3AV0A

Crystal structure of mre11-rad50 bound to atp s
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
369
structure length
369
Chain Sequence
GSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDNVDIESLNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Recombination
total genus 101
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3av0A03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3av0A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3av0A01
5GTUA 5EQVA 4Q7FA 3H68A 3QFOA 4ORBA 1USHA 3V4YA 1QFCA 1OIDA 1SU1A 1XZWA 1T70A 3H60A 4H1YP 3RL5A 1AUIA 2Q8UA 3N5UA 4ZVZA 3K7WC 1Z2WA 2IAEC 4TUIA 3PSNA 4I5NC 2P6BA 2NYMC 1S3MA 2DFJA 4FBQA 1UTEA 2O8AA 2Z72A 3E7AA 4F0ZA 2IE3C 4H2FA 4UT2A 2Z06A 1NNWA 4HD0A 3ICFA 4V0WA 4V0VA 1IT6A 3P71C 3IVEA 4FBWA 5C1VA 3DSCA 5J28A 3JYFA 1S3NA 4UT3B 1HP1A 1OIEA 4JA9A 2AHDA 3RL4A 4G9JA 1OI8A 2WDEA 3GVEA 1WAO1 1G5BA 3HVQA 4UT3A 3IB7A 3C9FA 3DSDA 4V0XA 2QFPA 4ORCA 2QFRA 3PSOA 2IE4C 4LACC 1U32A 3H61A 3THNA 1FJMA 3DW8C 3QG5C 3LL8A 3QFNA 4H2IA 4MOVA 4XPNA 1TCOA 5JPFA 4YKEA 2QJCA 2GJUA 4TUGA 2WDFA 1MF8A 2NPPC 4ZX2A 4H2BA 5HPEA 1XM7A 2HYOA 2O8GA 1V73A 2Z1AA 1II7A 3C5WC 3IVDA 4LU9A 3H69A 5JPEA 4M0VA 2NYLC 4IL1A 3QFKA 3KBPA 3ZTVA 4O4KA 2BDXA 3H64A 4DT2A 2A22A 3E7BA 1T71A 3EGHA 4ORAA 4KBPA 5JJTA 2HY1A 2ZBMA 2WDDA 4IYPC 2USHA 4O43A 1S8EA 3EGGA 5IOHA 1HO5A 2R17A 3H66A 3CK2A 2JOGA 4B2OA 1S3LA 1W24A 1WARA 1QHWA 2KKNA 2YVTA 3K7VC 4MOYA 4UWQA 4JA7A 3RL3A 4MP0A 3ZU0A 3THOB 5B8IA 2CV9A 4NZVA 4FCXA 3H67A 1S70A 2XMOA 1S95A 4FBKA 4H2GA 3H62B 3FGAC 3AV0A 4LTYA 4O5GA 2WDCA 4WWLA 1KBPA 3H63A 3AUZA 2BQ8X 1Z2XA 4OR9A 4DSYA 3IB8A 4DHLA 4H1SA 4J6OA 3RQZA 5INBA 5DNYA 1HPUA 1M63A 2NXFA 4O24A 2BCDA 4KKZA 5F3WA 3T1IA 3TGHA 4I5LC 3QFMA 2HYPA 1JK7A 1UF3A
chains in the Genus database with same CATH superfamily
1W5SA 4NXNE 3R9XB 5LMUE 1USHA 4G4QA 2GNOA 2EMLA 1MEYC 3HHXA 4LF4E 1IN4A 1IY2A 3DOAA 3A45A 2EOZA 4TUIA 2W82A 3U60B 1WJ7A 4WPYA 2LJHA 4RH8A 3HXLA 2LXEA 3FLOA 3VYYA 4JXJA 2EOJA 4AW4A 3BF2A 1N34E 3UK6A 5LL6R 1HP1A 4OVZB 2EOYA 2DNAA 1XHBA 1Q3CA 4G9JA 1HQYE 2R45A 2EM0A 1WAO1 2DXIA 1UN6B 3DFZA 2C9CA 3BBGA 1JK2A 3FTDA 2XSZA 1E9SA 2YFQA 3U5ZA 5ADZA 4Q28A 2ZAMA 1SXJE 2LNHC 5ITUA 1MJGM 1TR8A 2YTEA 2QSFX 3J2PB 2EOSA 3FUTA 2ZO9B 1VDDA 4YKEA 1JB0F 3AOEA 2EL5A 4R2QA 4F9BB 2NYLC 2V89A 2JZ1A 1TF6A 2KONA 5AC5A 4KBPA 2DZLA 3OTOE 2JY7A 4M9ZA 1WARA 1VEGA 2EN2A 3SAUA 1IN7A 1NJFA 1T4NA 2I9IA 1RQ0A 2HJJA 2OOAA 4DSYA 2APLA 2LT7A 3OTOM 4QNMA 2EE8A 5IWAM 4DV6E 4J6OA 3RQZA 2F5PA 1A1FA 3FIGA 4P16A 4DMIA 4ZPXA 2RPCA 1X37A 1IXSA 1L2DA 3B7ZA 4F9AB 2KOUA 3SATA 5A6JA 2R46A 4DV6M 1AUIA 2IAEC 3E0JA 3ILKA 2JXNA 4PT5A 5ITXE 2DAIA 4BC7A 4JV5M 4K0KE 2M4IA 2HHHE 3T1YM 4LJ6A 5KL4A 4DV0M 4WSPA 2LBSB 3EQ1A 3TWKA 5KQDA 2BJVA 4GKKE 2XSZD 3IVEA 2KW0A 3CF6E 1R6BX 2H5XA 4F9CB 4JI2M 3VLFB 1X48A 2UXCE 2Z7JA 3E46A 4MGKE 4JN6A 1EFUB 1Q02A 1G5BA 3IB7A 4LF8E 1LLMC 4IBFA 3PSOA 3VHTB 3H09A 2EMGA 2H36X 1FJGE 1OFHA 1YSYA 1K3XA 2RGHA 2GJUA 1WGLA 1GZ6A 2YRHA 2L6OA 3GLGB 4XK8F 2EOQA 3H4MA 1XM7A 3RGPA 1MN3A 2DLKA 2V6ZM 2L7IA 4G3OA 2YSPA 2CV2A 3J80S 4FK5C 3Q8GA 2UU9E 4QHTA 1QYRA 2PRTA 2KKNA 3FTCA 4Y28F 3K7VC 1A5TA 3L2AA 4DV2E 2M7QA 4KODA 3H67A 2DVWB 4LTYA 4LJ4A 4GKJE 2EPCA 4P17A 3F6GA 1QNTA 1GKIA 1SG9A 1IBLE 5INBA 1MU5A 1OAOC 1IQSA 3VK6A 5HPEA 5A6KA 2YNMD 3FRHA 4RNAA 1L8QA 1G71A 2NUGA 3J81C 1IBLM 4FWDA 4BB9A 4NXME 3HU2A 4MLQA 2WCC3 2RSIA 3HJ8A 2EN7A 2XFTA 4AG6A 4DR6M 2EQ3A 4JI6E 2YSOA 4A3VB 2F5QA 3E7AA 2YTIA 3VKHA 4J8ZA 3SARA 3P71C 2LVQD 1Q3BA 4JI6M 5J28A 1IBME 2KNZA 4WW0A 1XNRE 2EMIA 3KP0E 1DGHB 1PJTA 4IBEA 1ZBTA 2UXDE 4UT3A 4JI7E 3K6QA 3J7AG 1IBMM 2IE4C 3T6PA 4DR5E 2NABA 4LF6M 1IM2A 2HGHA 2L7HA 4F1IA 1STUA 2KRUA 1OAIA 5DYIA 1AH5A 2JZ0A 4DKKA 3V76A 4IBIA 2MH8A 1RC7A 2R44A 5EXTA 3GLGE 2JVAA 1KSFX 4ORAA 4NL4H 1NY6A 4XGIA 1OTRA 1T4OA 1T38A 1Z5CA 2UUCE 4LFBM 1UHZA 5KPTA 1NCSA 1YYWA 2CV9A 1OFIA 4WWLA 1IBKE 1Z2XA 1Z6TA 3TE6A 2EMFA 1WJPA 4X62E 3GQ4A 2UUCM 2M1SA 5DNYA 1QZEA 2VF7A 5GKNA 2LVAA 5KL6A 4DR4E 2EA0A 1Y8GA 4BS9A 2CTDA 4ORBA 4X62M 3VYXA 4DR1E 2JY6B 3RFWA 3HWSA 3K9PA 3M99B 4F6NA 1DQ3A 1L2CA 2X4AA 3GPYA 2V8QB 1N77A 2B3TB 3DA1A 2AHMA 1QAMA 1AUAA 3GRYA 4G4NA 2EPAA 5C1VA 4DV1E 2D7EA 4BC9A 3SAWA 3KDSE 2EMBA 3GVEA 1C1KA 3HX3A 1NV8A 4LJ5A 3C9FA 4JI1E 3DSDA 3EPKA 2QFRA 1R4GA 3HJQA 2DZOB 3PVSA 3U6DA 2JOBA 1QAOA 2YRMA 1J5EM 3C3DA 4JI4M 1HNWE 1XXHB 4QOSA 3UK3C 2CRUA 2EN3A 1ORYB 2HYOA 4JI3M 1YUJA 2LTRA 3LQQA 1F4IA 4LFAE 2B7TA 4B3SM 1KYQA 1HNWM 4R2DA 1EE8A 4GHAA 3IECA 3ECRA 1G3IA 2GPIA 2CV1A 3BGHA 4KHPE 4MOYA 4ZYEA 1VG5A 2FV4B 4P78A 4FCXA 2E1MA 3EPLA 1S70A 4LF9M 4LFAM 3BXWA 2CHQA 2EMHA 2K6BA 2L4FA 3L00A 4KHPM 4GMQA 2YQZA 1KJKA 1HPUA 1H6UA 1UILA 1XNQM 1JR3A 1N32E 2JWOA 3IWBA 4R8OA 2O01F 5TSEA 3VDUA 4JI0E 2C5RA 1XC8A 1OKSA 2YU5A 2Y0QA 2EMXA 4MGHA 1NY5A 2V85A 4H2FA 2KZSA 3E9SA 4JI0M 2MROB 3W0FA 2DWZB 5EXPA 1K82A 1ZMWA 3JYFA 3K2LA 2VQEM 1DO0A 2WSFF 3RL4A 2EOIA 4X65E 2F4VM 2K47A 2DAKA 4F6MA 4Q35B 2F5SA 5EXSA 1TH2A 1SXJA 2ENCA 2EQ1A 1EIJA 2X8AA 2ENHA 5JPFA 2E72A 4OX9M 3SYLA 4F54A 5BR8E 4AQYM 4DBGB 4YHHM 4WXCA 5LMNE 4M9SA 2M9AA 1V92A 2HAKA 1SXJB 1NEIA 4DT2A 4JYAM 1GABA 3EGHA 1A1GA 4GZNC 2J7OA 5CFFE 1NNJA 2F8BA 1G4AE 1D0LA 2EMYA 2Q2EB 2E5LE 3HQ1A 5C18A 2LVHA 2ZANA 2O25A 2ZTCA 2WDCA 3TWMA 3AUZA 1IQOA 4B7FA 2N3GA 2EP3A 2Y0TA 4B3TE 2WZJA 3FUXA 2LO3A 2LV2A 1QVRA 4IBBA 4CJ6A 1NHWC 2I7PA 4Z6YA 1HQCA 4X8WA 2ZTDA 2CHGA 4MGIE 2WZOA 5IV8B 3W68A 1XZWA 1GVNA 3CF2A 3MSWA 1YSAC 2EM9A 5ITXA 3IG8A 4IIWA 1LTMA 4AKGA 3I04M 3E21A 3U60A 2DGCA 3B7NA 2LH0A 1X6EA 1N33M 4HLQA 4V0VA 1WIVA 3SAVA 2YR0A 3I4VA 5AC4A 5EP4A 4S12A 2XZFA 3ZC7B 2WDEA 2DI0A 4P7DA 2EMZA 3A42A 4OVZA 3AOEC 4V0XA 4ORCA 5C1BA 4R2AA 4M0WA 4LY6A 1RU3A 3DZDA 3LCUA 4CHTB 4M9XA 4N4RB 4IBGA 3SASA 3FUVA 1TDHA 4L6V6 3FTFA 4DUZE 2CEAA 4I8OA 1V33A 2NPPC 1QDTA 4LJAA 1T3TA 2D7HA 4NSOB 4LU9A 3M7GA 3AOGA 2H1RA 1GQEA 4R2SA 2FFJA 4HL4A 2JYAA 1D0MA 2ERCA 2L3JA 2KHHA 2G8LA 4DUZM 2JWSA 2DXNA 2ZBMA 3EGGA 5IOHA 2WBTA 4UWQA 3A98B 3GLFB 4LGMA 1HNZM 1S95A 1T43A 2QBYB 2UXBM 1YLAA 4MM3B 3HKPA 5A2QC 1IFYA 2EMAA 1M63A 4I5LC 2WSCF 3AKZA 2Y20A 1YZ9A 1YPNA 4JI5M 5IWAE 3V4YA 2LE2A 1I94M 1X47A 1IN6A 1BBGA 2P6BA 3HHZA 3T1HM 1G41A 4QNRA 1HR0M 3EPHA 4ZYGA 2CUZA 1NNWA 3AFHA 1DV0A 2R4JA 2EPNA 4LFCE 4JV5E 3T1YE 2RRUA 4JA9A 3ADIA 4DV7M 4DV0E 2AHDA 1TF3A 1G8PA 1RMDA 2VRDA 3ADJA 4JI2E 4LFCM 3H61A 3THNA 2ELZA 2K0BX 1TCOA 3UMMA 4L8RC 5EJCA 2MKNA 1EKZA 3SBJA 3VK7A 1II7A 4GHLA 2BNKA 5ITQA 3MMPA 3GLGA 5IT9C 1P3QQ 3M6AA 3H4JA 3GQ3A 2WDDA 2USHA 4FVMA 1QHWA 2GLIA 3B7QA 4HTGA 1BVSA 1ZBQA 1GJSA 2LWXA 3IB8A 2CHVA 2D7GA 8CATA 1OIPA 1EH7A 3GLFE 2RS6A 4UN2B 2EM2A 4R2CA 1FNNA 2BCDA 3AJIB 4KKZA 2R62A 1UFZA 4QHSA 3A46A 2YEQA 4FW9A 1UF3A 3Q8XA 2EORA 3C4TA 5EQVA 4Q7FA 2EOFA 1QFCA 1WHNA 1XB2B 4WXDA 3KS4A 1N75A 2OO9A 3C9PA 2VQFM 5DFLA 3IWDA 4KT0F 1S3MA 1WHCA 3THGA 5AE2A 2O8AA 2HCBA 2MGWA 2J7JA 1IY1A 3KXEC 4ITQA 5L8RF 4DV5M 3RGSA 4DR6E 2MDRA 1AIPC 2EPRA 3DJWA 1E32A 4LZJA 3VDPA 2UUBM 1PDAA 1TDZA 3NBIA 4CIZA 2CP8A 1ZMUA 5IREB 2XFSA 1DGHA 2FOIC 1U32A 1D2NA 4H2IA 1QUTA 2XZUA 3GP1A 2QJCA 2ZM6M 2RGOA 4GEQB 5KL3A 1WXRA 3GLIE 4HEOA 2B9DA 1ZMVA 4X66M 3HZJA 4LF6E 4WYQB 3FYCA 1J7KA 4W5WA 1MGTA 1BBOA 2ZAOA 2D9HA 2DSYA 3F92A 1T39A 3E7BA 3HTXA 2HY1A 4DR3M 5A2QS 4LF5M 4L78A 3KS8A 5KO3A 1SFEA 2RSMA 2JOGA 1S3LA 1J09A 3J7AS 4AI6A 3KZYA 2DIXA 1LV7A 3FYDA 4AZFA 3J7BA 3HHYA 3CF0A 3K9OA 2N35A 4LFBE 4R3DA 4R2EA 4GC5A 4OW0A 1X3CA 1YUIA 3K1JA 4NRVA 2EM3A 2OQ4A 1SU1A 2L2KB 4ZVZA 1PRBA 4IJFA 3K7WC 2EPXA 3EIHA 5DYGA 1XMOM 4L16A 4IJDA 3SYKA 5EXXA 2DFJA 2L2NA 1YYOA 4FBQA 1QU6A 2JR1A 1DGCA 4X64M 1HT1E 2EPPA 2V88A 2B3TA 3KSJA 2FNAA 3HJSA 1VEKA 1NHGC 4DV3E 5A6BA 5BPVA 2GHFA 1IQPA 3MHHC 3ZOQB 3TQSA 1GO5A 2JXPA 2GQFA 3JR4A 1D0KA 2KNVA 4DV3M 3U6CA 5IT9S 2KXEA 2V1CA 3QG5C 5EP1A 2EOOA 1R5LA 3U61B 4ZYHA 2OPFA 4ZX2A 2R65A 1IXRC 1N36M 2EN6A 4DV4M 2V1UA 2O8GA 4BBYA 3IVDA 2P5TA 1QUSA 1G2FC 4IBJA 2BB8A 4IJEA 2MKDA 1XXHA 2BDXA 3F6HA 1J5EE 4JI4E 2DMYA 4NSRA 1T71A 4JI3E 3JAMC 1NVMA 1OIZA 3KOZE 2QZ4A 4YY3M 3SMPA 2FGGA 4LRSA 3FKEA 2YRKA 2EOEA 3ZU0A 4WP2A 4B3SE 5IZ7D 3C3EA 4BHCA 4AKIA 2BQ8X 1FKAE 5FLXC 2L2MA 3PNYA 2DKLA 4BLCA 4PD2A 4RF1A 3W0LB 2DHRA 2KRKA 2YTNA 1YUBA 3SMSA 3GLHE 2Z3XA 4LF9E 3LVWA 2G3QA 4NHRA 4O43A 3PXGA 1JQJC 4LJ7A 2DWLA 2FS1A 2L33A 2V87A 2EPOA 3RL5A 2JP9A 1XNQE 1N3GA 1GL6A 1XMQE 3J81S 1B69A 4FD2A 2QHOB 2LHCA 2Z72A 2L8TA 2L92A 2EL6A 2DAMA 2Z06A 4IS1C 4RF0A 2LRSA 1IT6A 2RKOA 1XMQM 2BJWA 1X6HA 1SXJC 4IBDA 2EM7A 1NJGA 1I4WA 1YFHA 1A1IA 3PFIA 2VQEE 5T6JA 1ZU1A 2UUAM 2LBCA 3DW8C 2EN1A 2F4VE 2NUEA 2EKKA 4ANRA 2KZUA 2ADRA 2ODRC 2EM5A 5AASA 1PJSA 4F2JC 4OX9E 3KWRA 4AQYE 1KFVA 4YHHE 1S8EA 3VKGA 2EOMA 3L27A 4JYAE 4LGYA 1X49A 2LTSA 4OR9A 1N78A 2JP7A 5ITTA 1C7YA 4BMJA 5KL7A 4R03A 2HYPA 3LMLA 4CISA 2A25A 5ITYA 4JI8M 1DGGA 4H1YP 1JR3D 1HT2E 1OIDA 3E4RA 1GL7A 2KNAA 2ZBKB 2EM8A 2WSEF 2EJ4A 1Z1BA 1HNXM 1YYKA 2EPUA 2EN8A 2I7NA 2LMZA 4UT2A 4HD0A 3ICFA 3KP1E 2LTUA 4TUWA 3OMLA 2ELYA 1A1HA 3KOXE 1WHQA 1A1KA 1OI8A 1N33E 4M30A 1WGNA 1IMUA 5KQ8A 1YE9A 4DUYE 3T15A 3W67A 3C58A 4BBAA 1IY0A 2M5ZA 4DR2M 1GJTA 2R0IA 2VF8A 3JAMS 3D8LA 4R7GA 4TUGA 2WDFA 4DUYM 1SXJD 4H2BA 3VK8A 2EUCA 3KOWE 2QP9X 3J80C 1UM8A 3KBPA 3GRRA 2L6MA 4B7GA 2CPNA 5FLXS 2V83A 2A22A 3NWLA 1S3SA 3C6KA 4LRTA 4D82A 3GRUA 2JOXA 1ZAEA 2ODRD 2F5NA 3SFZA 4FCTA 4L15A 4MP0A 5FTNA 2FH0A 3THOB 5JI3E 3GPUA 3FE3A 2R1FA 3D03A 4LF7M 3FGAC 2BWEA 2YTPA 3FRIA 5KPRA 2MC5A 3GLFA 3SC3A 4NXNM 2DLQA 5LMUM 2QBYA 1HNZE 3L25A 4Z8XA 4LF4M 4O24A 2NXFA 5F3WA 2UXBE 5A69A 4QOZC 2KHXA 3QWLA 5FTMA 4PDGA 3I51A 2JY9A 4JI5E 4I4LA 4CGYB 1KYIA 2EPMX 1N34M 2EL4A 4GEWA 3BIDA 3I01M 1I94E 2LVPC 2HL7A 3HY5A 1X5WA 3T38A 2YTFA 4HEIA 2G5GX 3T1HE 1R2ZA 1HR0E 1NV9A 3KZZA 5EP2A 3U5ZB 1X6FA 4MH0E 4I81A 1L1ZA 4EIWA 2YTQA 1ZAAC 4MLVA 4DV7E 1VQ1A 3LL8A 4KLNA 2DAEA 1DI2A 4B3RE 2NQ8C 4L8NA 3GLIA 3KSXA 1G2DC 4M9VC 2EOHA 3ZTVA 3GO8A 1R7RA 3LMMA 4DR7E 4XBOA 4D81A 4B3RM 3ADGA 5JJTA 3IG5A 3L26A 4NC6A 3QAUA 3TQMA 3GLIB 4BHBA 2R18A 4BCAA 1QQWA 2JA2A 2EMCA 1W24A 2CWBA 3LVVA 1E9RA 1E94E 2QQ8A 2EN4A 4DR7M 2XMOA 1QAQA 4H2GA 3H62B 5FTLA 4O5GA 1PJJA 2EM6A 1OJLA 4WURA 2Z4SA 4WFTA 3SHFA 2N3HA 4L5NC 1IXSB 2JPAA 5AE1A 3TGHA 2JY5A 3QFMA 2DXLA 5GTUA 1TF0B 2LVOC 2L4EA 3IHPA 3QFOA 4K0KM 2HHHM 4R71A 2EWLA 3IWCA 2XGNA 4II7A 3N5UA 2DMIA 1WXQA 3MHSC 2EM4A 4GKKM 2LHGA 1TN9A 4IBCA 5LLQA 2Z4RA 2O5RA 2NUFA 4WSGA 2UXCM 1EH6A 1O0WA 2VQFE 1IN8A 2FTXB 2LUPB 4LF8M 1OQYA 4B7HA 1OIEA 1FJGM 2X49A 4DV5E 2XH9A 2VDBB 4I5SA 1TGUA 4KWYA 1VDLA 2MDGA 4LACC 3FD9A 2IHR1 1FJMA 2UUBE 3GQ5A 2RTXA 4FCVA 1Z59A 4M0DA 1MF8A 3EPJA 2MJ5B 1TH3A 5JPEA 2UU9M 1VEJA 2EMKA 2G7HA 2M60A 4FWHA 2ZM6E 3TL4X 2K7IA 1PJQA 3U6SA 2KDLA 4DV2M 4F2LA 4IYPC 4X66E 1HO5A 4GKJM 4MB7A 2NA2A 4WX9A 2LUQA 4JA7A 5B8IA 1IXZA 4MGYE 4DR3E 4KZSA 3ADLA 4LF5E 3HPSA 4GIPA 2FE8A 3GLHA 2JY8A 2JNHA 2EJSA 2F5OA 4NXMM 5FSWA 2MC6A 3L28A 2CV0A 1F2IG 3RE8A 3GRVA 1G59A 4FCWA 3H68A 3RMPA 3H60A 1Z5AA 3WHLA 4ZYDA 2N8XA 1Z2WA 1K3WA 2YZTA 2KA6B 2WBSA 3BOSA 3GLHB 4I5NC 4OU7A 2WBUA 2L09A 2EKFA 3DF6A 3BBZA 5EQTA 3M0EA 2L2DA 2KEBA 1XNRM 2YU8A 2R4EA 1XWIA 3MHVC 2QPAA 1TH4A 3LW5F 1XMOE 4V0WA 2VF1A 1QZMA 3DSCA 5ITRA 4G4OA 2UXDM 4JI7M 2VE7C 4UT3B 3U6EA 4DR5M 4X64E 5FTKA 3HU1A 2C99A 2CE7A 2QCUA 2LJUA 3HVQA 3HPZA 2RQLA 1TTEA 2V86A 1NSFA 1A1LA 4OOGC 4MOVA 2CFOA 2HC5A 2YTJA 3C6MA 2EPLX 3D8BA 1PGYA 1EH8A 3C5WC 2DB2A 3U61A 3H69A 1ZR9A 4B3ME 4LG2A 3ZH9B 3U6QA 2DWNA 1N36E 5FTJA 3K92A 1A1JA 4DV4E 1J26A 1IBKM 1NO1A 3H66A 3QYEA 4B3MM 3RL3A 2XLJA 1T6OA 4NZVA 2DWMA 2EMWA 1DGBA 2J7NA 4Q7JA 5KPZA 2C9OA 4NRWA 3HU3A 3H63A 2CT1A 3FUWA 4YY3E 4AG5A 4L4UA 4DR4M 1PM5A 1SR9A 3U6OA 4DR1M 1DGFA 3U6MA 1HJPA 1JK7A 3HGIA 1IN5A 2YPNA 4PDIA 2BWBA 1T70A 1WR1B 1PJIA 2LVNC 4DV1M 3SHGB 3KFUG 2NYMC 3UJNA 3KOYE 2CSHA 1UTEA 4LJ8A 3B89A 4FBWA 2ZOAA 4B08A 3U6LA 4JI1M 1ZQ9A 1WRJA 3VFDA 2EOXA 4FWGA 5E26A 1L4SA 2A5YB 5A6BD 2QFPA 3P1XA 1NNUC 3FUUA 4NOOB 2EPZA 3UGJA 4GC9A 4KO8A 4XPNA 3KVWA 2YT4A 4PCZA 2EPKX 2QENA 2DZNB 2UUAE 5EP3A 4LCBA 3ZCBB 2Z1AA 3PNVA 1ZV1A 4IL1A 2XF3A 3MK6A 4R2PA 3JTZA 3WHKA 4O4KA 3H64A 2ENAA 1T4LB 2DENA 3J27B 5JI2E 1Q39A 2YVTA 2EQ0A 3U6PA 4FBKA 3KW6A 1KBPA 1N32M 4GH9A 4D80A 4DHLA 2Z8YM 3B74A 4RKUF 1R2YA 4H1SA 3JU0A 2EZ6A 2YTGA 2J5YA 4G6ZA 3GPPA 2K9DA 2DAGA 1DO2A 3TWLA 2QNJA 3NBXX 2DHYA 2Q8UA 2YTDA 3PSNA 5H37D 4X9JA 4JI8E 3LQRA 4REZA 3I4YA 4MGZE 3UZUA 4G4RA 4F0ZA 2MR9A 2DRPA 2IE3C 3GPXA 3LLHA 3K8ZA 3MJ5A 4X65M 4IBKA 3EIEA 2YWQA 2I13A 2HWJA 1MX0A 1UBDC 3FTEA 1S3NA 5IXMB 1HNXE 4GRIA 1BB8A 3L29A 2Y21A 3JR5A 1XXHE 1L2BA 4M2ZA 3AL0C 5KL2A 2C96A 4LZZA 5BR8M 1L1TA 5LMNM 1QDRA 3QFNA 1V34A 1CUKA 3QYBA 4R2RA 2K4VA 5AE3A 7CATA 1P47A 2BBGA 1GTKA 3HHWA 4AKHA 2B7VA 4DR2E 3C4BA 1V73A 1JK1A 4M0VA 1W5TA 1QANA 2YTOA 5KL5A 3QFKA 3TPZA 3LCVB 2EO2A 3CGWA 2RS7A 3B9PA 2E5LM 3ZQJA 1GLNA 2L3CA 2LCEA 3CTWB 4RHBB 3J7Yp 2R76A 1AAYA 2R6FA 2XEPA 2VIIA 2R17A 3CK2A 4B2OA 4B3TM 1Z5BA 5E6JA 3AV0A 2JUJA 2OOBA 1PKPA 2HKJA 3R8FA 4LF7E 4LJ9A 3T1IA 5A6AA 2C98A 1JR3E 4GITA
chains in the Genus database with same CATH topology
1W5SA 4NXNE 3R9XB 5LMUE 1USHA 4G4QA 3HHXA 4LF4E 1IN4A 1IY2A 3DOAA 3A45A 4TUIA 2W82A 3U60B 4WPYA 2LJHA 3HXLA 2LXEA 3FLOA 3VYYA 4JXJA 4AW4A 1N34E 3UK6A 5LL6R 1HP1A 4OVZB 1XHBA 1Q3CA 4G9JA 1HQYE 2R45A 1WAO1 2DXIA 3DFZA 2C9CA 3FTDA 2XSZA 1E9SA 2YFQA 3U5ZA 5ADZA 4Q28A 2ZAMA 1SXJE 2LNHC 5ITUA 3J2PB 3FUTA 2ZO9B 1VDDA 4YKEA 3AOEA 4F9BB 2NYLC 2V89A 2KONA 4KBPA 3OTOE 4M9ZA 1WARA 3SAUA 1IN7A 1NJFA 1T4NA 1RQ0A 4DSYA 3OTOM 4QNMA 5IWAM 4DV6E 4J6OA 3RQZA 2F5PA 3FIGA 4P16A 4DMIA 4ZPXA 1X37A 1L2DA 4F9AB 2KOUA 3SATA 2R46A 4DV6M 1AUIA 2IAEC 3E0JA 3ILKA 4PT5A 5ITXE 4BC7A 4JV5M 4K0KE 2M4IA 2HHHE 3T1YM 4LJ6A 4DV0M 4WSPA 2LBSB 3TWKA 5KQDA 2BJVA 4GKKE 2XSZD 3IVEA 2KW0A 3CF6E 1R6BX 4F9CB 4JI2M 3VLFB 1X48A 2UXCE 2Z7JA 4MGKE 4JN6A 1G5BA 3IB7A 4LF8E 4IBFA 3PSOA 3H09A 1FJGE 2H36X 1OFHA 1YSYA 1K3XA 2RGHA 2GJUA 1GZ6A 2L6OA 3GLGB 3H4MA 1XM7A 3RGPA 2V6ZM 2L7IA 2CV2A 3J80S 2UU9E 4QHTA 1QYRA 2KKNA 3FTCA 3K7VC 3L2AA 4DV2E 2M7QA 4KODA 3H67A 2DVWB 4LTYA 4LJ4A 4GKJE 3F6GA 1GKIA 1IBLE 5INBA 1MU5A 3VK6A 5HPEA 2YNMD 4RNAA 1L8QA 2NUGA 3J81C 1IBLM 4FWDA 4BB9A 4NXME 3HU2A 3HJ8A 2XFTA 4AG6A 4DR6M 4JI6E 4A3VB 2F5QA 3E7AA 3VKHA 4J8ZA 3SARA 3P71C 1Q3BA 4JI6M 5J28A 1IBME 4WW0A 1XNRE 3KP0E 1DGHB 4IBEA 1ZBTA 2UXDE 4UT3A 4JI7E 3K6QA 3J7AG 1IBMM 2IE4C 4DR5E 4LF6M 1IM2A 2L7HA 1STUA 2KRUA 5DYIA 4DKKA 4IBIA 1RC7A 5EXTA 2JVAA 1KSFX 4ORAA 4NL4H 1NY6A 4XGIA 1T4OA 1Z5CA 2UUCE 4LFBM 1UHZA 5KPTA 1YYWA 2CV9A 1OFIA 4WWLA 1IBKE 1Z2XA 1Z6TA 3TE6A 4X62E 3GQ4A 2UUCM 2M1SA 5DNYA 5GKNA 4DR4E 2EA0A 4BS9A 4ORBA 4X62M 3VYXA 4DR1E 3RFWA 3HWSA 1DQ3A 1L2CA 2X4AA 3GPYA 2V8QB 1N77A 2B3TB 3DA1A 2AHMA 1QAMA 3GRYA 4G4NA 5C1VA 4DV1E 2D7EA 4BC9A 3SAWA 3KDSE 3GVEA 1C1KA 4LJ5A 3C9FA 4JI1E 3DSDA 2QFRA 3HJQA 2DZOB 3PVSA 3U6DA 2JOBA 1QAOA 1J5EM 4JI4M 1HNWE 1XXHB 4QOSA 1ORYB 2HYOA 4JI3M 2LTRA 3LQQA 4LFAE 2B7TA 4B3SM 1HNWM 1EE8A 4GHAA 1G3IA 2CV1A 4KHPE 4MOYA 2FV4B 4P78A 4FCXA 2E1MA 1S70A 4LF9M 4LFAM 2CHQA 4KHPM 4GMQA 2YQZA 1HPUA 1H6UA 1UILA 1XNQM 1JR3A 1N32E 2JWOA 3IWBA 4R8OA 3VDUA 4JI0E 2C5RA 1XC8A 2Y0QA 4MGHA 1NY5A 2V85A 4H2FA 2KZSA 3E9SA 4JI0M 3W0FA 2DWZB 5EXPA 1K82A 3JYFA 3K2LA 2VQEM 1DO0A 3RL4A 4X65E 2F4VM 2K47A 2F5SA 5EXSA 1TH2A 1SXJA 2X8AA 5JPFA 4OX9M 3SYLA 4F54A 5BR8E 4AQYM 4YHHM 5LMNE 4M9SA 1SXJB 4DT2A 4JYAM 3EGHA 2J7OA 5CFFE 1NNJA 2F8BA 1G4AE 2Q2EB 2E5LE 3HQ1A 5C18A 2ZANA 2WDCA 3TWMA 3AUZA 4B7FA 2N3GA 2Y0TA 4B3TE 3FUXA 1QVRA 4IBBA 1NHWC 2I7PA 4Z6YA 1HQCA 4X8WA 2CHGA 4MGIE 2WZOA 1XZWA 1GVNA 3CF2A 3MSWA 5ITXA 3IG8A 4IIWA 4AKGA 3U60A 2LH0A 1N33M 4HLQA 4V0VA 3SAVA 2YR0A 3I4VA 5EP4A 4S12A 2XZFA 3ZC7B 2WDEA 4P7DA 3A42A 4OVZA 3AOEC 4V0XA 4ORCA 5C1BA 4M0WA 4LY6A 3DZDA 4CHTB 4M9XA 4IBGA 3SASA 3FUVA 1TDHA 3FTFA 4DUZE 2CEAA 4I8OA 2NPPC 4LJAA 1T3TA 2D7HA 4NSOB 4LU9A 3M7GA 3AOGA 2H1RA 1GQEA 2FFJA 4HL4A 2ERCA 2L3JA 2G8LA 4DUZM 2DXNA 2ZBMA 3EGGA 5IOHA 4UWQA 3A98B 3GLFB 4LGMA 1HNZM 1S95A 2QBYB 2UXBM 4MM3B 3HKPA 5A2QC 1M63A 4I5LC 3AKZA 2Y20A 1YZ9A 4JI5M 5IWAE 3V4YA 2LE2A 1I94M 1X47A 1IN6A 2P6BA 3HHZA 3T1HM 1G41A 4QNRA 1HR0M 2CUZA 1NNWA 3AFHA 2R4JA 4LFCE 4JV5E 3T1YE 4JA9A 3ADIA 4DV7M 4DV0E 2AHDA 1G8PA 3ADJA 4JI2E 4LFCM 3H61A 3THNA 1TCOA 3UMMA 4L8RC 5EJCA 1EKZA 3SBJA 3VK7A 1II7A 4GHLA 2BNKA 5ITQA 3GLGA 5IT9C 3M6AA 3GQ3A 2WDDA 2USHA 4FVMA 1QHWA 1ZBQA 2LWXA 3IB8A 2CHVA 2D7GA 8CATA 2RS6A 1FNNA 2BCDA 3AJIB 4KKZA 2R62A 4QHSA 3A46A 2YEQA 4FW9A 1UF3A 3Q8XA 3C4TA 5EQVA 4Q7FA 1QFCA 1WHNA 3KS4A 1N75A 2VQFM 3IWDA 1S3MA 3THGA 5AE2A 2O8AA 2HCBA 1IY1A 3KXEC 4ITQA 4DV5M 3RGSA 4DR6E 2MDRA 3DJWA 1E32A 4LZJA 3VDPA 2UUBM 1TDZA 3NBIA 5IREB 2XFSA 1DGHA 2FOIC 1U32A 1D2NA 4H2IA 2XZUA 3GP1A 2QJCA 2ZM6M 2RGOA 4GEQB 1WXRA 2B9DA 4X66M 4LF6E 4WYQB 3FYCA 1J7KA 4W5WA 2ZAOA 2DSYA 3E7BA 3HTXA 2HY1A 4DR3M 5A2QS 4LF5M 4L78A 3KS8A 5KO3A 2RSMA 2JOGA 1S3LA 1J09A 3J7AS 4AI6A 2DIXA 1LV7A 3FYDA 4AZFA 3J7BA 3HHYA 3CF0A 4LFBE 4R3DA 4GC5A 4OW0A 3K1JA 4NRVA 2OQ4A 1SU1A 2L2KB 4ZVZA 3K7WC 4IJFA 3EIHA 5DYGA 1XMOM 4L16A 3SYKA 5EXXA 2DFJA 2L2NA 1YYOA 4FBQA 1QU6A 2JR1A 4X64M 1HT1E 2V88A 3KSJA 2FNAA 3HJSA 1NHGC 4DV3E 5BPVA 1IQPA 3ZOQB 3TQSA 3JR4A 4DV3M 3U6CA 5IT9S 2KXEA 2V1CA 3QG5C 5EP1A 3U61B 2OPFA 4ZX2A 2R65A 1IXRC 1N36M 4DV4M 2V1UA 2O8GA 4BBYA 3IVDA 2P5TA 4IBJA 4IJEA 1XXHA 2BDXA 3F6HA 1J5EE 4JI4E 2DMYA 4NSRA 1T71A 4JI3E 3JAMC 1NVMA 3KOZE 2QZ4A 4YY3M 3SMPA 2FGGA 4LRSA 3FKEA 3ZU0A 4B3SE 5IZ7D 4AKIA 2BQ8X 1FKAE 5FLXC 2L2MA 3PNYA 4BLCA 4PD2A 4RF1A 3W0LB 2DHRA 2KRKA 1YUBA 3SMSA 2Z3XA 4LF9E 3LVWA 4O43A 3PXGA 1JQJC 4LJ7A 2DWLA 2L33A 2V87A 3RL5A 1XNQE 1GL6A 1XMQE 3J81S 4FD2A 2Z72A 2L8TA 2L92A 2Z06A 4RF0A 2LRSA 1IT6A 2RKOA 1XMQM 2BJWA 1SXJC 4IBDA 1NJGA 1I4WA 3PFIA 2VQEE 5T6JA 2UUAM 3DW8C 2F4VE 2NUEA 2KZUA 2ODRC 5AASA 4OX9E 3KWRA 4AQYE 1KFVA 4YHHE 1S8EA 3VKGA 3L27A 4JYAE 4LGYA 1X49A 2LTSA 4OR9A 1N78A 5ITTA 4BMJA 4R03A 2HYPA 3LMLA 4CISA 5ITYA 4JI8M 1DGGA 4H1YP 1JR3D 1HT2E 1OIDA 3E4RA 1GL7A 2ZBKB 1HNXM 1YYKA 2I7NA 2LMZA 4UT2A 4HD0A 3ICFA 3KP1E 4TUWA 3OMLA 3KOXE 1WHQA 1OI8A 1N33E 4M30A 5KQ8A 1YE9A 4DUYE 3T15A 3C58A 4BBAA 1IY0A 2M5ZA 4DR2M 3JAMS 3D8LA 4R7GA 4TUGA 2WDFA 4DUYM 1SXJD 4H2BA 3VK8A 2EUCA 3KOWE 2QP9X 3KBPA 1UM8A 3J80C 3GRRA 2L6MA 4B7GA 2CPNA 5FLXS 2V83A 2A22A 3NWLA 1S3SA 4LRTA 4D82A 3GRUA 2JOXA 1ZAEA 2ODRD 2F5NA 3SFZA 4FCTA 4L15A 4MP0A 5FTNA 3THOB 5JI3E 3GPUA 3D03A 4LF7M 3FGAC 5KPRA 2MC5A 3GLFA 3SC3A 4NXNM 5LMUM 2QBYA 1HNZE 3L25A 4Z8XA 4LF4M 2NXFA 4O24A 5F3WA 2UXBE 4QOZC 2KHXA 3QWLA 5FTMA 4PDGA 3I51A 2JY9A 4JI5E 4I4LA 4CGYB 1KYIA 1N34M 1I94E 2HL7A 3T38A 2G5GX 3T1HE 1R2ZA 1HR0E 5EP2A 3U5ZB 4MH0E 4I81A 1L1ZA 4EIWA 4DV7E 3LL8A 4KLNA 1DI2A 4B3RE 2NQ8C 4L8NA 3GLIA 3KSXA 3ZTVA 3GO8A 1R7RA 3LMMA 4DR7E 4XBOA 4D81A 4B3RM 3ADGA 5JJTA 3IG5A 3L26A 3QAUA 3GLIB 2R18A 4BCAA 1QQWA 2JA2A 1W24A 3LVVA 1E9RA 1E94E 4DR7M 2XMOA 1QAQA 4H2GA 3H62B 5FTLA 4O5GA 1PJJA 1OJLA 4WURA 2Z4SA 4WFTA 3SHFA 2N3HA 4L5NC 1IXSB 5AE1A 3TGHA 3QFMA 2DXLA 5GTUA 3QFOA 4K0KM 2HHHM 2EWLA 3IWCA 2XGNA 4II7A 3N5UA 1WXQA 4GKKM 4IBCA 2Z4RA 2O5RA 2NUFA 2UXCM 1O0WA 2VQFE 1IN8A 2FTXB 2LUPB 4LF8M 4B7HA 1OIEA 1FJGM 2X49A 4DV5E 2XH9A 4I5SA 1TGUA 4LACC 3FD9A 2IHR1 1FJMA 2UUBE 3GQ5A 2RTXA 4FCVA 1Z59A 4M0DA 1MF8A 1TH3A 5JPEA 2UU9M 2G7HA 2M60A 4FWHA 2ZM6E 3TL4X 3U6SA 4DV2M 4IYPC 4X66E 1HO5A 4GKJM 4MB7A 2NA2A 2LUQA 4JA7A 5B8IA 1IXZA 4MGYE 4DR3E 4KZSA 3ADLA 4LF5E 3HPSA 4GIPA 2FE8A 3GLHA 2F5OA 4NXMM 5FSWA 2MC6A 3L28A 2CV0A 3RE8A 3GRVA 1G59A 4FCWA 3H68A 3RMPA 3H60A 1Z5AA 3WHLA 1Z2WA 1K3WA 2YZTA 2KA6B 3BOSA 3GLHB 4I5NC 4OU7A 2L09A 3DF6A 5EQTA 3M0EA 2KEBA 1XNRM 2R4EA 1XWIA 3MHVC 2QPAA 1TH4A 1XMOE 4V0WA 2VF1A 1QZMA 3DSCA 5ITRA 4G4OA 2UXDM 4JI7M 2VE7C 4UT3B 3U6EA 4DR5M 4X64E 5FTKA 3HU1A 2C99A 2CE7A 2QCUA 3HVQA 3HPZA 2V86A 1NSFA 4OOGC 4MOVA 2CFOA 3D8BA 3C5WC 2DB2A 3U61A 3H69A 4B3ME 4LG2A 3ZH9B 3U6QA 2DWNA 1N36E 5FTJA 3K92A 4DV4E 1J26A 1IBKM 3H66A 4B3MM 3RL3A 2XLJA 4NZVA 2DWMA 1DGBA 2J7NA 5KPZA 2C9OA 4NRWA 3HU3A 3H63A 3FUWA 4YY3E 4AG5A 4L4UA 4DR4M 1PM5A 1SR9A 3U6OA 4DR1M 1DGFA 3U6MA 1JK7A 3HGIA 1IN5A 4PDIA 1T70A 1PJIA 4DV1M 3SHGB 3KFUG 2NYMC 3UJNA 3KOYE 1UTEA 4LJ8A 4FBWA 2ZOAA 4B08A 3U6LA 4JI1M 1ZQ9A 3VFDA 4FWGA 5E26A 2A5YB 2QFPA 3P1XA 1NNUC 3FUUA 4NOOB 3UGJA 4GC9A 4KO8A 4XPNA 3KVWA 2YT4A 4PCZA 2QENA 2DZNB 2UUAE 5EP3A 4LCBA 3ZCBB 2Z1AA 3PNVA 4IL1A 2XF3A 3MK6A 3JTZA 3WHKA 4O4KA 3H64A 1T4LB 3J27B 5JI2E 1Q39A 2YVTA 3U6PA 4FBKA 3KW6A 1KBPA 1N32M 4GH9A 4D80A 4DHLA 1R2YA 4H1SA 3JU0A 2EZ6A 4G6ZA 3GPPA 1DO2A 3TWLA 2Q8UA 3PSNA 5H37D 4JI8E 3LQRA 4REZA 3I4YA 4MGZE 3UZUA 4G4RA 4F0ZA 2IE3C 3GPXA 3LLHA 3K8ZA 3MJ5A 4X65M 4IBKA 3EIEA 1MX0A 3FTEA 1S3NA 1HNXE 4GRIA 3L29A 2Y21A 3JR5A 1L2BA 4M2ZA 3AL0C 2C96A 4LZZA 5BR8M 1L1TA 5LMNM 3QFNA 2K4VA 5AE3A 7CATA 3HHWA 4AKHA 2B7VA 4DR2E 3C4BA 1V73A 4M0VA 1W5TA 1QANA 3QFKA 3TPZA 2EO2A 2RS7A 3B9PA 2E5LM 1GLNA 2L3CA 3CTWB 3J7Yp 2XEPA 2VIIA 2R17A 3CK2A 4B2OA 4B3TM 1Z5BA 5E6JA 3AV0A 1PKPA 2HKJA 3R8FA 4LF7E 4LJ9A 3T1IA 2C98A 4GITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTU A;  5EQV A;  4Q7F A;  3H68 A;  3QFO A;  4ORB A;  1USH A;  3V4Y A;  1QFC A;  1OID A;  1SU1 A;  1XZW A;  1T70 A;  3H60 A;  4H1Y P;  3RL5 A;  1AUI A;  2Q8U A;  3N5U A;  4ZVZ A;  3K7W C;  1Z2W A;  2IAE C;  4TUI A;  3PSN A;  4I5N C;  2P6B A;  2NYM C;  1S3M A;  2DFJ A;  4FBQ A;  1UTE A;  2O8A A;  2Z72 A;  3E7A A;  4F0Z A;  2IE3 C;  4H2F A;  4UT2 A;  2Z06 A;  1NNW A;  4HD0 A;  3ICF A;  4V0W A;  4V0V A;  1IT6 A;  3P71 C;  3IVE A;  4FBW A;  5C1V A;  3DSC A;  5J28 A;  3JYF A;  1S3N A;  4UT3 B;  1HP1 A;  1OIE A;  4JA9 A;  2AHD A;  3RL4 A;  4G9J A;  1OI8 A;  2WDE A;  3GVE A;  1WAO 1;  1G5B A;  3HVQ A;  4UT3 A;  3IB7 A;  3C9F A;  3DSD A;  4V0X A;  2QFP A;  4ORC A;  2QFR A;  3PSO A;  2IE4 C;  4LAC C;  1U32 A;  3H61 A;  3THN A;  1FJM A;  3DW8 C;  3QG5 C;  3LL8 A;  3QFN A;  4H2I A;  4MOV A;  4XPN A;  1TCO A;  5JPF A;  4YKE A;  2QJC A;  2GJU A;  4TUG A;  2WDF A;  1MF8 A;  2NPP C;  4ZX2 A;  4H2B A;  5HPE A;  1XM7 A;  2HYO A;  2O8G A;  1V73 A;  2Z1A A;  1II7 A;  3C5W C;  3IVD A;  4LU9 A;  3H69 A;  5JPE A;  4M0V A;  2NYL C;  4IL1 A;  3QFK A;  3KBP A;  3ZTV A;  4O4K A;  2BDX A;  3H64 A;  4DT2 A;  2A22 A;  3E7B A;  1T71 A;  3EGH A;  4ORA A;  4KBP A;  5JJT A;  2HY1 A;  2ZBM A;  2WDD A;  4IYP C;  2USH A;  4O43 A;  1S8E A;  3EGG A;  5IOH A;  1HO5 A;  2R17 A;  3H66 A;  3CK2 A;  2JOG A;  4B2O A;  1S3L A;  1W24 A;  1WAR A;  1QHW A;  2KKN A;  2YVT A;  3K7V C;  4MOY A;  4UWQ A;  4JA7 A;  3RL3 A;  4MP0 A;  3ZU0 A;  3THO B;  5B8I A;  2CV9 A;  4NZV A;  4FCX A;  3H67 A;  1S70 A;  2XMO A;  1S95 A;  4FBK A;  4H2G A;  3H62 B;  3FGA C;  3AV0 A;  4LTY A;  4O5G A;  2WDC A;  4WWL A;  1KBP A;  3H63 A;  3AUZ A;  2BQ8 X;  1Z2X A;  4OR9 A;  4DSY A;  3IB8 A;  4DHL A;  4H1S A;  4J6O A;  3RQZ A;  5INB A;  5DNY A;  1HPU A;  1M63 A;  2NXF A;  4O24 A;  2BCD A;  4KKZ A;  5F3W A;  3T1I A;  3TGH A;  4I5L C;  3QFM A;  2HYP A;  1JK7 A;  1UF3 A; 
#chains in the Genus database with same CATH topology
 1W5S A;  4NXN E;  3R9X B;  5LMU E;  1USH A;  4G4Q A;  2GNO A;  2EML A;  1MEY C;  3HHX A;  4LF4 E;  1IN4 A;  1IY2 A;  3DOA A;  3A45 A;  2EOZ A;  4TUI A;  2W82 A;  3U60 B;  1WJ7 A;  4WPY A;  2LJH A;  4RH8 A;  3HXL A;  2LXE A;  3FLO A;  3VYY A;  4JXJ A;  2EOJ A;  4AW4 A;  3BF2 A;  1N34 E;  3UK6 A;  5LL6 R;  1HP1 A;  4OVZ B;  2EOY A;  2DNA A;  1XHB A;  1Q3C A;  4G9J A;  1HQY E;  2R45 A;  2EM0 A;  1WAO 1;  2DXI A;  1UN6 B;  3DFZ A;  2C9C A;  3BBG A;  1JK2 A;  3FTD A;  2XSZ A;  1E9S A;  2YFQ A;  3U5Z A;  5ADZ A;  4Q28 A;  2ZAM A;  1SXJ E;  2LNH C;  5ITU A;  1MJG M;  1TR8 A;  2YTE A;  2QSF X;  3J2P B;  2EOS A;  3FUT A;  2ZO9 B;  1VDD A;  4YKE A;  1JB0 F;  3AOE A;  2EL5 A;  4R2Q A;  4F9B B;  2NYL C;  2V89 A;  2JZ1 A;  1TF6 A;  2KON A;  5AC5 A;  4KBP A;  2DZL A;  3OTO E;  2JY7 A;  4M9Z A;  1WAR A;  1VEG A;  2EN2 A;  3SAU A;  1IN7 A;  1NJF A;  1T4N A;  2I9I A;  1RQ0 A;  2HJJ A;  2OOA A;  4DSY A;  2APL A;  2LT7 A;  3OTO M;  4QNM A;  2EE8 A;  5IWA M;  4DV6 E;  4J6O A;  3RQZ A;  2F5P A;  1A1F A;  3FIG A;  4P16 A;  4DMI A;  4ZPX A;  2RPC A;  1X37 A;  1IXS A;  1L2D A;  3B7Z A;  4F9A B;  2KOU A;  3SAT A;  5A6J A;  2R46 A;  4DV6 M;  1AUI A;  2IAE C;  3E0J A;  3ILK A;  2JXN A;  4PT5 A;  5ITX E;  2DAI A;  4BC7 A;  4JV5 M;  4K0K E;  2M4I A;  2HHH E;  3T1Y M;  4LJ6 A;  5KL4 A;  4DV0 M;  4WSP A;  2LBS B;  3EQ1 A;  3TWK A;  5KQD A;  2BJV A;  4GKK E;  2XSZ D;  3IVE A;  2KW0 A;  3CF6 E;  1R6B X;  2H5X A;  4F9C B;  4JI2 M;  3VLF B;  1X48 A;  2UXC E;  2Z7J A;  3E46 A;  4MGK E;  4JN6 A;  1EFU B;  1Q02 A;  1G5B A;  3IB7 A;  4LF8 E;  1LLM C;  4IBF A;  3PSO A;  3VHT B;  3H09 A;  2EMG A;  2H36 X;  1FJG E;  1OFH A;  1YSY A;  1K3X A;  2RGH A;  2GJU A;  1WGL A;  1GZ6 A;  2YRH A;  2L6O A;  3GLG B;  4XK8 F;  2EOQ A;  3H4M A;  1XM7 A;  3RGP A;  1MN3 A;  2DLK A;  2V6Z M;  2L7I A;  4G3O A;  2YSP A;  2CV2 A;  3J80 S;  4FK5 C;  3Q8G A;  2UU9 E;  4QHT A;  1QYR A;  2PRT A;  2KKN A;  3FTC A;  4Y28 F;  3K7V C;  1A5T A;  3L2A A;  4DV2 E;  2M7Q A;  4KOD A;  3H67 A;  2DVW B;  4LTY A;  4LJ4 A;  4GKJ E;  2EPC A;  4P17 A;  3F6G A;  1QNT A;  1GKI A;  1SG9 A;  1IBL E;  5INB A;  1MU5 A;  1OAO C;  1IQS A;  3VK6 A;  5HPE A;  5A6K A;  2YNM D;  3FRH A;  4RNA A;  1L8Q A;  1G71 A;  2NUG A;  3J81 C;  1IBL M;  4FWD A;  4BB9 A;  4NXM E;  3HU2 A;  4MLQ A;  2WCC 3;  2RSI A;  3HJ8 A;  2EN7 A;  2XFT A;  4AG6 A;  4DR6 M;  2EQ3 A;  4JI6 E;  2YSO A;  4A3V B;  2F5Q A;  3E7A A;  2YTI A;  3VKH A;  4J8Z A;  3SAR A;  3P71 C;  2LVQ D;  1Q3B A;  4JI6 M;  5J28 A;  1IBM E;  2KNZ A;  4WW0 A;  1XNR E;  2EMI A;  3KP0 E;  1DGH B;  1PJT A;  4IBE A;  1ZBT A;  2UXD E;  4UT3 A;  4JI7 E;  3K6Q A;  3J7A G;  1IBM M;  2IE4 C;  3T6P A;  4DR5 E;  2NAB A;  4LF6 M;  1IM2 A;  2HGH A;  2L7H A;  4F1I A;  1STU A;  2KRU A;  1OAI A;  5DYI A;  1AH5 A;  2JZ0 A;  4DKK A;  3V76 A;  4IBI A;  2MH8 A;  1RC7 A;  2R44 A;  5EXT A;  3GLG E;  2JVA A;  1KSF X;  4ORA A;  4NL4 H;  1NY6 A;  4XGI A;  1OTR A;  1T4O A;  1T38 A;  1Z5C A;  2UUC E;  4LFB M;  1UHZ A;  5KPT A;  1NCS A;  1YYW A;  2CV9 A;  1OFI A;  4WWL A;  1IBK E;  1Z2X A;  1Z6T A;  3TE6 A;  2EMF A;  1WJP A;  4X62 E;  3GQ4 A;  2UUC M;  2M1S A;  5DNY A;  1QZE A;  2VF7 A;  5GKN A;  2LVA A;  5KL6 A;  4DR4 E;  2EA0 A;  1Y8G A;  4BS9 A;  2CTD A;  4ORB A;  4X62 M;  3VYX A;  4DR1 E;  2JY6 B;  3RFW A;  3HWS A;  3K9P A;  3M99 B;  4F6N A;  1DQ3 A;  1L2C A;  2X4A A;  3GPY A;  2V8Q B;  1N77 A;  2B3T B;  3DA1 A;  2AHM A;  1QAM A;  1AUA A;  3GRY A;  4G4N A;  2EPA A;  5C1V A;  4DV1 E;  2D7E A;  4BC9 A;  3SAW A;  3KDS E;  2EMB A;  3GVE A;  1C1K A;  3HX3 A;  1NV8 A;  4LJ5 A;  3C9F A;  4JI1 E;  3DSD A;  3EPK A;  2QFR A;  1R4G A;  3HJQ A;  2DZO B;  3PVS A;  3U6D A;  2JOB A;  1QAO A;  2YRM A;  1J5E M;  3C3D A;  4JI4 M;  1HNW E;  1XXH B;  4QOS A;  3UK3 C;  2CRU A;  2EN3 A;  1ORY B;  2HYO A;  4JI3 M;  1YUJ A;  2LTR A;  3LQQ A;  1F4I A;  4LFA E;  2B7T A;  4B3S M;  1KYQ A;  1HNW M;  4R2D A;  1EE8 A;  4GHA A;  3IEC A;  3ECR A;  1G3I A;  2GPI A;  2CV1 A;  3BGH A;  4KHP E;  4MOY A;  4ZYE A;  1VG5 A;  2FV4 B;  4P78 A;  4FCX A;  2E1M A;  3EPL A;  1S70 A;  4LF9 M;  4LFA M;  3BXW A;  2CHQ A;  2EMH A;  2K6B A;  2L4F A;  3L00 A;  4KHP M;  4GMQ A;  2YQZ A;  1KJK A;  1HPU A;  1H6U A;  1UIL A;  1XNQ M;  1JR3 A;  1N32 E;  2JWO A;  3IWB A;  4R8O A;  2O01 F;  5TSE A;  3VDU A;  4JI0 E;  2C5R A;  1XC8 A;  1OKS A;  2YU5 A;  2Y0Q A;  2EMX A;  4MGH A;  1NY5 A;  2V85 A;  4H2F A;  2KZS A;  3E9S A;  4JI0 M;  2MRO B;  3W0F A;  2DWZ B;  5EXP A;  1K82 A;  1ZMW A;  3JYF A;  3K2L A;  2VQE M;  1DO0 A;  2WSF F;  3RL4 A;  2EOI A;  4X65 E;  2F4V M;  2K47 A;  2DAK A;  4F6M A;  4Q35 B;  2F5S A;  5EXS A;  1TH2 A;  1SXJ A;  2ENC A;  2EQ1 A;  1EIJ A;  2X8A A;  2ENH A;  5JPF A;  2E72 A;  4OX9 M;  3SYL A;  4F54 A;  5BR8 E;  4AQY M;  4DBG B;  4YHH M;  4WXC A;  5LMN E;  4M9S A;  2M9A A;  1V92 A;  2HAK A;  1SXJ B;  1NEI A;  4DT2 A;  4JYA M;  1GAB A;  3EGH A;  1A1G A;  4GZN C;  2J7O A;  5CFF E;  1NNJ A;  2F8B A;  1G4A E;  1D0L A;  2EMY A;  2Q2E B;  2E5L E;  3HQ1 A;  5C18 A;  2LVH A;  2ZAN A;  2O25 A;  2ZTC A;  2WDC A;  3TWM A;  3AUZ A;  1IQO A;  4B7F A;  2N3G A;  2EP3 A;  2Y0T A;  4B3T E;  2WZJ A;  3FUX A;  2LO3 A;  2LV2 A;  1QVR A;  4IBB A;  4CJ6 A;  1NHW C;  2I7P A;  4Z6Y A;  1HQC A;  4X8W A;  2ZTD A;  2CHG A;  4MGI E;  2WZO A;  5IV8 B;  3W68 A;  1XZW A;  1GVN A;  3CF2 A;  3MSW A;  1YSA C;  2EM9 A;  5ITX A;  3IG8 A;  4IIW A;  1LTM A;  4AKG A;  3I04 M;  3E21 A;  3U60 A;  2DGC A;  3B7N A;  2LH0 A;  1X6E A;  1N33 M;  4HLQ A;  4V0V A;  1WIV A;  3SAV A;  2YR0 A;  3I4V A;  5AC4 A;  5EP4 A;  4S12 A;  2XZF A;  3ZC7 B;  2WDE A;  2DI0 A;  4P7D A;  2EMZ A;  3A42 A;  4OVZ A;  3AOE C;  4V0X A;  4ORC A;  5C1B A;  4R2A A;  4M0W A;  4LY6 A;  1RU3 A;  3DZD A;  3LCU A;  4CHT B;  4M9X A;  4N4R B;  4IBG A;  3SAS A;  3FUV A;  1TDH A;  4L6V 6;  3FTF A;  4DUZ E;  2CEA A;  4I8O A;  1V33 A;  2NPP C;  1QDT A;  4LJA A;  1T3T A;  2D7H A;  4NSO B;  4LU9 A;  3M7G A;  3AOG A;  2H1R A;  1GQE A;  4R2S A;  2FFJ A;  4HL4 A;  2JYA A;  1D0M A;  2ERC A;  2L3J A;  2KHH A;  2G8L A;  4DUZ M;  2JWS A;  2DXN A;  2ZBM A;  3EGG A;  5IOH A;  2WBT A;  4UWQ A;  3A98 B;  3GLF B;  4LGM A;  1HNZ M;  1S95 A;  1T43 A;  2QBY B;  2UXB M;  1YLA A;  4MM3 B;  3HKP A;  5A2Q C;  1IFY A;  2EMA A;  1M63 A;  4I5L C;  2WSC F;  3AKZ A;  2Y20 A;  1YZ9 A;  1YPN A;  4JI5 M;  5IWA E;  3V4Y A;  2LE2 A;  1I94 M;  1X47 A;  1IN6 A;  1BBG A;  2P6B A;  3HHZ A;  3T1H M;  1G41 A;  4QNR A;  1HR0 M;  3EPH A;  4ZYG A;  2CUZ A;  1NNW A;  3AFH A;  1DV0 A;  2R4J A;  2EPN A;  4LFC E;  4JV5 E;  3T1Y E;  2RRU A;  4JA9 A;  3ADI A;  4DV7 M;  4DV0 E;  2AHD A;  1TF3 A;  1G8P A;  1RMD A;  2VRD A;  3ADJ A;  4JI2 E;  4LFC M;  3H61 A;  3THN A;  2ELZ A;  2K0B X;  1TCO A;  3UMM A;  4L8R C;  5EJC A;  2MKN A;  1EKZ A;  3SBJ A;  3VK7 A;  1II7 A;  4GHL A;  2BNK A;  5ITQ A;  3MMP A;  3GLG A;  5IT9 C;  1P3Q Q;  3M6A A;  3H4J A;  3GQ3 A;  2WDD A;  2USH A;  4FVM A;  1QHW A;  2GLI A;  3B7Q A;  4HTG A;  1BVS A;  1ZBQ A;  1GJS A;  2LWX A;  3IB8 A;  2CHV A;  2D7G A;  8CAT A;  1OIP A;  1EH7 A;  3GLF E;  2RS6 A;  4UN2 B;  2EM2 A;  4R2C A;  1FNN A;  2BCD A;  3AJI B;  4KKZ A;  2R62 A;  1UFZ A;  4QHS A;  3A46 A;  2YEQ A;  4FW9 A;  1UF3 A;  3Q8X A;  2EOR A;  3C4T A;  5EQV A;  4Q7F A;  2EOF A;  1QFC A;  1WHN A;  1XB2 B;  4WXD A;  3KS4 A;  1N75 A;  2OO9 A;  3C9P A;  2VQF M;  5DFL A;  3IWD A;  4KT0 F;  1S3M A;  1WHC A;  3THG A;  5AE2 A;  2O8A A;  2HCB A;  2MGW A;  2J7J A;  1IY1 A;  3KXE C;  4ITQ A;  5L8R F;  4DV5 M;  3RGS A;  4DR6 E;  2MDR A;  1AIP C;  2EPR A;  3DJW A;  1E32 A;  4LZJ A;  3VDP A;  2UUB M;  1PDA A;  1TDZ A;  3NBI A;  4CIZ A;  2CP8 A;  1ZMU A;  5IRE B;  2XFS A;  1DGH A;  2FOI C;  1U32 A;  1D2N A;  4H2I A;  1QUT A;  2XZU A;  3GP1 A;  2QJC A;  2ZM6 M;  2RGO A;  4GEQ B;  5KL3 A;  1WXR A;  3GLI E;  4HEO A;  2B9D A;  1ZMV A;  4X66 M;  3HZJ A;  4LF6 E;  4WYQ B;  3FYC A;  1J7K A;  4W5W A;  1MGT A;  1BBO A;  2ZAO A;  2D9H A;  2DSY A;  3F92 A;  1T39 A;  3E7B A;  3HTX A;  2HY1 A;  4DR3 M;  5A2Q S;  4LF5 M;  4L78 A;  3KS8 A;  5KO3 A;  1SFE A;  2RSM A;  2JOG A;  1S3L A;  1J09 A;  3J7A S;  4AI6 A;  3KZY A;  2DIX A;  1LV7 A;  3FYD A;  4AZF A;  3J7B A;  3HHY A;  3CF0 A;  3K9O A;  2N35 A;  4LFB E;  4R3D A;  4R2E A;  4GC5 A;  4OW0 A;  1X3C A;  1YUI A;  3K1J A;  4NRV A;  2EM3 A;  2OQ4 A;  1SU1 A;  2L2K B;  4ZVZ A;  1PRB A;  4IJF A;  3K7W C;  2EPX A;  3EIH A;  5DYG A;  1XMO M;  4L16 A;  4IJD A;  3SYK A;  5EXX A;  2DFJ A;  2L2N A;  1YYO A;  4FBQ A;  1QU6 A;  2JR1 A;  1DGC A;  4X64 M;  1HT1 E;  2EPP A;  2V88 A;  2B3T A;  3KSJ A;  2FNA A;  3HJS A;  1VEK A;  1NHG C;  4DV3 E;  5A6B A;  5BPV A;  2GHF A;  1IQP A;  3MHH C;  3ZOQ B;  3TQS A;  1GO5 A;  2JXP A;  2GQF A;  3JR4 A;  1D0K A;  2KNV A;  4DV3 M;  3U6C A;  5IT9 S;  2KXE A;  2V1C A;  3QG5 C;  5EP1 A;  2EOO A;  1R5L A;  3U61 B;  4ZYH A;  2OPF A;  4ZX2 A;  2R65 A;  1IXR C;  1N36 M;  2EN6 A;  4DV4 M;  2V1U A;  2O8G A;  4BBY A;  3IVD A;  2P5T A;  1QUS A;  1G2F C;  4IBJ A;  2BB8 A;  4IJE A;  2MKD A;  1XXH A;  2BDX A;  3F6H A;  1J5E E;  4JI4 E;  2DMY A;  4NSR A;  1T71 A;  4JI3 E;  3JAM C;  1NVM A;  1OIZ A;  3KOZ E;  2QZ4 A;  4YY3 M;  3SMP A;  2FGG A;  4LRS A;  3FKE A;  2YRK A;  2EOE A;  3ZU0 A;  4WP2 A;  4B3S E;  5IZ7 D;  3C3E A;  4BHC A;  4AKI A;  2BQ8 X;  1FKA E;  5FLX C;  2L2M A;  3PNY A;  2DKL A;  4BLC A;  4PD2 A;  4RF1 A;  3W0L B;  2DHR A;  2KRK A;  2YTN A;  1YUB A;  3SMS A;  3GLH E;  2Z3X A;  4LF9 E;  3LVW A;  2G3Q A;  4NHR A;  4O43 A;  3PXG A;  1JQJ C;  4LJ7 A;  2DWL A;  2FS1 A;  2L33 A;  2V87 A;  2EPO A;  3RL5 A;  2JP9 A;  1XNQ E;  1N3G A;  1GL6 A;  1XMQ E;  3J81 S;  1B69 A;  4FD2 A;  2QHO B;  2LHC A;  2Z72 A;  2L8T A;  2L92 A;  2EL6 A;  2DAM A;  2Z06 A;  4IS1 C;  4RF0 A;  2LRS A;  1IT6 A;  2RKO A;  1XMQ M;  2BJW A;  1X6H A;  1SXJ C;  4IBD A;  2EM7 A;  1NJG A;  1I4W A;  1YFH A;  1A1I A;  3PFI A;  2VQE E;  5T6J A;  1ZU1 A;  2UUA M;  2LBC A;  3DW8 C;  2EN1 A;  2F4V E;  2NUE A;  2EKK A;  4ANR A;  2KZU A;  2ADR A;  2ODR C;  2EM5 A;  5AAS A;  1PJS A;  4F2J C;  4OX9 E;  3KWR A;  4AQY E;  1KFV A;  4YHH E;  1S8E A;  3VKG A;  2EOM A;  3L27 A;  4JYA E;  4LGY A;  1X49 A;  2LTS A;  4OR9 A;  1N78 A;  2JP7 A;  5ITT A;  1C7Y A;  4BMJ A;  5KL7 A;  4R03 A;  2HYP A;  3LML A;  4CIS A;  2A25 A;  5ITY A;  4JI8 M;  1DGG A;  4H1Y P;  1JR3 D;  1HT2 E;  1OID A;  3E4R A;  1GL7 A;  2KNA A;  2ZBK B;  2EM8 A;  2WSE F;  2EJ4 A;  1Z1B A;  1HNX M;  1YYK A;  2EPU A;  2EN8 A;  2I7N A;  2LMZ A;  4UT2 A;  4HD0 A;  3ICF A;  3KP1 E;  2LTU A;  4TUW A;  3OML A;  2ELY A;  1A1H A;  3KOX E;  1WHQ A;  1A1K A;  1OI8 A;  1N33 E;  4M30 A;  1WGN A;  1IMU A;  5KQ8 A;  1YE9 A;  4DUY E;  3T15 A;  3W67 A;  3C58 A;  4BBA A;  1IY0 A;  2M5Z A;  4DR2 M;  1GJT A;  2R0I A;  2VF8 A;  3JAM S;  3D8L A;  4R7G A;  4TUG A;  2WDF A;  4DUY M;  1SXJ D;  4H2B A;  3VK8 A;  2EUC A;  3KOW E;  2QP9 X;  3J80 C;  1UM8 A;  3KBP A;  3GRR A;  2L6M A;  4B7G A;  2CPN A;  5FLX S;  2V83 A;  2A22 A;  3NWL A;  1S3S A;  3C6K A;  4LRT A;  4D82 A;  3GRU A;  2JOX A;  1ZAE A;  2ODR D;  2F5N A;  3SFZ A;  4FCT A;  4L15 A;  4MP0 A;  5FTN A;  2FH0 A;  3THO B;  5JI3 E;  3GPU A;  3FE3 A;  2R1F A;  3D03 A;  4LF7 M;  3FGA C;  2BWE A;  2YTP A;  3FRI A;  5KPR A;  2MC5 A;  3GLF A;  3SC3 A;  4NXN M;  2DLQ A;  5LMU M;  2QBY A;  1HNZ E;  3L25 A;  4Z8X A;  4LF4 M;  4O24 A;  2NXF A;  5F3W A;  2UXB E;  5A69 A;  4QOZ C;  2KHX A;  3QWL A;  5FTM A;  4PDG A;  3I51 A;  2JY9 A;  4JI5 E;  4I4L A;  4CGY B;  1KYI A;  2EPM X;  1N34 M;  2EL4 A;  4GEW A;  3BID A;  3I01 M;  1I94 E;  2LVP C;  2HL7 A;  3HY5 A;  1X5W A;  3T38 A;  2YTF A;  4HEI A;  2G5G X;  3T1H E;  1R2Z A;  1HR0 E;  1NV9 A;  3KZZ A;  5EP2 A;  3U5Z B;  1X6F A;  4MH0 E;  4I81 A;  1L1Z A;  4EIW A;  2YTQ A;  1ZAA C;  4MLV A;  4DV7 E;  1VQ1 A;  3LL8 A;  4KLN A;  2DAE A;  1DI2 A;  4B3R E;  2NQ8 C;  4L8N A;  3GLI A;  3KSX A;  1G2D C;  4M9V C;  2EOH A;  3ZTV A;  3GO8 A;  1R7R A;  3LMM A;  4DR7 E;  4XBO A;  4D81 A;  4B3R M;  3ADG A;  5JJT A;  3IG5 A;  3L26 A;  4NC6 A;  3QAU A;  3TQM A;  3GLI B;  4BHB A;  2R18 A;  4BCA A;  1QQW A;  2JA2 A;  2EMC A;  1W24 A;  2CWB A;  3LVV A;  1E9R A;  1E94 E;  2QQ8 A;  2EN4 A;  4DR7 M;  2XMO A;  1QAQ A;  4H2G A;  3H62 B;  5FTL A;  4O5G A;  1PJJ A;  2EM6 A;  1OJL A;  4WUR A;  2Z4S A;  4WFT A;  3SHF A;  2N3H A;  4L5N C;  1IXS B;  2JPA A;  5AE1 A;  3TGH A;  2JY5 A;  3QFM A;  2DXL A;  5GTU A;  1TF0 B;  2LVO C;  2L4E A;  3IHP A;  3QFO A;  4K0K M;  2HHH M;  4R71 A;  2EWL A;  3IWC A;  2XGN A;  4II7 A;  3N5U A;  2DMI A;  1WXQ A;  3MHS C;  2EM4 A;  4GKK M;  2LHG A;  1TN9 A;  4IBC A;  5LLQ A;  2Z4R A;  2O5R A;  2NUF A;  4WSG A;  2UXC M;  1EH6 A;  1O0W A;  2VQF E;  1IN8 A;  2FTX B;  2LUP B;  4LF8 M;  1OQY A;  4B7H A;  1OIE A;  1FJG M;  2X49 A;  4DV5 E;  2XH9 A;  2VDB B;  4I5S A;  1TGU A;  4KWY A;  1VDL A;  2MDG A;  4LAC C;  3FD9 A;  2IHR 1;  1FJM A;  2UUB E;  3GQ5 A;  2RTX A;  4FCV A;  1Z59 A;  4M0D A;  1MF8 A;  3EPJ A;  2MJ5 B;  1TH3 A;  5JPE A;  2UU9 M;  1VEJ A;  2EMK A;  2G7H A;  2M60 A;  4FWH A;  2ZM6 E;  3TL4 X;  2K7I A;  1PJQ A;  3U6S A;  2KDL A;  4DV2 M;  4F2L A;  4IYP C;  4X66 E;  1HO5 A;  4GKJ M;  4MB7 A;  2NA2 A;  4WX9 A;  2LUQ A;  4JA7 A;  5B8I A;  1IXZ A;  4MGY E;  4DR3 E;  4KZS A;  3ADL A;  4LF5 E;  3HPS A;  4GIP A;  2FE8 A;  3GLH A;  2JY8 A;  2JNH A;  2EJS A;  2F5O A;  4NXM M;  5FSW A;  2MC6 A;  3L28 A;  2CV0 A;  1F2I G;  3RE8 A;  3GRV A;  1G59 A;  4FCW A;  3H68 A;  3RMP A;  3H60 A;  1Z5A A;  3WHL A;  4ZYD A;  2N8X A;  1Z2W A;  1K3W A;  2YZT A;  2KA6 B;  2WBS A;  3BOS A;  3GLH B;  4I5N C;  4OU7 A;  2WBU A;  2L09 A;  2EKF A;  3DF6 A;  3BBZ A;  5EQT A;  3M0E A;  2L2D A;  2KEB A;  1XNR M;  2YU8 A;  2R4E A;  1XWI A;  3MHV C;  2QPA A;  1TH4 A;  3LW5 F;  1XMO E;  4V0W A;  2VF1 A;  1QZM A;  3DSC A;  5ITR A;  4G4O A;  2UXD M;  4JI7 M;  2VE7 C;  4UT3 B;  3U6E A;  4DR5 M;  4X64 E;  5FTK A;  3HU1 A;  2C99 A;  2CE7 A;  2QCU A;  2LJU A;  3HVQ A;  3HPZ A;  2RQL A;  1TTE A;  2V86 A;  1NSF A;  1A1L A;  4OOG C;  4MOV A;  2CFO A;  2HC5 A;  2YTJ A;  3C6M A;  2EPL X;  3D8B A;  1PGY A;  1EH8 A;  3C5W C;  2DB2 A;  3U61 A;  3H69 A;  1ZR9 A;  4B3M E;  4LG2 A;  3ZH9 B;  3U6Q A;  2DWN A;  1N36 E;  5FTJ A;  3K92 A;  1A1J A;  4DV4 E;  1J26 A;  1IBK M;  1NO1 A;  3H66 A;  3QYE A;  4B3M M;  3RL3 A;  2XLJ A;  1T6O A;  4NZV A;  2DWM A;  2EMW A;  1DGB A;  2J7N A;  4Q7J A;  5KPZ A;  2C9O A;  4NRW A;  3HU3 A;  3H63 A;  2CT1 A;  3FUW A;  4YY3 E;  4AG5 A;  4L4U A;  4DR4 M;  1PM5 A;  1SR9 A;  3U6O A;  4DR1 M;  1DGF A;  3U6M A;  1HJP A;  1JK7 A;  3HGI A;  1IN5 A;  2YPN A;  4PDI A;  2BWB A;  1T70 A;  1WR1 B;  1PJI A;  2LVN C;  4DV1 M;  3SHG B;  3KFU G;  2NYM C;  3UJN A;  3KOY E;  2CSH A;  1UTE A;  4LJ8 A;  3B89 A;  4FBW A;  2ZOA A;  4B08 A;  3U6L A;  4JI1 M;  1ZQ9 A;  1WRJ A;  3VFD A;  2EOX A;  4FWG A;  5E26 A;  1L4S A;  2A5Y B;  5A6B D;  2QFP A;  3P1X A;  1NNU C;  3FUU A;  4NOO B;  2EPZ A;  3UGJ A;  4GC9 A;  4KO8 A;  4XPN A;  3KVW A;  2YT4 A;  4PCZ A;  2EPK X;  2QEN A;  2DZN B;  2UUA E;  5EP3 A;  4LCB A;  3ZCB B;  2Z1A A;  3PNV A;  1ZV1 A;  4IL1 A;  2XF3 A;  3MK6 A;  4R2P A;  3JTZ A;  3WHK A;  4O4K A;  3H64 A;  2ENA A;  1T4L B;  2DEN A;  3J27 B;  5JI2 E;  1Q39 A;  2YVT A;  2EQ0 A;  3U6P A;  4FBK A;  3KW6 A;  1KBP A;  1N32 M;  4GH9 A;  4D80 A;  4DHL A;  2Z8Y M;  3B74 A;  4RKU F;  1R2Y A;  4H1S A;  3JU0 A;  2EZ6 A;  2YTG A;  2J5Y A;  4G6Z A;  3GPP A;  2K9D A;  2DAG A;  1DO2 A;  3TWL A;  2QNJ A;  3NBX X;  2DHY A;  2Q8U A;  2YTD A;  3PSN A;  5H37 D;  4X9J A;  4JI8 E;  3LQR A;  4REZ A;  3I4Y A;  4MGZ E;  3UZU A;  4G4R A;  4F0Z A;  2MR9 A;  2DRP A;  2IE3 C;  3GPX A;  3LLH A;  3K8Z A;  3MJ5 A;  4X65 M;  4IBK A;  3EIE A;  2YWQ A;  2I13 A;  2HWJ A;  1MX0 A;  1UBD C;  3FTE A;  1S3N A;  5IXM B;  1HNX E;  4GRI A;  1BB8 A;  3L29 A;  2Y21 A;  3JR5 A;  1XXH E;  1L2B A;  4M2Z A;  3AL0 C;  5KL2 A;  2C96 A;  4LZZ A;  5BR8 M;  1L1T A;  5LMN M;  1QDR A;  3QFN A;  1V34 A;  1CUK A;  3QYB A;  4R2R A;  2K4V A;  5AE3 A;  7CAT A;  1P47 A;  2BBG A;  1GTK A;  3HHW A;  4AKH A;  2B7V A;  4DR2 E;  3C4B A;  1V73 A;  1JK1 A;  4M0V A;  1W5T A;  1QAN A;  2YTO A;  5KL5 A;  3QFK A;  3TPZ A;  3LCV B;  2EO2 A;  3CGW A;  2RS7 A;  3B9P A;  2E5L M;  3ZQJ A;  1GLN A;  2L3C A;  2LCE A;  3CTW B;  4RHB B;  3J7Y p;  2R76 A;  1AAY A;  2R6F A;  2XEP A;  2VII A;  2R17 A;  3CK2 A;  4B2O A;  4B3T M;  1Z5B A;  5E6J A;  3AV0 A;  2JUJ A;  2OOB A;  1PKP A;  2HKJ A;  3R8F A;  4LF7 E;  4LJ9 A;  3T1I A;  5A6A A;  2C98 A;  1JR3 E;  4GIT A; 
#chains in the Genus database with same CATH homology
 1W5S A;  4NXN E;  3R9X B;  5LMU E;  1USH A;  4G4Q A;  3HHX A;  4LF4 E;  1IN4 A;  1IY2 A;  3DOA A;  3A45 A;  4TUI A;  2W82 A;  3U60 B;  4WPY A;  2LJH A;  3HXL A;  2LXE A;  3FLO A;  3VYY A;  4JXJ A;  4AW4 A;  1N34 E;  3UK6 A;  5LL6 R;  1HP1 A;  4OVZ B;  1XHB A;  1Q3C A;  4G9J A;  1HQY E;  2R45 A;  1WAO 1;  2DXI A;  3DFZ A;  2C9C A;  3FTD A;  2XSZ A;  1E9S A;  2YFQ A;  3U5Z A;  5ADZ A;  4Q28 A;  2ZAM A;  1SXJ E;  2LNH C;  5ITU A;  3J2P B;  3FUT A;  2ZO9 B;  1VDD A;  4YKE A;  3AOE A;  4F9B B;  2NYL C;  2V89 A;  2KON A;  4KBP A;  3OTO E;  4M9Z A;  1WAR A;  3SAU A;  1IN7 A;  1NJF A;  1T4N A;  1RQ0 A;  4DSY A;  3OTO M;  4QNM A;  5IWA M;  4DV6 E;  4J6O A;  3RQZ A;  2F5P A;  3FIG A;  4P16 A;  4DMI A;  4ZPX A;  1X37 A;  1L2D A;  4F9A B;  2KOU A;  3SAT A;  2R46 A;  4DV6 M;  1AUI A;  2IAE C;  3E0J A;  3ILK A;  4PT5 A;  5ITX E;  4BC7 A;  4JV5 M;  4K0K E;  2M4I A;  2HHH E;  3T1Y M;  4LJ6 A;  4DV0 M;  4WSP A;  2LBS B;  3TWK A;  5KQD A;  2BJV A;  4GKK E;  2XSZ D;  3IVE A;  2KW0 A;  3CF6 E;  1R6B X;  4F9C B;  4JI2 M;  3VLF B;  1X48 A;  2UXC E;  2Z7J A;  4MGK E;  4JN6 A;  1G5B A;  3IB7 A;  4LF8 E;  4IBF A;  3PSO A;  3H09 A;  1FJG E;  2H36 X;  1OFH A;  1YSY A;  1K3X A;  2RGH A;  2GJU A;  1GZ6 A;  2L6O A;  3GLG B;  3H4M A;  1XM7 A;  3RGP A;  2V6Z M;  2L7I A;  2CV2 A;  3J80 S;  2UU9 E;  4QHT A;  1QYR A;  2KKN A;  3FTC A;  3K7V C;  3L2A A;  4DV2 E;  2M7Q A;  4KOD A;  3H67 A;  2DVW B;  4LTY A;  4LJ4 A;  4GKJ E;  3F6G A;  1GKI A;  1IBL E;  5INB A;  1MU5 A;  3VK6 A;  5HPE A;  2YNM D;  4RNA A;  1L8Q A;  2NUG A;  3J81 C;  1IBL M;  4FWD A;  4BB9 A;  4NXM E;  3HU2 A;  3HJ8 A;  2XFT A;  4AG6 A;  4DR6 M;  4JI6 E;  4A3V B;  2F5Q A;  3E7A A;  3VKH A;  4J8Z A;  3SAR A;  3P71 C;  1Q3B A;  4JI6 M;  5J28 A;  1IBM E;  4WW0 A;  1XNR E;  3KP0 E;  1DGH B;  4IBE A;  1ZBT A;  2UXD E;  4UT3 A;  4JI7 E;  3K6Q A;  3J7A G;  1IBM M;  2IE4 C;  4DR5 E;  4LF6 M;  1IM2 A;  2L7H A;  1STU A;  2KRU A;  5DYI A;  4DKK A;  4IBI A;  1RC7 A;  5EXT A;  2JVA A;  1KSF X;  4ORA A;  4NL4 H;  1NY6 A;  4XGI A;  1T4O A;  1Z5C A;  2UUC E;  4LFB M;  1UHZ A;  5KPT A;  1YYW A;  2CV9 A;  1OFI A;  4WWL A;  1IBK E;  1Z2X A;  1Z6T A;  3TE6 A;  4X62 E;  3GQ4 A;  2UUC M;  2M1S A;  5DNY A;  5GKN A;  4DR4 E;  2EA0 A;  4BS9 A;  4ORB A;  4X62 M;  3VYX A;  4DR1 E;  3RFW A;  3HWS A;  1DQ3 A;  1L2C A;  2X4A A;  3GPY A;  2V8Q B;  1N77 A;  2B3T B;  3DA1 A;  2AHM A;  1QAM A;  3GRY A;  4G4N A;  5C1V A;  4DV1 E;  2D7E A;  4BC9 A;  3SAW A;  3KDS E;  3GVE A;  1C1K A;  4LJ5 A;  3C9F A;  4JI1 E;  3DSD A;  2QFR A;  3HJQ A;  2DZO B;  3PVS A;  3U6D A;  2JOB A;  1QAO A;  1J5E M;  4JI4 M;  1HNW E;  1XXH B;  4QOS A;  1ORY B;  2HYO A;  4JI3 M;  2LTR A;  3LQQ A;  4LFA E;  2B7T A;  4B3S M;  1HNW M;  1EE8 A;  4GHA A;  1G3I A;  2CV1 A;  4KHP E;  4MOY A;  2FV4 B;  4P78 A;  4FCX A;  2E1M A;  1S70 A;  4LF9 M;  4LFA M;  2CHQ A;  4KHP M;  4GMQ A;  2YQZ A;  1HPU A;  1H6U A;  1UIL A;  1XNQ M;  1JR3 A;  1N32 E;  2JWO A;  3IWB A;  4R8O A;  3VDU A;  4JI0 E;  2C5R A;  1XC8 A;  2Y0Q A;  4MGH A;  1NY5 A;  2V85 A;  4H2F A;  2KZS A;  3E9S A;  4JI0 M;  3W0F A;  2DWZ B;  5EXP A;  1K82 A;  3JYF A;  3K2L A;  2VQE M;  1DO0 A;  3RL4 A;  4X65 E;  2F4V M;  2K47 A;  2F5S A;  5EXS A;  1TH2 A;  1SXJ A;  2X8A A;  5JPF A;  4OX9 M;  3SYL A;  4F54 A;  5BR8 E;  4AQY M;  4YHH M;  5LMN E;  4M9S A;  1SXJ B;  4DT2 A;  4JYA M;  3EGH A;  2J7O A;  5CFF E;  1NNJ A;  2F8B A;  1G4A E;  2Q2E B;  2E5L E;  3HQ1 A;  5C18 A;  2ZAN A;  2WDC A;  3TWM A;  3AUZ A;  4B7F A;  2N3G A;  2Y0T A;  4B3T E;  3FUX A;  1QVR A;  4IBB A;  1NHW C;  2I7P A;  4Z6Y A;  1HQC A;  4X8W A;  2CHG A;  4MGI E;  2WZO A;  1XZW A;  1GVN A;  3CF2 A;  3MSW A;  5ITX A;  3IG8 A;  4IIW A;  4AKG A;  3U60 A;  2LH0 A;  1N33 M;  4HLQ A;  4V0V A;  3SAV A;  2YR0 A;  3I4V A;  5EP4 A;  4S12 A;  2XZF A;  3ZC7 B;  2WDE A;  4P7D A;  3A42 A;  4OVZ A;  3AOE C;  4V0X A;  4ORC A;  5C1B A;  4M0W A;  4LY6 A;  3DZD A;  4CHT B;  4M9X A;  4IBG A;  3SAS A;  3FUV A;  1TDH A;  3FTF A;  4DUZ E;  2CEA A;  4I8O A;  2NPP C;  4LJA A;  1T3T A;  2D7H A;  4NSO B;  4LU9 A;  3M7G A;  3AOG A;  2H1R A;  1GQE A;  2FFJ A;  4HL4 A;  2ERC A;  2L3J A;  2G8L A;  4DUZ M;  2DXN A;  2ZBM A;  3EGG A;  5IOH A;  4UWQ A;  3A98 B;  3GLF B;  4LGM A;  1HNZ M;  1S95 A;  2QBY B;  2UXB M;  4MM3 B;  3HKP A;  5A2Q C;  1M63 A;  4I5L C;  3AKZ A;  2Y20 A;  1YZ9 A;  4JI5 M;  5IWA E;  3V4Y A;  2LE2 A;  1I94 M;  1X47 A;  1IN6 A;  2P6B A;  3HHZ A;  3T1H M;  1G41 A;  4QNR A;  1HR0 M;  2CUZ A;  1NNW A;  3AFH A;  2R4J A;  4LFC E;  4JV5 E;  3T1Y E;  4JA9 A;  3ADI A;  4DV7 M;  4DV0 E;  2AHD A;  1G8P A;  3ADJ A;  4JI2 E;  4LFC M;  3H61 A;  3THN A;  1TCO A;  3UMM A;  4L8R C;  5EJC A;  1EKZ A;  3SBJ A;  3VK7 A;  1II7 A;  4GHL A;  2BNK A;  5ITQ A;  3GLG A;  5IT9 C;  3M6A A;  3GQ3 A;  2WDD A;  2USH A;  4FVM A;  1QHW A;  1ZBQ A;  2LWX A;  3IB8 A;  2CHV A;  2D7G A;  8CAT A;  2RS6 A;  1FNN A;  2BCD A;  3AJI B;  4KKZ A;  2R62 A;  4QHS A;  3A46 A;  2YEQ A;  4FW9 A;  1UF3 A;  3Q8X A;  3C4T A;  5EQV A;  4Q7F A;  1QFC A;  1WHN A;  3KS4 A;  1N75 A;  2VQF M;  3IWD A;  1S3M A;  3THG A;  5AE2 A;  2O8A A;  2HCB A;  1IY1 A;  3KXE C;  4ITQ A;  4DV5 M;  3RGS A;  4DR6 E;  2MDR A;  3DJW A;  1E32 A;  4LZJ A;  3VDP A;  2UUB M;  1TDZ A;  3NBI A;  5IRE B;  2XFS A;  1DGH A;  2FOI C;  1U32 A;  1D2N A;  4H2I A;  2XZU A;  3GP1 A;  2QJC A;  2ZM6 M;  2RGO A;  4GEQ B;  1WXR A;  2B9D A;  4X66 M;  4LF6 E;  4WYQ B;  3FYC A;  1J7K A;  4W5W A;  2ZAO A;  2DSY A;  3E7B A;  3HTX A;  2HY1 A;  4DR3 M;  5A2Q S;  4LF5 M;  4L78 A;  3KS8 A;  5KO3 A;  2RSM A;  2JOG A;  1S3L A;  1J09 A;  3J7A S;  4AI6 A;  2DIX A;  1LV7 A;  3FYD A;  4AZF A;  3J7B A;  3HHY A;  3CF0 A;  4LFB E;  4R3D A;  4GC5 A;  4OW0 A;  3K1J A;  4NRV A;  2OQ4 A;  1SU1 A;  2L2K B;  4ZVZ A;  3K7W C;  4IJF A;  3EIH A;  5DYG A;  1XMO M;  4L16 A;  3SYK A;  5EXX A;  2DFJ A;  2L2N A;  1YYO A;  4FBQ A;  1QU6 A;  2JR1 A;  4X64 M;  1HT1 E;  2V88 A;  3KSJ A;  2FNA A;  3HJS A;  1NHG C;  4DV3 E;  5BPV A;  1IQP A;  3ZOQ B;  3TQS A;  3JR4 A;  4DV3 M;  3U6C A;  5IT9 S;  2KXE A;  2V1C A;  3QG5 C;  5EP1 A;  3U61 B;  2OPF A;  4ZX2 A;  2R65 A;  1IXR C;  1N36 M;  4DV4 M;  2V1U A;  2O8G A;  4BBY A;  3IVD A;  2P5T A;  4IBJ A;  4IJE A;  1XXH A;  2BDX A;  3F6H A;  1J5E E;  4JI4 E;  2DMY A;  4NSR A;  1T71 A;  4JI3 E;  3JAM C;  1NVM A;  3KOZ E;  2QZ4 A;  4YY3 M;  3SMP A;  2FGG A;  4LRS A;  3FKE A;  3ZU0 A;  4B3S E;  5IZ7 D;  4AKI A;  2BQ8 X;  1FKA E;  5FLX C;  2L2M A;  3PNY A;  4BLC A;  4PD2 A;  4RF1 A;  3W0L B;  2DHR A;  2KRK A;  1YUB A;  3SMS A;  2Z3X A;  4LF9 E;  3LVW A;  4O43 A;  3PXG A;  1JQJ C;  4LJ7 A;  2DWL A;  2L33 A;  2V87 A;  3RL5 A;  1XNQ E;  1GL6 A;  1XMQ E;  3J81 S;  4FD2 A;  2Z72 A;  2L8T A;  2L92 A;  2Z06 A;  4RF0 A;  2LRS A;  1IT6 A;  2RKO A;  1XMQ M;  2BJW A;  1SXJ C;  4IBD A;  1NJG A;  1I4W A;  3PFI A;  2VQE E;  5T6J A;  2UUA M;  3DW8 C;  2F4V E;  2NUE A;  2KZU A;  2ODR C;  5AAS A;  4OX9 E;  3KWR A;  4AQY E;  1KFV A;  4YHH E;  1S8E A;  3VKG A;  3L27 A;  4JYA E;  4LGY A;  1X49 A;  2LTS A;  4OR9 A;  1N78 A;  5ITT A;  4BMJ A;  4R03 A;  2HYP A;  3LML A;  4CIS A;  5ITY A;  4JI8 M;  1DGG A;  4H1Y P;  1JR3 D;  1HT2 E;  1OID A;  3E4R A;  1GL7 A;  2ZBK B;  1HNX M;  1YYK A;  2I7N A;  2LMZ A;  4UT2 A;  4HD0 A;  3ICF A;  3KP1 E;  4TUW A;  3OML A;  3KOX E;  1WHQ A;  1OI8 A;  1N33 E;  4M30 A;  5KQ8 A;  1YE9 A;  4DUY E;  3T15 A;  3C58 A;  4BBA A;  1IY0 A;  2M5Z A;  4DR2 M;  3JAM S;  3D8L A;  4R7G A;  4TUG A;  2WDF A;  4DUY M;  1SXJ D;  4H2B A;  3VK8 A;  2EUC A;  3KOW E;  2QP9 X;  3KBP A;  1UM8 A;  3J80 C;  3GRR A;  2L6M A;  4B7G A;  2CPN A;  5FLX S;  2V83 A;  2A22 A;  3NWL A;  1S3S A;  4LRT A;  4D82 A;  3GRU A;  2JOX A;  1ZAE A;  2ODR D;  2F5N A;  3SFZ A;  4FCT A;  4L15 A;  4MP0 A;  5FTN A;  3THO B;  5JI3 E;  3GPU A;  3D03 A;  4LF7 M;  3FGA C;  5KPR A;  2MC5 A;  3GLF A;  3SC3 A;  4NXN M;  5LMU M;  2QBY A;  1HNZ E;  3L25 A;  4Z8X A;  4LF4 M;  2NXF A;  4O24 A;  5F3W A;  2UXB E;  4QOZ C;  2KHX A;  3QWL A;  5FTM A;  4PDG A;  3I51 A;  2JY9 A;  4JI5 E;  4I4L A;  4CGY B;  1KYI A;  1N34 M;  1I94 E;  2HL7 A;  3T38 A;  2G5G X;  3T1H E;  1R2Z A;  1HR0 E;  5EP2 A;  3U5Z B;  4MH0 E;  4I81 A;  1L1Z A;  4EIW A;  4DV7 E;  3LL8 A;  4KLN A;  1DI2 A;  4B3R E;  2NQ8 C;  4L8N A;  3GLI A;  3KSX A;  3ZTV A;  3GO8 A;  1R7R A;  3LMM A;  4DR7 E;  4XBO A;  4D81 A;  4B3R M;  3ADG A;  5JJT A;  3IG5 A;  3L26 A;  3QAU A;  3GLI B;  2R18 A;  4BCA A;  1QQW A;  2JA2 A;  1W24 A;  3LVV A;  1E9R A;  1E94 E;  4DR7 M;  2XMO A;  1QAQ A;  4H2G A;  3H62 B;  5FTL A;  4O5G A;  1PJJ A;  1OJL A;  4WUR A;  2Z4S A;  4WFT A;  3SHF A;  2N3H A;  4L5N C;  1IXS B;  5AE1 A;  3TGH A;  3QFM A;  2DXL A;  5GTU A;  3QFO A;  4K0K M;  2HHH M;  2EWL A;  3IWC A;  2XGN A;  4II7 A;  3N5U A;  1WXQ A;  4GKK M;  4IBC A;  2Z4R A;  2O5R A;  2NUF A;  2UXC M;  1O0W A;  2VQF E;  1IN8 A;  2FTX B;  2LUP B;  4LF8 M;  4B7H A;  1OIE A;  1FJG M;  2X49 A;  4DV5 E;  2XH9 A;  4I5S A;  1TGU A;  4LAC C;  3FD9 A;  2IHR 1;  1FJM A;  2UUB E;  3GQ5 A;  2RTX A;  4FCV A;  1Z59 A;  4M0D A;  1MF8 A;  1TH3 A;  5JPE A;  2UU9 M;  2G7H A;  2M60 A;  4FWH A;  2ZM6 E;  3TL4 X;  3U6S A;  4DV2 M;  4IYP C;  4X66 E;  1HO5 A;  4GKJ M;  4MB7 A;  2NA2 A;  2LUQ A;  4JA7 A;  5B8I A;  1IXZ A;  4MGY E;  4DR3 E;  4KZS A;  3ADL A;  4LF5 E;  3HPS A;  4GIP A;  2FE8 A;  3GLH A;  2F5O A;  4NXM M;  5FSW A;  2MC6 A;  3L28 A;  2CV0 A;  3RE8 A;  3GRV A;  1G59 A;  4FCW A;  3H68 A;  3RMP A;  3H60 A;  1Z5A A;  3WHL A;  1Z2W A;  1K3W A;  2YZT A;  2KA6 B;  3BOS A;  3GLH B;  4I5N C;  4OU7 A;  2L09 A;  3DF6 A;  5EQT A;  3M0E A;  2KEB A;  1XNR M;  2R4E A;  1XWI A;  3MHV C;  2QPA A;  1TH4 A;  1XMO E;  4V0W A;  2VF1 A;  1QZM A;  3DSC A;  5ITR A;  4G4O A;  2UXD M;  4JI7 M;  2VE7 C;  4UT3 B;  3U6E A;  4DR5 M;  4X64 E;  5FTK A;  3HU1 A;  2C99 A;  2CE7 A;  2QCU A;  3HVQ A;  3HPZ A;  2V86 A;  1NSF A;  4OOG C;  4MOV A;  2CFO A;  3D8B A;  3C5W C;  2DB2 A;  3U61 A;  3H69 A;  4B3M E;  4LG2 A;  3ZH9 B;  3U6Q A;  2DWN A;  1N36 E;  5FTJ A;  3K92 A;  4DV4 E;  1J26 A;  1IBK M;  3H66 A;  4B3M M;  3RL3 A;  2XLJ A;  4NZV A;  2DWM A;  1DGB A;  2J7N A;  5KPZ A;  2C9O A;  4NRW A;  3HU3 A;  3H63 A;  3FUW A;  4YY3 E;  4AG5 A;  4L4U A;  4DR4 M;  1PM5 A;  1SR9 A;  3U6O A;  4DR1 M;  1DGF A;  3U6M A;  1JK7 A;  3HGI A;  1IN5 A;  4PDI A;  1T70 A;  1PJI A;  4DV1 M;  3SHG B;  3KFU G;  2NYM C;  3UJN A;  3KOY E;  1UTE A;  4LJ8 A;  4FBW A;  2ZOA A;  4B08 A;  3U6L A;  4JI1 M;  1ZQ9 A;  3VFD A;  4FWG A;  5E26 A;  2A5Y B;  2QFP A;  3P1X A;  1NNU C;  3FUU A;  4NOO B;  3UGJ A;  4GC9 A;  4KO8 A;  4XPN A;  3KVW A;  2YT4 A;  4PCZ A;  2QEN A;  2DZN B;  2UUA E;  5EP3 A;  4LCB A;  3ZCB B;  2Z1A A;  3PNV A;  4IL1 A;  2XF3 A;  3MK6 A;  3JTZ A;  3WHK A;  4O4K A;  3H64 A;  1T4L B;  3J27 B;  5JI2 E;  1Q39 A;  2YVT A;  3U6P A;  4FBK A;  3KW6 A;  1KBP A;  1N32 M;  4GH9 A;  4D80 A;  4DHL A;  1R2Y A;  4H1S A;  3JU0 A;  2EZ6 A;  4G6Z A;  3GPP A;  1DO2 A;  3TWL A;  2Q8U A;  3PSN A;  5H37 D;  4JI8 E;  3LQR A;  4REZ A;  3I4Y A;  4MGZ E;  3UZU A;  4G4R A;  4F0Z A;  2IE3 C;  3GPX A;  3LLH A;  3K8Z A;  3MJ5 A;  4X65 M;  4IBK A;  3EIE A;  1MX0 A;  3FTE A;  1S3N A;  1HNX E;  4GRI A;  3L29 A;  2Y21 A;  3JR5 A;  1L2B A;  4M2Z A;  3AL0 C;  2C96 A;  4LZZ A;  5BR8 M;  1L1T A;  5LMN M;  3QFN A;  2K4V A;  5AE3 A;  7CAT A;  3HHW A;  4AKH A;  2B7V A;  4DR2 E;  3C4B A;  1V73 A;  4M0V A;  1W5T A;  1QAN A;  3QFK A;  3TPZ A;  2EO2 A;  2RS7 A;  3B9P A;  2E5L M;  1GLN A;  2L3C A;  3CTW B;  3J7Y p;  2XEP A;  2VII A;  2R17 A;  3CK2 A;  4B2O A;  4B3T M;  1Z5B A;  5E6J A;  3AV0 A;  1PKP A;  2HKJ A;  3R8F A;  4LF7 E;  4LJ9 A;  3T1I A;  2C98 A;  4GIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...