3AV0A

Crystal structure of mre11-rad50 bound to atp s
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
369
structure length
369
Chain Sequence
GSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDNVDIESLNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
molecule keywords DNA double-strand break repair protein mre11
total genus 101
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3av0A03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3av0A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3av0A01
3IVEA 2A22A 4G9JA 3QFOA 1OIDA 3H62B 1U32A 1V73A 4UT3B 1T71A 3T1IA 2BDXA 2KKNA 2QFRA 1FJMA 4H1YP 3AV0A 2O8GA 4Q7FA 4H2IA 4B2OA 3AUZA 3RL3A 2WDDA 5HPEA 3C9FA 4FBQA 4H1SA 5JPEA 2BCDA 3QG5C 1HPUA 4MOVA 3H60A 4H2BA 4O24A 4UT2A 1HP1A 2Z1AA 4FCXA 1G5BA 1MF8A 1S8EA 2GJUA 4ZVZA 4HD0A 1OIEA 3P71C 3H68A 4IL1A 3THNA 3H61A 1M63A 1W24A 1TCOA 3QFNA 3RL5A 3DSCA 1IT6A 4UT3A 1S3NA 4V0WA 4MOYA 1S95A 4LACC 5JJTA 4FBWA 3DSDA 3RQZA 2IAEC 3QFMA 5GTUA 4V0XA 1XZWA 2AHDA 3QFKA 2WDEA 4OR9A 3E7BA 3FGAC 1UF3A 1QHWA 2XMOA 2Z72A 4I5LC 3E7AA 4O4KA 5JPFA 2IE3C 2QFPA 4LTYA 2Q8UA 3EGGA 1OI8A 3IVDA 4DT2A 3IB8A 4J6OA 4TUGA 2YVTA 2BQ8X 1S70A 1II7A 3GVEA 4ORCA 5INBA 3C5WC 1XM7A 3LL8A 4O5GA 2NYMC 4O43A 1UTEA 1T70A 2ZBMA 2WDCA 2JOGA 1QFCA 4XPNA 4KKZA 4LU9A 4I5NC 4ZX2A 3JYFA 2USHA 2QJCA 5F3WA 2NPPC 4F0ZA 1S3LA 3EGHA 1Z2WA 2CV9A 5C1VA 3PSOA 2R17A 3THOB 4WWLA 5DNYA 4H2FA 4NZVA 2IE4C 5B8IA 1Z2XA 4M0VA 4KBPA 2HYOA 1HO5A 4FBKA 4YKEA 3ZTVA 3H66A 3K7WC 4JA9A 4ORAA 3ZU0A 1USHA 1JK7A 3RL4A 1S3MA 2HY1A 2HYPA 3H69A 4TUIA 2P6BA 5EQVA 3KBPA 1WARA 4JA7A 5IOHA 2WDFA 3ICFA 3K7VC 3V4YA 3CK2A 2NYLC 4V0VA 4MP0A 4DHLA 4UWQA 4DSYA 1AUIA 2Z06A 4H2GA 1SU1A 2DFJA 3N5UA 1KBPA 3HVQA 4IYPC 3H64A 3DW8C 1NNWA 3PSNA 3TGHA 3IB7A 2O8AA 3H63A 1WAO1 3H67A 2NXFA 4ORBA 5J28A
chains in the Genus database with same CATH superfamily
4DR6E 1UM8A 1V33A 2YTGA 4R2RA 1S3SA 2DENA 4DR4M 2L09A 2BJWA 5EQTA 2D7GA 1AAYA 3H60A 4WXDA 3VYXA 1QU6A 2EM4A 3GQ5A 3H61A 4YHHM 2EP3A 2B9DA 4AQYM 1G8PA 3GPPA 2I7NA 4X8WA 2NABA 2CV2A 1KYQA 3I01M 1XZWA 3GLFB 4CGYB 3NBXX 3J2PB 2I9IA 3FUVA 4JI4M 1YSYA 1ZR9A 4ZYEA 1UFZA 1UILA 3RMPA 2Z4RA 1L2BA 2JP9A 3LLHA 2V1CA 1T4NA 3HXLA 5FTNA 5ITTA 3J7AG 3ZQJA 5EP3A 4IBEA 1EH8A 4DV2M 5IWAE 2AHMA 4PDGA 3U5ZB 2CV0A 1Q3CA 2OOBA 3D03A 4FCTA 3PSOA 4DV5M 3THOB 3Q8XA 5A6KA 1I4WA 4YKEA 3ZTVA 2KHXA 1WHQA 2N35A 2FNAA 2F5QA 2A25A 2UUAM 1HT1E 4JI6E 2RS7A 3ICFA 4MP0A 2YTPA 4N4RB 3FUWA 4OX9M 1E32A 4LG2A 4JI4E 3H63A 1AH5A 3SMSA 2EWLA 5AASA 1PM5A 3IVEA 3UK6A 2MJ5B 5A6BD 1T71A 4DV3E 3C3DA 3OTOM 3AUZA 2WDDA 1YE9A 2MDRA 4H1SA 3SAUA 1OFIA 4O24A 1A1LA 4LF6E 4YY3M 3E46A 2WCC3 2DGCA 3J7Yp 3MMPA 4V0WA 3HJQA 5IT9C 3GPYA 3M0EA 1IBLE 2EA0A 1GJTA 2I13A 4B3MM 2R18A 1G2FC 4JI2E 1WR1B 1OIPA 2LNHC 2XZUA 3GLHA 4L8RC 1JB0F 1IY0A 3K1JA 2ZTCA 5KL3A 3KDSE 3ZOQB 1QAMA 1G41A 3VFDA 3GVEA 3U60B 2L4EA 3SHFA 2FS1A 2ZBMA 2KZUA 1FKAE 1NNUC 2BB8A 1SXJE 3W68A 2EPAA 4X9JA 3AJIB 2K47A 2UXDE 4NOOB 4LJ9A 1TH2A 2EN3A 5B8IA 5AE1A 1HO5A 3K7WC 4DR5M 4JI7M 3GRVA 2B7VA 1S3MA 2V6ZM 2XSZD 1Q3BA 2D9HA 3F92A 2M5ZA 3KW6A 4V0VA 2NYLC 2M7QA 1JR3A 2LJUA 1HJPA 1R6BX 1C7YA 3HVQA 2EOEA 1EIJA 4D80A 2L6MA 1R4GA 5IT9S 2RPCA 2DHYA 5AC5A 3HJ8A 4G9JA 3QFOA 2LVPC 2BNKA 4LFAM 2WSEF 2GQFA 4DV4M 2QHOB 3RL3A 1HNZM 3A45A 4IBCA 1XXHE 5C18A 4KHPE 4FD2A 3TQSA 3GQ4A 2CUZA 3FUXA 3U6MA 4G3OA 1SR9A 1XXHA 1DQ3A 2ADRA 4GIPA 4YY3E 1S3NA 1ZMUA 2CHQA 3VLFB 2VQFE 4LACC 2I7PA 1K3WA 4BHCA 4DKKA 1YLAA 3FGAC 3SHGB 4DUYE 4O4KA 3KZZA 4AKIA 4NSOB 2Z4SA 5KL4A 5ITXE 1JK1A 3SYLA 5FLXC 1II7A 2LTSA 4NXMM 4DR5E 3MHSC 1KYIA 4BLCA 2DXIA 1GO5A 2NUFA 2EOIA 1GLNA 4NXNM 1T70A 2APLA 1QVRA 2WDCA 3PNYA 1P3QQ 4ZYHA 1R7RA 2LV2A 3W0FA 4R2PA 3HHWA 1XNRM 3QYBA 2L8TA 4Q28A 1GZ6A 1YFHA 2L2MA 1Q02A 2IE4C 5E26A 1W5TA 1ZMWA 2L2KB 3H66A 1YYKA 1HNXM 3RL4A 3VDUA 2HYPA 3H69A 2P6BA 2XFTA 1QDTA 1Z5AA 2DKLA 2Y0TA 4DSYA 4H2GA 2XEPA 4B3RM 1DGBA 1STUA 4DV3M 4L8NA 4X66E 1R5LA 4ORBA 4JXJA 1PJIA 2KA6B 2DZOB 2BJVA 3IWCA 3TWLA 2DXNA 1IQOA 1XXHB 2EN4A 4P16A 3LVVA 1G4AE 3LCUA 3SBJA 1HT2E 2QP9X 3W0LB 3GRYA 2Z1AA 4KLNA 2EM8A 1NJGA 4JI6M 1MF8A 3FIGA 1TF6A 4HD0A 4ZVZA 3QFNA 1YYOA 1IBKE 4F2LA 1T43A 3ECRA 3HU2A 2IAEC 1KFVA 1X37A 5ADZA 2RRUA 2L33A 3CTWB 1BBOA 3JTZA 3HHYA 2OQ4A 2V1UA 2R45A 2DSYA 2ZM6E 4GKJE 3E7AA 1PJQA 4HEIA 3TE6A 4LJ8A 4GMQA 4DR7E 3SARA 1S70A 2Y20A 3JR4A 4WSPA 3KP0E 3AOEA 4PT5A 2H5XA 4GKKE 1ZAAC 4FVMA 5LMNM 2FGGA 2QBYB 4MLQA 1S3LA 1NNJA 2UU9E 2KOUA 4WP2A 1ZV1A 5FTMA 4JI1M 5EJCA 2DLKA 4LZJA 3K6QA 3TPZA 4DR2E 3KS4A 1SXJD 3ADLA 4R3DA 4IJEA 2YZTA 3ADJA 2DRPA 3VDPA 1GJSA 2VE7C 4BBYA 1QQWA 3GPXA 4GRIA 2JOBA 3IWBA 2HKJA 2ZANA 4IBGA 2YRMA 2EPZA 1TGUA 2E72A 3J80S 3E21A 2EMCA 3CF0A 1QUSA 4K0KM 5LL6R 2JA2A 5KL6A 3FRIA 2QFRA 3RE8A 2JNHA 3AFHA 2EMHA 2BWBA 4WPYA 2O8GA 2L7IA 2YFQA 3MHHC 3J7BA 3SFZA 4XGIA 2ELZA 2EM6A 3QG5C 1VDDA 4PCZA 5EP4A 1G5BA 4R2AA 1XHBA 1XMOE 4MGHA 4FW9A 4R71A 1IT6A 4AG5A 4QOZC 3VKHA 1IBLM 1J7KA 3KOXE 3FTEA 4FBWA 1L8QA 2CP8A 4DBGB 4JYAE 2R4EA 4V0XA 4G4OA 3D8LA 4D81A 4M30A 3HX3A 4JI8E 4I81A 2EKFA 1K3XA 1RU3A 2GNOA 1D0KA 2K7IA 1TDZA 3HHZA 1YUIA 3IB8A 1MX0A 5ITXA 1TH4A 2JY8A 3OTOE 1ZAEA 2QPAA 3MHVC 2NYMC 2C99A 4IBFA 2EPPA 2L2DA 2CPNA 2EM0A 5A6JA 4I5NC 2DWLA 2R65A 3K2LA 3GLHB 3C6MA 1HQYE 5GKNA 2ENCA 4JI7E 4AZFA 1EH7A 4NRWA 2G7HA 3V76A 4LF8M 4M9VC 1GKIA 3PFIA 5FTJA 5FSWA 1EH6A 4ORAA 4JI3E 4NC6A 4NL4H 3KBPA 5A6BA 4JA7A 3JU0A 2L7HA 1I94M 5L8RF 5AE3A 3MJ5A 3HZJA 3C58A 2R76A 2VF1A 2YTJA 2CFOA 4REZA 4DV5E 2KHHA 1A1IA 2ZAMA 2LTRA 2QCUA 1UBDC 3IB7A 3JAMC 4QNRA 2X8AA 2NXFA 3L28A 5LMUE 2WZJA 5BPVA 2EMIA 4Y28F 4R8OA 1PGYA 2VIIA 1FJMA 4H1YP 4KT0F 4H2IA 3HJSA 4DR1M 3GO8A 2NUEA 5JPEA 2CHVA 1OFHA 3HHXA 1ZBQA 4JI0E 1N36E 4HEOA 2G8LA 4CHTB 4GKJM 2EOZA 3TQMA 4IL1A 3DSCA 1W24A 4DV7E 4FWGA 1KJKA 3A46A 2R1FA 4AQYE 3B7NA 1IFYA 2QFPA 2JY5A 1NEIA 2L3CA 4R2QA 1G2DC 4Q7JA 2V8QB 3EGGA 1CUKA 1OI8A 3A98B 3ZCBB 2P5TA 4PD2A 2C96A 5INBA 4DR4E 2JUJA 2EM5A 2PRTA 3FYDA 1MU5A 1NY6A 1IMUA 4KKZA 4QHTA 3TWMA 4DR6M 2CRUA 5F3WA 3GLHE 1QZMA 2VDBB 2ZAOA 2YTOA 3B7QA 2JZ0A 3GLFA 3HKPA 1J5EM 2EMFA 1Z2WA 2MH8A 5BR8E 2W82A 2YPNA 2FOIC 1J09A 2LRSA 1VEGA 2MDGA 2YRKA 2YTIA 2J7JA 1A1GA 1YYWA 2WBTA 1HNXE 3KOZE 5DFLA 1AUIA 2Z06A 3HU3A 4DV2E 1XMQM 4OW0A 4JI0M 4BB9A 4FK5C 4L15A 2H1RA 2VQEE 2YTFA 5EXSA 1HNZE 2CT1A 1N33M 2YTEA 4QNMA 4X64M 3FTDA 1JR3D 1DGHA 2NUGA 2XF3A 2JWOA 4WYQB 4FCWA 4CISA 1WHNA 4GHAA 2JZ1A 4DV1E 2LMZA 2EN6A 4DUYM 4R2EA 4YHHE 4L16A 2EORA 4KZSA 4UT3A 4RHBB 5T6JA 1S95A 4LGYA 3MK6A 1WJPA 2MC5A 2UXCE 5GTUA 1Z59A 1HR0E 2AHDA 2DAKA 3U6PA 1UF3A 4WX9A 4LF9M 4ANRA 4B7HA 1QNTA 4JI1E 4J6OA 1W5SA 3FLOA 3M99B 4O5GA 2LUQA 3UZUA 2LE2A 4JI5M 2KRUA 2EMGA 3T1HE 4MM3B 5C1BA 1ZU1A 3H09A 4I8OA 1WXRA 2XZFA 3EIHA 2Y0QA 2V88A 1DGHB 4B3TE 4F54A 1F4IA 5EQVA 5KPRA 4XK8F 3AL0C 2ZM6M 2WDFA 3SMPA 4UWQA 2EPNA 2GHFA 3J81S 3SC3A 1MN3A 2OPFA 1T6OA 4BCAA 2JVAA 1WAO1 2NA2A 3J27B 1G3IA 4GH9A 2EPMX 4B7FA 2EPXA 2LTUA 1OJLA 2RS6A 1V73A 3T1IA 1AUAA 2DVWB 4ZYGA 4LJ5A 1LV7A 3FUTA 1P47A 2EN2A 4LZZA 2C98A 4CJ6A 1N77A 3GPUA 4OVZB 2F5SA 1GL6A 2YTQA 4M0DA 3CGWA 2MKNA 1QZEA 2DWNA 4B3ME 2LXEA 1N33E 2EPOA 4L78A 3KFUG 4L5NC 2MR9A 2EOOA 3QFMA 5KL2A 1Z5BA 2KNZA 3I4YA 1PJJA 1N34E 2UXBE 2LVAA 2BBGA 3DJWA 1D0MA 3E7BA 4BMJA 4UN2B 2C9OA 5IWAM 4FCVA 2EPUA 2YEQA 4BC9A 5EXTA 2DIXA 3KWRA 1TDHA 3B9PA 3FUUA 1Z5CA 2K0BX 3M7GA 3IECA 1X48A 3SYKA 4LFCE 3FTFA 3B74A 4AKHA 2LBCA 2LJHA 3DA1A 4M0WA 4NXNE 2F5PA 3U6EA 5LMUM 4F6MA 4LF4E 4NZVA 2JXNA 4OX9E 2G5GX 4JV5M 2CE7A 1JK7A 1SG9A 5DYIA 4IBBA 4JI3M 3FKEA 1T4OA 2WBSA 3P1XA 3T6PA 3AOEC 4A3VB 2H36X 4LFBE 3K9OA 1DGFA 4Z6YA 1VQ1A 2DMYA 2IHR1 4LCBA 2DAMA 2KXEA 4LJAA 2JP7A 2DNAA 2RTXA 3AOGA 2LWXA 4B3RE 2EM2A 2EM9A 3E0JA 4WSGA 2N8XA 4GC5A 3THNA 5IV8B 3RL5A 3C4BA 1R2ZA 1PJSA 3U6SA 2N3HA 2V83A 4B7GA 4XBOA 2UXBM 4W5WA 3GLIB 3B89A 1YSAC 1NO1A 1QANA 4G4NA 3EPHA 2QBYA 3BF2A 4D82A 2WZOA 2YWQA 1E9RA 2LVOC 1VG5A 2OOAA 4DT2A 1NV9A 2HC5A 2EOJA 1V34A 4LF8E 1T3TA 3TL4X 3BOSA 4DUZE 3C5WC 3U5ZA 3LCVB 3T38A 3JYFA 5A2QC 2QJCA 2VF8A 3C9PA 4GITA 4J8ZA 2EN7A 3GLIE 2DWZB 4F1IA 1ORYB 1WXQA 3CF6E 1PDAA 1Z2XA 3IHPA 1R2YA 4FBKA 2EOFA 1AIPC 2KZSA 4OVZA 2MKDA 4L4UA 1WARA 2L6OA 1K82A 4JI2M 4DHLA 3IG8A 1UHZA 3DOAA 1IY1A 5IZ7D 4II7A 1IY2A 2ZO9B 1L4SA 2HWJA 2EL5A 1BBGA 1IBMM 5FTKA 4B2OA 2DZNB 2XSZA 5EXXA 4IBJA 4FBQA 4NHRA 3H4MA 1YPNA 2EOQA 4MOVA 1ZQ9A 4IBDA 4UT2A 4R2CA 3NBIA 4X62E 4KO8A 1E94E 3I04M 3K9PA 1EKZA 2FTXB 4IIWA 2YTDA 2EQ1A 1MEYC 1JR3E 1GABA 5ITUA 2Z72A 4DV0E 1WJ7A 1C1KA 3KVWA 5ITRA 1TH3A 4MB7A 4B3SE 3T1YE 2YVTA 3SAWA 2EE8A 3D8BA 2KONA 3LQQA 3KSXA 1X5WA 5CFFE 1OKSA 1IM2A 2MGWA 4XPNA 3PXGA 2L4FA 2JR1A 3EGHA 2YU5A 3J80C 2DB2A 3VK8A 4WWLA 4LGMA 2YRHA 5IXMB 4KBPA 1USHA 3DF6A 1IXRC 4GZNC 4Z8XA 3BGHA 4LF7E 2F4VM 3HTXA 2YT4A 2CTDA 4LJ7A 1HQCA 4BC7A 2UUCM 3RFWA 5KPTA 2BWEA 3AKZA 3TGHA 1IN6A 2EPCA 1IBKM 2RGHA 5AC4A 2A22A 4G4QA 2LH0A 3H62B 1U32A 2G3QA 3M6AA 3EPLA 4IBIA 3FTCA 3AV0A 3BBGA 4LY6A 1UN6B 2EOXA 1QAOA 4BHBA 3C9FA 1Y8GA 4H2BA 1L2CA 1MGTA 2E1MA 1HP1A 2F4VE 4CIZA 4FCXA 4LF7M 1VEKA 5JI3E 3P71C 2HGHA 1TCOA 2LHCA 2XH9A 3J7AS 2JY6B 5EP1A 5IREB 2C5RA 1TTEA 1QAQA 5EP2A 3QFKA 2WDEA 4R7GA 5KQDA 2UUCE 5JI2E 4LRSA 1XWIA 1HNWE 2X4AA 2B3TA 3ADGA 3EQ1A 2MC6A 3FE3A 3EIEA 1IXZA 2X49A 3U60A 1IQPA 2DLQA 4AI6A 2K4VA 2CHGA 1XMOM 2EKKA 1D2NA 4MH0E 2EJ4A 1OQYA 5DYGA 4NXME 2EOSA 5DNYA 3FD9A 2R6FA 3W67A 5E6JA 2YQZA 3HU1A 5H37D 3CK2A 1DO2A 3DZDA 2EMXA 4M9ZA 2R4JA 3GP1A 4DUZM 2O8AA 1VEJA 4OU7A 4NSRA 4X64E 3C6KA 1H6UA 4KWYA 2V86A 3K92A 2Q2EB 2C9CA 1IQSA 2EL4A 1DV0A 1SXJC 1DGCA 1YUJA 1SXJA 3QAUA 2N3GA 3U6OA 1RMDA 1XMQE 4AW4A 3J81C 2ZBKB 1BVSA 2O25A 4GC9A 4DV4E 4LJ4A 3KOYE 3B7ZA 3HQ1A 1XB2B 4WW0A 1ZMVA 5LMNE 4F9AB 2ODRC 4JI5E 4GHLA 3GLIA 2E5LE 4P7DA 2HHHE 3R8FA 2VQEM 4JYAM 3I51A 3UJNA 3IWDA 1T4LB 2EQ3A 4NRVA 1B69A 4LF9E 4M2ZA 4DMIA 2QSFX 3KS8A 2EOHA 1OTRA 3BXWA 2JPAA 3PVSA 3PNVA 1QDRA 1JQJC 2RQLA 4LF6M 2EMBA 1IN8A 2UXCM 3GLGA 1QYRA 2O01F 1OIZA 3HY5A 4F9BB 2EO2A 1GVNA 3KXEC 3LQRA 3VK6A 2NPPC 2Z8YM 4K0KE 1RQ0A 1LTMA 2F8BA 2D7HA 3L25A 3H4JA 1X6HA 2EL6A 1A1FA 1TR8A 4JA9A 4IJFA 2HY1A 2RGOA 3K7VC 2M1SA 2RSMA 1TF3A 5LLQA 1FNNA 3VYYA 3ILKA 2M9AA 1FJGM 1L1TA 1T38A 3LMLA 2JXPA 1HNWM 3Q8GA 2DZLA 4DV7M 2LVNC 2YSPA 2BDXA 3L26A 2DAGA 3LVWA 1NY5A 2L92A 2DHRA 4I4LA 4GKKM 4PDIA 2UUBE 2JYAA 4M9SA 4QHSA 4HTGA 2LVQD 2ZTDA 1HPUA 2WSFF 2YU8A 2LO3A 2R62A 4DR7M 1S8EA 1GTKA 1OIEA 1TF0B 1M63A 3HWSA 1EFUB 2F5OA 4MOYA 3LMMA 1N3GA 4LJ6A 4I5SA 2KDLA 2FFJA 4LFBM 3RQZA 3C3EA 3I4VA 1NHGC 3KOWE 4F9CB 1OAOC 4LFCM 2M4IA 1WRJA 2XMOA 1QHWA 4I5LC 4LTYA 2UUAE 4X62M 2ZOAA 3JR5A 2DMIA 5TSEA 2Y21A 2EMLA 1DO0A 1WGNA 2EMKA 4X65E 2RKOA 4IS1C 3HPSA 4O43A 2A5YB 2OO9A 1A1KA 2QZ4A 2FV4B 3E9SA 2KW0A 2EZ6A 4RH8A 4F6NA 3UGJA 4GEWA 4H2FA 2EOYA 4JN6A 4DR1E 2HYOA 2XGNA 3ZU0A 4LFAE 1RC7A 4WXCA 2J7OA 2D7EA 5KQ8A 4MLVA 3SASA 4MGKE 3N5UA 2DFJA 2V85A 4DV6E 3DW8C 2EPRA 2QENA 3GLGE 2JWSA 3L27A 2K9DA 1WIVA 2R44A 3WHKA 2K6BA 2KEBA 3UMMA 2HCBA 2YNMD 4IBKA 3MSWA 3U6CA 2EMAA 1X49A 4P78A 2DAIA 4Q35B 3A42A 2ENAA 5ITYA 1HR0M 5HPEA 4QOSA 2LCEA 2UXDM 2XFSA 2B7TA 1NVMA 1X6FA 3U61B 1XC8A 3VK7A 4AKGA 3KZYA 3C4TA 3KP1E 4DR2M 2ELYA 3L00A 5FTLA 2O5RA 4RKUF 2LVHA 2HHHM 2UU9M 2EQ0A 1SXJB 2DAEA 1JK2A 4R2DA 2ODRD 2EN8A 1G71A 4IJDA 2IE3C 2HL7A 3IVDA 2DI0A 1O0WA 4RF1A 4B3TM 1IXSA 1IN4A 4KODA 4AG6A 2JY9A 4KHPM 3LL8A 1E9SA 1L1ZA 2GLIA 3KSJA 4P17A 3L2AA 4LU9A 1KSFX 3F6GA 5A69A 2USHA 2QQ8A 1X3CA 2EM3A 2ERCA 3T1HM 2R17A 4WFTA 1Z1BA 4F2JC 1NCSA 3SATA 4MGIE 1T39A 2CV1A 3F6HA 2KRKA 2KNAA 2RSIA 1DGGA 3V4YA 2LUPB 3ZH9B 4LF4M 3LW5F 3DFZA 3THGA 1TN9A 2B3TB 3UK3C 1PJTA 3TWKA 3RGSA 5J28A 2EPKX 1LLMC 1WGLA 4X66M 1XNQM 1J26A 4GEQB 3GLGB 4Q7FA 2VRDA 3HPZA 1Z6TA 5KPZA 2J7NA 2UUBM 1DI2A 4MGYE 7CATA 3BIDA 1OAIA 4DV1M 2BCDA 4RF0A 2HAKA 4DV6M 3EPJA 2HJJA 4M9XA 3U6DA 2VF7A 2Z3XA 1PKPA 4HLQA 2EMYA 2EM7A 1N34M 4R2SA 3EPKA 1FJGE 4LF5M 3JAMS 1XNRE 2YSOA 4RNAA 2KNVA 1F2IG 4FWDA 3E4RA 1ZBTA 5JPFA 1NJFA 2EMZA 4DR3M 2Q8UA 2Z7JA 3QWLA 3GRRA 1D0LA 4TUGA 4ORCA 4BBAA 1XM7A 4X65M 1IXSB 2EOMA 4MGZE 1UTEA 3T1YM 4FWHA 1X6EA 2JOGA 1IN5A 5A2QS 1J5EE 4G4RA 1MJGM 4DV0M 2WSCF 3GLFE 5KL7A 4JV5E 2EN1A 3GRUA 1A1HA 3FRHA 3QYEA 1L2DA 4M0VA 4ITQA 2EJSA 2F5NA 2R46A 4R03A 1YUBA 4DR3E 1GL7A 3K8ZA 2QNJA 2EMWA 1N36M 3T15A 1GQEA 4OOGC 1X47A 5KL5A 3U6LA 1G59A 3FYCA 2V87A 1V92A 2JY7A 5KO3A 4LF5E 3H64A 1NNWA 3PSNA 2E5LM 8CATA 5ITQA 3U61A 1QUTA 2LT7A 1IN7A 3H67A 2JOXA 3VHTB 2FE8A 3BBZA 2MROB 1OIDA 2VQFM 2DWMA 4ZPXA 4UT3B 2CSHA 2DXLA 2KKNA 1N75A 3IG5A 3U6QA 1PRBA 4L6V6 4B3SM 4TUWA 2L2NA 1NHWC 1I94E 1XNQE 2CEAA 2GJUA 3WHLA 3H68A 1NV8A 1N32E 2LBSB 1NSFA 3RGPA 5JJTA 3GQ3A 4S12A 3VKGA 3DSDA 4EIWA 2R0IA 4LRTA 2NQ8C 2YTNA 3HGIA 4OR9A 1BB8A 2ENHA 2GPIA 2LHGA 3CF2A 2BQ8X 5FLXS 2YR0A 3OMLA 2CWBA 5EXPA 1Q39A 3NWLA 1IBME 4HL4A 1N32M 1QFCA 5A6AA 4JI8M 4ZX2A 4G6ZA 1N78A 4F0ZA 2WBUA 1EE8A 1YZ9A 3ZC7B 1A1JA 2CV9A 5C1VA 4B08A 1VDLA 2EPLX 2FH0A 4TUIA 5IOHA 3R9XB 1SFEA 1SU1A 2J5YA 1KBPA 2M60A 2V89A 4IYPC 3ADIA 5BR8M 5AE2A 1WHCA 2L3JA 4ZYDA 4WURA 4BS9A 3L29A 2XLJA 3SAVA 2EUCA 1A5TA
chains in the Genus database with same CATH topology
4DR6E 1UM8A 1DGFA 3CF0A 4DV7M 4O5GA 4Z6YA 4K0KM 5LL6R 2JA2A 1S3SA 2DMYA 2IHR1 2BDXA 3L26A 2QFRA 3RE8A 4LCBA 3LVWA 3AFHA 4DR4M 4WPYA 1NY5A 2KXEA 4LJAA 2L92A 2O8GA 2DHRA 4I4LA 2L09A 2BJWA 4GKKM 5EQTA 2L7IA 2YFQA 4PDIA 2D7GA 2RTXA 3AOGA 2UUBE 3J7BA 3SFZA 4XGIA 2LWXA 4M9SA 4QHSA 3QG5C 1HPUA 4B3RE 3H60A 1VDDA 4PCZA 3E0JA 2R62A 3VYXA 1QU6A 5EP4A 4DR7M 3GQ5A 1G5BA 1S8EA 1OIEA 4GC5A 3THNA 1XHBA 1XMOE 3H61A 1M63A 4MGHA 3HWSA 4YHHM 3C4BA 3RL5A 4FW9A 1R2ZA 2F5OA 2B9DA 1IT6A 4AG5A 4AQYM 3U6SA 4QOZC 1G8PA 2N3HA 3GPPA 3VKHA 2V83A 3LMMA 2I7NA 1J7KA 4LJ6A 1IBLM 3KOXE 4B7GA 4I5SA 3FTEA 4FBWA 1L8QA 2FFJA 4X8WA 4LFBM 4XBOA 2CV2A 2UXBM 2R4EA 4JYAE 4V0XA 3I4VA 3RQZA 1XZWA 4W5WA 3GLIB 3GLFB 4G4OA 4CGYB 1NHGC 3KOWE 3D8LA 3J2PB 4D81A 4M30A 4F9CB 3FUVA 4LFCM 2M4IA 4JI8E 4JI4M 1YSYA 1QANA 4I81A 2XMOA 4G4NA 1QHWA 4I5LC 2QBYA 4LTYA 2UUAE 4X62M 4D82A 2ZOAA 3JR5A 1K3XA 2WZOA 1E9RA 1UILA 3RMPA 2Y21A 1DO0A 4DT2A 2Z4RA 1TDZA 1L2BA 3HHZA 3H66A 3LLHA 3IB8A 1MX0A 2V1CA 1TH4A 5ITXA 4LF8E 3OTOE 1ZAEA 1T3TA 3TL4X 1T4NA 3BOSA 3HXLA 5FTNA 5ITTA 2QPAA 2RKOA 4X65E 4DUZE 3J7AG 3C5WC 3MHVC 5EP3A 3U5ZA 2C99A 3HPSA 2NYMC 4IBEA 4O43A 4IBFA 4DV2M 3T38A 3DSDA 2A5YB 2QZ4A 2FV4B 2CPNA 4I5NC 3E9SA 2KW0A 3JYFA 2DWLA 5A2QC 2EZ6A 2R65A 3K2LA 4GITA 3GLHB 2QJCA 4J8ZA 5IWAE 2AHMA 4PDGA 1HQYE 5GKNA 3U5ZB 2CV0A 4JI7E 2DWZB 1Q3CA 4AZFA 3UGJA 4NRWA 1ORYB 2G7HA 4FCTA 4LF8M 3D03A 4DV5M 1WXQA 3PSOA 1GKIA 3PFIA 3THOB 3CF6E 5FTJA 3Q8XA 4JN6A 4DR1E 4H2FA 1Z2XA 5FSWA 1I4WA 2HYOA 1R2YA 4FBKA 4YKEA 3ZTVA 2KHXA 1WHQA 2XGNA 4ORAA 3ZU0A 4JI3E 2FNAA 2KZSA 2F5QA 2UUAM 1HT1E 4NL4H 1RC7A 4LFAE 4OVZA 4JI6E 4L4UA 3KBPA 1WARA 2RS7A 4JA7A 3JU0A 3ICFA 2L7HA 2L6OA 1I94M 1K82A 4JI2M 4DHLA 4MP0A 2J7OA 2D7EA 3IG8A 5KQ8A 5AE3A 3FUWA 3SASA 4OX9M 4MGKE 1UHZA 3MJ5A 3C58A 2DFJA 3N5UA 2VF1A 1E32A 2CFOA 4REZA 2V85A 3DOAA 4DV5E 4DV6E 4LG2A 5JPEA 1IY1A 4JI4E 3DW8C 2QENA 2ZAMA 2LTRA 2QCUA 3IB7A 3L27A 4QNRA 2X8AA 4II7A 5IZ7D 3JAMC 1IY2A 3H63A 2ZO9B 2NXFA 3WHKA 3SMSA 3L28A 2EWLA 1PM5A 5AASA 5LMUE 3IVEA 5BPVA 2KEBA 3UMMA 3UK6A 4R8OA 1IBMM 1T71A 2VIIA 2HCBA 1FJMA 2YNMD 4H1YP 4IBKA 5FTKA 3MSWA 4DV3E 3U6CA 4B2OA 2DZNB 1X49A 4H2IA 4P78A 3OTOM 3AUZA 3HJSA 4DR1M 2XSZA 3A42A 1YE9A 5EXXA 5ITYA 3GO8A 1HR0M 2MDRA 4QOSA 4IBJA 2NUEA 5HPEA 2UXDM 2XFSA 3SAUA 2CHVA 2B7TA 1NVMA 1OFIA 1OFHA 3H4MA 1ZQ9A 3HHXA 3U61B 2H36X 4MOVA 4IBDA 4LF6E 4O24A 1ZBQA 4JI0E 3NBIA 4UT2A 4X62E 1XC8A 1N36E 4KO8A 4YY3M 3VK7A 1E94E 2G8LA 4CHTB 4GKJM 4IL1A 4AKGA 3C4TA 3DSCA 3KP1E 1W24A 4DR2M 3J7Yp 4H1SA 5FTLA 1EKZA 2O5RA 1HNWM 4V0WA 2FTXB 4DV7E 4FWGA 2HHHM 2UU9M 3HJQA 3A46A 3GPYA 5IT9C 3M0EA 1IBLE 2EA0A 4IIWA 4AQYE 1SXJB 4B3MM 2R18A 4IYPC 4JI2E 5ITUA 2ODRD 2Z72A 4DV0E 2LNHC 2XZUA 2IE3C 3GLHA 4L8RC 2L3CA 2QFPA 1C1KA 1IY0A 3KVWA 5ITRA 2HL7A 2V8QB 3K1JA 1TH3A 3EGGA 4MB7A 1OI8A 3IVDA 1O0WA 3KDSE 3A98B 3ZCBB 3ZOQB 2P5TA 4B3SE 3T1YE 1QAMA 4PD2A 3SAWA 2YVTA 1G41A 2C96A 3VFDA 3GVEA 4RF1A 4B3TM 5INBA 3U60B 1IN4A 4KODA 3D8BA 4AG6A 2KONA 2JY9A 4KHPM 4DR4E 3LL8A 3LQQA 1E9SA 1L1ZA 3SHFA 3KSXA 2ZBMA 3FYDA 2KZUA 3KSJA 3J80S 1MU5A 5CFFE 1IM2A 1NY6A 1FKAE 4XPNA 3L2AA 3PXGA 4LU9A 1KSFX 3F6GA 1NNUC 4KKZA 4QHTA 3TWMA 4DR6M 5F3WA 2USHA 1SXJE 1QZMA 2ZAOA 3GLFA 2JR1A 3HKPA 1J5EM 3EGHA 1Z2WA 2ERCA 3AJIB 3T1HM 2K47A 5BR8E 2W82A 2UXDE 4NOOB 2R17A 3J80C 2DB2A 3VK8A 4WFTA 4WWLA 4LGMA 1TH2A 4LJ9A 5B8IA 2FOIC 1J09A 5AE1A 3SATA 4KBPA 1HO5A 2LRSA 4MGIE 3K7WC 4DR5M 4JI7M 3GRVA 1USHA 2B7VA 3DF6A 1S3MA 1IXRC 2CV1A 4Z8XA 2V6ZM 2XSZD 1Q3BA 4LF7E 2F4VM 3F6HA 3HTXA 1YYWA 2KRKA 2M5ZA 1HNXE 3KW6A 1DGGA 3KOZE 2NYLC 2YT4A 2M7QA 1JR3A 4V0VA 3V4YA 4LJ7A 1HQCA 1AUIA 2Z06A 3HU3A 4DV2E 2LUPB 1R6BX 1XMQM 3HVQA 4BC7A 3ZH9B 2UUCM 4LF4M 4OW0A 4JI0M 3RFWA 4D80A 4BB9A 5KPTA 3AKZA 2L6MA 3DFZA 4L15A 3THGA 2H1RA 3TGHA 2VQEE 2B3TB 1IN6A 5IT9S 5EXSA 1HNZE 3TWKA 3RGSA 1IBKM 1N33M 2RGHA 3HJ8A 2A22A 4G9JA 5J28A 4G4QA 3QFOA 2LH0A 3H62B 1U32A 4QNMA 2BNKA 3M6AA 4X66M 3FTDA 4X64M 1JR3D 4LFAM 4IBIA 3FTCA 4DV4M 1XNQM 1J26A 1DGHA 3AV0A 4LY6A 4GEQB 3GLGB 2XF3A 2JWOA 2NUGA 4WYQB 4Q7FA 1QAOA 1Z6TA 4FCWA 5KPZA 2J7NA 1HNZM 3A45A 2UUBM 4IBCA 4CISA 1DI2A 1WHNA 3RL3A 4MGYE 5C18A 7CATA 3C9FA 4KHPE 4DV1M 4GHAA 2BCDA 4FD2A 3TQSA 3GQ4A 4DV1E 4H2BA 2CUZA 3FUXA 1L2CA 2E1MA 1HP1A 2LMZA 4RF0A 3U6MA 2F4VE 4DV6M 4FCXA 4LF7M 1SR9A 4DUYM 5JI3E 3P71C 4M9XA 1XXHA 4YHHE 3U6DA 1DQ3A 2Z3XA 1PKPA 4L16A 1TCOA 4HLQA 2XH9A 4GIPA 4KZSA 4UT3A 5T6JA 1N34M 4YY3E 2CHQA 3J7AS 1S3NA 3VLFB 2VQFE 1S95A 4LACC 2I7PA 4LGYA 3MK6A 5EP1A 5IREB 1K3WA 2C5RA 2MC5A 2UXCE 1FJGE 3E7BA 4MOYA 5GTUA 4LF5M 4DKKA 3JAMS 1XNRE 1QAQA 1Z59A 1HR0E 4RNAA 2AHDA 5EP2A 3QFKA 2WDEA 4FWDA 3E4RA 1ZBTA 3U6PA 4R7GA 5KQDA 2UUCE 3SHGB 4DUYE 1UF3A 3FGAC 4O4KA 5JPFA 5JI2E 4AKIA 1NJFA 4NSOB 4LF9M 2Z4SA 4LRSA 4DR3M 2Q8UA 2Z7JA 3QWLA 4B7HA 1XWIA 3HPZA 5ITXE 3GRRA 4JI1E 3SYLA 1HNWE 4J6OA 4TUGA 2X4AA 1W5SA 5FLXC 1II7A 2LTSA 4NXMM 3ADGA 4DR5E 3FLOA 4ORCA 4BBAA 2MC6A 3EIEA 1KYIA 4X65M 1XM7A 1IXSB 1IXZA 2X49A 1IQPA 4BLCA 3U60A 2DXIA 4MGZE 3UZUA 4AI6A 2LE2A 4JI5M 2LUQA 2KRUA 1GLNA 4NXNM 3T1YM 2NUFA 1T70A 4FWHA 1UTEA 3T1HE 1QVRA 4MM3B 2K4VA 2JOGA 2WDCA 2CHGA 1IN5A 3PNYA 5A2QS 1XMOM 1J5EE 5C1BA 1R7RA 1D2NA 4MH0E 4G4RA 3W0FA 4DV0M 3HHWA 1XNRM 3H09A 4I8OA 2L8TA 4Q28A 1WXRA 4JV5E 2XZFA 3GRUA 5DYGA 4NXME 4LFBE 3EIHA 1GZ6A 5DNYA 3FD9A 1L2DA 2L2MA 2IE4C 4M0VA 5E26A 4ITQA 1W5TA 2Y0QA 2F5NA 2V88A 2R46A 5E6JA 2YQZA 1YUBA 1DGHB 1GL7A 4R03A 1HNXM 4F54A 2L2KB 4DR3E 4B3TE 1YYKA 3VDUA 2HYPA 3HU1A 3H69A 3RL4A 2P6BA 2XFTA 3K8ZA 5H37D 5EQVA 5KPRA 1N36M 3AL0C 2ZM6M 1Z5AA 3T15A 2WDFA 1GQEA 4OOGC 3CK2A 1X47A 3SMPA 2Y0TA 3U6LA 4UWQA 1G59A 1DO2A 4DSYA 3FYCA 3DZDA 2V87A 4H2GA 2XEPA 3J81S 3SC3A 4M9ZA 2R4JA 5KO3A 3GP1A 4LF5E 3H64A 2OPFA 1NNWA 4B3RM 2E5LM 3PSNA 8CATA 1DGBA 5ITQA 4DUZM 4DV3M 3U61A 1STUA 4BCAA 2O8AA 2JVAA 4L8NA 1WAO1 4OU7A 4NSRA 2NA2A 3J27B 1IN7A 3H67A 1G3IA 2JOXA 4X64E 1H6UA 4GH9A 4X66E 2FE8A 2V86A 4ORBA 3K92A 4JXJA 2KA6B 2C9CA 2Q2EB 4B7FA 1PJIA 1OIDA 1OJLA 1SXJC 2VQFM 2DWMA 2DZOB 2BJVA 4ZPXA 2RS6A 3IWCA 1V73A 3ADIA 4UT3B 3TWLA 3T1IA 2DXLA 2KKNA 1N75A 3IG5A 3U6QA 2DXNA 1SXJA 2DVWB 1XXHB 3QAUA 4LJ5A 2N3GA 1LV7A 4P16A 3U6OA 3LVVA 3FUTA 1G4AE 3SBJA 1HT2E 2QP9X 1XMQE 2WDDA 4B3SM 4AW4A 4TUWA 2L2NA 2ZBKB 4LZZA 4GC9A 3J81C 2C98A 1NHWC 3GRYA 3W0LB 1N77A 4DV4E 1I94E 1XNQE 4KLNA 4LJ4A 2Z1AA 3GPUA 4OVZB 1NJGA 3KOYE 1GL6A 2CEAA 2F5SA 4JI6M 3FIGA 3HQ1A 4M0DA 3WHLA 4WW0A 1MF8A 2GJUA 3H68A 4HD0A 4ZVZA 4B3ME 2DWNA 5LMNE 1YYOA 3QFNA 2LXEA 1IBKE 1N33E 1N32E 4F9AB 4L78A 3KFUG 2ODRC 4JI5E 2LBSB 1NSFA 3RGPA 4GHLA 3GLIA 5JJTA 3HU2A 3GQ3A 4L5NC 4S12A 3VKGA 4P7DA 2E5LE 2HHHE 2IAEC 1KFVA 4EIWA 1X37A 3QFMA 1Z5BA 3I4YA 1PJJA 5ADZA 1N34E 3R8FA 2L33A 3CTWB 4LRTA 2VQEM 2NQ8C 3HHYA 4JYAM 3JTZA 2UXBE 3I51A 3UJNA 3IWDA 1T4LB 3DJWA 4NRVA 2OQ4A 4LF9E 2V1UA 2R45A 3HGIA 2DSYA 2ZM6E 4BMJA 4M2ZA 2C9OA 4GKJE 5IWAM 4DMIA 3E7AA 4FCVA 3KS8A 3SAVA 3TE6A 2YEQA 4LJ8A 4BC9A 3CF2A 4GMQA 4DR7E 5EXTA 4FBQA 2DIXA 2BQ8X 3SARA 1S70A 3PVSA 2Y20A 3PNVA 3KWRA 1JQJC 5FLXS 3JR4A 1TDHA 2YR0A 4LF6M 3OMLA 3KP0E 3B9PA 4WSPA 1IN8A 2UXCM 3GLGA 3AOEA 1QYRA 4OR9A 5EXPA 3FUUA 1Z5CA 4PT5A 1Q39A 3NWLA 3M7GA 1X48A 4HL4A 1N32M 4F9BB 1IBME 4GKKE 3SYKA 4FVMA 5LMNM 1QFCA 2EO2A 2FGGA 4JI8M 4LFCE 3FTFA 1GVNA 4ZX2A 4AKHA 3KXEC 3LQRA 4G6ZA 1N78A 2LJHA 3DA1A 3VK6A 2QBYB 4M0WA 4NXNE 2F5PA 2NPPC 4K0KE 1RQ0A 1S3LA 1EE8A 3U6EA 1YZ9A 5LMUM 3ZC7B 1NNJA 2D7HA 3L25A 2F8BA 2KOUA 2UU9E 2CV9A 5C1VA 4LF4E 4NZVA 5FTMA 4B08A 4JI1M 5EJCA 4OX9E 4LZJA 3K6QA 3TPZA 4DR2E 2G5GX 4F0ZA 4JV5M 3KS4A 4JA9A 1SXJD 2CE7A 4IJFA 1JK7A 2HY1A 4TUIA 3ADLA 4R3DA 4IJEA 2YZTA 3ADJA 5IOHA 2RGOA 3K7VC 3VDPA 3R9XB 2VE7C 2M1SA 2RSMA 1SU1A 5DYIA 2M60A 2V89A 4BBYA 1KBPA 4IBBA 1FNNA 4JI3M 3VYYA 1QQWA 3GPXA 3ILKA 3FKEA 4GRIA 5BR8M 1T4OA 2HKJA 2JOBA 1FJGM 2ZANA 3IWBA 3P1XA 5AE2A 4IBGA 2L3JA 1L1TA 1TGUA 4WURA 4A3VB 3L29A 3LMLA 4BS9A 2XLJA 3AOEC 2EUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVE A;  2A22 A;  4G9J A;  3QFO A;  1OID A;  3H62 B;  1U32 A;  1V73 A;  4UT3 B;  1T71 A;  3T1I A;  2BDX A;  2KKN A;  2QFR A;  1FJM A;  4H1Y P;  3AV0 A;  2O8G A;  4Q7F A;  4H2I A;  4B2O A;  3AUZ A;  3RL3 A;  2WDD A;  5HPE A;  3C9F A;  4FBQ A;  4H1S A;  5JPE A;  2BCD A;  3QG5 C;  1HPU A;  4MOV A;  3H60 A;  4H2B A;  4O24 A;  4UT2 A;  1HP1 A;  2Z1A A;  4FCX A;  1G5B A;  1MF8 A;  1S8E A;  2GJU A;  4ZVZ A;  4HD0 A;  1OIE A;  3P71 C;  3H68 A;  4IL1 A;  3THN A;  3H61 A;  1M63 A;  1W24 A;  1TCO A;  3QFN A;  3RL5 A;  3DSC A;  1IT6 A;  4UT3 A;  1S3N A;  4V0W A;  4MOY A;  1S95 A;  4LAC C;  5JJT A;  4FBW A;  3DSD A;  3RQZ A;  2IAE C;  3QFM A;  5GTU A;  4V0X A;  1XZW A;  2AHD A;  3QFK A;  2WDE A;  4OR9 A;  3E7B A;  3FGA C;  1UF3 A;  1QHW A;  2XMO A;  2Z72 A;  4I5L C;  3E7A A;  4O4K A;  5JPF A;  2IE3 C;  2QFP A;  4LTY A;  2Q8U A;  3EGG A;  1OI8 A;  3IVD A;  4DT2 A;  3IB8 A;  4J6O A;  4TUG A;  2YVT A;  2BQ8 X;  1S70 A;  1II7 A;  3GVE A;  4ORC A;  5INB A;  3C5W C;  1XM7 A;  3LL8 A;  4O5G A;  2NYM C;  4O43 A;  1UTE A;  1T70 A;  2ZBM A;  2WDC A;  2JOG A;  1QFC A;  4XPN A;  4KKZ A;  4LU9 A;  4I5N C;  4ZX2 A;  3JYF A;  2USH A;  2QJC A;  5F3W A;  2NPP C;  4F0Z A;  1S3L A;  3EGH A;  1Z2W A;  2CV9 A;  5C1V A;  3PSO A;  2R17 A;  3THO B;  4WWL A;  5DNY A;  4H2F A;  4NZV A;  2IE4 C;  5B8I A;  1Z2X A;  4M0V A;  4KBP A;  2HYO A;  1HO5 A;  4FBK A;  4YKE A;  3ZTV A;  3H66 A;  3K7W C;  4JA9 A;  4ORA A;  3ZU0 A;  1USH A;  1JK7 A;  3RL4 A;  1S3M A;  2HY1 A;  2HYP A;  3H69 A;  4TUI A;  2P6B A;  5EQV A;  3KBP A;  1WAR A;  4JA7 A;  5IOH A;  2WDF A;  3ICF A;  3K7V C;  3V4Y A;  3CK2 A;  2NYL C;  4V0V A;  4MP0 A;  4DHL A;  4UWQ A;  4DSY A;  1AUI A;  2Z06 A;  4H2G A;  1SU1 A;  2DFJ A;  3N5U A;  1KBP A;  3HVQ A;  4IYP C;  3H64 A;  3DW8 C;  1NNW A;  3PSN A;  3TGH A;  3IB7 A;  2O8A A;  3H63 A;  1WAO 1;  3H67 A;  2NXF A;  4ORB A;  5J28 A; 
#chains in the Genus database with same CATH topology
 4DR6 E;  1UM8 A;  1V33 A;  2YTG A;  4R2R A;  1S3S A;  2DEN A;  4DR4 M;  2L09 A;  2BJW A;  5EQT A;  2D7G A;  1AAY A;  3H60 A;  4WXD A;  3VYX A;  1QU6 A;  2EM4 A;  3GQ5 A;  3H61 A;  4YHH M;  2EP3 A;  2B9D A;  4AQY M;  1G8P A;  3GPP A;  2I7N A;  4X8W A;  2NAB A;  2CV2 A;  1KYQ A;  3I01 M;  1XZW A;  3GLF B;  4CGY B;  3NBX X;  3J2P B;  2I9I A;  3FUV A;  4JI4 M;  1YSY A;  1ZR9 A;  4ZYE A;  1UFZ A;  1UIL A;  3RMP A;  2Z4R A;  1L2B A;  2JP9 A;  3LLH A;  2V1C A;  1T4N A;  3HXL A;  5FTN A;  5ITT A;  3J7A G;  3ZQJ A;  5EP3 A;  4IBE A;  1EH8 A;  4DV2 M;  5IWA E;  2AHM A;  4PDG A;  3U5Z B;  2CV0 A;  1Q3C A;  2OOB A;  3D03 A;  4FCT A;  3PSO A;  4DV5 M;  3THO B;  3Q8X A;  5A6K A;  1I4W A;  4YKE A;  3ZTV A;  2KHX A;  1WHQ A;  2N35 A;  2FNA A;  2F5Q A;  2A25 A;  2UUA M;  1HT1 E;  4JI6 E;  2RS7 A;  3ICF A;  4MP0 A;  2YTP A;  4N4R B;  3FUW A;  4OX9 M;  1E32 A;  4LG2 A;  4JI4 E;  3H63 A;  1AH5 A;  3SMS A;  2EWL A;  5AAS A;  1PM5 A;  3IVE A;  3UK6 A;  2MJ5 B;  5A6B D;  1T71 A;  4DV3 E;  3C3D A;  3OTO M;  3AUZ A;  2WDD A;  1YE9 A;  2MDR A;  4H1S A;  3SAU A;  1OFI A;  4O24 A;  1A1L A;  4LF6 E;  4YY3 M;  3E46 A;  2WCC 3;  2DGC A;  3J7Y p;  3MMP A;  4V0W A;  3HJQ A;  5IT9 C;  3GPY A;  3M0E A;  1IBL E;  2EA0 A;  1GJT A;  2I13 A;  4B3M M;  2R18 A;  1G2F C;  4JI2 E;  1WR1 B;  1OIP A;  2LNH C;  2XZU A;  3GLH A;  4L8R C;  1JB0 F;  1IY0 A;  3K1J A;  2ZTC A;  5KL3 A;  3KDS E;  3ZOQ B;  1QAM A;  1G41 A;  3VFD A;  3GVE A;  3U60 B;  2L4E A;  3SHF A;  2FS1 A;  2ZBM A;  2KZU A;  1FKA E;  1NNU C;  2BB8 A;  1SXJ E;  3W68 A;  2EPA A;  4X9J A;  3AJI B;  2K47 A;  2UXD E;  4NOO B;  4LJ9 A;  1TH2 A;  2EN3 A;  5B8I A;  5AE1 A;  1HO5 A;  3K7W C;  4DR5 M;  4JI7 M;  3GRV A;  2B7V A;  1S3M A;  2V6Z M;  2XSZ D;  1Q3B A;  2D9H A;  3F92 A;  2M5Z A;  3KW6 A;  4V0V A;  2NYL C;  2M7Q A;  1JR3 A;  2LJU A;  1HJP A;  1R6B X;  1C7Y A;  3HVQ A;  2EOE A;  1EIJ A;  4D80 A;  2L6M A;  1R4G A;  5IT9 S;  2RPC A;  2DHY A;  5AC5 A;  3HJ8 A;  4G9J A;  3QFO A;  2LVP C;  2BNK A;  4LFA M;  2WSE F;  2GQF A;  4DV4 M;  2QHO B;  3RL3 A;  1HNZ M;  3A45 A;  4IBC A;  1XXH E;  5C18 A;  4KHP E;  4FD2 A;  3TQS A;  3GQ4 A;  2CUZ A;  3FUX A;  3U6M A;  4G3O A;  1SR9 A;  1XXH A;  1DQ3 A;  2ADR A;  4GIP A;  4YY3 E;  1S3N A;  1ZMU A;  2CHQ A;  3VLF B;  2VQF E;  4LAC C;  2I7P A;  1K3W A;  4BHC A;  4DKK A;  1YLA A;  3FGA C;  3SHG B;  4DUY E;  4O4K A;  3KZZ A;  4AKI A;  4NSO B;  2Z4S A;  5KL4 A;  5ITX E;  1JK1 A;  3SYL A;  5FLX C;  1II7 A;  2LTS A;  4NXM M;  4DR5 E;  3MHS C;  1KYI A;  4BLC A;  2DXI A;  1GO5 A;  2NUF A;  2EOI A;  1GLN A;  4NXN M;  1T70 A;  2APL A;  1QVR A;  2WDC A;  3PNY A;  1P3Q Q;  4ZYH A;  1R7R A;  2LV2 A;  3W0F A;  4R2P A;  3HHW A;  1XNR M;  3QYB A;  2L8T A;  4Q28 A;  1GZ6 A;  1YFH A;  2L2M A;  1Q02 A;  2IE4 C;  5E26 A;  1W5T A;  1ZMW A;  2L2K B;  3H66 A;  1YYK A;  1HNX M;  3RL4 A;  3VDU A;  2HYP A;  3H69 A;  2P6B A;  2XFT A;  1QDT A;  1Z5A A;  2DKL A;  2Y0T A;  4DSY A;  4H2G A;  2XEP A;  4B3R M;  1DGB A;  1STU A;  4DV3 M;  4L8N A;  4X66 E;  1R5L A;  4ORB A;  4JXJ A;  1PJI A;  2KA6 B;  2DZO B;  2BJV A;  3IWC A;  3TWL A;  2DXN A;  1IQO A;  1XXH B;  2EN4 A;  4P16 A;  3LVV A;  1G4A E;  3LCU A;  3SBJ A;  1HT2 E;  2QP9 X;  3W0L B;  3GRY A;  2Z1A A;  4KLN A;  2EM8 A;  1NJG A;  4JI6 M;  1MF8 A;  3FIG A;  1TF6 A;  4HD0 A;  4ZVZ A;  3QFN A;  1YYO A;  1IBK E;  4F2L A;  1T43 A;  3ECR A;  3HU2 A;  2IAE C;  1KFV A;  1X37 A;  5ADZ A;  2RRU A;  2L33 A;  3CTW B;  1BBO A;  3JTZ A;  3HHY A;  2OQ4 A;  2V1U A;  2R45 A;  2DSY A;  2ZM6 E;  4GKJ E;  3E7A A;  1PJQ A;  4HEI A;  3TE6 A;  4LJ8 A;  4GMQ A;  4DR7 E;  3SAR A;  1S70 A;  2Y20 A;  3JR4 A;  4WSP A;  3KP0 E;  3AOE A;  4PT5 A;  2H5X A;  4GKK E;  1ZAA C;  4FVM A;  5LMN M;  2FGG A;  2QBY B;  4MLQ A;  1S3L A;  1NNJ A;  2UU9 E;  2KOU A;  4WP2 A;  1ZV1 A;  5FTM A;  4JI1 M;  5EJC A;  2DLK A;  4LZJ A;  3K6Q A;  3TPZ A;  4DR2 E;  3KS4 A;  1SXJ D;  3ADL A;  4R3D A;  4IJE A;  2YZT A;  3ADJ A;  2DRP A;  3VDP A;  1GJS A;  2VE7 C;  4BBY A;  1QQW A;  3GPX A;  4GRI A;  2JOB A;  3IWB A;  2HKJ A;  2ZAN A;  4IBG A;  2YRM A;  2EPZ A;  1TGU A;  2E72 A;  3J80 S;  3E21 A;  2EMC A;  3CF0 A;  1QUS A;  4K0K M;  5LL6 R;  2JA2 A;  5KL6 A;  3FRI A;  2QFR A;  3RE8 A;  2JNH A;  3AFH A;  2EMH A;  2BWB A;  4WPY A;  2O8G A;  2L7I A;  2YFQ A;  3MHH C;  3J7B A;  3SFZ A;  4XGI A;  2ELZ A;  2EM6 A;  3QG5 C;  1VDD A;  4PCZ A;  5EP4 A;  1G5B A;  4R2A A;  1XHB A;  1XMO E;  4MGH A;  4FW9 A;  4R71 A;  1IT6 A;  4AG5 A;  4QOZ C;  3VKH A;  1IBL M;  1J7K A;  3KOX E;  3FTE A;  4FBW A;  1L8Q A;  2CP8 A;  4DBG B;  4JYA E;  2R4E A;  4V0X A;  4G4O A;  3D8L A;  4D81 A;  4M30 A;  3HX3 A;  4JI8 E;  4I81 A;  2EKF A;  1K3X A;  1RU3 A;  2GNO A;  1D0K A;  2K7I A;  1TDZ A;  3HHZ A;  1YUI A;  3IB8 A;  1MX0 A;  5ITX A;  1TH4 A;  2JY8 A;  3OTO E;  1ZAE A;  2QPA A;  3MHV C;  2NYM C;  2C99 A;  4IBF A;  2EPP A;  2L2D A;  2CPN A;  2EM0 A;  5A6J A;  4I5N C;  2DWL A;  2R65 A;  3K2L A;  3GLH B;  3C6M A;  1HQY E;  5GKN A;  2ENC A;  4JI7 E;  4AZF A;  1EH7 A;  4NRW A;  2G7H A;  3V76 A;  4LF8 M;  4M9V C;  1GKI A;  3PFI A;  5FTJ A;  5FSW A;  1EH6 A;  4ORA A;  4JI3 E;  4NC6 A;  4NL4 H;  3KBP A;  5A6B A;  4JA7 A;  3JU0 A;  2L7H A;  1I94 M;  5L8R F;  5AE3 A;  3MJ5 A;  3HZJ A;  3C58 A;  2R76 A;  2VF1 A;  2YTJ A;  2CFO A;  4REZ A;  4DV5 E;  2KHH A;  1A1I A;  2ZAM A;  2LTR A;  2QCU A;  1UBD C;  3IB7 A;  3JAM C;  4QNR A;  2X8A A;  2NXF A;  3L28 A;  5LMU E;  2WZJ A;  5BPV A;  2EMI A;  4Y28 F;  4R8O A;  1PGY A;  2VII A;  1FJM A;  4H1Y P;  4KT0 F;  4H2I A;  3HJS A;  4DR1 M;  3GO8 A;  2NUE A;  5JPE A;  2CHV A;  1OFH A;  3HHX A;  1ZBQ A;  4JI0 E;  1N36 E;  4HEO A;  2G8L A;  4CHT B;  4GKJ M;  2EOZ A;  3TQM A;  4IL1 A;  3DSC A;  1W24 A;  4DV7 E;  4FWG A;  1KJK A;  3A46 A;  2R1F A;  4AQY E;  3B7N A;  1IFY A;  2QFP A;  2JY5 A;  1NEI A;  2L3C A;  4R2Q A;  1G2D C;  4Q7J A;  2V8Q B;  3EGG A;  1CUK A;  1OI8 A;  3A98 B;  3ZCB B;  2P5T A;  4PD2 A;  2C96 A;  5INB A;  4DR4 E;  2JUJ A;  2EM5 A;  2PRT A;  3FYD A;  1MU5 A;  1NY6 A;  1IMU A;  4KKZ A;  4QHT A;  3TWM A;  4DR6 M;  2CRU A;  5F3W A;  3GLH E;  1QZM A;  2VDB B;  2ZAO A;  2YTO A;  3B7Q A;  2JZ0 A;  3GLF A;  3HKP A;  1J5E M;  2EMF A;  1Z2W A;  2MH8 A;  5BR8 E;  2W82 A;  2YPN A;  2FOI C;  1J09 A;  2LRS A;  1VEG A;  2MDG A;  2YRK A;  2YTI A;  2J7J A;  1A1G A;  1YYW A;  2WBT A;  1HNX E;  3KOZ E;  5DFL A;  1AUI A;  2Z06 A;  3HU3 A;  4DV2 E;  1XMQ M;  4OW0 A;  4JI0 M;  4BB9 A;  4FK5 C;  4L15 A;  2H1R A;  2VQE E;  2YTF A;  5EXS A;  1HNZ E;  2CT1 A;  1N33 M;  2YTE A;  4QNM A;  4X64 M;  3FTD A;  1JR3 D;  1DGH A;  2NUG A;  2XF3 A;  2JWO A;  4WYQ B;  4FCW A;  4CIS A;  1WHN A;  4GHA A;  2JZ1 A;  4DV1 E;  2LMZ A;  2EN6 A;  4DUY M;  4R2E A;  4YHH E;  4L16 A;  2EOR A;  4KZS A;  4UT3 A;  4RHB B;  5T6J A;  1S95 A;  4LGY A;  3MK6 A;  1WJP A;  2MC5 A;  2UXC E;  5GTU A;  1Z59 A;  1HR0 E;  2AHD A;  2DAK A;  3U6P A;  1UF3 A;  4WX9 A;  4LF9 M;  4ANR A;  4B7H A;  1QNT A;  4JI1 E;  4J6O A;  1W5S A;  3FLO A;  3M99 B;  4O5G A;  2LUQ A;  3UZU A;  2LE2 A;  4JI5 M;  2KRU A;  2EMG A;  3T1H E;  4MM3 B;  5C1B A;  1ZU1 A;  3H09 A;  4I8O A;  1WXR A;  2XZF A;  3EIH A;  2Y0Q A;  2V88 A;  1DGH B;  4B3T E;  4F54 A;  1F4I A;  5EQV A;  5KPR A;  4XK8 F;  3AL0 C;  2ZM6 M;  2WDF A;  3SMP A;  4UWQ A;  2EPN A;  2GHF A;  3J81 S;  3SC3 A;  1MN3 A;  2OPF A;  1T6O A;  4BCA A;  2JVA A;  1WAO 1;  2NA2 A;  3J27 B;  1G3I A;  4GH9 A;  2EPM X;  4B7F A;  2EPX A;  2LTU A;  1OJL A;  2RS6 A;  1V73 A;  3T1I A;  1AUA A;  2DVW B;  4ZYG A;  4LJ5 A;  1LV7 A;  3FUT A;  1P47 A;  2EN2 A;  4LZZ A;  2C98 A;  4CJ6 A;  1N77 A;  3GPU A;  4OVZ B;  2F5S A;  1GL6 A;  2YTQ A;  4M0D A;  3CGW A;  2MKN A;  1QZE A;  2DWN A;  4B3M E;  2LXE A;  1N33 E;  2EPO A;  4L78 A;  3KFU G;  4L5N C;  2MR9 A;  2EOO A;  3QFM A;  5KL2 A;  1Z5B A;  2KNZ A;  3I4Y A;  1PJJ A;  1N34 E;  2UXB E;  2LVA A;  2BBG A;  3DJW A;  1D0M A;  3E7B A;  4BMJ A;  4UN2 B;  2C9O A;  5IWA M;  4FCV A;  2EPU A;  2YEQ A;  4BC9 A;  5EXT A;  2DIX A;  3KWR A;  1TDH A;  3B9P A;  3FUU A;  1Z5C A;  2K0B X;  3M7G A;  3IEC A;  1X48 A;  3SYK A;  4LFC E;  3FTF A;  3B74 A;  4AKH A;  2LBC A;  2LJH A;  3DA1 A;  4M0W A;  4NXN E;  2F5P A;  3U6E A;  5LMU M;  4F6M A;  4LF4 E;  4NZV A;  2JXN A;  4OX9 E;  2G5G X;  4JV5 M;  2CE7 A;  1JK7 A;  1SG9 A;  5DYI A;  4IBB A;  4JI3 M;  3FKE A;  1T4O A;  2WBS A;  3P1X A;  3T6P A;  3AOE C;  4A3V B;  2H36 X;  4LFB E;  3K9O A;  1DGF A;  4Z6Y A;  1VQ1 A;  2DMY A;  2IHR 1;  4LCB A;  2DAM A;  2KXE A;  4LJA A;  2JP7 A;  2DNA A;  2RTX A;  3AOG A;  2LWX A;  4B3R E;  2EM2 A;  2EM9 A;  3E0J A;  4WSG A;  2N8X A;  4GC5 A;  3THN A;  5IV8 B;  3RL5 A;  3C4B A;  1R2Z A;  1PJS A;  3U6S A;  2N3H A;  2V83 A;  4B7G A;  4XBO A;  2UXB M;  4W5W A;  3GLI B;  3B89 A;  1YSA C;  1NO1 A;  1QAN A;  4G4N A;  3EPH A;  2QBY A;  3BF2 A;  4D82 A;  2WZO A;  2YWQ A;  1E9R A;  2LVO C;  1VG5 A;  2OOA A;  4DT2 A;  1NV9 A;  2HC5 A;  2EOJ A;  1V34 A;  4LF8 E;  1T3T A;  3TL4 X;  3BOS A;  4DUZ E;  3C5W C;  3U5Z A;  3LCV B;  3T38 A;  3JYF A;  5A2Q C;  2QJC A;  2VF8 A;  3C9P A;  4GIT A;  4J8Z A;  2EN7 A;  3GLI E;  2DWZ B;  4F1I A;  1ORY B;  1WXQ A;  3CF6 E;  1PDA A;  1Z2X A;  3IHP A;  1R2Y A;  4FBK A;  2EOF A;  1AIP C;  2KZS A;  4OVZ A;  2MKD A;  4L4U A;  1WAR A;  2L6O A;  1K82 A;  4JI2 M;  4DHL A;  3IG8 A;  1UHZ A;  3DOA A;  1IY1 A;  5IZ7 D;  4II7 A;  1IY2 A;  2ZO9 B;  1L4S A;  2HWJ A;  2EL5 A;  1BBG A;  1IBM M;  5FTK A;  4B2O A;  2DZN B;  2XSZ A;  5EXX A;  4IBJ A;  4FBQ A;  4NHR A;  3H4M A;  1YPN A;  2EOQ A;  4MOV A;  1ZQ9 A;  4IBD A;  4UT2 A;  4R2C A;  3NBI A;  4X62 E;  4KO8 A;  1E94 E;  3I04 M;  3K9P A;  1EKZ A;  2FTX B;  4IIW A;  2YTD A;  2EQ1 A;  1MEY C;  1JR3 E;  1GAB A;  5ITU A;  2Z72 A;  4DV0 E;  1WJ7 A;  1C1K A;  3KVW A;  5ITR A;  1TH3 A;  4MB7 A;  4B3S E;  3T1Y E;  2YVT A;  3SAW A;  2EE8 A;  3D8B A;  2KON A;  3LQQ A;  3KSX A;  1X5W A;  5CFF E;  1OKS A;  1IM2 A;  2MGW A;  4XPN A;  3PXG A;  2L4F A;  2JR1 A;  3EGH A;  2YU5 A;  3J80 C;  2DB2 A;  3VK8 A;  4WWL A;  4LGM A;  2YRH A;  5IXM B;  4KBP A;  1USH A;  3DF6 A;  1IXR C;  4GZN C;  4Z8X A;  3BGH A;  4LF7 E;  2F4V M;  3HTX A;  2YT4 A;  2CTD A;  4LJ7 A;  1HQC A;  4BC7 A;  2UUC M;  3RFW A;  5KPT A;  2BWE A;  3AKZ A;  3TGH A;  1IN6 A;  2EPC A;  1IBK M;  2RGH A;  5AC4 A;  2A22 A;  4G4Q A;  2LH0 A;  3H62 B;  1U32 A;  2G3Q A;  3M6A A;  3EPL A;  4IBI A;  3FTC A;  3AV0 A;  3BBG A;  4LY6 A;  1UN6 B;  2EOX A;  1QAO A;  4BHB A;  3C9F A;  1Y8G A;  4H2B A;  1L2C A;  1MGT A;  2E1M A;  1HP1 A;  2F4V E;  4CIZ A;  4FCX A;  4LF7 M;  1VEK A;  5JI3 E;  3P71 C;  2HGH A;  1TCO A;  2LHC A;  2XH9 A;  3J7A S;  2JY6 B;  5EP1 A;  5IRE B;  2C5R A;  1TTE A;  1QAQ A;  5EP2 A;  3QFK A;  2WDE A;  4R7G A;  5KQD A;  2UUC E;  5JI2 E;  4LRS A;  1XWI A;  1HNW E;  2X4A A;  2B3T A;  3ADG A;  3EQ1 A;  2MC6 A;  3FE3 A;  3EIE A;  1IXZ A;  2X49 A;  3U60 A;  1IQP A;  2DLQ A;  4AI6 A;  2K4V A;  2CHG A;  1XMO M;  2EKK A;  1D2N A;  4MH0 E;  2EJ4 A;  1OQY A;  5DYG A;  4NXM E;  2EOS A;  5DNY A;  3FD9 A;  2R6F A;  3W67 A;  5E6J A;  2YQZ A;  3HU1 A;  5H37 D;  3CK2 A;  1DO2 A;  3DZD A;  2EMX A;  4M9Z A;  2R4J A;  3GP1 A;  4DUZ M;  2O8A A;  1VEJ A;  4OU7 A;  4NSR A;  4X64 E;  3C6K A;  1H6U A;  4KWY A;  2V86 A;  3K92 A;  2Q2E B;  2C9C A;  1IQS A;  2EL4 A;  1DV0 A;  1SXJ C;  1DGC A;  1YUJ A;  1SXJ A;  3QAU A;  2N3G A;  3U6O A;  1RMD A;  1XMQ E;  4AW4 A;  3J81 C;  2ZBK B;  1BVS A;  2O25 A;  4GC9 A;  4DV4 E;  4LJ4 A;  3KOY E;  3B7Z A;  3HQ1 A;  1XB2 B;  4WW0 A;  1ZMV A;  5LMN E;  4F9A B;  2ODR C;  4JI5 E;  4GHL A;  3GLI A;  2E5L E;  4P7D A;  2HHH E;  3R8F A;  2VQE M;  4JYA M;  3I51 A;  3UJN A;  3IWD A;  1T4L B;  2EQ3 A;  4NRV A;  1B69 A;  4LF9 E;  4M2Z A;  4DMI A;  2QSF X;  3KS8 A;  2EOH A;  1OTR A;  3BXW A;  2JPA A;  3PVS A;  3PNV A;  1QDR A;  1JQJ C;  2RQL A;  4LF6 M;  2EMB A;  1IN8 A;  2UXC M;  3GLG A;  1QYR A;  2O01 F;  1OIZ A;  3HY5 A;  4F9B B;  2EO2 A;  1GVN A;  3KXE C;  3LQR A;  3VK6 A;  2NPP C;  2Z8Y M;  4K0K E;  1RQ0 A;  1LTM A;  2F8B A;  2D7H A;  3L25 A;  3H4J A;  1X6H A;  2EL6 A;  1A1F A;  1TR8 A;  4JA9 A;  4IJF A;  2HY1 A;  2RGO A;  3K7V C;  2M1S A;  2RSM A;  1TF3 A;  5LLQ A;  1FNN A;  3VYY A;  3ILK A;  2M9A A;  1FJG M;  1L1T A;  1T38 A;  3LML A;  2JXP A;  1HNW M;  3Q8G A;  2DZL A;  4DV7 M;  2LVN C;  2YSP A;  2BDX A;  3L26 A;  2DAG A;  3LVW A;  1NY5 A;  2L92 A;  2DHR A;  4I4L A;  4GKK M;  4PDI A;  2UUB E;  2JYA A;  4M9S A;  4QHS A;  4HTG A;  2LVQ D;  2ZTD A;  1HPU A;  2WSF F;  2YU8 A;  2LO3 A;  2R62 A;  4DR7 M;  1S8E A;  1GTK A;  1OIE A;  1TF0 B;  1M63 A;  3HWS A;  1EFU B;  2F5O A;  4MOY A;  3LMM A;  1N3G A;  4LJ6 A;  4I5S A;  2KDL A;  2FFJ A;  4LFB M;  3RQZ A;  3C3E A;  3I4V A;  1NHG C;  3KOW E;  4F9C B;  1OAO C;  4LFC M;  2M4I A;  1WRJ A;  2XMO A;  1QHW A;  4I5L C;  4LTY A;  2UUA E;  4X62 M;  2ZOA A;  3JR5 A;  2DMI A;  5TSE A;  2Y21 A;  2EML A;  1DO0 A;  1WGN A;  2EMK A;  4X65 E;  2RKO A;  4IS1 C;  3HPS A;  4O43 A;  2A5Y B;  2OO9 A;  1A1K A;  2QZ4 A;  2FV4 B;  3E9S A;  2KW0 A;  2EZ6 A;  4RH8 A;  4F6N A;  3UGJ A;  4GEW A;  4H2F A;  2EOY A;  4JN6 A;  4DR1 E;  2HYO A;  2XGN A;  3ZU0 A;  4LFA E;  1RC7 A;  4WXC A;  2J7O A;  2D7E A;  5KQ8 A;  4MLV A;  3SAS A;  4MGK E;  3N5U A;  2DFJ A;  2V85 A;  4DV6 E;  3DW8 C;  2EPR A;  2QEN A;  3GLG E;  2JWS A;  3L27 A;  2K9D A;  1WIV A;  2R44 A;  3WHK A;  2K6B A;  2KEB A;  3UMM A;  2HCB A;  2YNM D;  4IBK A;  3MSW A;  3U6C A;  2EMA A;  1X49 A;  4P78 A;  2DAI A;  4Q35 B;  3A42 A;  2ENA A;  5ITY A;  1HR0 M;  5HPE A;  4QOS A;  2LCE A;  2UXD M;  2XFS A;  2B7T A;  1NVM A;  1X6F A;  3U61 B;  1XC8 A;  3VK7 A;  4AKG A;  3KZY A;  3C4T A;  3KP1 E;  4DR2 M;  2ELY A;  3L00 A;  5FTL A;  2O5R A;  4RKU F;  2LVH A;  2HHH M;  2UU9 M;  2EQ0 A;  1SXJ B;  2DAE A;  1JK2 A;  4R2D A;  2ODR D;  2EN8 A;  1G71 A;  4IJD A;  2IE3 C;  2HL7 A;  3IVD A;  2DI0 A;  1O0W A;  4RF1 A;  4B3T M;  1IXS A;  1IN4 A;  4KOD A;  4AG6 A;  2JY9 A;  4KHP M;  3LL8 A;  1E9S A;  1L1Z A;  2GLI A;  3KSJ A;  4P17 A;  3L2A A;  4LU9 A;  1KSF X;  3F6G A;  5A69 A;  2USH A;  2QQ8 A;  1X3C A;  2EM3 A;  2ERC A;  3T1H M;  2R17 A;  4WFT A;  1Z1B A;  4F2J C;  1NCS A;  3SAT A;  4MGI E;  1T39 A;  2CV1 A;  3F6H A;  2KRK A;  2KNA A;  2RSI A;  1DGG A;  3V4Y A;  2LUP B;  3ZH9 B;  4LF4 M;  3LW5 F;  3DFZ A;  3THG A;  1TN9 A;  2B3T B;  3UK3 C;  1PJT A;  3TWK A;  3RGS A;  5J28 A;  2EPK X;  1LLM C;  1WGL A;  4X66 M;  1XNQ M;  1J26 A;  4GEQ B;  3GLG B;  4Q7F A;  2VRD A;  3HPZ A;  1Z6T A;  5KPZ A;  2J7N A;  2UUB M;  1DI2 A;  4MGY E;  7CAT A;  3BID A;  1OAI A;  4DV1 M;  2BCD A;  4RF0 A;  2HAK A;  4DV6 M;  3EPJ A;  2HJJ A;  4M9X A;  3U6D A;  2VF7 A;  2Z3X A;  1PKP A;  4HLQ A;  2EMY A;  2EM7 A;  1N34 M;  4R2S A;  3EPK A;  1FJG E;  4LF5 M;  3JAM S;  1XNR E;  2YSO A;  4RNA A;  2KNV A;  1F2I G;  4FWD A;  3E4R A;  1ZBT A;  5JPF A;  1NJF A;  2EMZ A;  4DR3 M;  2Q8U A;  2Z7J A;  3QWL A;  3GRR A;  1D0L A;  4TUG A;  4ORC A;  4BBA A;  1XM7 A;  4X65 M;  1IXS B;  2EOM A;  4MGZ E;  1UTE A;  3T1Y M;  4FWH A;  1X6E A;  2JOG A;  1IN5 A;  5A2Q S;  1J5E E;  4G4R A;  1MJG M;  4DV0 M;  2WSC F;  3GLF E;  5KL7 A;  4JV5 E;  2EN1 A;  3GRU A;  1A1H A;  3FRH A;  3QYE A;  1L2D A;  4M0V A;  4ITQ A;  2EJS A;  2F5N A;  2R46 A;  4R03 A;  1YUB A;  4DR3 E;  1GL7 A;  3K8Z A;  2QNJ A;  2EMW A;  1N36 M;  3T15 A;  1GQE A;  4OOG C;  1X47 A;  5KL5 A;  3U6L A;  1G59 A;  3FYC A;  2V87 A;  1V92 A;  2JY7 A;  5KO3 A;  4LF5 E;  3H64 A;  1NNW A;  3PSN A;  2E5L M;  8CAT A;  5ITQ A;  3U61 A;  1QUT A;  2LT7 A;  1IN7 A;  3H67 A;  2JOX A;  3VHT B;  2FE8 A;  3BBZ A;  2MRO B;  1OID A;  2VQF M;  2DWM A;  4ZPX A;  4UT3 B;  2CSH A;  2DXL A;  2KKN A;  1N75 A;  3IG5 A;  3U6Q A;  1PRB A;  4L6V 6;  4B3S M;  4TUW A;  2L2N A;  1NHW C;  1I94 E;  1XNQ E;  2CEA A;  2GJU A;  3WHL A;  3H68 A;  1NV8 A;  1N32 E;  2LBS B;  1NSF A;  3RGP A;  5JJT A;  3GQ3 A;  4S12 A;  3VKG A;  3DSD A;  4EIW A;  2R0I A;  4LRT A;  2NQ8 C;  2YTN A;  3HGI A;  4OR9 A;  1BB8 A;  2ENH A;  2GPI A;  2LHG A;  3CF2 A;  2BQ8 X;  5FLX S;  2YR0 A;  3OML A;  2CWB A;  5EXP A;  1Q39 A;  3NWL A;  1IBM E;  4HL4 A;  1N32 M;  1QFC A;  5A6A A;  4JI8 M;  4ZX2 A;  4G6Z A;  1N78 A;  4F0Z A;  2WBU A;  1EE8 A;  1YZ9 A;  3ZC7 B;  1A1J A;  2CV9 A;  5C1V A;  4B08 A;  1VDL A;  2EPL X;  2FH0 A;  4TUI A;  5IOH A;  3R9X B;  1SFE A;  1SU1 A;  2J5Y A;  1KBP A;  2M60 A;  2V89 A;  4IYP C;  3ADI A;  5BR8 M;  5AE2 A;  1WHC A;  2L3J A;  4ZYD A;  4WUR A;  4BS9 A;  3L29 A;  2XLJ A;  3SAV A;  2EUC A;  1A5T A; 
#chains in the Genus database with same CATH homology
 4DR6 E;  1UM8 A;  1DGF A;  3CF0 A;  4DV7 M;  4O5G A;  4Z6Y A;  4K0K M;  5LL6 R;  2JA2 A;  1S3S A;  2DMY A;  2IHR 1;  2BDX A;  3L26 A;  2QFR A;  3RE8 A;  4LCB A;  3LVW A;  3AFH A;  4DR4 M;  4WPY A;  1NY5 A;  2KXE A;  4LJA A;  2L92 A;  2O8G A;  2DHR A;  4I4L A;  2L09 A;  2BJW A;  4GKK M;  5EQT A;  2L7I A;  2YFQ A;  4PDI A;  2D7G A;  2RTX A;  3AOG A;  2UUB E;  3J7B A;  3SFZ A;  4XGI A;  2LWX A;  4M9S A;  4QHS A;  3QG5 C;  1HPU A;  4B3R E;  3H60 A;  1VDD A;  4PCZ A;  3E0J A;  2R62 A;  3VYX A;  1QU6 A;  5EP4 A;  4DR7 M;  3GQ5 A;  1G5B A;  1S8E A;  1OIE A;  4GC5 A;  3THN A;  1XHB A;  1XMO E;  3H61 A;  1M63 A;  4MGH A;  3HWS A;  4YHH M;  3C4B A;  3RL5 A;  4FW9 A;  1R2Z A;  2F5O A;  2B9D A;  1IT6 A;  4AG5 A;  4AQY M;  3U6S A;  4QOZ C;  1G8P A;  2N3H A;  3GPP A;  3VKH A;  2V83 A;  3LMM A;  2I7N A;  1J7K A;  4LJ6 A;  1IBL M;  3KOX E;  4B7G A;  4I5S A;  3FTE A;  4FBW A;  1L8Q A;  2FFJ A;  4X8W A;  4LFB M;  4XBO A;  2CV2 A;  2UXB M;  2R4E A;  4JYA E;  4V0X A;  3I4V A;  3RQZ A;  1XZW A;  4W5W A;  3GLI B;  3GLF B;  4G4O A;  4CGY B;  1NHG C;  3KOW E;  3D8L A;  3J2P B;  4D81 A;  4M30 A;  4F9C B;  3FUV A;  4LFC M;  2M4I A;  4JI8 E;  4JI4 M;  1YSY A;  1QAN A;  4I81 A;  2XMO A;  4G4N A;  1QHW A;  4I5L C;  2QBY A;  4LTY A;  2UUA E;  4X62 M;  4D82 A;  2ZOA A;  3JR5 A;  1K3X A;  2WZO A;  1E9R A;  1UIL A;  3RMP A;  2Y21 A;  1DO0 A;  4DT2 A;  2Z4R A;  1TDZ A;  1L2B A;  3HHZ A;  3H66 A;  3LLH A;  3IB8 A;  1MX0 A;  2V1C A;  1TH4 A;  5ITX A;  4LF8 E;  3OTO E;  1ZAE A;  1T3T A;  3TL4 X;  1T4N A;  3BOS A;  3HXL A;  5FTN A;  5ITT A;  2QPA A;  2RKO A;  4X65 E;  4DUZ E;  3J7A G;  3C5W C;  3MHV C;  5EP3 A;  3U5Z A;  2C99 A;  3HPS A;  2NYM C;  4IBE A;  4O43 A;  4IBF A;  4DV2 M;  3T38 A;  3DSD A;  2A5Y B;  2QZ4 A;  2FV4 B;  2CPN A;  4I5N C;  3E9S A;  2KW0 A;  3JYF A;  2DWL A;  5A2Q C;  2EZ6 A;  2R65 A;  3K2L A;  4GIT A;  3GLH B;  2QJC A;  4J8Z A;  5IWA E;  2AHM A;  4PDG A;  1HQY E;  5GKN A;  3U5Z B;  2CV0 A;  4JI7 E;  2DWZ B;  1Q3C A;  4AZF A;  3UGJ A;  4NRW A;  1ORY B;  2G7H A;  4FCT A;  4LF8 M;  3D03 A;  4DV5 M;  1WXQ A;  3PSO A;  1GKI A;  3PFI A;  3THO B;  3CF6 E;  5FTJ A;  3Q8X A;  4JN6 A;  4DR1 E;  4H2F A;  1Z2X A;  5FSW A;  1I4W A;  2HYO A;  1R2Y A;  4FBK A;  4YKE A;  3ZTV A;  2KHX A;  1WHQ A;  2XGN A;  4ORA A;  3ZU0 A;  4JI3 E;  2FNA A;  2KZS A;  2F5Q A;  2UUA M;  1HT1 E;  4NL4 H;  1RC7 A;  4LFA E;  4OVZ A;  4JI6 E;  4L4U A;  3KBP A;  1WAR A;  2RS7 A;  4JA7 A;  3JU0 A;  3ICF A;  2L7H A;  2L6O A;  1I94 M;  1K82 A;  4JI2 M;  4DHL A;  4MP0 A;  2J7O A;  2D7E A;  3IG8 A;  5KQ8 A;  5AE3 A;  3FUW A;  3SAS A;  4OX9 M;  4MGK E;  1UHZ A;  3MJ5 A;  3C58 A;  2DFJ A;  3N5U A;  2VF1 A;  1E32 A;  2CFO A;  4REZ A;  2V85 A;  3DOA A;  4DV5 E;  4DV6 E;  4LG2 A;  5JPE A;  1IY1 A;  4JI4 E;  3DW8 C;  2QEN A;  2ZAM A;  2LTR A;  2QCU A;  3IB7 A;  3L27 A;  4QNR A;  2X8A A;  4II7 A;  5IZ7 D;  3JAM C;  1IY2 A;  3H63 A;  2ZO9 B;  2NXF A;  3WHK A;  3SMS A;  3L28 A;  2EWL A;  1PM5 A;  5AAS A;  5LMU E;  3IVE A;  5BPV A;  2KEB A;  3UMM A;  3UK6 A;  4R8O A;  1IBM M;  1T71 A;  2VII A;  2HCB A;  1FJM A;  2YNM D;  4H1Y P;  4IBK A;  5FTK A;  3MSW A;  4DV3 E;  3U6C A;  4B2O A;  2DZN B;  1X49 A;  4H2I A;  4P78 A;  3OTO M;  3AUZ A;  3HJS A;  4DR1 M;  2XSZ A;  3A42 A;  1YE9 A;  5EXX A;  5ITY A;  3GO8 A;  1HR0 M;  2MDR A;  4QOS A;  4IBJ A;  2NUE A;  5HPE A;  2UXD M;  2XFS A;  3SAU A;  2CHV A;  2B7T A;  1NVM A;  1OFI A;  1OFH A;  3H4M A;  1ZQ9 A;  3HHX A;  3U61 B;  2H36 X;  4MOV A;  4IBD A;  4LF6 E;  4O24 A;  1ZBQ A;  4JI0 E;  3NBI A;  4UT2 A;  4X62 E;  1XC8 A;  1N36 E;  4KO8 A;  4YY3 M;  3VK7 A;  1E94 E;  2G8L A;  4CHT B;  4GKJ M;  4IL1 A;  4AKG A;  3C4T A;  3DSC A;  3KP1 E;  1W24 A;  4DR2 M;  3J7Y p;  4H1S A;  5FTL A;  1EKZ A;  2O5R A;  1HNW M;  4V0W A;  2FTX B;  4DV7 E;  4FWG A;  2HHH M;  2UU9 M;  3HJQ A;  3A46 A;  3GPY A;  5IT9 C;  3M0E A;  1IBL E;  2EA0 A;  4IIW A;  4AQY E;  1SXJ B;  4B3M M;  2R18 A;  4IYP C;  4JI2 E;  5ITU A;  2ODR D;  2Z72 A;  4DV0 E;  2LNH C;  2XZU A;  2IE3 C;  3GLH A;  4L8R C;  2L3C A;  2QFP A;  1C1K A;  1IY0 A;  3KVW A;  5ITR A;  2HL7 A;  2V8Q B;  3K1J A;  1TH3 A;  3EGG A;  4MB7 A;  1OI8 A;  3IVD A;  1O0W A;  3KDS E;  3A98 B;  3ZCB B;  3ZOQ B;  2P5T A;  4B3S E;  3T1Y E;  1QAM A;  4PD2 A;  3SAW A;  2YVT A;  1G41 A;  2C96 A;  3VFD A;  3GVE A;  4RF1 A;  4B3T M;  5INB A;  3U60 B;  1IN4 A;  4KOD A;  3D8B A;  4AG6 A;  2KON A;  2JY9 A;  4KHP M;  4DR4 E;  3LL8 A;  3LQQ A;  1E9S A;  1L1Z A;  3SHF A;  3KSX A;  2ZBM A;  3FYD A;  2KZU A;  3KSJ A;  3J80 S;  1MU5 A;  5CFF E;  1IM2 A;  1NY6 A;  1FKA E;  4XPN A;  3L2A A;  3PXG A;  4LU9 A;  1KSF X;  3F6G A;  1NNU C;  4KKZ A;  4QHT A;  3TWM A;  4DR6 M;  5F3W A;  2USH A;  1SXJ E;  1QZM A;  2ZAO A;  3GLF A;  2JR1 A;  3HKP A;  1J5E M;  3EGH A;  1Z2W A;  2ERC A;  3AJI B;  3T1H M;  2K47 A;  5BR8 E;  2W82 A;  2UXD E;  4NOO B;  2R17 A;  3J80 C;  2DB2 A;  3VK8 A;  4WFT A;  4WWL A;  4LGM A;  1TH2 A;  4LJ9 A;  5B8I A;  2FOI C;  1J09 A;  5AE1 A;  3SAT A;  4KBP A;  1HO5 A;  2LRS A;  4MGI E;  3K7W C;  4DR5 M;  4JI7 M;  3GRV A;  1USH A;  2B7V A;  3DF6 A;  1S3M A;  1IXR C;  2CV1 A;  4Z8X A;  2V6Z M;  2XSZ D;  1Q3B A;  4LF7 E;  2F4V M;  3F6H A;  3HTX A;  1YYW A;  2KRK A;  2M5Z A;  1HNX E;  3KW6 A;  1DGG A;  3KOZ E;  2NYL C;  2YT4 A;  2M7Q A;  1JR3 A;  4V0V A;  3V4Y A;  4LJ7 A;  1HQC A;  1AUI A;  2Z06 A;  3HU3 A;  4DV2 E;  2LUP B;  1R6B X;  1XMQ M;  3HVQ A;  4BC7 A;  3ZH9 B;  2UUC M;  4LF4 M;  4OW0 A;  4JI0 M;  3RFW A;  4D80 A;  4BB9 A;  5KPT A;  3AKZ A;  2L6M A;  3DFZ A;  4L15 A;  3THG A;  2H1R A;  3TGH A;  2VQE E;  2B3T B;  1IN6 A;  5IT9 S;  5EXS A;  1HNZ E;  3TWK A;  3RGS A;  1IBK M;  1N33 M;  2RGH A;  3HJ8 A;  2A22 A;  4G9J A;  5J28 A;  4G4Q A;  3QFO A;  2LH0 A;  3H62 B;  1U32 A;  4QNM A;  2BNK A;  3M6A A;  4X66 M;  3FTD A;  4X64 M;  1JR3 D;  4LFA M;  4IBI A;  3FTC A;  4DV4 M;  1XNQ M;  1J26 A;  1DGH A;  3AV0 A;  4LY6 A;  4GEQ B;  3GLG B;  2XF3 A;  2JWO A;  2NUG A;  4WYQ B;  4Q7F A;  1QAO A;  1Z6T A;  4FCW A;  5KPZ A;  2J7N A;  1HNZ M;  3A45 A;  2UUB M;  4IBC A;  4CIS A;  1DI2 A;  1WHN A;  3RL3 A;  4MGY E;  5C18 A;  7CAT A;  3C9F A;  4KHP E;  4DV1 M;  4GHA A;  2BCD A;  4FD2 A;  3TQS A;  3GQ4 A;  4DV1 E;  4H2B A;  2CUZ A;  3FUX A;  1L2C A;  2E1M A;  1HP1 A;  2LMZ A;  4RF0 A;  3U6M A;  2F4V E;  4DV6 M;  4FCX A;  4LF7 M;  1SR9 A;  4DUY M;  5JI3 E;  3P71 C;  4M9X A;  1XXH A;  4YHH E;  3U6D A;  1DQ3 A;  2Z3X A;  1PKP A;  4L16 A;  1TCO A;  4HLQ A;  2XH9 A;  4GIP A;  4KZS A;  4UT3 A;  5T6J A;  1N34 M;  4YY3 E;  2CHQ A;  3J7A S;  1S3N A;  3VLF B;  2VQF E;  1S95 A;  4LAC C;  2I7P A;  4LGY A;  3MK6 A;  5EP1 A;  5IRE B;  1K3W A;  2C5R A;  2MC5 A;  2UXC E;  1FJG E;  3E7B A;  4MOY A;  5GTU A;  4LF5 M;  4DKK A;  3JAM S;  1XNR E;  1QAQ A;  1Z59 A;  1HR0 E;  4RNA A;  2AHD A;  5EP2 A;  3QFK A;  2WDE A;  4FWD A;  3E4R A;  1ZBT A;  3U6P A;  4R7G A;  5KQD A;  2UUC E;  3SHG B;  4DUY E;  1UF3 A;  3FGA C;  4O4K A;  5JPF A;  5JI2 E;  4AKI A;  1NJF A;  4NSO B;  4LF9 M;  2Z4S A;  4LRS A;  4DR3 M;  2Q8U A;  2Z7J A;  3QWL A;  4B7H A;  1XWI A;  3HPZ A;  5ITX E;  3GRR A;  4JI1 E;  3SYL A;  1HNW E;  4J6O A;  4TUG A;  2X4A A;  1W5S A;  5FLX C;  1II7 A;  2LTS A;  4NXM M;  3ADG A;  4DR5 E;  3FLO A;  4ORC A;  4BBA A;  2MC6 A;  3EIE A;  1KYI A;  4X65 M;  1XM7 A;  1IXS B;  1IXZ A;  2X49 A;  1IQP A;  4BLC A;  3U60 A;  2DXI A;  4MGZ E;  3UZU A;  4AI6 A;  2LE2 A;  4JI5 M;  2LUQ A;  2KRU A;  1GLN A;  4NXN M;  3T1Y M;  2NUF A;  1T70 A;  4FWH A;  1UTE A;  3T1H E;  1QVR A;  4MM3 B;  2K4V A;  2JOG A;  2WDC A;  2CHG A;  1IN5 A;  3PNY A;  5A2Q S;  1XMO M;  1J5E E;  5C1B A;  1R7R A;  1D2N A;  4MH0 E;  4G4R A;  3W0F A;  4DV0 M;  3HHW A;  1XNR M;  3H09 A;  4I8O A;  2L8T A;  4Q28 A;  1WXR A;  4JV5 E;  2XZF A;  3GRU A;  5DYG A;  4NXM E;  4LFB E;  3EIH A;  1GZ6 A;  5DNY A;  3FD9 A;  1L2D A;  2L2M A;  2IE4 C;  4M0V A;  5E26 A;  4ITQ A;  1W5T A;  2Y0Q A;  2F5N A;  2V88 A;  2R46 A;  5E6J A;  2YQZ A;  1YUB A;  1DGH B;  1GL7 A;  4R03 A;  1HNX M;  4F54 A;  2L2K B;  4DR3 E;  4B3T E;  1YYK A;  3VDU A;  2HYP A;  3HU1 A;  3H69 A;  3RL4 A;  2P6B A;  2XFT A;  3K8Z A;  5H37 D;  5EQV A;  5KPR A;  1N36 M;  3AL0 C;  2ZM6 M;  1Z5A A;  3T15 A;  2WDF A;  1GQE A;  4OOG C;  3CK2 A;  1X47 A;  3SMP A;  2Y0T A;  3U6L A;  4UWQ A;  1G59 A;  1DO2 A;  4DSY A;  3FYC A;  3DZD A;  2V87 A;  4H2G A;  2XEP A;  3J81 S;  3SC3 A;  4M9Z A;  2R4J A;  5KO3 A;  3GP1 A;  4LF5 E;  3H64 A;  2OPF A;  1NNW A;  4B3R M;  2E5L M;  3PSN A;  8CAT A;  1DGB A;  5ITQ A;  4DUZ M;  4DV3 M;  3U61 A;  1STU A;  4BCA A;  2O8A A;  2JVA A;  4L8N A;  1WAO 1;  4OU7 A;  4NSR A;  2NA2 A;  3J27 B;  1IN7 A;  3H67 A;  1G3I A;  2JOX A;  4X64 E;  1H6U A;  4GH9 A;  4X66 E;  2FE8 A;  2V86 A;  4ORB A;  3K92 A;  4JXJ A;  2KA6 B;  2C9C A;  2Q2E B;  4B7F A;  1PJI A;  1OID A;  1OJL A;  1SXJ C;  2VQF M;  2DWM A;  2DZO B;  2BJV A;  4ZPX A;  2RS6 A;  3IWC A;  1V73 A;  3ADI A;  4UT3 B;  3TWL A;  3T1I A;  2DXL A;  2KKN A;  1N75 A;  3IG5 A;  3U6Q A;  2DXN A;  1SXJ A;  2DVW B;  1XXH B;  3QAU A;  4LJ5 A;  2N3G A;  1LV7 A;  4P16 A;  3U6O A;  3LVV A;  3FUT A;  1G4A E;  3SBJ A;  1HT2 E;  2QP9 X;  1XMQ E;  2WDD A;  4B3S M;  4AW4 A;  4TUW A;  2L2N A;  2ZBK B;  4LZZ A;  4GC9 A;  3J81 C;  2C98 A;  1NHW C;  3GRY A;  3W0L B;  1N77 A;  4DV4 E;  1I94 E;  1XNQ E;  4KLN A;  4LJ4 A;  2Z1A A;  3GPU A;  4OVZ B;  1NJG A;  3KOY E;  1GL6 A;  2CEA A;  2F5S A;  4JI6 M;  3FIG A;  3HQ1 A;  4M0D A;  3WHL A;  4WW0 A;  1MF8 A;  2GJU A;  3H68 A;  4HD0 A;  4ZVZ A;  4B3M E;  2DWN A;  5LMN E;  1YYO A;  3QFN A;  2LXE A;  1IBK E;  1N33 E;  1N32 E;  4F9A B;  4L78 A;  3KFU G;  2ODR C;  4JI5 E;  2LBS B;  1NSF A;  3RGP A;  4GHL A;  3GLI A;  5JJT A;  3HU2 A;  3GQ3 A;  4L5N C;  4S12 A;  3VKG A;  4P7D A;  2E5L E;  2HHH E;  2IAE C;  1KFV A;  4EIW A;  1X37 A;  3QFM A;  1Z5B A;  3I4Y A;  1PJJ A;  5ADZ A;  1N34 E;  3R8F A;  2L33 A;  3CTW B;  4LRT A;  2VQE M;  2NQ8 C;  3HHY A;  4JYA M;  3JTZ A;  2UXB E;  3I51 A;  3UJN A;  3IWD A;  1T4L B;  3DJW A;  4NRV A;  2OQ4 A;  4LF9 E;  2V1U A;  2R45 A;  3HGI A;  2DSY A;  2ZM6 E;  4BMJ A;  4M2Z A;  2C9O A;  4GKJ E;  5IWA M;  4DMI A;  3E7A A;  4FCV A;  3KS8 A;  3SAV A;  3TE6 A;  2YEQ A;  4LJ8 A;  4BC9 A;  3CF2 A;  4GMQ A;  4DR7 E;  5EXT A;  4FBQ A;  2DIX A;  2BQ8 X;  3SAR A;  1S70 A;  3PVS A;  2Y20 A;  3PNV A;  3KWR A;  1JQJ C;  5FLX S;  3JR4 A;  1TDH A;  2YR0 A;  4LF6 M;  3OML A;  3KP0 E;  3B9P A;  4WSP A;  1IN8 A;  2UXC M;  3GLG A;  3AOE A;  1QYR A;  4OR9 A;  5EXP A;  3FUU A;  1Z5C A;  4PT5 A;  1Q39 A;  3NWL A;  3M7G A;  1X48 A;  4HL4 A;  1N32 M;  4F9B B;  1IBM E;  4GKK E;  3SYK A;  4FVM A;  5LMN M;  1QFC A;  2EO2 A;  2FGG A;  4JI8 M;  4LFC E;  3FTF A;  1GVN A;  4ZX2 A;  4AKH A;  3KXE C;  3LQR A;  4G6Z A;  1N78 A;  2LJH A;  3DA1 A;  3VK6 A;  2QBY B;  4M0W A;  4NXN E;  2F5P A;  2NPP C;  4K0K E;  1RQ0 A;  1S3L A;  1EE8 A;  3U6E A;  1YZ9 A;  5LMU M;  3ZC7 B;  1NNJ A;  2D7H A;  3L25 A;  2F8B A;  2KOU A;  2UU9 E;  2CV9 A;  5C1V A;  4LF4 E;  4NZV A;  5FTM A;  4B08 A;  4JI1 M;  5EJC A;  4OX9 E;  4LZJ A;  3K6Q A;  3TPZ A;  4DR2 E;  2G5G X;  4F0Z A;  4JV5 M;  3KS4 A;  4JA9 A;  1SXJ D;  2CE7 A;  4IJF A;  1JK7 A;  2HY1 A;  4TUI A;  3ADL A;  4R3D A;  4IJE A;  2YZT A;  3ADJ A;  5IOH A;  2RGO A;  3K7V C;  3VDP A;  3R9X B;  2VE7 C;  2M1S A;  2RSM A;  1SU1 A;  5DYI A;  2M60 A;  2V89 A;  4BBY A;  1KBP A;  4IBB A;  1FNN A;  4JI3 M;  3VYY A;  1QQW A;  3GPX A;  3ILK A;  3FKE A;  4GRI A;  5BR8 M;  1T4O A;  2HKJ A;  2JOB A;  1FJG M;  2ZAN A;  3IWB A;  3P1X A;  5AE2 A;  4IBG A;  2L3J A;  1L1T A;  1TGU A;  4WUR A;  4A3V B;  3L29 A;  3LML A;  4BS9 A;  2XLJ A;  3AOE C;  2EUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...