  5IRE B;  1IN7 A;  2VQF M;  3DSD A;  1TDZ A;  3H62 B;  4HD0 A;  2D7H A;  4R2S A;  2BDX A;  2UUC M;  2WZJ A;  2G5G X;  5HPE A;  5ITX A;  3OTO M;  5AAS A;  4F0Z A;  2Z3X A;  4LF8 M;  4L6V 6;  2MGW A;  1P3Q Q;  3ICF A;  5EP3 A;  1A1F A;  4JI6 E;  2R18 A;  2ZBM A;  2ODR D;  4JI2 E;  5IWA E;  3E0J A;  4KO8 A;  1UIL A;  5BR8 M;  4FCV A;  3L25 A;  2Z7J A;  2J7O A;  3HPS A;  5EQV A;  3ILK A;  1R7R A;  3RGS A;  3SMS A;  2DLK A;  4P17 A;  4DKK A;  3U6Q A;  2CSH A;  5IT9 C;  2L7H A;  2EE8 A;  1OJL A;  1TH4 A;  4X65 E;  1PJQ A;  2B7V A;  2JZ0 A;  2R76 A;  4P7D A;  2XFS A;  2D7E A;  4GKJ M;  1JR3 D;  2I13 A;  3T38 A;  2HWJ A;  4L5N C;  3TWM A;  4LGM A;  3A46 A;  2R4J A;  1G4A E;  2D7G A;  1NV8 A;  3H69 A;  3QFN A;  4DMI A;  2E5L M;  3KZY A;  3K2L A;  3BOS A;  4B3T M;  2EO2 A;  2EQ3 A;  4OVZ A;  3FRI A;  4DUZ M;  4HLQ A;  3U6M A;  3QYE A;  4DR6 M;  3ZU0 A;  2QZ4 A;  2BNK A;  3Q8X A;  2EOZ A;  3L00 A;  3J81 S;  4LF4 E;  5FTM A;  2LBC A;  4V0W A;  4R7G A;  2EMX A;  2EMH A;  2EL4 A;  1GAB A;  3UJN A;  5ITY A;  1NNJ A;  2WDD A;  4OVZ B;  1DO2 A;  1N34 M;  3V76 A;  2N35 A;  4GIP A;  1XNR M;  2DAM A;  2FS1 A;  2LUP B;  2G7H A;  3DJW A;  4JI4 E;  1ZAE A;  2CV1 A;  4GC5 A;  2QBY A;  2DMI A;  3ZQJ A;  3FUW A;  2WSC F;  2L4F A;  3C5W C;  2GQF A;  2EOH A;  2YU8 A;  3SMP A;  2L6O A;  1LV7 A;  2EOS A;  5FLX C;  5LMU E;  2EKK A;  3UK6 A;  4DV0 E;  2V85 A;  4AQY E;  4PDG A;  1ZBQ A;  3T15 A;  3L2A A;  2RPC A;  2DXL A;  2DKL A;  2W82 A;  3F6H A;  3DA1 A;  1IMU A;  3PSO A;  2QBY B;  3FD9 A;  1B69 A;  4G3O A;  2XLJ A;  4I4L A;  2DAG A;  3SYL A;  3L29 A;  5GKN A;  2RTX A;  2VII A;  1GO5 A;  4LCB A;  1WRJ A;  1BVS A;  1X49 A;  5IOH A;  1Q3C A;  1V73 A;  4FCT A;  4JI8 E;  4GHA A;  3IEC A;  2YRH A;  1TGU A;  2QHO B;  1TTE A;  4LRS A;  3LQQ A;  2GHF A;  4JYA E;  3GVE A;  1NEI A;  1RMD A;  1WIV A;  2CEA A;  1PJJ A;  2R46 A;  2JWO A;  2Z72 A;  2APL A;  3QFK A;  1MX0 A;  4DUY M;  3HKP A;  3H4M A;  2KDL A;  2DFJ A;  2G8L A;  3JR4 A;  1L4S A;  4WUR A;  5ITQ A;  1HO5 A;  5IT9 S;  2EA0 A;  2L33 A;  1UF3 A;  4GRI A;  3FTD A;  2QFR A;  2RS7 A;  2LMZ A;  4JI1 M;  4JXJ A;  3JR5 A;  3K6Q A;  1MGT A;  2YPN A;  1PJT A;  3E46 A;  5LL6 R;  2ELZ A;  3CF0 A;  4ORA A;  3T1Y M;  2EMZ A;  1QZE A;  5KL3 A;  4K0K E;  2EM2 A;  2UUB E;  2ENH A;  3UMM A;  2XF3 A;  2ELY A;  3M0E A;  4GIT A;  3K92 A;  3LL8 A;  3CF6 E;  4KOD A;  3T6P A;  2Y0T A;  1YYK A;  5IZ7 D;  1J5E E;  5AE3 A;  4G6Z A;  3FE3 A;  4LTY A;  2LWX A;  2LVN C;  4MOY A;  4DR5 E;  4AW4 A;  1VQ1 A;  3E9S A;  1G41 A;  2CWB A;  3U60 A;  2NA2 A;  5KL2 A;  2CHQ A;  3AOG A;  3J80 C;  3DZD A;  4XPN A;  2FNA A;  1CUK A;  2EN2 A;  1G2D C;  4QHS A;  2EM9 A;  2V1C A;  5FSW A;  2DXI A;  3IWB A;  3J27 B;  1QAQ A;  1A1J A;  2CPN A;  3K9P A;  4ZX2 A;  3PNV A;  2HC5 A;  3BF2 A;  3U60 B;  4WW0 A;  4X8W A;  1ZBT A;  4ZYE A;  5FLX S;  4P16 A;  2EOR A;  4O43 A;  3IWD A;  1HNW E;  2IE4 C;  3KP0 E;  5BPV A;  4JI7 E;  4MB7 A;  3FUX A;  2CRU A;  4II7 A;  3U6C A;  4GKK E;  1ZU1 A;  2UUA M;  1SFE A;  1LTM A;  2EPL X;  3C6M A;  4KZS A;  2OO9 A;  3SFZ A;  3EGH A;  4JI0 E;  3DW8 C;  1W5S A;  3SBJ A;  3DOA A;  4L78 A;  2DRP A;  2VQF E;  1V34 A;  2DLQ A;  2VE7 C;  1IQP A;  1A1H A;  2C96 A;  2UUC E;  3KOZ E;  4ZPX A;  2R45 A;  3HJS A;  2BB8 A;  4UWQ A;  3OTO E;  4LF7 M;  4LF8 E;  1AUI A;  2BJW A;  2GLI A;  2IHR 1;  1TF6 A;  2NYM C;  1W24 A;  2UXB M;  1FJM A;  4IJF A;  4F6M A;  4NRV A;  5JI3 E;  4B3R M;  4J8Z A;  2EMF A;  1IBK M;  2F4V E;  4IBC A;  5BR8 E;  1H6U A;  1IQS A;  2GPI A;  1HT1 E;  2FFJ A;  3GQ4 A;  1N75 A;  2R17 A;  1EIJ A;  4LJ9 A;  1STU A;  1DGC A;  1E9R A;  1UBD C;  4DV7 E;  1OIZ A;  3GPU A;  2FH0 A;  1XWI A;  5LLQ A;  3F92 A;  1OTR A;  5AC4 A;  3FIG A;  3KBP A;  2M4I A;  1HR0 M;  4RNA A;  4WX9 A;  1N3G A;  4BHC A;  4IBE A;  1BBO A;  1T4N A;  3HQ1 A;  2L09 A;  2NXF A;  2DIX A;  3L27 A;  2EM4 A;  3VFD A;  4EIW A;  2E5L E;  4X9J A;  1L2C A;  2JY9 A;  4DV1 M;  3C3E A;  3SAT A;  2BBG A;  5JPF A;  3KOW E;  3B7Q A;  4DUZ E;  4LJ6 A;  2DXN A;  4LFA M;  4DR6 E;  1QZM A;  3J80 S;  2HHH M;  3H63 A;  4JA7 A;  1G5B A;  1IXZ A;  3H61 A;  5H37 D;  4O4K A;  5AE2 A;  2MH8 A;  4IJE A;  1T3T A;  2DAI A;  2L2N A;  4RF1 A;  1X47 A;  3GLH E;  1N34 E;  2LV2 A;  1PRB A;  2YSP A;  2YTG A;  3D8L A;  4I5S A;  2DSY A;  1QNT A;  3EIH A;  3E4R A;  5CFF E;  4R3D A;  2XZF A;  2J5Y A;  3KOX E;  5FTN A;  1YYO A;  1EKZ A;  5L8R F;  2X49 A;  2EOM A;  4FBW A;  4X66 M;  1S3S A;  2FGG A;  3BBG A;  2J7N A;  2MDR A;  3FTC A;  2EMA A;  4BCA A;  1VEG A;  2OPF A;  1RQ0 A;  1UHZ A;  3IVE A;  4FCW A;  2DZO B;  4MGI E;  4LJ5 A;  3R8F A;  3C9F A;  4NZV A;  1D2N A;  3VK8 A;  2XSZ A;  2V87 A;  2O25 A;  4F6N A;  1VDL A;  3NBI A;  1A5T A;  4FWG A;  3H68 A;  3HU3 A;  1A1L A;  4QOZ C;  3U5Z A;  4KBP A;  5LMN M;  3FYC A;  3EQ1 A;  1YUI A;  2EOY A;  1LLM C;  2ZM6 M;  4UN2 B;  3KP1 E;  1VEJ A;  1QAM A;  2KZS A;  4QHT A;  3SAV A;  2NUG A;  4R2Q A;  4DUY E;  2R1F A;  4XGI A;  3GRU A;  3BID A;  3I51 A;  3U5Z B;  2C98 A;  2WDE A;  2LH0 A;  2KHX A;  3HZJ A;  3GPP A;  2H36 X;  1OKS A;  3FLO A;  4JI1 E;  3SAS A;  1S95 A;  2N3G A;  5A6K A;  3C4T A;  2YTJ A;  2K7I A;  4ZYG A;  3VKH A;  4WPY A;  1BB8 A;  3UK3 C;  2KKN A;  3GLH A;  4WP2 A;  1L2B A;  4R2R A;  3U6L A;  3HXL A;  4MLV A;  2KRK A;  4B7H A;  4R03 A;  3R9X B;  1JB0 F;  4ZYH A;  1WJP A;  4QOS A;  1SXJ D;  1Z1B A;  3RL5 A;  1N36 M;  3KSX A;  4R2D A;  1RU3 A;  2QQ8 A;  1DV0 A;  3H60 A;  3FTE A;  4MGZ E;  3W0F A;  2YTN A;  3MMP A;  3EIE A;  2XEP A;  2DHR A;  2EML A;  4MLQ A;  3GLH B;  1XMQ E;  3J7B A;  3LML A;  2EM6 A;  4YHH M;  2EM0 A;  2EM8 A;  4B3M M;  4AKI A;  1EH8 A;  1IFY A;  2EPP A;  1IBL M;  1C1K A;  3U6D A;  2CHV A;  5ITR A;  2YEQ A;  3L28 A;  2CTD A;  5A6B A;  4RKU F;  2EP3 A;  3HTX A;  4JI3 M;  1NJG A;  1EE8 A;  2YTI A;  1UTE A;  4ORB A;  2LHC A;  4G4N A;  1XXH A;  2M9A A;  2MC6 A;  4FVM A;  4F9B B;  1JK7 A;  3H4J A;  2DHY A;  1ZMU A;  2EOJ A;  1IN5 A;  1VEK A;  3HVQ A;  4B7G A;  4YY3 E;  4B3S E;  4ZYD A;  1XHB A;  3HJ8 A;  3IB8 A;  3LQR A;  2VF7 A;  3P1X A;  2UUA E;  1NCS A;  2V86 A;  4PCZ A;  2O8G A;  3RQZ A;  1T71 A;  1FKA E;  3NWL A;  1XXH B;  2MKN A;  5DFL A;  3SYK A;  4N4R B;  1T38 A;  1ZMW A;  3B89 A;  1E9S A;  3QAU A;  1S3L A;  3ZH9 B;  2DZL A;  2Z8Y M;  5GTU A;  1NJF A;  2EPC A;  4IBB A;  3IG5 A;  4KLN A;  4NXN M;  2HGH A;  2JY7 A;  2F5Q A;  2B9D A;  4LF7 E;  2YTO A;  3VKG A;  1WHC A;  2M1S A;  1J7K A;  2UXD M;  4LG2 A;  1S3M A;  4WYQ B;  2LTS A;  4QNM A;  1OI8 A;  1IBK E;  3JAM C;  3QG5 C;  3HGI A;  4R2P A;  2XMO A;  1YE9 A;  3ZOQ B;  2KNZ A;  2YRM A;  4X64 M;  1WAO 1;  1HQY E;  2G3Q A;  2MKD A;  2QCU A;  2YRK A;  3ECR A;  1QDR A;  2Y21 A;  1Y8G A;  5DYI A;  2EZ6 A;  3SAW A;  2C5R A;  4A3V B;  3VYY A;  4M9X A;  4V0V A;  3NBX X;  2YFQ A;  4OU7 A;  4L8R C;  1HR0 E;  4B7F A;  4H2F A;  3B9P A;  3KVW A;  1XZW A;  1G2F C;  4I5N C;  3ZC7 B;  2WDC A;  3DF6 A;  1ORY B;  2BWE A;  1MU5 A;  3GLG E;  4NSO B;  4LZJ A;  2JOG A;  3B74 A;  2LXE A;  4DV1 E;  2YVT A;  4IBJ A;  2BQ8 X;  4BBA A;  1USH A;  1Z2W A;  1I4W A;  2WBU A;  3T1H M;  2L3C A;  4OR9 A;  1MN3 A;  1BBG A;  2ZO9 B;  4DR7 M;  2JXN A;  2Z1A A;  5EXT A;  1NVM A;  4LRT A;  4I81 A;  3ZCB B;  4LF6 M;  4DR3 M;  2EPU A;  1V92 A;  4JV5 M;  3FGA C;  4IBF A;  1JK1 A;  2EPM X;  3M99 B;  1S3N A;  1TCO A;  2JR1 A;  1QU6 A;  1W5T A;  3FTF A;  3DSC A;  2EJS A;  2CT1 A;  2C9O A;  2KA6 B;  3EPL A;  1YPN A;  3TWL A;  2DGC A;  2CV2 A;  1EFU B;  1HNZ M;  4BC9 A;  2EPR A;  2IAE C;  4YKE A;  4QNR A;  2M60 A;  1YUJ A;  2N8X A;  2F8B A;  1L2D A;  1Z6T A;  2EPK X;  4TUW A;  5ITU A;  1R4G A;  4F2J C;  1TDH A;  2EN7 A;  1UN6 B;  1XMO M;  1GVN A;  1XNQ E;  5DYG A;  3THO B;  1JQJ C;  3QWL A;  5ADZ A;  3BXW A;  4MGK E;  3TL4 X;  5LMN E;  1OFH A;  4D82 A;  3ADG A;  4MGH A;  3MK6 A;  2EOE A;  3H64 A;  3SHF A;  2ZM6 E;  2CP8 A;  1QHW A;  3GLG A;  1S70 A;  3JAM S;  2YZT A;  3UGJ A;  2EMI A;  4MM3 B;  3J7Y p;  2O01 F;  1OQY A;  5C18 A;  4REZ A;  2UU9 E;  3ADJ A;  3RL3 A;  3B7N A;  2MR9 A;  1IQO A;  2RKO A;  4Z6Y A;  1QDT A;  1DQ3 A;  2EMY A;  2R6F A;  3GLG B;  3JTZ A;  4M2Z A;  1AAY A;  4JI5 E;  2E72 A;  1T6O A;  3TWK A;  1R6B X;  2P5T A;  5A6J A;  5EQT A;  2EMC A;  4M9S A;  3L26 A;  2BCD A;  4LFB M;  1NHW C;  1JK2 A;  2QP9 X;  2CV9 A;  4PD2 A;  3LMM A;  1IT6 A;  4L4U A;  3HY5 A;  3HWS A;  4WXC A;  4D80 A;  1N36 E;  4FD2 A;  3TGH A;  4RH8 A;  1GLN A;  5EXX A;  1PDA A;  2YTD A;  3ADL A;  2UXC M;  3K7V C;  3TE6 A;  3THG A;  2EN4 A;  2DVW B;  1DGH B;  4YHH E;  2R44 A;  4LF9 M;  4B3M E;  1HNX M;  1IBL E;  1QUS A;  1I94 M;  2JWS A;  3UZU A;  2RS6 A;  2QSF X;  1MJG M;  5EXP A;  1QVR A;  5TSE A;  2YTF A;  1G71 A;  5IXM B;  5JJT A;  2M5Z A;  3CGW A;  4JI3 E;  5KL6 A;  1EH6 A;  1YLA A;  4BLC A;  2EMG A;  2EWL A;  3PFI A;  3VDP A;  3RMP A;  2HY1 A;  1L1Z A;  2L2M A;  2OQ4 A;  1KJK A;  2R0I A;  5DNY A;  3I04 M;  3W68 A;  1F2I G;  4F2L A;  2HAK A;  4NHR A;  2EOI A;  2E1M A;  3KS4 A;  4FCX A;  2CE7 A;  1IN6 A;  1AUA A;  4GKJ E;  1AIP C;  1SU1 A;  1G8P A;  4ANR A;  3FUT A;  2Q8U A;  1YFH A;  2LHG A;  4PT5 A;  2YU5 A;  2QPA A;  1F4I A;  1GZ6 A;  2QEN A;  2CV0 A;  3HHX A;  4B3T E;  3FUV A;  1OAI A;  1PGY A;  2DWL A;  3GP1 A;  4NXN E;  3D8B A;  2PRT A;  3EGG A;  3AV0 A;  4DHL A;  2UXD E;  4L15 A;  5E26 A;  1PJS A;  1IN4 A;  2YR0 A;  8CAT A;  2VRD A;  2NQ8 C;  2EM7 A;  1WHN A;  1IXR C;  2JVA A;  1VDD A;  1X6E A;  1WXR A;  4X64 E;  2LJH A;  4LGY A;  4R71 A;  1HPU A;  4JI8 M;  1MEY C;  1XNR E;  1Q39 A;  1ZQ9 A;  2EN6 A;  1KSF X;  3M6A A;  2LNH C;  1TF0 B;  2V89 A;  1PM5 A;  3TPZ A;  3U6S A;  1G59 A;  3ZTV A;  4NSR A;  2EUC A;  2LE2 A;  3VK7 A;  2WSF F;  4M0W A;  2EPN A;  2KNA A;  2AHM A;  1K82 A;  3E7B A;  4H1Y P;  3MHS C;  4Q7J A;  3PXG A;  4KHP M;  3SAU A;  3M7G A;  4XK8 F;  4HTG A;  2NUF A;  3KOY E;  1VG5 A;  3V4Y A;  2ERC A;  1K3W A;  2DI0 A;  3J7A S;  2WCC 3;  3HU2 A;  1PJI A;  2L6M A;  3AOE A;  2Z4S A;  4DR1 M;  1DGG A;  3GQ3 A;  2DWM A;  5F3W A;  1X48 A;  4L16 A;  1OIE A;  2UUB M;  4AG5 A;  1DGF A;  1XB2 B;  1XXH E;  5A2Q C;  4OOG C;  1SR9 A;  4DR7 E;  1WJ7 A;  4G9J A;  1KFV A;  4LFC M;  4Q28 A;  3IWC A;  4IYP C;  2ENC A;  4DR3 E;  5A6B D;  4GEW A;  2JPA A;  2LVQ D;  1D0K A;  4J6O A;  2DEN A;  2J7J A;  3AOE C;  5EXS A;  1J5E M;  2EMW A;  2HKJ A;  1NSF A;  2YT4 A;  4DV2 M;  5J28 A;  3QFO A;  5JI2 E;  1YUB A;  1UFZ A;  2JOX A;  4HEI A;  1ZMV A;  4DR5 M;  1WXQ A;  3C3D A;  3I4Y A;  3J7A G;  2LVO C;  4IBI A;  4DV4 M;  5FTJ A;  1N78 A;  4XBO A;  1N33 M;  5JPE A;  4FWD A;  5KL7 A;  2DAK A;  2GNO A;  2X8A A;  3GPY A;  3T1Y E;  2RGO A;  4AG6 A;  1N77 A;  3RGP A;  4DR2 M;  2KON A;  2V8Q B;  3U6E A;  2VQE M;  2XFT A;  4LJ7 A;  3CF2 A;  1GJS A;  2HL7 A;  4FBK A;  1SXJ E;  3HX3 A;  1RC7 A;  3HHZ A;  1Z5A A;  1XC8 A;  2NAB A;  4GKK M;  5KPZ A;  2D9H A;  2Y20 A;  5C1V A;  4LAC C;  1J09 A;  1WGN A;  3U6O A;  2ZTC A;  2L8T A;  3GQ5 A;  1WR1 B;  2LVH A;  3Q8G A;  2LT7 A;  3RE8 A;  1T4L B;  1FNN A;  4FK5 C;  4AI6 A;  4BHB A;  1DGB A;  2JA2 A;  1NY5 A;  4IL1 A;  1QFC A;  1NV9 A;  1FJG M;  3H66 A;  2LTU A;  1G3I A;  1X6F A;  1WGL A;  4AKG A;  1P47 A;  4G4Q A;  1E94 E;  5FTL A;  4NXM M;  3H09 A;  4KWY A;  4O5G A;  2IE3 C;  2JP9 A;  3QFM A;  4R8O A;  3BBZ A;  4LZZ A;  2KOU A;  2AHD A;  1QAN A;  3MSW A;  3HHW A;  2R65 A;  2L4E A;  4LY6 A;  1SG9 A;  4S12 A;  2F4V M;  2EN3 A;  4DV6 M;  2HYO A;  2RGH A;  4G4O A;  3PNY A;  4TUG A;  4M9V C;  1OIP A;  4LFB E;  3VLF B;  3JYF A;  4DR4 M;  1DI2 A;  3VK6 A;  4NOO B;  3GLF E;  3T1I A;  1TF3 A;  2A25 A;  2ZOA A;  2BJV A;  1JR3 E;  4MOV A;  4LU9 A;  4DV7 M;  1R2Y A;  3B7Z A;  3HPZ A;  4DSY A;  2ZAO A;  3A42 A;  1IXS A;  4GZN C;  3AJI B;  3SAR A;  2L7I A;  2UXC E;  2DNA A;  4DV3 M;  5A2Q S;  1S8E A;  1IBM M;  1QYR A;  3AFH A;  4LF9 E;  1HNX E;  4I8O A;  1EH7 A;  1D0M A;  3GLI E;  1I94 E;  3E21 A;  4Q35 B;  5A6A A;  4DV5 M;  4LJ4 A;  2C99 A;  4P78 A;  1SXJ A;  3WHK A;  2UXB E;  2F5S A;  3AUZ A;  4ITQ A;  2X4A A;  1IXS B;  2EMB A;  4B3R E;  2DWN A;  3HJQ A;  4AZF A;  2A5Y B;  4HL4 A;  3GRY A;  4R2A A;  4GC9 A;  2EM3 A;  2A22 A;  2LVA A;  4X62 M;  2YTP A;  4I5L C;  5ITT A;  1L1T A;  1KYI A;  5IV8 B;  2LBS B;  3W67 A;  2YTE A;  2DB2 A;  2FV4 B;  1SXJ B;  1SXJ C;  2HYP A;  2OOB A;  2KZU A;  4LJ8 A;  4B08 A;  4IIW A;  2LTR A;  1GL7 A;  1ZV1 A;  2DWZ B;  3IG8 A;  1YSY A;  2VDB B;  2XZU A;  4OX9 M;  5INB A;  4AKH A;  4LF5 M;  2JZ1 A;  5KPT A;  2XH9 A;  4BMJ A;  3AL0 C;  4RHB B;  2L3J A;  2C9C A;  2CUZ A;  4H2I A;  4FWH A;  3KXE C;  2ODR C;  2MC5 A;  2DAE A;  1R2Z A;  4LFA E;  2LUQ A;  2JY5 A;  1HT2 E;  2HHH E;  3GLF A;  2ZAM A;  3FKE A;  3FRH A;  2V88 A;  1JR3 A;  4H2G A;  5AC5 A;  3LW5 F;  4M0V A;  2FTX B;  3KZZ A;  1Z2X A;  2HCB A;  2LRS A;  5EP1 A;  1A1I A;  3LVV A;  2YQZ A;  3C6K A;  5KPR A;  2DZN B;  4M0D A;  3GLF B;  4OW0 A;  4BB9 A;  3JU0 A;  3GLI A;  4F54 A;  3SHG B;  1N32 M;  1L8Q A;  3C58 A;  2B3T A;  2K47 A;  5EP4 A;  2WSE F;  4DBG B;  4ORC A; 
#chains in the Genus database with same CATH homology
 4X66 E;  1OFI A;  1Z5B A;  5C1B A;  2V83 A;  3RL4 A;  3K7W C;  4ZVZ A;  4D81 A;  3U6P A;  4KHP E;  3GLI B;  2KEB A;  2B3T B;  4DR1 E;  1IN8 A;  4GEQ B;  4RF0 A;  4IBK A;  4B2O A;  4GHL A;  3A98 B;  4W5W A;  4LFC E;  1WAR A;  4Q7F A;  4IBG A;  4Z8X A;  4L8N A;  4DV2 E;  1XMQ M;  2L92 A;  1IY1 A;  1Z59 A;  2R4E A;  3GO8 A;  4WWL A;  1TH3 A;  2NPP C;  4DV4 E;  4FBQ A;  2DMY A;  4JI6 M;  5E6J A;  1NNU C;  4JI2 M;  1N33 E;  5IWA M;  1M63 A;  1DO0 A;  5FTK A;  2L2K B;  3D03 A;  4DR2 E;  4M9Z A;  4WSP A;  1DGH A;  2VQE E;  3KDS E;  1UM8 A;  4WFT A;  2XGN A;  2YNM D;  3LVW A;  4YY3 M;  4B3S M;  3HU1 A;  4X65 M;  1Q3B A;  3IVD A;  2FOI C;  1QQW A;  1IY0 A;  1E32 A;  2B7T A;  1Z5C A;  4FW9 A;  3THN A;  2NYL C;  3VDU A;  4GMQ A;  3F6G A;  3KW6 A;  1YZ9 A;  3HHY A;  2Z4R A;  2P6B A;  3U61 A;  1PKP A;  2N3H A;  1FJG E;  2ZAN A;  3I4V A;  3KFU G;  3DFZ A;  4NXM E;  2CFO A;  4MP0 A;  4G4R A;  4LF4 M;  2WDF A;  2F5O A;  4M30 A;  3CTW B;  1NY6 A;  4KKZ A;  4MH0 E;  3U61 B;  1T4O A;  3CK2 A;  4DV6 E;  2JOB A;  1NHG C;  2Y0Q A;  4DR4 E;  1U32 A;  2V6Z M;  3A45 A;  4JI4 M;  2XSZ D;  2QJC A;  2QFP A;  2USH A;  3RFW A;  2GJU A;  2I7N A;  4DV3 E;  1TH2 A;  4BC7 A;  1IBM E;  3J2P B;  5LMU M;  1QAO A;  3H67 A;  4DV0 M;  4AQY M;  3IB7 A;  2Q2E B;  4PDI A;  1MF8 A;  3KWR A;  5KO3 A;  3P71 C;  4DV5 E;  2O5R A;  1YYW A;  5EP2 A;  1T70 A;  3VYX A;  4JA9 A;  4IBD A;  4UT3 A;  3W0L B;  4NL4 H;  4V0X A;  2WZO A;  4X62 E;  3C4B A;  3K1J A;  4NRW A;  3E7A A;  5EJC A;  4JYA M;  3PVS A;  4F9C B;  7CAT A;  4CGY B;  3OML A;  3KSJ A;  4UT3 B;  2CHG A;  5AE1 A;  4OX9 E;  3AKZ A;  1OID A;  1IY2 A;  5KQD A;  5T6J A;  4LF5 E;  2H1R A;  2ZBK B;  3TQS A;  4LJA A;  3GRR A;  3LLH A;  1KBP A;  3GRV A;  4BS9 A;  2F5N A;  3T1H E;  4K0K M;  4CIS A;  4JN6 A;  5ITX E;  2KXE A;  1XM7 A;  3FUU A;  1HP1 A;  3MJ5 A;  2K4V A;  1XNQ M;  3KS8 A;  3GPX A;  1WHQ A;  1GKI A;  4LF6 E;  4JV5 E;  4O24 A;  2M7Q A;  4H2B A;  2F5P A;  4UT2 A;  1HQC A;  3SC3 A;  2R62 A;  1GQE A;  1II7 A;  1X37 A;  1N32 E;  1J26 A;  4F9A B;  1HNZ E;  2RSM A;  2O8A A;  3WHL A;  3J81 C;  2UU9 M;  2KRU A;  4GH9 A;  1K3X A;  4MGY E;  2V1U A;  1IM2 A;  3FYD A;  3K8Z A;  4TUI A;  1XMO E;  2VF1 A;  4H1S A;  4BBY A;  5B8I A;  4JI5 M;  2FE8 A;  3N5U A;  2Z06 A;  1O0W A;  1HNW M;  3ADI A;  3MHV C;  4JI7 M;  5KQ8 A;  1NNW A;  2I7P A;  4DT2 A;  1GL6 A;  2KW0 A;  2NUE A;  4JI0 M;  4CHT B;  3PSN A;  5IRE B;  1IN7 A;  2VQF M;  3DSD A;  1TDZ A;  3H62 B;  4HD0 A;  2D7H A;  2BDX A;  2UUC M;  2G5G X;  5HPE A;  5ITX A;  3OTO M;  5AAS A;  4F0Z A;  2Z3X A;  4LF8 M;  3ICF A;  5EP3 A;  4JI6 E;  2R18 A;  2ZBM A;  2ODR D;  4JI2 E;  5IWA E;  3E0J A;  4KO8 A;  1UIL A;  5BR8 M;  4FCV A;  3L25 A;  2Z7J A;  2J7O A;  3HPS A;  5EQV A;  3ILK A;  1R7R A;  3RGS A;  3SMS A;  4DKK A;  3U6Q A;  5IT9 C;  2L7H A;  1OJL A;  1TH4 A;  4X65 E;  2B7V A;  4P7D A;  2XFS A;  2D7E A;  4GKJ M;  1JR3 D;  3T38 A;  4L5N C;  3TWM A;  4LGM A;  3A46 A;  2R4J A;  1G4A E;  2D7G A;  3H69 A;  3QFN A;  4DMI A;  2E5L M;  3K2L A;  3BOS A;  4B3T M;  2EO2 A;  4OVZ A;  4DUZ M;  4HLQ A;  3U6M A;  4DR6 M;  3ZU0 A;  2QZ4 A;  2BNK A;  3Q8X A;  3J81 S;  4LF4 E;  5FTM A;  4V0W A;  4R7G A;  3UJN A;  5ITY A;  1NNJ A;  2WDD A;  4OVZ B;  1DO2 A;  1N34 M;  4GIP A;  1XNR M;  2LUP B;  2G7H A;  3DJW A;  4JI4 E;  1ZAE A;  2CV1 A;  4GC5 A;  2QBY A;  3FUW A;  3C5W C;  3SMP A;  2L6O A;  1LV7 A;  5FLX C;  5LMU E;  3UK6 A;  4DV0 E;  2V85 A;  4AQY E;  4PDG A;  1ZBQ A;  3T15 A;  3L2A A;  2DXL A;  2W82 A;  3F6H A;  3DA1 A;  3PSO A;  2QBY B;  3FD9 A;  2XLJ A;  4I4L A;  3L29 A;  5GKN A;  3SYL A;  2RTX A;  2VII A;  4LCB A;  1X49 A;  5IOH A;  1Q3C A;  1V73 A;  4FCT A;  4JI8 E;  4GHA A;  1TGU A;  4JYA E;  4LRS A;  3LQQ A;  3GVE A;  2CEA A;  1PJJ A;  2R46 A;  2JWO A;  2Z72 A;  3QFK A;  1MX0 A;  4DUY M;  3HKP A;  3H4M A;  2DFJ A;  2G8L A;  3JR4 A;  4WUR A;  5ITQ A;  1HO5 A;  5IT9 S;  2EA0 A;  2L33 A;  1UF3 A;  4GRI A;  3FTD A;  2QFR A;  2RS7 A;  2LMZ A;  4JI1 M;  4JXJ A;  3JR5 A;  3K6Q A;  5LL6 R;  3CF0 A;  4ORA A;  3T1Y M;  4K0K E;  2UUB E;  3UMM A;  2XF3 A;  3M0E A;  4GIT A;  3K92 A;  3LL8 A;  3CF6 E;  4KOD A;  2Y0T A;  1YYK A;  5IZ7 D;  1J5E E;  5AE3 A;  4G6Z A;  4LTY A;  2LWX A;  4MOY A;  4DR5 E;  4AW4 A;  3E9S A;  1G41 A;  3U60 A;  2NA2 A;  2CHQ A;  3AOG A;  3J80 C;  3DZD A;  4XPN A;  2FNA A;  4QHS A;  2V1C A;  5FSW A;  2DXI A;  3IWB A;  3J27 B;  1QAQ A;  2CPN A;  4ZX2 A;  3PNV A;  3U60 B;  4WW0 A;  4X8W A;  1ZBT A;  5FLX S;  4P16 A;  4O43 A;  3IWD A;  1HNW E;  2IE4 C;  3KP0 E;  5BPV A;  4JI7 E;  4MB7 A;  3FUX A;  4II7 A;  3U6C A;  4GKK E;  2UUA M;  4KZS A;  3SFZ A;  3EGH A;  4JI0 E;  3DW8 C;  1W5S A;  3SBJ A;  3DOA A;  4L78 A;  2VQF E;  2VE7 C;  1IQP A;  2C96 A;  2UUC E;  3KOZ E;  4ZPX A;  2R45 A;  3HJS A;  4UWQ A;  3OTO E;  4LF7 M;  4LF8 E;  1AUI A;  2BJW A;  2IHR 1;  2NYM C;  1W24 A;  2UXB M;  1FJM A;  4IJF A;  4NRV A;  5JI3 E;  4B3R M;  4J8Z A;  1IBK M;  2F4V E;  4IBC A;  5BR8 E;  1H6U A;  1HT1 E;  2FFJ A;  3GQ4 A;  1N75 A;  2R17 A;  4LJ9 A;  1STU A;  1E9R A;  4DV7 E;  3GPU A;  1XWI A;  3FIG A;  3KBP A;  2M4I A;  1HR0 M;  4RNA A;  4IBE A;  1T4N A;  3HQ1 A;  2L09 A;  2NXF A;  2DIX A;  3L27 A;  3VFD A;  4EIW A;  2E5L E;  1L2C A;  2JY9 A;  4DV1 M;  3SAT A;  5JPF A;  3KOW E;  4DUZ E;  4LJ6 A;  2DXN A;  4LFA M;  4DR6 E;  1QZM A;  3J80 S;  2HHH M;  3H63 A;  4JA7 A;  1G5B A;  1IXZ A;  3H61 A;  5H37 D;  4O4K A;  5AE2 A;  4IJE A;  1T3T A;  2L2N A;  4RF1 A;  1X47 A;  1N34 E;  3D8L A;  4I5S A;  2DSY A;  3EIH A;  3E4R A;  5CFF E;  4R3D A;  2XZF A;  3KOX E;  5FTN A;  1YYO A;  1EKZ A;  4FBW A;  2X49 A;  4X66 M;  1S3S A;  2FGG A;  2J7N A;  2MDR A;  3FTC A;  4BCA A;  2OPF A;  1RQ0 A;  1UHZ A;  3IVE A;  4FCW A;  2DZO B;  4MGI E;  4LJ5 A;  3R8F A;  3C9F A;  4NZV A;  1D2N A;  3VK8 A;  2XSZ A;  2V87 A;  3NBI A;  4FWG A;  3H68 A;  3HU3 A;  4QOZ C;  3U5Z A;  4KBP A;  5LMN M;  3FYC A;  2ZM6 M;  3KP1 E;  1QAM A;  2KZS A;  4QHT A;  3SAV A;  2NUG A;  4DUY E;  4XGI A;  3GRU A;  3I51 A;  3U5Z B;  2C98 A;  2WDE A;  2LH0 A;  2KHX A;  3GPP A;  2H36 X;  3FLO A;  4JI1 E;  3SAS A;  1S95 A;  2N3G A;  3C4T A;  3VKH A;  4WPY A;  2KKN A;  3GLH A;  1L2B A;  3U6L A;  3HXL A;  2KRK A;  4B7H A;  4R03 A;  3R9X B;  4QOS A;  1SXJ D;  3RL5 A;  1N36 M;  3KSX A;  3H60 A;  3FTE A;  4MGZ E;  3W0F A;  3EIE A;  2XEP A;  2DHR A;  3GLH B;  1XMQ E;  3J7B A;  3LML A;  4YHH M;  4B3M M;  4AKI A;  1IBL M;  1C1K A;  3U6D A;  2CHV A;  5ITR A;  2YEQ A;  3L28 A;  3HTX A;  4JI3 M;  1NJG A;  1EE8 A;  1UTE A;  4ORB A;  4G4N A;  1XXH A;  2MC6 A;  4FVM A;  4F9B B;  1JK7 A;  1IN5 A;  3HVQ A;  4B7G A;  4YY3 E;  4B3S E;  1XHB A;  3HJ8 A;  3IB8 A;  3LQR A;  3P1X A;  2UUA E;  2V86 A;  4PCZ A;  2O8G A;  3RQZ A;  1T71 A;  1FKA E;  3NWL A;  1XXH B;  3SYK A;  1E9S A;  3QAU A;  1S3L A;  3ZH9 B;  5GTU A;  1NJF A;  4IBB A;  3IG5 A;  4KLN A;  4NXN M;  2F5Q A;  2B9D A;  4LF7 E;  3VKG A;  2M1S A;  1J7K A;  2UXD M;  4LG2 A;  1S3M A;  4WYQ B;  2LTS A;  4QNM A;  1OI8 A;  1IBK E;  3JAM C;  3QG5 C;  3HGI A;  2XMO A;  1YE9 A;  3ZOQ B;  4X64 M;  1WAO 1;  1HQY E;  2QCU A;  2Y21 A;  5DYI A;  2EZ6 A;  3SAW A;  2C5R A;  4A3V B;  3VYY A;  4M9X A;  4V0V A;  2YFQ A;  4OU7 A;  4L8R C;  1HR0 E;  4B7F A;  4H2F A;  3B9P A;  3KVW A;  1XZW A;  4I5N C;  3ZC7 B;  2WDC A;  3DF6 A;  1ORY B;  1MU5 A;  4NSO B;  4LZJ A;  2JOG A;  2LXE A;  4DV1 E;  2YVT A;  4IBJ A;  2BQ8 X;  4BBA A;  1USH A;  1Z2W A;  1I4W A;  3T1H M;  2L3C A;  4OR9 A;  2ZO9 B;  4DR7 M;  2Z1A A;  5EXT A;  1NVM A;  4LRT A;  4I81 A;  3ZCB B;  4LF6 M;  4DR3 M;  4JV5 M;  3FGA C;  4IBF A;  1S3N A;  1TCO A;  2JR1 A;  1QU6 A;  1W5T A;  3FTF A;  3DSC A;  2C9O A;  2KA6 B;  3TWL A;  2CV2 A;  1HNZ M;  4BC9 A;  2IAE C;  4YKE A;  4QNR A;  2M60 A;  2F8B A;  1L2D A;  1Z6T A;  4TUW A;  5ITU A;  1TDH A;  1XMO M;  1GVN A;  1XNQ E;  5DYG A;  3THO B;  1JQJ C;  3QWL A;  5ADZ A;  4MGK E;  3TL4 X;  5LMN E;  1OFH A;  4D82 A;  3ADG A;  4MGH A;  3MK6 A;  3H64 A;  3SHF A;  2ZM6 E;  1QHW A;  3GLG A;  1S70 A;  3JAM S;  2YZT A;  3UGJ A;  4MM3 B;  3J7Y p;  5C18 A;  4REZ A;  2UU9 E;  3ADJ A;  3RL3 A;  2RKO A;  4Z6Y A;  1DQ3 A;  3JTZ A;  3GLG B;  4M2Z A;  4JI5 E;  3TWK A;  1R6B X;  2P5T A;  5EQT A;  4M9S A;  3L26 A;  2BCD A;  4LFB M;  1NHW C;  2QP9 X;  2CV9 A;  4PD2 A;  3LMM A;  1IT6 A;  4L4U A;  3HWS A;  4D80 A;  1N36 E;  4FD2 A;  3TGH A;  1GLN A;  5EXX A;  3ADL A;  2UXC M;  3K7V C;  3TE6 A;  3THG A;  2DVW B;  1DGH B;  4YHH E;  4LF9 M;  4B3M E;  1HNX M;  1IBL E;  1I94 M;  3UZU A;  2RS6 A;  5EXP A;  1QVR A;  5JJT A;  2M5Z A;  4JI3 E;  4BLC A;  2EWL A;  3PFI A;  3VDP A;  3RMP A;  2HY1 A;  1L1Z A;  2L2M A;  2OQ4 A;  5DNY A;  2E1M A;  3KS4 A;  4FCX A;  2CE7 A;  1IN6 A;  4GKJ E;  1SU1 A;  1G8P A;  3FUT A;  2Q8U A;  4PT5 A;  2QPA A;  1GZ6 A;  2QEN A;  2CV0 A;  3HHX A;  4B3T E;  3FUV A;  2DWL A;  3GP1 A;  4NXN E;  3D8B A;  3EGG A;  3AV0 A;  4DHL A;  2UXD E;  4L15 A;  5E26 A;  1IN4 A;  2YR0 A;  8CAT A;  2NQ8 C;  1WHN A;  1IXR C;  2JVA A;  1VDD A;  1WXR A;  4X64 E;  2LJH A;  4LGY A;  1HPU A;  4JI8 M;  1XNR E;  1Q39 A;  1ZQ9 A;  1KSF X;  3M6A A;  2LNH C;  2V89 A;  1PM5 A;  3TPZ A;  3U6S A;  1G59 A;  3ZTV A;  4NSR A;  2EUC A;  2LE2 A;  3VK7 A;  4M0W A;  2AHM A;  1K82 A;  3E7B A;  4H1Y P;  3PXG A;  4KHP M;  3SAU A;  3M7G A;  2NUF A;  3KOY E;  3V4Y A;  2ERC A;  1K3W A;  3J7A S;  3HU2 A;  1PJI A;  2L6M A;  3AOE A;  2Z4S A;  4DR1 M;  1DGG A;  3GQ3 A;  2DWM A;  5F3W A;  1X48 A;  4L16 A;  1OIE A;  2UUB M;  4AG5 A;  1DGF A;  5A2Q C;  4OOG C;  1SR9 A;  4DR7 E;  4G9J A;  1KFV A;  4LFC M;  4Q28 A;  3IWC A;  4IYP C;  4DR3 E;  4J6O A;  3AOE C;  5EXS A;  1J5E M;  2HKJ A;  1NSF A;  2YT4 A;  4DV2 M;  5J28 A;  3QFO A;  5JI2 E;  1YUB A;  2JOX A;  4DR5 M;  1WXQ A;  3I4Y A;  3J7A G;  4IBI A;  4DV4 M;  5FTJ A;  1N78 A;  4XBO A;  1N33 M;  5JPE A;  4FWD A;  2X8A A;  3GPY A;  3T1Y E;  2RGO A;  4AG6 A;  1N77 A;  3RGP A;  4DR2 M;  2KON A;  2V8Q B;  3U6E A;  2VQE M;  2XFT A;  4LJ7 A;  3CF2 A;  2HL7 A;  4FBK A;  1SXJ E;  1RC7 A;  3HHZ A;  1Z5A A;  1XC8 A;  4GKK M;  5KPZ A;  2Y20 A;  5C1V A;  4LAC C;  1J09 A;  3U6O A;  2L8T A;  3GQ5 A;  3RE8 A;  1T4L B;  1FNN A;  4AI6 A;  1DGB A;  2JA2 A;  1NY5 A;  4IL1 A;  1QFC A;  1FJG M;  3H66 A;  1G3I A;  4AKG A;  4G4Q A;  1E94 E;  5FTL A;  4NXM M;  3H09 A;  4O5G A;  2IE3 C;  3QFM A;  4R8O A;  4LZZ A;  2KOU A;  2AHD A;  3MSW A;  3HHW A;  2R65 A;  4LY6 A;  4S12 A;  2F4V M;  4DV6 M;  2HYO A;  2RGH A;  4G4O A;  3PNY A;  4TUG A;  4LFB E;  3VLF B;  3JYF A;  4DR4 M;  1DI2 A;  3VK6 A;  4NOO B;  3T1I A;  2ZOA A;  2BJV A;  4MOV A;  4LU9 A;  4DV7 M;  1R2Y A;  3HPZ A;  4DSY A;  2ZAO A;  3A42 A;  3AJI B;  3SAR A;  2L7I A;  2UXC E;  4DV3 M;  5A2Q S;  1S8E A;  1IBM M;  1QYR A;  3AFH A;  4LF9 E;  1HNX E;  4I8O A;  1I94 E;  4DV5 M;  4LJ4 A;  2C99 A;  4P78 A;  1SXJ A;  3WHK A;  2UXB E;  2F5S A;  3AUZ A;  4ITQ A;  2X4A A;  1IXS B;  4B3R E;  2DWN A;  3HJQ A;  4AZF A;  2A5Y B;  4HL4 A;  3GRY A;  4GC9 A;  2A22 A;  4X62 M;  4I5L C;  5ITT A;  1L1T A;  1KYI A;  2LBS B;  2DB2 A;  2FV4 B;  1SXJ B;  1SXJ C;  2HYP A;  2KZU A;  4LJ8 A;  4B08 A;  4IIW A;  2LTR A;  1GL7 A;  2DWZ B;  3IG8 A;  1YSY A;  2XZU A;  4OX9 M;  5INB A;  4AKH A;  4LF5 M;  5KPT A;  2XH9 A;  4BMJ A;  3AL0 C;  2L3J A;  2C9C A;  2CUZ A;  4H2I A;  4FWH A;  3KXE C;  2ODR C;  2MC5 A;  1R2Z A;  4LFA E;  2LUQ A;  1HT2 E;  2HHH E;  3GLF A;  2ZAM A;  3FKE A;  2V88 A;  1JR3 A;  4H2G A;  4M0V A;  2FTX B;  1Z2X A;  2HCB A;  2LRS A;  5EP1 A;  3LVV A;  2YQZ A;  5KPR A;  2DZN B;  4M0D A;  3GLF B;  4OW0 A;  4BB9 A;  3JU0 A;  3GLI A;  4F54 A;  3SHG B;  1N32 M;  1L8Q A;  3C58 A;  2K47 A;  5EP4 A;  1QAN A;  4ORC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...