3AV0A

Crystal structure of mre11-rad50 bound to atp s
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
369
structure length
369
Chain Sequence
GSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDNVDIESLNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords DNA double-strand break repair protein mre11
publication title Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
rcsb
source organism Methanocaldococcus jannaschii
total genus 101
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3av0A03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3av0A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3av0A01
2NPPC 2BCDA 2IAEC 4JA7A 4V0VA 4I5LC 4O24A 4H2IA 4MOVA 4O43A 4TUIA 2HY1A 4B2OA 3K7WC 1U32A 4FBKA 2AHDA 3EGGA 1JK7A 3H62B 3FGAC 4F0ZA 3DSDA 2BQ8X 3HVQA 3IVEA 3K7VC 4H2FA 4MOYA 2Z1AA 2QFRA 2NXFA 4DHLA 1OIEA 1II7A 5J28A 2WDEA 3V4YA 2QFPA 1KBPA 1T71A 1S3MA 4TUGA 3C5WC 3IVDA 2HYPA 3QFNA 4J6OA 4Q7FA 3RQZA 5C1VA 4ORAA 2WDDA 4FBQA 2DFJA 1T70A 3H61A 4LTYA 3H66A 3AUZA 1HPUA 4FBWA 2GJUA 3RL3A 1SU1A 1S70A 2O8GA 2XMOA 1UTEA 3QFKA 3GVEA 4ZVZA 5IOHA 1Z2XA 4MP0A 1S95A 1V73A 4M0VA 1S3LA 1XZWA 1QFCA 3RL4A 2NYMC 5JPEA 3THNA 3H60A 4H2BA 4H2GA 3ZU0A 2YVTA 2BDXA 2CV9A 3PSNA 3DSCA 4UT2A 5EQVA 3JYFA 3QG5C 1TCOA 4UWQA 3P71C 1FJMA 5GTUA 4O5GA 3T1IA 3DW8C 4ORCA 4ZX2A 4XPNA 4OR9A 5INBA 2WDCA 1HP1A 2Z72A 4DSYA 3CK2A 3H63A 3N5UA 3E7BA 2Q8UA 4DT2A 3H67A 1S8EA 5JPFA 1Z2WA 2R17A 4YKEA 2ZBMA 4LACC 4WWLA 2NYLC 2KKNA 4LU9A 1USHA 3TGHA 5B8IA 2A22A 3IB8A 4O4KA 1HO5A 4HD0A 1M63A 1W24A 3THOB 5JJTA 4FCXA 4V0WA 2IE4C 4V0XA 1XM7A 4IYPC 4G9JA 1UF3A 2USHA 1AUIA 3RL5A 1IT6A 2JOGA 3H64A 3LL8A 1QHWA 1NNWA 4IL1A 3H68A 3ICFA 4NZVA 1G5BA 1WARA 4H1YP 2WDFA 3C9FA 3PSOA 3KBPA 3IB7A 1MF8A 3EGHA 4ORBA 2HYOA 2QJCA 2Z06A 3ZTVA 3AV0A 4H1SA 4JA9A 4KKZA 5F3WA 1WAO1 5DNYA 3E7AA 2P6BA 2O8AA 3QFMA 5HPEA 1OIDA 1OI8A 4KBPA 4UT3A 3H69A 3QFOA 4I5NC 1S3NA 4UT3B 2IE3C
chains in the Genus database with same CATH superfamily
4DV2M 2HGHA 2JZ1A 1G2FC 3L28A 1FJGM 3JAMC 2EMLA 3U6CA 1Q3BA 2LH0A 4JV5E 1T39A 2JWSA 2JXNA 3VK8A 3GLIB 2ZTDA 2CFOA 2G8LA 2EOHA 4H2FA 3HHXA 4PD2A 3SMSA 2CTDA 1T71A 3GLFA 4FCTA 5KL5A 3SBJA 2BB8A 3GRRA 2EA0A 1X6FA 3LVVA 1W5TA 4FBWA 7CATA 2VDBB 1Z2XA 5AC5A 4JI2M 4LY6A 3LVWA 1S3LA 2EPLX 4PT5A 4RKUF 4FK5C 2YSOA 2LT7A 2JA2A 3GPYA 2EOZA 2EMKA 2A5YB 3VKGA 3HHYA 4DKKA 1TN9A 2JUJA 2WDCA 1NJGA 1JK1A 4DR2E 1GQEA 2D7GA 2EMAA 3CK2A 3N5UA 2C9CA 5IZ7D 2DZOB 2FGGA 1OAOC 1J7KA 4X65M 2LCEA 2LTRA 2H1RA 3U61A 3M6AA 2X8AA 4HD0A 1W5SA 1MJGM 1G71A 2XSZD 2EOJA 1WHNA 2JOXA 3TL4X 4QHSA 4B3TM 2C98A 3HJ8A 2JY5A 3K9OA 2F5SA 1BB8A 4H1YP 1DV0A 3J27B 3PFIA 1NSFA 2FV4B 2B7VA 3M99B 2I7PA 1PJJA 3KOWE 1RC7A 1A1FA 4AQYM 3UK6A 4I5LC 1HNZE 4O24A 2EOYA 3E46A 1KJKA 1NEIA 2EMYA 2L2MA 3AJIB 5A6AA 3C6MA 4LZJA 1R2YA 3EGGA 2EWLA 4R3DA 3H62B 3HVQA 4L8NA 3KOZE 2EQ1A 3U5ZB 2RS7A 2NXFA 4MGHA 1ZU1A 1KBPA 2EM2A 5LL6R 2MKDA 4IBBA 4FBQA 2VQFE 2QBYA 2K7IA 1N32E 1SXJB 3TQSA 3HTXA 1D2NA 2JP7A 4JI1E 3KWRA 5KQ8A 5AC4A 1QAOA 4TUWA 4QOSA 2R46A 1Q02A 5AE2A 4H2GA 4FWGA 2EN7A 2AHMA 4PDGA 3JAMS 1TDHA 3C3EA 4D81A 4B7FA 4MLQA 3KXEC 4L6V6 1OQYA 1NY6A 3A98B 5FSWA 2E72A 4GC5A 1GL6A 1YFHA 1NHWC 2BBGA 2B3TB 1GLNA 4XGIA 1QAQA 4GKJE 2KRKA 1A1LA 2NYLC 4LU9A 2KDLA 2O5RA 4NSOB 5B8IA 4NSRA 1YUBA 2M9AA 3CF0A 2MKNA 3GLGA 1HNXE 3U6PA 4RF1A 2V1UA 1N75A 3GLIE 4WPYA 1NNJA 2EPCA 3THGA 4JXJA 1WARA 4LF6M 1DI2A 1XNRE 4Z8XA 2WSEF 1VEGA 3ZTVA 2CHVA 1QYRA 4WP2A 3EPJA 3R8FA 2XSZA 4MGZE 2DB2A 4DV6M 1OIDA 1GTKA 4UT3A 4LF4E 4R7GA 2JY9A 4WSPA 2UXBM 4B2OA 4IBJA 5AE3A 4FBKA 2J7JA 2EJ4A 3BF2A 1GJSA 2GLIA 4DHLA 3KSXA 2UU9E 1G59A 4J6OA 1YZ9A 1R5LA 2HHHE 4GKKM 2DXIA 2YTPA 4M9ZA 4MGYE 1RMDA 2ENHA 2FOIC 2EPRA 4L78A 1PJQA 5ITXE 3UJNA 2VRDA 2MR9A 3B7NA 4R2AA 3FYCA 3D8LA 4AZFA 1STUA 1KYQA 1ZBQA 4HEIA 2CV9A 1QAMA 1F2IG 4MGIE 4B7GA 3P71C 2DZLA 2EPXA 5FTJA 4ORCA 1ZMVA 4RH8A 5INBA 2DAKA 4LF7E 1L4SA 4ZYEA 2JWOA 2R45A 1S8EA 5EXPA 5JPFA 4XBOA 1R4GA 4JYAM 3EPKA 2YEQA 4LFAE 4L8RC 1IBLE 5FLXS 4B3SM 2CEAA 1IBKE 2UUAM 4X66M 3HPZA 5JJTA 3SFZA 3I01M 1GO5A 1NVMA 4G9JA 3RL5A 3R9XB 4DV3M 4DV4M 4I4LA 1N36M 2EPMX 5DFLA 2CRUA 3HKPA 2WDFA 3FTDA 1ZMUA 2LXEA 4Q35B 3GO8A 3HU1A 3UZUA 4LJAA 5FTKA 3SHGB 1SXJE 5EJCA 2J5YA 2MH8A 3J7BA 2V8QB 2Q2EB 1KFVA 3FRIA 2DRPA 4WX9A 3J81C 1YYWA 3I4VA 3UK3C 4DUYM 2J7NA 2HY1A 2JY6B 2QP9X 3MHSC 2QHOB 2QSFX 2F5PA 2EOQA 1HR0E 2QZ4A 1S3MA 3RQZA 4RNAA 4TUGA 4ORAA 3GLHB 1PM5A 2R44A 4GHLA 3A45A 5FTNA 2EOSA 2YWQA 1UTEA 3HXLA 2VE7C 2BWEA 2MJ5B 2MGWA 1JQJC 2MDGA 2M4IA 5BR8M 1TCOA 2R65A 4YY3M 5IWAM 1TDZA 1NO1A 4ZYDA 2ZOAA 3T1IA 1E9RA 3HQ1A 5ITTA 3T6PA 3DJWA 5KQDA 4DSYA 1A1JA 2DGCA 3B7ZA 5ITUA 3U6EA 2RRUA 1FJGE 2DXNA 3HHWA 5E6JA 2HAKA 2ZBMA 5E26A 1QANA 2VIIA 2B7TA 2F8BA 2LTUA 3ZCBB 4R2EA 4BCAA 2DZNB 2LMZA 1L2DA 2KONA 3L26A 4R71A 4JI6M 2UUBM 4BLCA 3AFHA 3Q8GA 3A46A 1N78A 2EMFA 1YSYA 2KOUA 1N33M 4ORBA 1HQYE 4H1SA 4JI2E 1SFEA 3T1HM 5KPTA 2V87A 3PVSA 4JI5E 1MN3A 2IE3C 2EM4A 4I5SA 2BCDA 2V88A 2EMCA 3CTWB 4TUIA 3FYDA 1Q39A 4AKGA 5J28A 3LLHA 2UXCM 2ERCA 1D0MA 4OW0A 4YHHE 4QOZC 3H66A 2LUQA 4X65E 3KS4A 4DR5M 1PGYA 3ADJA 2JR1A 4IBIA 5L8RF 2YTIA 1IFYA 2CSHA 4II7A 2EORA 2JY7A 4B3TE 2UUCM 4DR4M 3L2AA 2RSIA 2KHHA 1ZAAC 2DIXA 1GKIA 1IXSA 4JI3M 3LQRA 2DHYA 1GL7A 1OFIA 1AIPC 2EMHA 2N3HA 2CHGA 1HO5A 2RS6A 2NUGA 2L6OA 3EPHA 1VDDA 1NNUC 1YYKA 3FD9A 4L5NC 3DA1A 1QHWA 4NRVA 4FWHA 3OTOM 2EPZA 1P3QQ 2EP3A 5LLQA 3GLHE 3FLOA 3AV0A 1YUJA 1WAO1 1IY2A 2GQFA 2XLJA 3AL0C 2GHFA 3QWLA 2DKLA 5HPEA 1QU6A 1WGLA 2VF8A 3SASA 3DF6A 1QNTA 2EMZA 3I51A 3T1YM 4M9XA 5EP2A 1U32A 1PJSA 2DNAA 4OVZA 2XF3A 4DV5E 3ADLA 2QFRA 2OQ4A 2D7HA 2RTXA 4WXCA 2HYPA 3GLFB 5C1VA 2XH9A 2HWJA 2DWLA 4LRTA 3J7AG 2R4JA 1R2ZA 4M0VA 1UFZA 1E94E 3H60A 3HZJA 3DSCA 3E21A 4LF8M 5EQVA 2W82A 2CE7A 1B69A 4LF6E 4EIWA 3VKHA 4O5GA 4NOOB 4NXMM 2YFQA 2FE8A 3NBIA 2Z72A 1X6HA 4DR3E 4M30A 1YPNA 2V85A 3BGHA 3U60A 4DR6E 5KL7A 4B3RM 1EE8A 4DR7M 1T4OA 4J8ZA 3KW6A 2DWMA 2EJSA 3U61B 3EIHA 1SXJD 3J7Yp 1LTMA 2EN8A 4IYPC 2C99A 2USHA 4DV7M 3GQ4A 4NXNM 1BBGA 1QDTA 3IB7A 2HYOA 2OO9A 2XEPA 4KKZA 1SG9A 2RGHA 8CATA 2KZUA 4KBPA 4DV1M 3SMPA 2DXLA 5CFFE 1VEJA 4XK8F 4RF0A 2EL5A 3C58A 4UN2B 1T3TA 2O25A 3K7VC 2YRMA 5IREB 1J5EM 3LCVB 3V4YA 3IVDA 3QFNA 1DGHA 4BC9A 5A69A 4WSGA 4LJ6A 2LVNC 2QBYB 1T38A 2GJUA 3SYKA 2DWZB 4R2CA 5A2QC 1S70A 4ZVZA 3GVEA 4MB7A 5IOHA 3PXGA 1IQPA 2UUAE 4BHCA 4X66E 3IWDA 4LGYA 2E5LE 2CP8A 1ZV1A 3J80S 2Z3XA 2YTOA 4DV4E 1JB0F 2L4FA 3EQ1A 2BDXA 3BBGA 5C18A 4UT2A 5EXXA 5EP3A 4IBKA 1OKSA 4DR1E 2JY8A 2EM9A 5JI3E 2ZO9B 2EOFA 2EOIA 3SYLA 1IY0A 1IXRC 3T15A 2YPNA 3VFDA 3BXWA 4DUYE 4LACC 1NHGC 4IS1C 4KHPM 3GLGB 1VDLA 2ELZA 2DENA 1HNWE 4G6ZA 2KZSA 1IT6A 3LL8A 5ITYA 5FTMA 1NNWA 1DGCA 2YU8A 3L27A 1YLAA 1QZMA 3GLFE 1IN7A 1IN8A 5H37D 1OAIA 2Z06A 1P47A 1SXJA 3GQ5A 5IT9C 2LHCA 4BMJA 4UT3B 1Z1BA 3I4YA 5EP1A 1K3WA 1A5TA 2WCC3 5IWAE 1DO0A 3K6QA 1BVSA 4F0ZA 2J7OA 4AG6A 1XMOM 3K2LA 1IN5A 1TF6A 4DV0E 4JV5M 2ODRD 1WXRA 3KFUG 3H61A 3AUZA 3FE3A 2EOOA 2EO2A 1IBME 4LCBA 1Z5CA 4CJ6A 1V34A 2VF7A 1AUAA 2G7HA 2EPNA 3L00A 1JR3D 2FS1A 4Y28F 2O01F 3RFWA 4F6MA 4H2BA 1PJIA 4JI6E 3BOSA 2B9DA 4G4NA 3C3DA 3C4TA 2Y0QA 1A1GA 3M7GA 3DW8C 4IBDA 2H36X 4OU7A 3T1HE 5ITQA 4RHBB 1OJLA 2MC5A 2Q8UA 3BIDA 2LJUA 3IG5A 4S12A 1F4IA 2NUEA 3TGHA 3F92A 5A2QS 4M0WA 3GPUA 4L15A 4FCXA 2UXCE 2WZJA 1XXHB 4PCZA 3H64A 3AKZA 4OX9E 5EXTA 2CHQA 3V76A 2F4VE 4JN6A 3PSOA 3EGHA 3MHHC 3WHKA 2EM7A 4DR5E 4F9BB 2L3CA 2R0IA 3E7AA 5BPVA 4AG5A 3ZC7B 3GRYA 3C9PA 4AI6A 3B7QA 1XNQM 2MROB 2WBSA 4H2IA 2EOMA 5A6KA 2L33A 3TWMA 3K7WC 2YTGA 2BQ8X 4X62M 4MOYA 2NQ8C 3VYYA 2QFPA 4JI3E 5IXMB 2EMXA 1HNZM 2Z7JA 3ZH9B 4FD2A 3PNYA 2EM3A 2JP9A 3K8ZA 1HPUA 2G3QA 4WW0A 4AKHA 1VEKA 2HL7A 3LW5F 1V33A 1S95A 1V73A 3MSWA 1N32M 3FUTA 4MLVA 4GIPA 4ZYHA 2LO3A 2RSMA 3GLGE 2EN4A 2JVAA 1ZMWA 3F6GA 1ORYB 2EMWA 3KP0E 4I8OA 5JI2E 1TH3A 2D9HA 5GTUA 3RE8A 1TR8A 3ADIA 4WYQB 1JR3A 2L2DA 2R76A 1C1KA 1C7YA 2OPFA 5LMUM 1GJTA 5IV8B 4R2RA 1X3CA 3T1YE 1HJPA 4LFCM 2GNOA 1G8PA 4R2SA 4N4RB 1XC8A 4GRIA 3TQMA 2ENAA 4JI4M 2EKKA 2KNVA 4V0WA 3KP1E 4LJ4A 2ELYA 2JOGA 3GRVA 2HC5A 4PDIA 4LJ5A 1N77A 4IJDA 1CUKA 4A3VB 2F5QA 3C9FA 1EFUB 4DV2E 4LJ9A 3B74A 2YTEA 3H4MA 1WHCA 2QJCA 2DAGA 2DMIA 2ZANA 3GLHA 1N34M 4GITA 1OIPA 1WXQA 2EOEA 2EQ0A 2EM6A 4B7HA 4V0VA 2F5NA 1I94M 3IG8A 3KZYA 3EPLA 4LJ8A 4NXME 2QENA 4BC7A 1O0WA 3FIGA 1Z59A 3C5WC 1LV7A 3MHVC 4IBCA 4JI8M 1T70A 2EPAA 2QNJA 4WURA 4Z6YA 4DR7E 4IBEA 1GVNA 2UU9M 1IN4A 2K9DA 2K0BX 5JPEA 4I81A 4DV7E 1IQSA 1WGNA 4NXNE 3JYFA 3KVWA 3FTFA 1XXHE 3I04M 4BBAA 1GZ6A 1PRBA 2CWBA 4ZX2A 2DLKA 4AW4A 1HP1A 2XFTA 2APLA 2EMBA 1IXSB 3E7BA 1ZBTA 2QCUA 4YKEA 2KXEA 2EN1A 4WWLA 4P7DA 4IBFA 5DYGA 5TSEA 3J81S 5GKNA 1M63A 1RU3A 2Y20A 4LF7M 2EMIA 3JR4A 1W24A 1J5EE 2IE4C 2LVOC 2HKJA 2L92A 1AUIA 4F1IA 4LFAM 1NCSA 2KRUA 3H68A 4AQYE 2L8TA 2V86A 2K47A 2DAIA 2N35A 3J7AS 1XB2B 5ITRA 3FUVA 3W0FA 1J26A 1L2BA 2FFJA 1PKPA 2KNAA 2EN6A 3NWLA 2WBTA 1L8QA 1HQCA 1ZR9A 3RGSA 4MOVA 4O43A 4NRWA 2OOBA 4LF5M 3GRUA 2DSYA 3FRHA 2N3GA 3IVEA 2X49A 4OVZB 2Z1AA 4G4RA 3DZDA 2P5TA 1G41A 1ZAEA 1A1HA 2NUFA 3LMLA 1YE9A 1G4AE 1NV9A 2EUCA 2I7NA 2EN3A 1IM2A 2D7EA 3E9SA 2ODRC 2UXDM 3ZOQB 3HJQA 2ZTCA 4D82A 2YVTA 4ZPXA 3C4BA 4GZNC 1QUSA 3QG5C 3FUXA 1EH6A 3L25A 1K82A 4REZA 1EIJA 1DQ3A 1UBDC 2NA2A 2ZAMA 2Z8YM 5LMNM 2YRKA 4FVMA 2XGNA 3JTZA 3DOAA 3U60B 3TE6A 4R2PA 4K0KM 1YUIA 5EQTA 3VYXA 3LMMA 2QPAA 3GPXA 1XMOE 4P16A 2KHXA 4IJEA 1QVRA 4V0XA 2LBSB 2C9OA 1UF3A 2CV1A 2ZM6M 3IHPA 1NV8A 2X4AA 2YU5A 4DV6E 1R7RA 1TF3A 1WR1B 2Y0TA 3KZZA 1S3SA 2CV0A 4L4UA 1G2DC 1R6BX 3RMPA 2DI0A 2L2NA 3TWLA 2I13A 4B3MM 4R2QA 2DLQA 2UXBE 3LQQA 4GMQA 2R6FA 2P6BA 4OOGC 2VQEM 4JI7M 4IBGA 2F5OA 4Q28A 4D80A 3GLIA 2M5ZA 3FUUA 4GKKE 4JI5M 3FGAC 1HT1E 2H5XA 1VQ1A 4LRSA 3L29A 1NY5A 4ITQA 4GEWA 1EH8A 4F9AB 3HJSA 4F2LA 1DGHB 4GHAA 5T6JA 4G4QA 2LJHA 4R8OA 3A42A 4FCWA 1SU1A 4MP0A 1VG5A 2Z4SA 1MEYC 3MK6A 2EPKX 4YHHM 1XZWA 1WIVA 1XMQM 3GPPA 1YSAC 2KNZA 2V6ZM 2V89A 4KZSA 1L1ZA 2LNHC 4NL4H 4JYAE 2DAEA 3IECA 4GEQB 2BNKA 4F6NA 2LHGA 3HU3A 4OR9A 1X47A 2JOBA 4B3SE 3GP1A 5EP4A 4LZZA 1XNQE 2YTDA 2QQ8A 5ITXA 4DUZM 4DV3E 1N36E 3TWKA 2LE2A 4X62E 4M2ZA 4WFTA 3VK6A 4LFBM 1YYOA 5KPRA 2JNHA 2FNAA 1XM7A 4QNRA 4M9SA 3ZQJA 1H6UA 3CF6E 4JI0M 2BJWA 3U6MA 4X64M 2HCBA 1QZEA 1MF8A 2MDRA 3D03A 1XWIA 3KS8A 2LVQD 2LWXA 5FLXC 4IIWA 1Z6TA 1N3GA 1DGFA 2IAEC 3HY5A 2ENCA 2BWBA 1Z5AA 2KW0A 1T4NA 2CPNA 3FTEA 4FW9A 1V92A 4G4OA 2AHDA 2N8XA 3DSDA 3U5ZA 1Z5BA 3KOYE 2DWNA 3VDUA 2ADRA 3W67A 4L16A 3AOEA 1RQ0A 2WZOA 4MH0E 4R03A 2YTQA 3DFZA 4LF9M 4R2DA 5LMUE 1D0KA 2EE8A 1T43A 4LFCE 4DV5M 5BR8E 1XHBA 2RGOA 2CV2A 4ZYGA 1LLMC 3FTCA 4YY3E 4JI4E 2I9IA 2LVHA 5A6BD 4FWDA 4Q7JA 3SHFA 3SAUA 4P78A 3ZU0A 4MM3B 1BBOA 2R18A 3F6HA 2LBCA 4LJ7A 3QYEA 2R62A 1QDRA 1N34E 2WSCF 4X8WA 2DHRA 4B08A 2B3TA 4DT2A 2LTSA 3H67A 1Q3CA 2R17A 2FTXB 1I94E 1WJ7A 3SAVA 4KLNA 1NJFA 2L09A 3BBZA 2UUBE 1TH4A 4WXDA 4M0DA 4DR3M 1N33E 2YTNA 5ADZA 3KSJA 4DR6M 5FTLA 3CGWA 4JI8E 4KODA 1UILA 5DYIA 1AH5A 1G5BA 2PRTA 3UMMA 2L6MA 2K6BA 1K3XA 4JA9A 5DNYA 1KSFX 2HJJA 4DR2M 1WHQA 4HLQA 4KWYA 2NPPC 1DGGA 3D8BA 2RQLA 2M7QA 1JK7A 4IJFA 2EL4A 4HEOA 1X5WA 2WDEA 4M9VC 2BJVA 3C6KA 2Z4RA 2DFJA 2E1MA 4CGYB 4QNMA 2UUCE 3RL3A 4DR4E 4F9CB 2XMOA 3HGIA 3QFKA 1EH7A 3GQ3A 3B89A 1E32A 3K9PA 4KT0F 1SR9A 3P1XA 3H4JA 1QFCA 4CHTB 1TF0B 1QUTA 3PSNA 1MGTA 2L2KB 1UM8A 2RPCA 3LCUA 1UHZA 3IWCA 1FJMA 3QAUA 1FNNA 2E5LM 1XXHA 4X9JA 3M0EA 3ECRA 1GABA 5AASA 5KL2A 5A6BA 3Q8XA 1KYIA 4DR1M 2VQFM 4BB9A 1X49A 2MC6A 3HPSA 4LF5E 3OTOE 5IT9S 4MGKE 2L7IA 2A22A 4O4KA 3FUWA 4JI1M 2IHR1 2EKFA 2R4EA 2M1SA 2LVAA 2EL6A 1MX0A 2CUZA 2G5GX 3U6SA 4KO8A 4IL1A 3ILKA 4NZVA 3ICFA 1EKZA 1I4WA 4HTGA 2JYAA 3E0JA 3HHZA 1HNWM 3SAWA 5F3WA 1L2CA 2YZTA 2YRHA 2UXDE 2O8AA 1OFHA 2EPOA 5AE1A 4F2JC 3K92A 3H69A 4I5NC 3U6DA 1TGUA 4QHTA 4JA7A 2KEBA 2DAMA 4GKJM 3U6QA 3AOEC 2XZUA 3SATA 2R1FA 2YTFA 1HNXM 1SXJC 2EPUA 1OIEA 4Q7FA 3W68A 4GC9A 5LMNE 1G3IA 2L7HA 4K0KE 3K1JA 2V83A 1XNRM 2A25A 4LF8E 2DMYA 1PJTA 1X6EA 1A1IA 4DV0M 2EM0A 3RL4A 2ZM6E 4LF4M 4HL4A 5KPZA 1IXZA 1IBMM 1AAYA 1HT2E 3U6OA 1WJPA 3KOXE 4B3RE 3FKEA 4B3ME 4XPNA 2FH0A 1T4LB 1WRJA 2VQEE 4GH9A 3B9PA 2HHHM 3VK7A 4JI7E 2Y21A 5EXSA 2LVPC 1MU5A 2YQZA 2XZFA 2KKNA 1USHA 3VLFB 3E4RA 1J09A 2NABA 4NC6A 5KL6A 2LRSA 4BBYA 3JU0A 3HWSA 2XFSA 1DO2A 2YNMD 3RGPA 1DGBA 4CIZA 2LUPB 2VF1A 3KBPA 4DV1E 2EM5A 2YT4A 4CISA 4DBGB 1T6OA 1IMUA 2ZBKB 3AOGA 1X48A 3QFMA 4OX9M 3HX3A 2EMGA 1XMQE 4FCVA 2V1CA 2F4VM 1S3NA 5KL3A 2OOAA 1X37A 2K4VA 2EZ6A 4G3OA 1IBLM 5A6JA 4NHRA 1IBKM 3VHTB 1FKAE 4LGMA 2GPIA 2DVWB 1II7A 2JZ0A 3HU2A 4BHBA 2C96A 3MMPA 2WDDA 1ZQ9A 4LG2A 4LTYA 3TPZA 4DUZE 4ANRA 1JR3E 3PNVA 4DMIA 2O8GA 3CF2A 1OIZA 5C1BA 4F54A 4LFBE 3KDSE 3EIEA 3NBXX 1OTRA 2NYMC 2YR0A 3THNA 2EN2A 3IWBA 4JI0E 4X64E 2JPAA 5KL4A 3QYBA 4UWQA 2L4EA 1IQOA 2EOXA 2WSFF 4W5WA 3W0LB 4BS9A 1HR0M 2JXPA 2ZAOA 1PDAA 1JK2A 4KHPE 5KO3A 3H63A 3WHLA 3ADGA 1D0LA 1Z2WA 1E9SA 1QQWA 1Y8GA 1L1TA 2M60A 3J2PB 3J80C 2EM8A 3IB8A 3MJ5A 1TTEA 3THOB 3VDPA 3UGJA 2YSPA 2YTJA 1UN6B 4LF9E 3OMLA 3SARA 2EPPA 3JR5A 2LV2A 2EQ3A 1IY1A 1IN6A 3U6LA 2C5RA 2RKOA 1A1KA 3SC3A 2CT1A 2L3JA 3T38A 2KA6B 2WBUA 1OI8A 4AKIA 1TH2A 3QFOA 4P17A 3H09A
chains in the Genus database with same CATH topology
4DV2M 3L28A 1FJGM 3JAMC 3U6CA 1Q3BA 2LH0A 4JV5E 3VK8A 3GLIB 2CFOA 2G8LA 4H2FA 3HHXA 4PD2A 3SMSA 1T71A 3GLFA 4FCTA 3SBJA 3GRRA 2EA0A 3LVVA 1W5TA 4FBWA 7CATA 1Z2XA 4JI2M 4LY6A 3LVWA 1S3LA 4PT5A 2JA2A 3GPYA 2A5YB 3VKGA 3HHYA 4DKKA 2WDCA 1NJGA 4DR2E 1GQEA 2D7GA 3CK2A 3N5UA 2C9CA 5IZ7D 2DZOB 2FGGA 1J7KA 4X65M 2LTRA 2H1RA 3U61A 3M6AA 2X8AA 4HD0A 1W5SA 2XSZD 1WHNA 2JOXA 3TL4X 4QHSA 4B3TM 2C98A 3HJ8A 2F5SA 4H1YP 3J27B 3PFIA 1NSFA 2FV4B 2B7VA 2I7PA 1PJJA 3KOWE 1RC7A 4AQYM 3UK6A 4I5LC 1HNZE 4O24A 2L2MA 3AJIB 4LZJA 1R2YA 3EGGA 2EWLA 4R3DA 3H62B 3HVQA 4L8NA 3KOZE 2RS7A 3U5ZB 2NXFA 4MGHA 1KBPA 5LL6R 4IBBA 4FBQA 2VQFE 2QBYA 1N32E 1SXJB 3TQSA 3HTXA 1D2NA 4JI1E 3KWRA 5KQ8A 1QAOA 4TUWA 4QOSA 2R46A 5AE2A 4H2GA 4FWGA 2AHMA 4PDGA 3JAMS 1TDHA 4D81A 4B7FA 3KXEC 1NY6A 3A98B 5FSWA 4GC5A 1GL6A 1NHWC 2B3TB 1GLNA 4XGIA 1QAQA 4GKJE 2KRKA 2NYLC 4LU9A 2O5RA 4NSOB 5B8IA 4NSRA 1YUBA 3CF0A 3GLGA 1HNXE 3U6PA 4RF1A 2V1UA 1N75A 4WPYA 1NNJA 3THGA 4JXJA 1WARA 4LF6M 1DI2A 1XNRE 4Z8XA 3ZTVA 2CHVA 1QYRA 3R8FA 2XSZA 4MGZE 2DB2A 4DV6M 1OIDA 4UT3A 4LF4E 4R7GA 2JY9A 4WSPA 2UXBM 4B2OA 4IBJA 5AE3A 4FBKA 4DHLA 3KSXA 2UU9E 1G59A 4J6OA 1YZ9A 2HHHE 4GKKM 2DXIA 4M9ZA 4MGYE 2FOIC 4L78A 5ITXE 3UJNA 3FYCA 3D8LA 4AZFA 1STUA 1ZBQA 2CV9A 1QAMA 4MGIE 4B7GA 3P71C 5FTJA 4ORCA 5INBA 4LF7E 2JWOA 2R45A 1S8EA 5EXPA 5JPFA 4XBOA 4JYAM 2YEQA 4LFAE 4L8RC 1IBLE 5FLXS 4B3SM 2CEAA 1IBKE 2UUAM 4X66M 3HPZA 5JJTA 3SFZA 1NVMA 4G9JA 3RL5A 3R9XB 4DV3M 4DV4M 4I4LA 1N36M 3HKPA 2WDFA 3FTDA 2LXEA 3GO8A 3HU1A 3UZUA 4LJAA 5FTKA 3SHGB 1SXJE 5EJCA 3J7BA 2V8QB 2Q2EB 1KFVA 3J81C 1YYWA 3I4VA 4DUYM 2J7NA 2HY1A 2QP9X 2F5PA 1HR0E 2QZ4A 1S3MA 3RQZA 4RNAA 4TUGA 4ORAA 3GLHB 1PM5A 4GHLA 3A45A 5FTNA 1UTEA 3HXLA 2VE7C 1JQJC 2M4IA 5BR8M 1TCOA 2R65A 4YY3M 5IWAM 1TDZA 2ZOAA 3T1IA 1E9RA 3HQ1A 5ITTA 3DJWA 5KQDA 4DSYA 5ITUA 3U6EA 1FJGE 2DXNA 3HHWA 5E6JA 2ZBMA 5E26A 1QANA 2VIIA 2B7TA 2F8BA 3ZCBB 4BCAA 2DZNB 2LMZA 1L2DA 2KONA 3L26A 4JI6M 2UUBM 4BLCA 3AFHA 3A46A 1N78A 1YSYA 2KOUA 1N33M 4ORBA 1HQYE 4H1SA 4JI2E 3T1HM 5KPTA 2V87A 3PVSA 4JI5E 2IE3C 4I5SA 2BCDA 2V88A 3CTWB 4TUIA 3FYDA 1Q39A 4AKGA 5J28A 3LLHA 2UXCM 2ERCA 4OW0A 4YHHE 4QOZC 3H66A 2LUQA 4X65E 3KS4A 4DR5M 3ADJA 2JR1A 4IBIA 4II7A 4B3TE 2UUCM 4DR4M 3L2AA 2DIXA 1GKIA 4JI3M 3LQRA 1GL7A 1OFIA 2N3HA 2CHGA 1HO5A 2RS6A 2NUGA 2L6OA 1VDDA 1NNUC 1YYKA 3FD9A 4L5NC 3DA1A 1QHWA 4NRVA 4FWHA 3OTOM 3FLOA 3AV0A 1WAO1 1IY2A 2XLJA 3AL0C 3QWLA 5HPEA 1QU6A 3SASA 3DF6A 3I51A 3T1YM 4M9XA 5EP2A 1U32A 4OVZA 2XF3A 4DV5E 3ADLA 2QFRA 2OQ4A 2D7HA 2RTXA 2HYPA 3GLFB 5C1VA 2XH9A 2DWLA 4LRTA 3J7AG 2R4JA 1R2ZA 4M0VA 1E94E 3H60A 3DSCA 5EQVA 4LF8M 2W82A 2CE7A 4LF6E 4EIWA 3VKHA 4O5GA 4NOOB 4NXMM 2YFQA 2FE8A 3NBIA 2Z72A 4DR3E 4M30A 2V85A 3U60A 4DR6E 4B3RM 1EE8A 4DR7M 1T4OA 4J8ZA 3KW6A 2DWMA 3U61B 3EIHA 1SXJD 3J7Yp 4IYPC 2C99A 2USHA 4DV7M 3GQ4A 4NXNM 3IB7A 2HYOA 2XEPA 4KKZA 2RGHA 8CATA 2KZUA 4KBPA 4DV1M 3SMPA 2DXLA 5CFFE 4RF0A 3C58A 1T3TA 3K7VC 5IREB 1J5EM 3V4YA 3IVDA 3QFNA 1DGHA 4BC9A 4LJ6A 2QBYB 2GJUA 3SYKA 2DWZB 5A2QC 1S70A 4ZVZA 3GVEA 4MB7A 5IOHA 3PXGA 1IQPA 2UUAE 4X66E 3IWDA 4LGYA 2E5LE 3J80S 2Z3XA 4DV4E 2BDXA 5C18A 4UT2A 5EXXA 5EP3A 4IBKA 4DR1E 5JI3E 2ZO9B 3SYLA 1IY0A 1IXRC 3T15A 3VFDA 4DUYE 4LACC 1NHGC 4KHPM 3GLGB 1HNWE 4G6ZA 2KZSA 1IT6A 3LL8A 5ITYA 5FTMA 1NNWA 3L27A 1QZMA 1IN7A 1IN8A 5H37D 2Z06A 1SXJA 3GQ5A 5IT9C 4UT3B 4BMJA 3I4YA 5EP1A 1K3WA 5IWAE 1DO0A 3K6QA 4F0ZA 2J7OA 4AG6A 1XMOM 3K2LA 1IN5A 4DV0E 4JV5M 2ODRD 3H61A 3KFUG 1WXRA 3AUZA 2EO2A 1IBME 4LCBA 1Z5CA 2G7HA 1JR3D 3RFWA 4H2BA 1PJIA 4JI6E 3BOSA 2B9DA 4G4NA 3C4TA 2Y0QA 3M7GA 3DW8C 4IBDA 2H36X 4OU7A 3T1HE 5ITQA 1OJLA 2MC5A 2Q8UA 3IG5A 4S12A 2NUEA 3TGHA 5A2QS 4M0WA 3GPUA 4L15A 4FCXA 2UXCE 1XXHB 4PCZA 3H64A 3AKZA 4OX9E 5EXTA 2CHQA 2F4VE 4JN6A 3PSOA 3EGHA 3WHKA 4DR5E 4F9BB 2L3CA 3E7AA 5BPVA 4AG5A 3ZC7B 3GRYA 4AI6A 1XNQM 4H2IA 2L33A 3TWMA 3K7WC 2BQ8X 4X62M 4MOYA 2NQ8C 3VYYA 2QFPA 4JI3E 1HNZM 2Z7JA 3ZH9B 4FD2A 3PNYA 3K8ZA 1HPUA 4WW0A 4AKHA 2HL7A 1S95A 1V73A 3MSWA 1N32M 3FUTA 4GIPA 2RSMA 2JVAA 3F6GA 1ORYB 3KP0E 4I8OA 5JI2E 1TH3A 5GTUA 3RE8A 3ADIA 4WYQB 1JR3A 1C1KA 2OPFA 5LMUM 3T1YE 4LFCM 1G8PA 1XC8A 4GRIA 4JI4M 4V0WA 3KP1E 4LJ4A 2JOGA 3GRVA 4PDIA 4LJ5A 1N77A 4A3VB 2F5QA 3C9FA 4DV2E 4LJ9A 3H4MA 2QJCA 2ZANA 3GLHA 1N34M 4GITA 1WXQA 4B7HA 4V0VA 2F5NA 1I94M 3IG8A 4LJ8A 4NXME 2QENA 4BC7A 1O0WA 3FIGA 1Z59A 3C5WC 1LV7A 3MHVC 4IBCA 4JI8M 1T70A 4WURA 4Z6YA 4DR7E 4IBEA 1GVNA 2UU9M 1IN4A 5JPEA 4I81A 4DV7E 4NXNE 3JYFA 3KVWA 3FTFA 4BBAA 1GZ6A 4ZX2A 4AW4A 1HP1A 2XFTA 1IXSB 3E7BA 1ZBTA 2QCUA 4YKEA 2KXEA 4WWLA 4P7DA 4IBFA 5DYGA 3J81S 5GKNA 1M63A 2Y20A 4LF7M 1W24A 3JR4A 1J5EE 2IE4C 2HKJA 2L92A 1AUIA 4LFAM 2KRUA 3H68A 4AQYE 2L8TA 2V86A 2K47A 3J7AS 5ITRA 3FUVA 3W0FA 1J26A 1L2BA 2FFJA 1PKPA 3NWLA 1L8QA 1HQCA 3RGSA 4MOVA 4O43A 4NRWA 4LF5M 3GRUA 2DSYA 2N3GA 3IVEA 2X49A 4OVZB 2Z1AA 4G4RA 3DZDA 2P5TA 1G41A 1ZAEA 2NUFA 3LMLA 1YE9A 1G4AE 2EUCA 2I7NA 1IM2A 2D7EA 3E9SA 2ODRC 2UXDM 3ZOQB 3HJQA 4D82A 2YVTA 4ZPXA 3C4BA 3QG5C 3FUXA 3L25A 1K82A 4REZA 1DQ3A 2NA2A 2ZAMA 5LMNM 4FVMA 2XGNA 3JTZA 3DOAA 3U60B 3TE6A 4K0KM 5EQTA 3VYXA 3LMMA 2QPAA 3GPXA 1XMOE 4P16A 2KHXA 4IJEA 1QVRA 4V0XA 2LBSB 2C9OA 1UF3A 2CV1A 2ZM6M 2X4AA 4DV6E 1R7RA 2Y0TA 1S3SA 2CV0A 4L4UA 1R6BX 3RMPA 2L2NA 3TWLA 4B3MM 2UXBE 3LQQA 4GMQA 2P6BA 4OOGC 2VQEM 4JI7M 4IBGA 2F5OA 4Q28A 4D80A 3GLIA 2M5ZA 3FUUA 4GKKE 4JI5M 3FGAC 1HT1E 4LRSA 3L29A 1NY5A 4ITQA 4F9AB 3HJSA 1DGHB 4GHAA 5T6JA 4G4QA 2LJHA 4R8OA 3A42A 4FCWA 1SU1A 4MP0A 2Z4SA 3MK6A 4YHHM 1XZWA 1XMQM 3GPPA 2V6ZM 2V89A 4KZSA 1L1ZA 2LNHC 4NL4H 4JYAE 4GEQB 2BNKA 3HU3A 4OR9A 1X47A 2JOBA 4B3SE 3GP1A 5EP4A 4LZZA 1XNQE 5ITXA 4DUZM 4DV3E 1N36E 3TWKA 2LE2A 4X62E 4M2ZA 4WFTA 3VK6A 4LFBM 1YYOA 5KPRA 2FNAA 1XM7A 4QNRA 4M9SA 1H6UA 3CF6E 4JI0M 2BJWA 3U6MA 4X64M 2HCBA 1MF8A 2MDRA 3D03A 1XWIA 3KS8A 2LWXA 5FLXC 4IIWA 1Z6TA 1DGFA 2IAEC 2CPNA 1Z5AA 2KW0A 1T4NA 3FTEA 4FW9A 4G4OA 2AHDA 3DSDA 3U5ZA 1Z5BA 3KOYE 2DWNA 3VDUA 4L16A 3AOEA 1RQ0A 2WZOA 4MH0E 4R03A 3DFZA 4LF9M 5LMUE 4LFCE 4DV5M 5BR8E 1XHBA 2RGOA 2CV2A 3FTCA 4YY3E 4JI4E 4FWDA 3SAUA 3SHFA 4P78A 3ZU0A 4MM3B 2R18A 3F6HA 4LJ7A 2R62A 1N34E 4X8WA 2DHRA 4B08A 4DT2A 2LTSA 3H67A 1Q3CA 2R17A 2FTXB 1I94E 3SAVA 4KLNA 1NJFA 2L09A 2UUBE 1TH4A 4M0DA 4DR3M 1N33E 5ADZA 3KSJA 4DR6M 5FTLA 4JI8E 4KODA 1UILA 5DYIA 1G5BA 3UMMA 2L6MA 1K3XA 4JA9A 5DNYA 1KSFX 4DR2M 1WHQA 4HLQA 2NPPC 1DGGA 3D8BA 2M7QA 1JK7A 4IJFA 2WDEA 2BJVA 2Z4RA 2DFJA 2E1MA 4CGYB 4QNMA 2UUCE 3RL3A 4DR4E 4F9CB 2XMOA 3HGIA 3QFKA 3GQ3A 1E32A 1SR9A 3P1XA 1QFCA 4CHTB 3PSNA 2L2KB 1UM8A 1UHZA 3IWCA 1FJMA 3QAUA 1FNNA 2E5LM 1XXHA 3M0EA 5AASA 3Q8XA 1KYIA 4DR1M 2VQFM 4BB9A 1X49A 2MC6A 3HPSA 4LF5E 3OTOE 5IT9S 4MGKE 2L7IA 2A22A 4O4KA 3FUWA 4JI1M 2IHR1 2R4EA 2M1SA 1MX0A 2CUZA 2G5GX 3U6SA 4KO8A 4IL1A 3ILKA 3ICFA 4NZVA 1EKZA 1I4WA 3E0JA 3HHZA 1HNWM 3SAWA 5F3WA 1L2CA 2YZTA 2UXDE 2O8AA 1OFHA 5AE1A 3K92A 3H69A 4I5NC 3U6DA 1TGUA 4QHTA 4JA7A 2KEBA 4GKJM 3U6QA 3AOEC 2XZUA 3SATA 1HNXM 1SXJC 1OIEA 4Q7FA 4GC9A 5LMNE 1G3IA 2L7HA 4K0KE 3K1JA 2V83A 1XNRM 4LF8E 2DMYA 4DV0M 3RL4A 2ZM6E 4LF4M 4HL4A 5KPZA 1IXZA 1IBMM 1HT2E 3U6OA 3KOXE 4B3RE 3FKEA 4B3ME 4XPNA 1T4LB 2VQEE 4GH9A 3B9PA 2HHHM 3VK7A 4JI7E 2Y21A 5EXSA 1MU5A 2YQZA 2XZFA 2KKNA 1USHA 3VLFB 3E4RA 1J09A 2LRSA 4BBYA 3JU0A 3HWSA 2XFSA 1DO2A 2YNMD 3RGPA 1DGBA 2LUPB 2VF1A 3KBPA 4DV1E 2YT4A 4CISA 2ZBKB 3AOGA 1X48A 3QFMA 4OX9M 1XMQE 4FCVA 2V1CA 2F4VM 1S3NA 1X37A 2K4VA 2EZ6A 1IBLM 1IBKM 1FKAE 4LGMA 2DVWB 1II7A 3HU2A 2C96A 2WDDA 1ZQ9A 4LG2A 4LTYA 3TPZA 4DUZE 3PNVA 4DMIA 2O8GA 3CF2A 5C1BA 4F54A 4LFBE 3KDSE 3EIEA 2NYMC 2YR0A 3THNA 3IWBA 4JI0E 4X64E 4UWQA 4W5WA 3W0LB 4BS9A 1HR0M 2ZAOA 4KHPE 3H63A 5KO3A 3WHLA 3ADGA 1Z2WA 1E9SA 1QQWA 1L1TA 2M60A 3J2PB 3J80C 3IB8A 3MJ5A 3THOB 3VDPA 3UGJA 4LF9E 3OMLA 3SARA 3JR5A 1IY1A 1IN6A 3U6LA 2C5RA 2RKOA 3SC3A 2L3JA 3T38A 2KA6B 1OI8A 4AKIA 1TH2A 3QFOA 3H09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPP C;  2BCD A;  2IAE C;  4JA7 A;  4V0V A;  4I5L C;  4O24 A;  4H2I A;  4MOV A;  4O43 A;  4TUI A;  2HY1 A;  4B2O A;  3K7W C;  1U32 A;  4FBK A;  2AHD A;  3EGG A;  1JK7 A;  3H62 B;  3FGA C;  4F0Z A;  3DSD A;  2BQ8 X;  3HVQ A;  3IVE A;  3K7V C;  4H2F A;  4MOY A;  2Z1A A;  2QFR A;  2NXF A;  4DHL A;  1OIE A;  1II7 A;  5J28 A;  2WDE A;  3V4Y A;  2QFP A;  1KBP A;  1T71 A;  1S3M A;  4TUG A;  3C5W C;  3IVD A;  2HYP A;  3QFN A;  4J6O A;  4Q7F A;  3RQZ A;  5C1V A;  4ORA A;  2WDD A;  4FBQ A;  2DFJ A;  1T70 A;  3H61 A;  4LTY A;  3H66 A;  3AUZ A;  1HPU A;  4FBW A;  2GJU A;  3RL3 A;  1SU1 A;  1S70 A;  2O8G A;  2XMO A;  1UTE A;  3QFK A;  3GVE A;  4ZVZ A;  5IOH A;  1Z2X A;  4MP0 A;  1S95 A;  1V73 A;  4M0V A;  1S3L A;  1XZW A;  1QFC A;  3RL4 A;  2NYM C;  5JPE A;  3THN A;  3H60 A;  4H2B A;  4H2G A;  3ZU0 A;  2YVT A;  2BDX A;  2CV9 A;  3PSN A;  3DSC A;  4UT2 A;  5EQV A;  3JYF A;  3QG5 C;  1TCO A;  4UWQ A;  3P71 C;  1FJM A;  5GTU A;  4O5G A;  3T1I A;  3DW8 C;  4ORC A;  4ZX2 A;  4XPN A;  4OR9 A;  5INB A;  2WDC A;  1HP1 A;  2Z72 A;  4DSY A;  3CK2 A;  3H63 A;  3N5U A;  3E7B A;  2Q8U A;  4DT2 A;  3H67 A;  1S8E A;  5JPF A;  1Z2W A;  2R17 A;  4YKE A;  2ZBM A;  4LAC C;  4WWL A;  2NYL C;  2KKN A;  4LU9 A;  1USH A;  3TGH A;  5B8I A;  2A22 A;  3IB8 A;  4O4K A;  1HO5 A;  4HD0 A;  1M63 A;  1W24 A;  3THO B;  5JJT A;  4FCX A;  4V0W A;  2IE4 C;  4V0X A;  1XM7 A;  4IYP C;  4G9J A;  1UF3 A;  2USH A;  1AUI A;  3RL5 A;  1IT6 A;  2JOG A;  3H64 A;  3LL8 A;  1QHW A;  1NNW A;  4IL1 A;  3H68 A;  3ICF A;  4NZV A;  1G5B A;  1WAR A;  4H1Y P;  2WDF A;  3C9F A;  3PSO A;  3KBP A;  3IB7 A;  1MF8 A;  3EGH A;  4ORB A;  2HYO A;  2QJC A;  2Z06 A;  3ZTV A;  3AV0 A;  4H1S A;  4JA9 A;  4KKZ A;  5F3W A;  1WAO 1;  5DNY A;  3E7A A;  2P6B A;  2O8A A;  3QFM A;  5HPE A;  1OID A;  1OI8 A;  4KBP A;  4UT3 A;  3H69 A;  3QFO A;  4I5N C;  1S3N A;  4UT3 B;  2IE3 C; 
#chains in the Genus database with same CATH topology
 4DV2 M;  2HGH A;  2JZ1 A;  1G2F C;  3L28 A;  1FJG M;  3JAM C;  2EML A;  3U6C A;  1Q3B A;  2LH0 A;  4JV5 E;  1T39 A;  2JWS A;  2JXN A;  3VK8 A;  3GLI B;  2ZTD A;  2CFO A;  2G8L A;  2EOH A;  4H2F A;  3HHX A;  4PD2 A;  3SMS A;  2CTD A;  1T71 A;  3GLF A;  4FCT A;  5KL5 A;  3SBJ A;  2BB8 A;  3GRR A;  2EA0 A;  1X6F A;  3LVV A;  1W5T A;  4FBW A;  7CAT A;  2VDB B;  1Z2X A;  5AC5 A;  4JI2 M;  4LY6 A;  3LVW A;  1S3L A;  2EPL X;  4PT5 A;  4RKU F;  4FK5 C;  2YSO A;  2LT7 A;  2JA2 A;  3GPY A;  2EOZ A;  2EMK A;  2A5Y B;  3VKG A;  3HHY A;  4DKK A;  1TN9 A;  2JUJ A;  2WDC A;  1NJG A;  1JK1 A;  4DR2 E;  1GQE A;  2D7G A;  2EMA A;  3CK2 A;  3N5U A;  2C9C A;  5IZ7 D;  2DZO B;  2FGG A;  1OAO C;  1J7K A;  4X65 M;  2LCE A;  2LTR A;  2H1R A;  3U61 A;  3M6A A;  2X8A A;  4HD0 A;  1W5S A;  1MJG M;  1G71 A;  2XSZ D;  2EOJ A;  1WHN A;  2JOX A;  3TL4 X;  4QHS A;  4B3T M;  2C98 A;  3HJ8 A;  2JY5 A;  3K9O A;  2F5S A;  1BB8 A;  4H1Y P;  1DV0 A;  3J27 B;  3PFI A;  1NSF A;  2FV4 B;  2B7V A;  3M99 B;  2I7P A;  1PJJ A;  3KOW E;  1RC7 A;  1A1F A;  4AQY M;  3UK6 A;  4I5L C;  1HNZ E;  4O24 A;  2EOY A;  3E46 A;  1KJK A;  1NEI A;  2EMY A;  2L2M A;  3AJI B;  5A6A A;  3C6M A;  4LZJ A;  1R2Y A;  3EGG A;  2EWL A;  4R3D A;  3H62 B;  3HVQ A;  4L8N A;  3KOZ E;  2EQ1 A;  3U5Z B;  2RS7 A;  2NXF A;  4MGH A;  1ZU1 A;  1KBP A;  2EM2 A;  5LL6 R;  2MKD A;  4IBB A;  4FBQ A;  2VQF E;  2QBY A;  2K7I A;  1N32 E;  1SXJ B;  3TQS A;  3HTX A;  1D2N A;  2JP7 A;  4JI1 E;  3KWR A;  5KQ8 A;  5AC4 A;  1QAO A;  4TUW A;  4QOS A;  2R46 A;  1Q02 A;  5AE2 A;  4H2G A;  4FWG A;  2EN7 A;  2AHM A;  4PDG A;  3JAM S;  1TDH A;  3C3E A;  4D81 A;  4B7F A;  4MLQ A;  3KXE C;  4L6V 6;  1OQY A;  1NY6 A;  3A98 B;  5FSW A;  2E72 A;  4GC5 A;  1GL6 A;  1YFH A;  1NHW C;  2BBG A;  2B3T B;  1GLN A;  4XGI A;  1QAQ A;  4GKJ E;  2KRK A;  1A1L A;  2NYL C;  4LU9 A;  2KDL A;  2O5R A;  4NSO B;  5B8I A;  4NSR A;  1YUB A;  2M9A A;  3CF0 A;  2MKN A;  3GLG A;  1HNX E;  3U6P A;  4RF1 A;  2V1U A;  1N75 A;  3GLI E;  4WPY A;  1NNJ A;  2EPC A;  3THG A;  4JXJ A;  1WAR A;  4LF6 M;  1DI2 A;  1XNR E;  4Z8X A;  2WSE F;  1VEG A;  3ZTV A;  2CHV A;  1QYR A;  4WP2 A;  3EPJ A;  3R8F A;  2XSZ A;  4MGZ E;  2DB2 A;  4DV6 M;  1OID A;  1GTK A;  4UT3 A;  4LF4 E;  4R7G A;  2JY9 A;  4WSP A;  2UXB M;  4B2O A;  4IBJ A;  5AE3 A;  4FBK A;  2J7J A;  2EJ4 A;  3BF2 A;  1GJS A;  2GLI A;  4DHL A;  3KSX A;  2UU9 E;  1G59 A;  4J6O A;  1YZ9 A;  1R5L A;  2HHH E;  4GKK M;  2DXI A;  2YTP A;  4M9Z A;  4MGY E;  1RMD A;  2ENH A;  2FOI C;  2EPR A;  4L78 A;  1PJQ A;  5ITX E;  3UJN A;  2VRD A;  2MR9 A;  3B7N A;  4R2A A;  3FYC A;  3D8L A;  4AZF A;  1STU A;  1KYQ A;  1ZBQ A;  4HEI A;  2CV9 A;  1QAM A;  1F2I G;  4MGI E;  4B7G A;  3P71 C;  2DZL A;  2EPX A;  5FTJ A;  4ORC A;  1ZMV A;  4RH8 A;  5INB A;  2DAK A;  4LF7 E;  1L4S A;  4ZYE A;  2JWO A;  2R45 A;  1S8E A;  5EXP A;  5JPF A;  4XBO A;  1R4G A;  4JYA M;  3EPK A;  2YEQ A;  4LFA E;  4L8R C;  1IBL E;  5FLX S;  4B3S M;  2CEA A;  1IBK E;  2UUA M;  4X66 M;  3HPZ A;  5JJT A;  3SFZ A;  3I01 M;  1GO5 A;  1NVM A;  4G9J A;  3RL5 A;  3R9X B;  4DV3 M;  4DV4 M;  4I4L A;  1N36 M;  2EPM X;  5DFL A;  2CRU A;  3HKP A;  2WDF A;  3FTD A;  1ZMU A;  2LXE A;  4Q35 B;  3GO8 A;  3HU1 A;  3UZU A;  4LJA A;  5FTK A;  3SHG B;  1SXJ E;  5EJC A;  2J5Y A;  2MH8 A;  3J7B A;  2V8Q B;  2Q2E B;  1KFV A;  3FRI A;  2DRP A;  4WX9 A;  3J81 C;  1YYW A;  3I4V A;  3UK3 C;  4DUY M;  2J7N A;  2HY1 A;  2JY6 B;  2QP9 X;  3MHS C;  2QHO B;  2QSF X;  2F5P A;  2EOQ A;  1HR0 E;  2QZ4 A;  1S3M A;  3RQZ A;  4RNA A;  4TUG A;  4ORA A;  3GLH B;  1PM5 A;  2R44 A;  4GHL A;  3A45 A;  5FTN A;  2EOS A;  2YWQ A;  1UTE A;  3HXL A;  2VE7 C;  2BWE A;  2MJ5 B;  2MGW A;  1JQJ C;  2MDG A;  2M4I A;  5BR8 M;  1TCO A;  2R65 A;  4YY3 M;  5IWA M;  1TDZ A;  1NO1 A;  4ZYD A;  2ZOA A;  3T1I A;  1E9R A;  3HQ1 A;  5ITT A;  3T6P A;  3DJW A;  5KQD A;  4DSY A;  1A1J A;  2DGC A;  3B7Z A;  5ITU A;  3U6E A;  2RRU A;  1FJG E;  2DXN A;  3HHW A;  5E6J A;  2HAK A;  2ZBM A;  5E26 A;  1QAN A;  2VII A;  2B7T A;  2F8B A;  2LTU A;  3ZCB B;  4R2E A;  4BCA A;  2DZN B;  2LMZ A;  1L2D A;  2KON A;  3L26 A;  4R71 A;  4JI6 M;  2UUB M;  4BLC A;  3AFH A;  3Q8G A;  3A46 A;  1N78 A;  2EMF A;  1YSY A;  2KOU A;  1N33 M;  4ORB A;  1HQY E;  4H1S A;  4JI2 E;  1SFE A;  3T1H M;  5KPT A;  2V87 A;  3PVS A;  4JI5 E;  1MN3 A;  2IE3 C;  2EM4 A;  4I5S A;  2BCD A;  2V88 A;  2EMC A;  3CTW B;  4TUI A;  3FYD A;  1Q39 A;  4AKG A;  5J28 A;  3LLH A;  2UXC M;  2ERC A;  1D0M A;  4OW0 A;  4YHH E;  4QOZ C;  3H66 A;  2LUQ A;  4X65 E;  3KS4 A;  4DR5 M;  1PGY A;  3ADJ A;  2JR1 A;  4IBI A;  5L8R F;  2YTI A;  1IFY A;  2CSH A;  4II7 A;  2EOR A;  2JY7 A;  4B3T E;  2UUC M;  4DR4 M;  3L2A A;  2RSI A;  2KHH A;  1ZAA C;  2DIX A;  1GKI A;  1IXS A;  4JI3 M;  3LQR A;  2DHY A;  1GL7 A;  1OFI A;  1AIP C;  2EMH A;  2N3H A;  2CHG A;  1HO5 A;  2RS6 A;  2NUG A;  2L6O A;  3EPH A;  1VDD A;  1NNU C;  1YYK A;  3FD9 A;  4L5N C;  3DA1 A;  1QHW A;  4NRV A;  4FWH A;  3OTO M;  2EPZ A;  1P3Q Q;  2EP3 A;  5LLQ A;  3GLH E;  3FLO A;  3AV0 A;  1YUJ A;  1WAO 1;  1IY2 A;  2GQF A;  2XLJ A;  3AL0 C;  2GHF A;  3QWL A;  2DKL A;  5HPE A;  1QU6 A;  1WGL A;  2VF8 A;  3SAS A;  3DF6 A;  1QNT A;  2EMZ A;  3I51 A;  3T1Y M;  4M9X A;  5EP2 A;  1U32 A;  1PJS A;  2DNA A;  4OVZ A;  2XF3 A;  4DV5 E;  3ADL A;  2QFR A;  2OQ4 A;  2D7H A;  2RTX A;  4WXC A;  2HYP A;  3GLF B;  5C1V A;  2XH9 A;  2HWJ A;  2DWL A;  4LRT A;  3J7A G;  2R4J A;  1R2Z A;  4M0V A;  1UFZ A;  1E94 E;  3H60 A;  3HZJ A;  3DSC A;  3E21 A;  4LF8 M;  5EQV A;  2W82 A;  2CE7 A;  1B69 A;  4LF6 E;  4EIW A;  3VKH A;  4O5G A;  4NOO B;  4NXM M;  2YFQ A;  2FE8 A;  3NBI A;  2Z72 A;  1X6H A;  4DR3 E;  4M30 A;  1YPN A;  2V85 A;  3BGH A;  3U60 A;  4DR6 E;  5KL7 A;  4B3R M;  1EE8 A;  4DR7 M;  1T4O A;  4J8Z A;  3KW6 A;  2DWM A;  2EJS A;  3U61 B;  3EIH A;  1SXJ D;  3J7Y p;  1LTM A;  2EN8 A;  4IYP C;  2C99 A;  2USH A;  4DV7 M;  3GQ4 A;  4NXN M;  1BBG A;  1QDT A;  3IB7 A;  2HYO A;  2OO9 A;  2XEP A;  4KKZ A;  1SG9 A;  2RGH A;  8CAT A;  2KZU A;  4KBP A;  4DV1 M;  3SMP A;  2DXL A;  5CFF E;  1VEJ A;  4XK8 F;  4RF0 A;  2EL5 A;  3C58 A;  4UN2 B;  1T3T A;  2O25 A;  3K7V C;  2YRM A;  5IRE B;  1J5E M;  3LCV B;  3V4Y A;  3IVD A;  3QFN A;  1DGH A;  4BC9 A;  5A69 A;  4WSG A;  4LJ6 A;  2LVN C;  2QBY B;  1T38 A;  2GJU A;  3SYK A;  2DWZ B;  4R2C A;  5A2Q C;  1S70 A;  4ZVZ A;  3GVE A;  4MB7 A;  5IOH A;  3PXG A;  1IQP A;  2UUA E;  4BHC A;  4X66 E;  3IWD A;  4LGY A;  2E5L E;  2CP8 A;  1ZV1 A;  3J80 S;  2Z3X A;  2YTO A;  4DV4 E;  1JB0 F;  2L4F A;  3EQ1 A;  2BDX A;  3BBG A;  5C18 A;  4UT2 A;  5EXX A;  5EP3 A;  4IBK A;  1OKS A;  4DR1 E;  2JY8 A;  2EM9 A;  5JI3 E;  2ZO9 B;  2EOF A;  2EOI A;  3SYL A;  1IY0 A;  1IXR C;  3T15 A;  2YPN A;  3VFD A;  3BXW A;  4DUY E;  4LAC C;  1NHG C;  4IS1 C;  4KHP M;  3GLG B;  1VDL A;  2ELZ A;  2DEN A;  1HNW E;  4G6Z A;  2KZS A;  1IT6 A;  3LL8 A;  5ITY A;  5FTM A;  1NNW A;  1DGC A;  2YU8 A;  3L27 A;  1YLA A;  1QZM A;  3GLF E;  1IN7 A;  1IN8 A;  5H37 D;  1OAI A;  2Z06 A;  1P47 A;  1SXJ A;  3GQ5 A;  5IT9 C;  2LHC A;  4BMJ A;  4UT3 B;  1Z1B A;  3I4Y A;  5EP1 A;  1K3W A;  1A5T A;  2WCC 3;  5IWA E;  1DO0 A;  3K6Q A;  1BVS A;  4F0Z A;  2J7O A;  4AG6 A;  1XMO M;  3K2L A;  1IN5 A;  1TF6 A;  4DV0 E;  4JV5 M;  2ODR D;  1WXR A;  3KFU G;  3H61 A;  3AUZ A;  3FE3 A;  2EOO A;  2EO2 A;  1IBM E;  4LCB A;  1Z5C A;  4CJ6 A;  1V34 A;  2VF7 A;  1AUA A;  2G7H A;  2EPN A;  3L00 A;  1JR3 D;  2FS1 A;  4Y28 F;  2O01 F;  3RFW A;  4F6M A;  4H2B A;  1PJI A;  4JI6 E;  3BOS A;  2B9D A;  4G4N A;  3C3D A;  3C4T A;  2Y0Q A;  1A1G A;  3M7G A;  3DW8 C;  4IBD A;  2H36 X;  4OU7 A;  3T1H E;  5ITQ A;  4RHB B;  1OJL A;  2MC5 A;  2Q8U A;  3BID A;  2LJU A;  3IG5 A;  4S12 A;  1F4I A;  2NUE A;  3TGH A;  3F92 A;  5A2Q S;  4M0W A;  3GPU A;  4L15 A;  4FCX A;  2UXC E;  2WZJ A;  1XXH B;  4PCZ A;  3H64 A;  3AKZ A;  4OX9 E;  5EXT A;  2CHQ A;  3V76 A;  2F4V E;  4JN6 A;  3PSO A;  3EGH A;  3MHH C;  3WHK A;  2EM7 A;  4DR5 E;  4F9B B;  2L3C A;  2R0I A;  3E7A A;  5BPV A;  4AG5 A;  3ZC7 B;  3GRY A;  3C9P A;  4AI6 A;  3B7Q A;  1XNQ M;  2MRO B;  2WBS A;  4H2I A;  2EOM A;  5A6K A;  2L33 A;  3TWM A;  3K7W C;  2YTG A;  2BQ8 X;  4X62 M;  4MOY A;  2NQ8 C;  3VYY A;  2QFP A;  4JI3 E;  5IXM B;  2EMX A;  1HNZ M;  2Z7J A;  3ZH9 B;  4FD2 A;  3PNY A;  2EM3 A;  2JP9 A;  3K8Z A;  1HPU A;  2G3Q A;  4WW0 A;  4AKH A;  1VEK A;  2HL7 A;  3LW5 F;  1V33 A;  1S95 A;  1V73 A;  3MSW A;  1N32 M;  3FUT A;  4MLV A;  4GIP A;  4ZYH A;  2LO3 A;  2RSM A;  3GLG E;  2EN4 A;  2JVA A;  1ZMW A;  3F6G A;  1ORY B;  2EMW A;  3KP0 E;  4I8O A;  5JI2 E;  1TH3 A;  2D9H A;  5GTU A;  3RE8 A;  1TR8 A;  3ADI A;  4WYQ B;  1JR3 A;  2L2D A;  2R76 A;  1C1K A;  1C7Y A;  2OPF A;  5LMU M;  1GJT A;  5IV8 B;  4R2R A;  1X3C A;  3T1Y E;  1HJP A;  4LFC M;  2GNO A;  1G8P A;  4R2S A;  4N4R B;  1XC8 A;  4GRI A;  3TQM A;  2ENA A;  4JI4 M;  2EKK A;  2KNV A;  4V0W A;  3KP1 E;  4LJ4 A;  2ELY A;  2JOG A;  3GRV A;  2HC5 A;  4PDI A;  4LJ5 A;  1N77 A;  4IJD A;  1CUK A;  4A3V B;  2F5Q A;  3C9F A;  1EFU B;  4DV2 E;  4LJ9 A;  3B74 A;  2YTE A;  3H4M A;  1WHC A;  2QJC A;  2DAG A;  2DMI A;  2ZAN A;  3GLH A;  1N34 M;  4GIT A;  1OIP A;  1WXQ A;  2EOE A;  2EQ0 A;  2EM6 A;  4B7H A;  4V0V A;  2F5N A;  1I94 M;  3IG8 A;  3KZY A;  3EPL A;  4LJ8 A;  4NXM E;  2QEN A;  4BC7 A;  1O0W A;  3FIG A;  1Z59 A;  3C5W C;  1LV7 A;  3MHV C;  4IBC A;  4JI8 M;  1T70 A;  2EPA A;  2QNJ A;  4WUR A;  4Z6Y A;  4DR7 E;  4IBE A;  1GVN A;  2UU9 M;  1IN4 A;  2K9D A;  2K0B X;  5JPE A;  4I81 A;  4DV7 E;  1IQS A;  1WGN A;  4NXN E;  3JYF A;  3KVW A;  3FTF A;  1XXH E;  3I04 M;  4BBA A;  1GZ6 A;  1PRB A;  2CWB A;  4ZX2 A;  2DLK A;  4AW4 A;  1HP1 A;  2XFT A;  2APL A;  2EMB A;  1IXS B;  3E7B A;  1ZBT A;  2QCU A;  4YKE A;  2KXE A;  2EN1 A;  4WWL A;  4P7D A;  4IBF A;  5DYG A;  5TSE A;  3J81 S;  5GKN A;  1M63 A;  1RU3 A;  2Y20 A;  4LF7 M;  2EMI A;  3JR4 A;  1W24 A;  1J5E E;  2IE4 C;  2LVO C;  2HKJ A;  2L92 A;  1AUI A;  4F1I A;  4LFA M;  1NCS A;  2KRU A;  3H68 A;  4AQY E;  2L8T A;  2V86 A;  2K47 A;  2DAI A;  2N35 A;  3J7A S;  1XB2 B;  5ITR A;  3FUV A;  3W0F A;  1J26 A;  1L2B A;  2FFJ A;  1PKP A;  2KNA A;  2EN6 A;  3NWL A;  2WBT A;  1L8Q A;  1HQC A;  1ZR9 A;  3RGS A;  4MOV A;  4O43 A;  4NRW A;  2OOB A;  4LF5 M;  3GRU A;  2DSY A;  3FRH A;  2N3G A;  3IVE A;  2X49 A;  4OVZ B;  2Z1A A;  4G4R A;  3DZD A;  2P5T A;  1G41 A;  1ZAE A;  1A1H A;  2NUF A;  3LML A;  1YE9 A;  1G4A E;  1NV9 A;  2EUC A;  2I7N A;  2EN3 A;  1IM2 A;  2D7E A;  3E9S A;  2ODR C;  2UXD M;  3ZOQ B;  3HJQ A;  2ZTC A;  4D82 A;  2YVT A;  4ZPX A;  3C4B A;  4GZN C;  1QUS A;  3QG5 C;  3FUX A;  1EH6 A;  3L25 A;  1K82 A;  4REZ A;  1EIJ A;  1DQ3 A;  1UBD C;  2NA2 A;  2ZAM A;  2Z8Y M;  5LMN M;  2YRK A;  4FVM A;  2XGN A;  3JTZ A;  3DOA A;  3U60 B;  3TE6 A;  4R2P A;  4K0K M;  1YUI A;  5EQT A;  3VYX A;  3LMM A;  2QPA A;  3GPX A;  1XMO E;  4P16 A;  2KHX A;  4IJE A;  1QVR A;  4V0X A;  2LBS B;  2C9O A;  1UF3 A;  2CV1 A;  2ZM6 M;  3IHP A;  1NV8 A;  2X4A A;  2YU5 A;  4DV6 E;  1R7R A;  1TF3 A;  1WR1 B;  2Y0T A;  3KZZ A;  1S3S A;  2CV0 A;  4L4U A;  1G2D C;  1R6B X;  3RMP A;  2DI0 A;  2L2N A;  3TWL A;  2I13 A;  4B3M M;  4R2Q A;  2DLQ A;  2UXB E;  3LQQ A;  4GMQ A;  2R6F A;  2P6B A;  4OOG C;  2VQE M;  4JI7 M;  4IBG A;  2F5O A;  4Q28 A;  4D80 A;  3GLI A;  2M5Z A;  3FUU A;  4GKK E;  4JI5 M;  3FGA C;  1HT1 E;  2H5X A;  1VQ1 A;  4LRS A;  3L29 A;  1NY5 A;  4ITQ A;  4GEW A;  1EH8 A;  4F9A B;  3HJS A;  4F2L A;  1DGH B;  4GHA A;  5T6J A;  4G4Q A;  2LJH A;  4R8O A;  3A42 A;  4FCW A;  1SU1 A;  4MP0 A;  1VG5 A;  2Z4S A;  1MEY C;  3MK6 A;  2EPK X;  4YHH M;  1XZW A;  1WIV A;  1XMQ M;  3GPP A;  1YSA C;  2KNZ A;  2V6Z M;  2V89 A;  4KZS A;  1L1Z A;  2LNH C;  4NL4 H;  4JYA E;  2DAE A;  3IEC A;  4GEQ B;  2BNK A;  4F6N A;  2LHG A;  3HU3 A;  4OR9 A;  1X47 A;  2JOB A;  4B3S E;  3GP1 A;  5EP4 A;  4LZZ A;  1XNQ E;  2YTD A;  2QQ8 A;  5ITX A;  4DUZ M;  4DV3 E;  1N36 E;  3TWK A;  2LE2 A;  4X62 E;  4M2Z A;  4WFT A;  3VK6 A;  4LFB M;  1YYO A;  5KPR A;  2JNH A;  2FNA A;  1XM7 A;  4QNR A;  4M9S A;  3ZQJ A;  1H6U A;  3CF6 E;  4JI0 M;  2BJW A;  3U6M A;  4X64 M;  2HCB A;  1QZE A;  1MF8 A;  2MDR A;  3D03 A;  1XWI A;  3KS8 A;  2LVQ D;  2LWX A;  5FLX C;  4IIW A;  1Z6T A;  1N3G A;  1DGF A;  2IAE C;  3HY5 A;  2ENC A;  2BWB A;  1Z5A A;  2KW0 A;  1T4N A;  2CPN A;  3FTE A;  4FW9 A;  1V92 A;  4G4O A;  2AHD A;  2N8X A;  3DSD A;  3U5Z A;  1Z5B A;  3KOY E;  2DWN A;  3VDU A;  2ADR A;  3W67 A;  4L16 A;  3AOE A;  1RQ0 A;  2WZO A;  4MH0 E;  4R03 A;  2YTQ A;  3DFZ A;  4LF9 M;  4R2D A;  5LMU E;  1D0K A;  2EE8 A;  1T43 A;  4LFC E;  4DV5 M;  5BR8 E;  1XHB A;  2RGO A;  2CV2 A;  4ZYG A;  1LLM C;  3FTC A;  4YY3 E;  4JI4 E;  2I9I A;  2LVH A;  5A6B D;  4FWD A;  4Q7J A;  3SHF A;  3SAU A;  4P78 A;  3ZU0 A;  4MM3 B;  1BBO A;  2R18 A;  3F6H A;  2LBC A;  4LJ7 A;  3QYE A;  2R62 A;  1QDR A;  1N34 E;  2WSC F;  4X8W A;  2DHR A;  4B08 A;  2B3T A;  4DT2 A;  2LTS A;  3H67 A;  1Q3C A;  2R17 A;  2FTX B;  1I94 E;  1WJ7 A;  3SAV A;  4KLN A;  1NJF A;  2L09 A;  3BBZ A;  2UUB E;  1TH4 A;  4WXD A;  4M0D A;  4DR3 M;  1N33 E;  2YTN A;  5ADZ A;  3KSJ A;  4DR6 M;  5FTL A;  3CGW A;  4JI8 E;  4KOD A;  1UIL A;  5DYI A;  1AH5 A;  1G5B A;  2PRT A;  3UMM A;  2L6M A;  2K6B A;  1K3X A;  4JA9 A;  5DNY A;  1KSF X;  2HJJ A;  4DR2 M;  1WHQ A;  4HLQ A;  4KWY A;  2NPP C;  1DGG A;  3D8B A;  2RQL A;  2M7Q A;  1JK7 A;  4IJF A;  2EL4 A;  4HEO A;  1X5W A;  2WDE A;  4M9V C;  2BJV A;  3C6K A;  2Z4R A;  2DFJ A;  2E1M A;  4CGY B;  4QNM A;  2UUC E;  3RL3 A;  4DR4 E;  4F9C B;  2XMO A;  3HGI A;  3QFK A;  1EH7 A;  3GQ3 A;  3B89 A;  1E32 A;  3K9P A;  4KT0 F;  1SR9 A;  3P1X A;  3H4J A;  1QFC A;  4CHT B;  1TF0 B;  1QUT A;  3PSN A;  1MGT A;  2L2K B;  1UM8 A;  2RPC A;  3LCU A;  1UHZ A;  3IWC A;  1FJM A;  3QAU A;  1FNN A;  2E5L M;  1XXH A;  4X9J A;  3M0E A;  3ECR A;  1GAB A;  5AAS A;  5KL2 A;  5A6B A;  3Q8X A;  1KYI A;  4DR1 M;  2VQF M;  4BB9 A;  1X49 A;  2MC6 A;  3HPS A;  4LF5 E;  3OTO E;  5IT9 S;  4MGK E;  2L7I A;  2A22 A;  4O4K A;  3FUW A;  4JI1 M;  2IHR 1;  2EKF A;  2R4E A;  2M1S A;  2LVA A;  2EL6 A;  1MX0 A;  2CUZ A;  2G5G X;  3U6S A;  4KO8 A;  4IL1 A;  3ILK A;  4NZV A;  3ICF A;  1EKZ A;  1I4W A;  4HTG A;  2JYA A;  3E0J A;  3HHZ A;  1HNW M;  3SAW A;  5F3W A;  1L2C A;  2YZT A;  2YRH A;  2UXD E;  2O8A A;  1OFH A;  2EPO A;  5AE1 A;  4F2J C;  3K92 A;  3H69 A;  4I5N C;  3U6D A;  1TGU A;  4QHT A;  4JA7 A;  2KEB A;  2DAM A;  4GKJ M;  3U6Q A;  3AOE C;  2XZU A;  3SAT A;  2R1F A;  2YTF A;  1HNX M;  1SXJ C;  2EPU A;  1OIE A;  4Q7F A;  3W68 A;  4GC9 A;  5LMN E;  1G3I A;  2L7H A;  4K0K E;  3K1J A;  2V83 A;  1XNR M;  2A25 A;  4LF8 E;  2DMY A;  1PJT A;  1X6E A;  1A1I A;  4DV0 M;  2EM0 A;  3RL4 A;  2ZM6 E;  4LF4 M;  4HL4 A;  5KPZ A;  1IXZ A;  1IBM M;  1AAY A;  1HT2 E;  3U6O A;  1WJP A;  3KOX E;  4B3R E;  3FKE A;  4B3M E;  4XPN A;  2FH0 A;  1T4L B;  1WRJ A;  2VQE E;  4GH9 A;  3B9P A;  2HHH M;  3VK7 A;  4JI7 E;  2Y21 A;  5EXS A;  2LVP C;  1MU5 A;  2YQZ A;  2XZF A;  2KKN A;  1USH A;  3VLF B;  3E4R A;  1J09 A;  2NAB A;  4NC6 A;  5KL6 A;  2LRS A;  4BBY A;  3JU0 A;  3HWS A;  2XFS A;  1DO2 A;  2YNM D;  3RGP A;  1DGB A;  4CIZ A;  2LUP B;  2VF1 A;  3KBP A;  4DV1 E;  2EM5 A;  2YT4 A;  4CIS A;  4DBG B;  1T6O A;  1IMU A;  2ZBK B;  3AOG A;  1X48 A;  3QFM A;  4OX9 M;  3HX3 A;  2EMG A;  1XMQ E;  4FCV A;  2V1C A;  2F4V M;  1S3N A;  5KL3 A;  2OOA A;  1X37 A;  2K4V A;  2EZ6 A;  4G3O A;  1IBL M;  5A6J A;  4NHR A;  1IBK M;  3VHT B;  1FKA E;  4LGM A;  2GPI A;  2DVW B;  1II7 A;  2JZ0 A;  3HU2 A;  4BHB A;  2C96 A;  3MMP A;  2WDD A;  1ZQ9 A;  4LG2 A;  4LTY A;  3TPZ A;  4DUZ E;  4ANR A;  1JR3 E;  3PNV A;  4DMI A;  2O8G A;  3CF2 A;  1OIZ A;  5C1B A;  4F54 A;  4LFB E;  3KDS E;  3EIE A;  3NBX X;  1OTR A;  2NYM C;  2YR0 A;  3THN A;  2EN2 A;  3IWB A;  4JI0 E;  4X64 E;  2JPA A;  5KL4 A;  3QYB A;  4UWQ A;  2L4E A;  1IQO A;  2EOX A;  2WSF F;  4W5W A;  3W0L B;  4BS9 A;  1HR0 M;  2JXP A;  2ZAO A;  1PDA A;  1JK2 A;  4KHP E;  5KO3 A;  3H63 A;  3WHL A;  3ADG A;  1D0L A;  1Z2W A;  1E9S A;  1QQW A;  1Y8G A;  1L1T A;  2M60 A;  3J2P B;  3J80 C;  2EM8 A;  3IB8 A;  3MJ5 A;  1TTE A;  3THO B;  3VDP A;  3UGJ A;  2YSP A;  2YTJ A;  1UN6 B;  4LF9 E;  3OML A;  3SAR A;  2EPP A;  3JR5 A;  2LV2 A;  2EQ3 A;  1IY1 A;  1IN6 A;  3U6L A;  2C5R A;  2RKO A;  1A1K A;  3SC3 A;  2CT1 A;  2L3J A;  3T38 A;  2KA6 B;  2WBU A;  1OI8 A;  4AKI A;  1TH2 A;  3QFO A;  4P17 A;  3H09 A; 
#chains in the Genus database with same CATH homology
 4DV2 M;  3L28 A;  1FJG M;  3JAM C;  3U6C A;  1Q3B A;  2LH0 A;  4JV5 E;  3VK8 A;  3GLI B;  2CFO A;  2G8L A;  4H2F A;  3HHX A;  4PD2 A;  3SMS A;  1T71 A;  3GLF A;  4FCT A;  3SBJ A;  3GRR A;  2EA0 A;  3LVV A;  1W5T A;  4FBW A;  7CAT A;  1Z2X A;  4JI2 M;  4LY6 A;  3LVW A;  1S3L A;  4PT5 A;  2JA2 A;  3GPY A;  2A5Y B;  3VKG A;  3HHY A;  4DKK A;  2WDC A;  1NJG A;  4DR2 E;  1GQE A;  2D7G A;  3CK2 A;  3N5U A;  2C9C A;  5IZ7 D;  2DZO B;  2FGG A;  1J7K A;  4X65 M;  2LTR A;  2H1R A;  3U61 A;  3M6A A;  2X8A A;  4HD0 A;  1W5S A;  2XSZ D;  1WHN A;  2JOX A;  3TL4 X;  4QHS A;  4B3T M;  2C98 A;  3HJ8 A;  2F5S A;  4H1Y P;  3J27 B;  3PFI A;  1NSF A;  2FV4 B;  2B7V A;  2I7P A;  1PJJ A;  3KOW E;  1RC7 A;  4AQY M;  3UK6 A;  4I5L C;  1HNZ E;  4O24 A;  2L2M A;  3AJI B;  4LZJ A;  1R2Y A;  3EGG A;  2EWL A;  4R3D A;  3H62 B;  3HVQ A;  4L8N A;  3KOZ E;  2RS7 A;  3U5Z B;  2NXF A;  4MGH A;  1KBP A;  5LL6 R;  4IBB A;  4FBQ A;  2VQF E;  2QBY A;  1N32 E;  1SXJ B;  3TQS A;  3HTX A;  1D2N A;  4JI1 E;  3KWR A;  5KQ8 A;  1QAO A;  4TUW A;  4QOS A;  2R46 A;  5AE2 A;  4H2G A;  4FWG A;  2AHM A;  4PDG A;  3JAM S;  1TDH A;  4D81 A;  4B7F A;  3KXE C;  1NY6 A;  3A98 B;  5FSW A;  4GC5 A;  1GL6 A;  1NHW C;  2B3T B;  1GLN A;  4XGI A;  1QAQ A;  4GKJ E;  2KRK A;  2NYL C;  4LU9 A;  2O5R A;  4NSO B;  5B8I A;  4NSR A;  1YUB A;  3CF0 A;  3GLG A;  1HNX E;  3U6P A;  4RF1 A;  2V1U A;  1N75 A;  4WPY A;  1NNJ A;  3THG A;  4JXJ A;  1WAR A;  4LF6 M;  1DI2 A;  1XNR E;  4Z8X A;  3ZTV A;  2CHV A;  1QYR A;  3R8F A;  2XSZ A;  4MGZ E;  2DB2 A;  4DV6 M;  1OID A;  4UT3 A;  4LF4 E;  4R7G A;  2JY9 A;  4WSP A;  2UXB M;  4B2O A;  4IBJ A;  5AE3 A;  4FBK A;  4DHL A;  3KSX A;  2UU9 E;  1G59 A;  4J6O A;  1YZ9 A;  2HHH E;  4GKK M;  2DXI A;  4M9Z A;  4MGY E;  2FOI C;  4L78 A;  5ITX E;  3UJN A;  3FYC A;  3D8L A;  4AZF A;  1STU A;  1ZBQ A;  2CV9 A;  1QAM A;  4MGI E;  4B7G A;  3P71 C;  5FTJ A;  4ORC A;  5INB A;  4LF7 E;  2JWO A;  2R45 A;  1S8E A;  5EXP A;  5JPF A;  4XBO A;  4JYA M;  2YEQ A;  4LFA E;  4L8R C;  1IBL E;  5FLX S;  4B3S M;  2CEA A;  1IBK E;  2UUA M;  4X66 M;  3HPZ A;  5JJT A;  3SFZ A;  1NVM A;  4G9J A;  3RL5 A;  3R9X B;  4DV3 M;  4DV4 M;  4I4L A;  1N36 M;  3HKP A;  2WDF A;  3FTD A;  2LXE A;  3GO8 A;  3HU1 A;  3UZU A;  4LJA A;  5FTK A;  3SHG B;  1SXJ E;  5EJC A;  3J7B A;  2V8Q B;  2Q2E B;  1KFV A;  3J81 C;  1YYW A;  3I4V A;  4DUY M;  2J7N A;  2HY1 A;  2QP9 X;  2F5P A;  1HR0 E;  2QZ4 A;  1S3M A;  3RQZ A;  4RNA A;  4TUG A;  4ORA A;  3GLH B;  1PM5 A;  4GHL A;  3A45 A;  5FTN A;  1UTE A;  3HXL A;  2VE7 C;  1JQJ C;  2M4I A;  5BR8 M;  1TCO A;  2R65 A;  4YY3 M;  5IWA M;  1TDZ A;  2ZOA A;  3T1I A;  1E9R A;  3HQ1 A;  5ITT A;  3DJW A;  5KQD A;  4DSY A;  5ITU A;  3U6E A;  1FJG E;  2DXN A;  3HHW A;  5E6J A;  2ZBM A;  5E26 A;  1QAN A;  2VII A;  2B7T A;  2F8B A;  3ZCB B;  4BCA A;  2DZN B;  2LMZ A;  1L2D A;  2KON A;  3L26 A;  4JI6 M;  2UUB M;  4BLC A;  3AFH A;  3A46 A;  1N78 A;  1YSY A;  2KOU A;  1N33 M;  4ORB A;  1HQY E;  4H1S A;  4JI2 E;  3T1H M;  5KPT A;  2V87 A;  3PVS A;  4JI5 E;  2IE3 C;  4I5S A;  2BCD A;  2V88 A;  3CTW B;  4TUI A;  3FYD A;  1Q39 A;  4AKG A;  5J28 A;  3LLH A;  2UXC M;  2ERC A;  4OW0 A;  4YHH E;  4QOZ C;  3H66 A;  2LUQ A;  4X65 E;  3KS4 A;  4DR5 M;  3ADJ A;  2JR1 A;  4IBI A;  4II7 A;  4B3T E;  2UUC M;  4DR4 M;  3L2A A;  2DIX A;  1GKI A;  4JI3 M;  3LQR A;  1GL7 A;  1OFI A;  2N3H A;  2CHG A;  1HO5 A;  2RS6 A;  2NUG A;  2L6O A;  1VDD A;  1NNU C;  1YYK A;  3FD9 A;  4L5N C;  3DA1 A;  1QHW A;  4NRV A;  4FWH A;  3OTO M;  3FLO A;  3AV0 A;  1WAO 1;  1IY2 A;  2XLJ A;  3AL0 C;  3QWL A;  5HPE A;  1QU6 A;  3SAS A;  3DF6 A;  3I51 A;  3T1Y M;  4M9X A;  5EP2 A;  1U32 A;  4OVZ A;  2XF3 A;  4DV5 E;  3ADL A;  2QFR A;  2OQ4 A;  2D7H A;  2RTX A;  2HYP A;  3GLF B;  5C1V A;  2XH9 A;  2DWL A;  4LRT A;  3J7A G;  2R4J A;  1R2Z A;  4M0V A;  1E94 E;  3H60 A;  3DSC A;  5EQV A;  4LF8 M;  2W82 A;  2CE7 A;  4LF6 E;  4EIW A;  3VKH A;  4O5G A;  4NOO B;  4NXM M;  2YFQ A;  2FE8 A;  3NBI A;  2Z72 A;  4DR3 E;  4M30 A;  2V85 A;  3U60 A;  4DR6 E;  4B3R M;  1EE8 A;  4DR7 M;  1T4O A;  4J8Z A;  3KW6 A;  2DWM A;  3U61 B;  3EIH A;  1SXJ D;  3J7Y p;  4IYP C;  2C99 A;  2USH A;  4DV7 M;  3GQ4 A;  4NXN M;  3IB7 A;  2HYO A;  2XEP A;  4KKZ A;  2RGH A;  8CAT A;  2KZU A;  4KBP A;  4DV1 M;  3SMP A;  2DXL A;  5CFF E;  4RF0 A;  3C58 A;  1T3T A;  3K7V C;  5IRE B;  1J5E M;  3V4Y A;  3IVD A;  3QFN A;  1DGH A;  4BC9 A;  4LJ6 A;  2QBY B;  2GJU A;  3SYK A;  2DWZ B;  5A2Q C;  1S70 A;  4ZVZ A;  3GVE A;  4MB7 A;  5IOH A;  3PXG A;  1IQP A;  2UUA E;  4X66 E;  3IWD A;  4LGY A;  2E5L E;  3J80 S;  2Z3X A;  4DV4 E;  2BDX A;  5C18 A;  4UT2 A;  5EXX A;  5EP3 A;  4IBK A;  4DR1 E;  5JI3 E;  2ZO9 B;  3SYL A;  1IY0 A;  1IXR C;  3T15 A;  3VFD A;  4DUY E;  4LAC C;  1NHG C;  4KHP M;  3GLG B;  1HNW E;  4G6Z A;  2KZS A;  1IT6 A;  3LL8 A;  5ITY A;  5FTM A;  1NNW A;  3L27 A;  1QZM A;  1IN7 A;  1IN8 A;  5H37 D;  2Z06 A;  1SXJ A;  3GQ5 A;  5IT9 C;  4UT3 B;  4BMJ A;  3I4Y A;  5EP1 A;  1K3W A;  5IWA E;  1DO0 A;  3K6Q A;  4F0Z A;  2J7O A;  4AG6 A;  1XMO M;  3K2L A;  1IN5 A;  4DV0 E;  4JV5 M;  2ODR D;  3H61 A;  3KFU G;  1WXR A;  3AUZ A;  2EO2 A;  1IBM E;  4LCB A;  1Z5C A;  2G7H A;  1JR3 D;  3RFW A;  4H2B A;  1PJI A;  4JI6 E;  3BOS A;  2B9D A;  4G4N A;  3C4T A;  2Y0Q A;  3M7G A;  3DW8 C;  4IBD A;  2H36 X;  4OU7 A;  3T1H E;  5ITQ A;  1OJL A;  2MC5 A;  2Q8U A;  3IG5 A;  4S12 A;  2NUE A;  3TGH A;  5A2Q S;  4M0W A;  3GPU A;  4L15 A;  4FCX A;  2UXC E;  1XXH B;  4PCZ A;  3H64 A;  3AKZ A;  4OX9 E;  5EXT A;  2CHQ A;  2F4V E;  4JN6 A;  3PSO A;  3EGH A;  3WHK A;  4DR5 E;  4F9B B;  2L3C A;  3E7A A;  5BPV A;  4AG5 A;  3ZC7 B;  3GRY A;  4AI6 A;  1XNQ M;  4H2I A;  2L33 A;  3TWM A;  3K7W C;  2BQ8 X;  4X62 M;  4MOY A;  2NQ8 C;  3VYY A;  2QFP A;  4JI3 E;  1HNZ M;  2Z7J A;  3ZH9 B;  4FD2 A;  3PNY A;  3K8Z A;  1HPU A;  4WW0 A;  4AKH A;  2HL7 A;  1S95 A;  1V73 A;  3MSW A;  1N32 M;  3FUT A;  4GIP A;  2RSM A;  2JVA A;  3F6G A;  1ORY B;  3KP0 E;  4I8O A;  5JI2 E;  1TH3 A;  5GTU A;  3RE8 A;  3ADI A;  4WYQ B;  1JR3 A;  1C1K A;  2OPF A;  5LMU M;  3T1Y E;  4LFC M;  1G8P A;  1XC8 A;  4GRI A;  4JI4 M;  4V0W A;  3KP1 E;  4LJ4 A;  2JOG A;  3GRV A;  4PDI A;  4LJ5 A;  1N77 A;  4A3V B;  2F5Q A;  3C9F A;  4DV2 E;  4LJ9 A;  3H4M A;  2QJC A;  2ZAN A;  3GLH A;  1N34 M;  4GIT A;  1WXQ A;  4B7H A;  4V0V A;  2F5N A;  1I94 M;  3IG8 A;  4LJ8 A;  4NXM E;  2QEN A;  4BC7 A;  1O0W A;  3FIG A;  1Z59 A;  3C5W C;  1LV7 A;  3MHV C;  4IBC A;  4JI8 M;  1T70 A;  4WUR A;  4Z6Y A;  4DR7 E;  4IBE A;  1GVN A;  2UU9 M;  1IN4 A;  5JPE A;  4I81 A;  4DV7 E;  4NXN E;  3JYF A;  3KVW A;  3FTF A;  4BBA A;  1GZ6 A;  4ZX2 A;  4AW4 A;  1HP1 A;  2XFT A;  1IXS B;  3E7B A;  1ZBT A;  2QCU A;  4YKE A;  2KXE A;  4WWL A;  4P7D A;  4IBF A;  5DYG A;  3J81 S;  5GKN A;  1M63 A;  2Y20 A;  4LF7 M;  1W24 A;  3JR4 A;  1J5E E;  2IE4 C;  2HKJ A;  2L92 A;  1AUI A;  4LFA M;  2KRU A;  3H68 A;  4AQY E;  2L8T A;  2V86 A;  2K47 A;  3J7A S;  5ITR A;  3FUV A;  3W0F A;  1J26 A;  1L2B A;  2FFJ A;  1PKP A;  3NWL A;  1L8Q A;  1HQC A;  3RGS A;  4MOV A;  4O43 A;  4NRW A;  4LF5 M;  3GRU A;  2DSY A;  2N3G A;  3IVE A;  2X49 A;  4OVZ B;  2Z1A A;  4G4R A;  3DZD A;  2P5T A;  1G41 A;  1ZAE A;  2NUF A;  3LML A;  1YE9 A;  1G4A E;  2EUC A;  2I7N A;  1IM2 A;  2D7E A;  3E9S A;  2ODR C;  2UXD M;  3ZOQ B;  3HJQ A;  4D82 A;  2YVT A;  4ZPX A;  3C4B A;  3QG5 C;  3FUX A;  3L25 A;  1K82 A;  4REZ A;  1DQ3 A;  2NA2 A;  2ZAM A;  5LMN M;  4FVM A;  2XGN A;  3JTZ A;  3DOA A;  3U60 B;  3TE6 A;  4K0K M;  5EQT A;  3VYX A;  3LMM A;  2QPA A;  3GPX A;  1XMO E;  4P16 A;  2KHX A;  4IJE A;  1QVR A;  4V0X A;  2LBS B;  2C9O A;  1UF3 A;  2CV1 A;  2ZM6 M;  2X4A A;  4DV6 E;  1R7R A;  2Y0T A;  1S3S A;  2CV0 A;  4L4U A;  1R6B X;  3RMP A;  2L2N A;  3TWL A;  4B3M M;  2UXB E;  3LQQ A;  4GMQ A;  2P6B A;  4OOG C;  2VQE M;  4JI7 M;  4IBG A;  2F5O A;  4Q28 A;  4D80 A;  3GLI A;  2M5Z A;  3FUU A;  4GKK E;  4JI5 M;  3FGA C;  1HT1 E;  4LRS A;  3L29 A;  1NY5 A;  4ITQ A;  4F9A B;  3HJS A;  1DGH B;  4GHA A;  5T6J A;  4G4Q A;  2LJH A;  4R8O A;  3A42 A;  4FCW A;  1SU1 A;  4MP0 A;  2Z4S A;  3MK6 A;  4YHH M;  1XZW A;  1XMQ M;  3GPP A;  2V6Z M;  2V89 A;  4KZS A;  1L1Z A;  2LNH C;  4NL4 H;  4JYA E;  4GEQ B;  2BNK A;  3HU3 A;  4OR9 A;  1X47 A;  2JOB A;  4B3S E;  3GP1 A;  5EP4 A;  4LZZ A;  1XNQ E;  5ITX A;  4DUZ M;  4DV3 E;  1N36 E;  3TWK A;  2LE2 A;  4X62 E;  4M2Z A;  4WFT A;  3VK6 A;  4LFB M;  1YYO A;  5KPR A;  2FNA A;  1XM7 A;  4QNR A;  4M9S A;  1H6U A;  3CF6 E;  4JI0 M;  2BJW A;  3U6M A;  4X64 M;  2HCB A;  1MF8 A;  2MDR A;  3D03 A;  1XWI A;  3KS8 A;  2LWX A;  5FLX C;  4IIW A;  1Z6T A;  1DGF A;  2IAE C;  2CPN A;  1Z5A A;  2KW0 A;  1T4N A;  3FTE A;  4FW9 A;  4G4O A;  2AHD A;  3DSD A;  3U5Z A;  1Z5B A;  3KOY E;  2DWN A;  3VDU A;  4L16 A;  3AOE A;  1RQ0 A;  2WZO A;  4MH0 E;  4R03 A;  3DFZ A;  4LF9 M;  5LMU E;  4LFC E;  4DV5 M;  5BR8 E;  1XHB A;  2RGO A;  2CV2 A;  3FTC A;  4YY3 E;  4JI4 E;  4FWD A;  3SAU A;  3SHF A;  4P78 A;  3ZU0 A;  4MM3 B;  2R18 A;  3F6H A;  4LJ7 A;  2R62 A;  1N34 E;  4X8W A;  2DHR A;  4B08 A;  4DT2 A;  2LTS A;  3H67 A;  1Q3C A;  2R17 A;  2FTX B;  1I94 E;  3SAV A;  4KLN A;  1NJF A;  2L09 A;  2UUB E;  1TH4 A;  4M0D A;  4DR3 M;  1N33 E;  5ADZ A;  3KSJ A;  4DR6 M;  5FTL A;  4JI8 E;  4KOD A;  1UIL A;  5DYI A;  1G5B A;  3UMM A;  2L6M A;  1K3X A;  4JA9 A;  5DNY A;  1KSF X;  4DR2 M;  1WHQ A;  4HLQ A;  2NPP C;  1DGG A;  3D8B A;  2M7Q A;  1JK7 A;  4IJF A;  2WDE A;  2BJV A;  2Z4R A;  2DFJ A;  2E1M A;  4CGY B;  4QNM A;  2UUC E;  3RL3 A;  4DR4 E;  4F9C B;  2XMO A;  3HGI A;  3QFK A;  3GQ3 A;  1E32 A;  1SR9 A;  3P1X A;  1QFC A;  4CHT B;  3PSN A;  2L2K B;  1UM8 A;  1UHZ A;  3IWC A;  1FJM A;  3QAU A;  1FNN A;  2E5L M;  1XXH A;  3M0E A;  5AAS A;  3Q8X A;  1KYI A;  4DR1 M;  2VQF M;  4BB9 A;  1X49 A;  2MC6 A;  3HPS A;  4LF5 E;  3OTO E;  5IT9 S;  4MGK E;  2L7I A;  2A22 A;  4O4K A;  3FUW A;  4JI1 M;  2IHR 1;  2R4E A;  2M1S A;  1MX0 A;  2CUZ A;  2G5G X;  3U6S A;  4KO8 A;  4IL1 A;  3ILK A;  3ICF A;  4NZV A;  1EKZ A;  1I4W A;  3E0J A;  3HHZ A;  1HNW M;  3SAW A;  5F3W A;  1L2C A;  2YZT A;  2UXD E;  2O8A A;  1OFH A;  5AE1 A;  3K92 A;  3H69 A;  4I5N C;  3U6D A;  1TGU A;  4QHT A;  4JA7 A;  2KEB A;  4GKJ M;  3U6Q A;  3AOE C;  2XZU A;  3SAT A;  1HNX M;  1SXJ C;  1OIE A;  4Q7F A;  4GC9 A;  5LMN E;  1G3I A;  2L7H A;  4K0K E;  3K1J A;  2V83 A;  1XNR M;  4LF8 E;  2DMY A;  4DV0 M;  3RL4 A;  2ZM6 E;  4LF4 M;  4HL4 A;  5KPZ A;  1IXZ A;  1IBM M;  1HT2 E;  3U6O A;  3KOX E;  4B3R E;  3FKE A;  4B3M E;  4XPN A;  1T4L B;  2VQE E;  4GH9 A;  3B9P A;  2HHH M;  3VK7 A;  4JI7 E;  2Y21 A;  5EXS A;  1MU5 A;  2YQZ A;  2XZF A;  2KKN A;  1USH A;  3VLF B;  3E4R A;  1J09 A;  2LRS A;  4BBY A;  3JU0 A;  3HWS A;  2XFS A;  1DO2 A;  2YNM D;  3RGP A;  1DGB A;  2LUP B;  2VF1 A;  3KBP A;  4DV1 E;  2YT4 A;  4CIS A;  2ZBK B;  3AOG A;  1X48 A;  3QFM A;  4OX9 M;  1XMQ E;  4FCV A;  2V1C A;  2F4V M;  1S3N A;  1X37 A;  2K4V A;  2EZ6 A;  1IBL M;  1IBK M;  1FKA E;  4LGM A;  2DVW B;  1II7 A;  3HU2 A;  2C96 A;  2WDD A;  1ZQ9 A;  4LG2 A;  4LTY A;  3TPZ A;  4DUZ E;  3PNV A;  4DMI A;  2O8G A;  3CF2 A;  5C1B A;  4F54 A;  4LFB E;  3KDS E;  3EIE A;  2NYM C;  2YR0 A;  3THN A;  3IWB A;  4JI0 E;  4X64 E;  4UWQ A;  4W5W A;  3W0L B;  4BS9 A;  1HR0 M;  2ZAO A;  4KHP E;  3H63 A;  5KO3 A;  3WHL A;  3ADG A;  1Z2W A;  1E9S A;  1QQW A;  1L1T A;  2M60 A;  3J2P B;  3J80 C;  3IB8 A;  3MJ5 A;  3THO B;  3VDP A;  3UGJ A;  4LF9 E;  3OML A;  3SAR A;  3JR5 A;  1IY1 A;  1IN6 A;  3U6L A;  2C5R A;  2RKO A;  3SC3 A;  2L3J A;  3T38 A;  2KA6 B;  1OI8 A;  4AKI A;  1TH2 A;  3QFO A;  3H09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...