2HYOA

Crystal structure of rv0805 n97a mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
227
Chain Sequence
PRPDYVLLHISDTHLIDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGAHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCGCNLVHVYPDTVVHSVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analysis of the Rv0805 Cyclic Nucleotide Phosphodiesterase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Rv0805N97A
total genus 70
structure length 227
sequence length 256
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2hyoA00
2CV9A 5B8IA 3V4YA 4MOVA 3QG5C 4DHLA 1Z2WA 2O8AA 2QJCA 2HYPA 1XZWA 3K7WC 4IL1A 4B2OA 4ORAA 4TUGA 3QFOA 2QFPA 1OIDA 1M63A 1T71A 1QHWA 4WWLA 3RL5A 1II7A 2NPPC 4H2FA 4LU9A 3THNA 3LL8A 2Z72A 3ZTVA 5IOHA 2P6BA 2WDDA 4MOYA 3H69A 3H63A 4UT3B 1UF3A 3H68A 4J6OA 5JPFA 3DSDA 4JA7A 3QFMA 4O43A 4NZVA 2A22A 4M0VA 2YVTA 1UTEA 4DT2A 3DW8C 3E7AA 1T70A 3N5UA 1TCOA 4FBQA 4LTYA 1G5BA 3IB7A 2Z1AA 2NXFA 5EQVA 3C5WC 2AHDA 2JOGA 3DSCA 1S95A 1S8EA 4H1SA 3EGGA 1OI8A 2XMOA 1HP1A 3CK2A 3C9FA 2WDCA 3JYFA 3H66A 2USHA 4HD0A 3GVEA 1V73A 1S3LA 4UT3A 2KKNA 2Z06A 3K7VC 1OIEA 4H1YP 1WARA 2BQ8X 1HO5A 1MF8A 3AUZA 2NYLC 2ZBMA 4ZX2A 3ICFA 3TGHA 2HYOA 4FCXA 1HPUA 2BCDA 1AUIA 3IB8A 3IVEA 2HY1A 2IE3C 4DSYA 4I5NC 3P71C 4I5LC 2WDEA 4Q7FA 3ZU0A 3EGHA 1S3NA 3HVQA 3PSOA 5F3WA 3KBPA 1S3MA 4H2GA 1U32A 1WAO1 4MP0A 2DFJA 4H2BA 4O5GA 1S70A 2BDXA 2GJUA 4YKEA 5DNYA 1JK7A 4LACC 4V0VA 1KBPA 4H2IA 4V0WA 3RL4A 3T1IA 3RL3A 5JPEA 4O24A 4IYPC 2IE4C 4ORBA 1SU1A 5INBA 3H67A 3THOB 3H62B 4KKZA 4G9JA 3H60A 4XPNA 4TUIA 3H61A 2O8GA 2WDFA 4FBKA 4FBWA 1Z2XA 2R17A 4KBPA 3H64A 4UWQA 3PSNA 5HPEA 2Q8UA 1USHA 4UT2A 3QFKA 4JA9A 4V0XA 2IAEC 5JJTA 1IT6A 4OR9A 2NYMC 3RQZA 5C1VA 3AV0A 1FJMA 5GTUA 1XM7A 1W24A 2QFRA 3IVDA 5J28A 3E7BA 4O4KA 4ORCA 4ZVZA 3FGAC 1NNWA 4F0ZA 1QFCA 3QFNA
chains in the Genus database with same CATH superfamily
2CV9A 5B8IA 3V4YA 4MOVA 3QG5C 4DHLA 1Z2WA 2O8AA 2ZO9B 2QJCA 2HYPA 1XZWA 3K7WC 4IL1A 4B2OA 4ORAA 4TUGA 3QFOA 2QFPA 1OIDA 1M63A 3D03A 1T71A 1QHWA 4WWLA 3RL5A 1II7A 2NPPC 4H2FA 4LU9A 3THNA 3LL8A 2Z72A 3ZTVA 5IOHA 2P6BA 2WDDA 4MOYA 3H69A 3H63A 4UT3B 1UF3A 3H68A 4J6OA 5JPFA 3DSDA 4JA7A 2DXLA 3QFMA 3E0JA 4O43A 4NZVA 2A22A 4M0VA 2YVTA 1UTEA 4DT2A 3DW8C 3E7AA 1T70A 3N5UA 1TCOA 4FBQA 4LTYA 1G5BA 3IB7A 2Z1AA 2NXFA 5EQVA 3C5WC 2AHDA 2JOGA 3DSCA 1S95A 1S8EA 4H1SA 3EGGA 1OI8A 2XMOA 1HP1A 3CK2A 3C9FA 2WDCA 3JYFA 3H66A 2USHA 4HD0A 3GVEA 3FLOA 1V73A 1S3LA 4UT3A 2KKNA 2Z06A 3K7VC 1OIEA 4H1YP 1WARA 2BQ8X 1HO5A 1MF8A 3AUZA 2NYLC 2ZBMA 4ZX2A 3ICFA 3TGHA 2HYOA 4FCXA 1HPUA 2BCDA 1AUIA 3IB8A 3IVEA 2HY1A 2IE3C 4DSYA 4I5NC 3P71C 4I5LC 2WDEA 4Q7FA 3ZU0A 3EGHA 1S3NA 3HVQA 3PSOA 5F3WA 3KBPA 1S3MA 4H2GA 1U32A 1WAO1 4MP0A 2DFJA 4H2BA 4O5GA 1S70A 2YEQA 2BDXA 2GJUA 4YKEA 5DNYA 1JK7A 4LACC 4V0VA 1KBPA 4H2IA 4V0WA 3RL4A 3T1IA 3RL3A 5JPEA 4O24A 4IYPC 2IE4C 4ORBA 1SU1A 5INBA 3H67A 3THOB 3H62B 4KKZA 4G9JA 3H60A 4XPNA 4TUIA 3H61A 2O8GA 2WDFA 4FBKA 2ZOAA 4FBWA 1Z2XA 2R17A 4KBPA 3H64A 4UWQA 3PSNA 5HPEA 2DXNA 2Q8UA 1USHA 4UT2A 3QFKA 4JA9A 4V0XA 2IAEC 5JJTA 1IT6A 4OR9A 2NYMC 3RQZA 5C1VA 3AV0A 1FJMA 5GTUA 1XM7A 1W24A 2QFRA 3IVDA 5J28A 3E7BA 4O4KA 4ORCA 4ZVZA 3FGAC 1NNWA 4F0ZA 1QFCA 3QFNA
chains in the Genus database with same CATH topology
2CV9A 5B8IA 3V4YA 4MOVA 3QG5C 4DHLA 1Z2WA 2O8AA 2ZO9B 2QJCA 2HYPA 1XZWA 3K7WC 4IL1A 4B2OA 4ORAA 4TUGA 3QFOA 2QFPA 1OIDA 1M63A 3D03A 1T71A 1QHWA 4WWLA 3RL5A 1II7A 2NPPC 4H2FA 4LU9A 3THNA 3LL8A 2Z72A 3ZTVA 5IOHA 2P6BA 2WDDA 4MOYA 3H69A 3H63A 4UT3B 1UF3A 3H68A 4J6OA 5JPFA 3DSDA 4JA7A 2DXLA 3QFMA 3E0JA 4O43A 4NZVA 2A22A 4M0VA 2YVTA 1UTEA 4DT2A 3DW8C 3E7AA 1T70A 3N5UA 1TCOA 4FBQA 4LTYA 1G5BA 3IB7A 2Z1AA 2NXFA 5EQVA 3C5WC 2AHDA 2JOGA 3DSCA 1S95A 1S8EA 4H1SA 3EGGA 1OI8A 2XMOA 1HP1A 3CK2A 3C9FA 2WDCA 3JYFA 3H66A 2USHA 4HD0A 3GVEA 3FLOA 1V73A 1S3LA 4UT3A 2KKNA 2Z06A 3K7VC 1OIEA 4H1YP 1WARA 2BQ8X 1HO5A 1MF8A 3AUZA 2NYLC 2ZBMA 4ZX2A 3ICFA 3TGHA 2HYOA 4FCXA 1HPUA 2BCDA 1AUIA 3IB8A 3IVEA 2HY1A 2IE3C 4DSYA 4I5NC 3P71C 4I5LC 2WDEA 4Q7FA 3ZU0A 3EGHA 1S3NA 3HVQA 3PSOA 5F3WA 3KBPA 1S3MA 4H2GA 1U32A 1WAO1 4MP0A 2DFJA 4H2BA 4O5GA 1S70A 2YEQA 2BDXA 2GJUA 4YKEA 5DNYA 1JK7A 4LACC 4V0VA 1KBPA 4H2IA 4V0WA 3RL4A 3T1IA 3RL3A 5JPEA 4O24A 4IYPC 2IE4C 4ORBA 1SU1A 5INBA 3H67A 3THOB 3H62B 4KKZA 4G9JA 3H60A 4XPNA 4TUIA 3H61A 2O8GA 2WDFA 4FBKA 2ZOAA 4FBWA 1Z2XA 2R17A 4KBPA 3H64A 4UWQA 3PSNA 5HPEA 2DXNA 2Q8UA 1USHA 4UT2A 3QFKA 4JA9A 4V0XA 2IAEC 5JJTA 1IT6A 4OR9A 2NYMC 3RQZA 5C1VA 3AV0A 1FJMA 5GTUA 1XM7A 1W24A 2QFRA 3IVDA 5J28A 3E7BA 4O4KA 4ORCA 4ZVZA 3FGAC 1NNWA 4F0ZA 1QFCA 3QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV9 A;  5B8I A;  3V4Y A;  4MOV A;  3QG5 C;  4DHL A;  1Z2W A;  2O8A A;  2QJC A;  2HYP A;  1XZW A;  3K7W C;  4IL1 A;  4B2O A;  4ORA A;  4TUG A;  3QFO A;  2QFP A;  1OID A;  1M63 A;  1T71 A;  1QHW A;  4WWL A;  3RL5 A;  1II7 A;  2NPP C;  4H2F A;  4LU9 A;  3THN A;  3LL8 A;  2Z72 A;  3ZTV A;  5IOH A;  2P6B A;  2WDD A;  4MOY A;  3H69 A;  3H63 A;  4UT3 B;  1UF3 A;  3H68 A;  4J6O A;  5JPF A;  3DSD A;  4JA7 A;  3QFM A;  4O43 A;  4NZV A;  2A22 A;  4M0V A;  2YVT A;  1UTE A;  4DT2 A;  3DW8 C;  3E7A A;  1T70 A;  3N5U A;  1TCO A;  4FBQ A;  4LTY A;  1G5B A;  3IB7 A;  2Z1A A;  2NXF A;  5EQV A;  3C5W C;  2AHD A;  2JOG A;  3DSC A;  1S95 A;  1S8E A;  4H1S A;  3EGG A;  1OI8 A;  2XMO A;  1HP1 A;  3CK2 A;  3C9F A;  2WDC A;  3JYF A;  3H66 A;  2USH A;  4HD0 A;  3GVE A;  1V73 A;  1S3L A;  4UT3 A;  2KKN A;  2Z06 A;  3K7V C;  1OIE A;  4H1Y P;  1WAR A;  2BQ8 X;  1HO5 A;  1MF8 A;  3AUZ A;  2NYL C;  2ZBM A;  4ZX2 A;  3ICF A;  3TGH A;  2HYO A;  4FCX A;  1HPU A;  2BCD A;  1AUI A;  3IB8 A;  3IVE A;  2HY1 A;  2IE3 C;  4DSY A;  4I5N C;  3P71 C;  4I5L C;  2WDE A;  4Q7F A;  3ZU0 A;  3EGH A;  1S3N A;  3HVQ A;  3PSO A;  5F3W A;  3KBP A;  1S3M A;  4H2G A;  1U32 A;  1WAO 1;  4MP0 A;  2DFJ A;  4H2B A;  4O5G A;  1S70 A;  2BDX A;  2GJU A;  4YKE A;  5DNY A;  1JK7 A;  4LAC C;  4V0V A;  1KBP A;  4H2I A;  4V0W A;  3RL4 A;  3T1I A;  3RL3 A;  5JPE A;  4O24 A;  4IYP C;  2IE4 C;  4ORB A;  1SU1 A;  5INB A;  3H67 A;  3THO B;  3H62 B;  4KKZ A;  4G9J A;  3H60 A;  4XPN A;  4TUI A;  3H61 A;  2O8G A;  2WDF A;  4FBK A;  4FBW A;  1Z2X A;  2R17 A;  4KBP A;  3H64 A;  4UWQ A;  3PSN A;  5HPE A;  2Q8U A;  1USH A;  4UT2 A;  3QFK A;  4JA9 A;  4V0X A;  2IAE C;  5JJT A;  1IT6 A;  4OR9 A;  2NYM C;  3RQZ A;  5C1V A;  3AV0 A;  1FJM A;  5GTU A;  1XM7 A;  1W24 A;  2QFR A;  3IVD A;  5J28 A;  3E7B A;  4O4K A;  4ORC A;  4ZVZ A;  3FGA C;  1NNW A;  4F0Z A;  1QFC A;  3QFN A; 
#chains in the Genus database with same CATH topology
 2CV9 A;  5B8I A;  3V4Y A;  4MOV A;  3QG5 C;  4DHL A;  1Z2W A;  2O8A A;  2ZO9 B;  2QJC A;  2HYP A;  1XZW A;  3K7W C;  4IL1 A;  4B2O A;  4ORA A;  4TUG A;  3QFO A;  2QFP A;  1OID A;  1M63 A;  3D03 A;  1T71 A;  1QHW A;  4WWL A;  3RL5 A;  1II7 A;  2NPP C;  4H2F A;  4LU9 A;  3THN A;  3LL8 A;  2Z72 A;  3ZTV A;  5IOH A;  2P6B A;  2WDD A;  4MOY A;  3H69 A;  3H63 A;  4UT3 B;  1UF3 A;  3H68 A;  4J6O A;  5JPF A;  3DSD A;  4JA7 A;  2DXL A;  3QFM A;  3E0J A;  4O43 A;  4NZV A;  2A22 A;  4M0V A;  2YVT A;  1UTE A;  4DT2 A;  3DW8 C;  3E7A A;  1T70 A;  3N5U A;  1TCO A;  4FBQ A;  4LTY A;  1G5B A;  3IB7 A;  2Z1A A;  2NXF A;  5EQV A;  3C5W C;  2AHD A;  2JOG A;  3DSC A;  1S95 A;  1S8E A;  4H1S A;  3EGG A;  1OI8 A;  2XMO A;  1HP1 A;  3CK2 A;  3C9F A;  2WDC A;  3JYF A;  3H66 A;  2USH A;  4HD0 A;  3GVE A;  3FLO A;  1V73 A;  1S3L A;  4UT3 A;  2KKN A;  2Z06 A;  3K7V C;  1OIE A;  4H1Y P;  1WAR A;  2BQ8 X;  1HO5 A;  1MF8 A;  3AUZ A;  2NYL C;  2ZBM A;  4ZX2 A;  3ICF A;  3TGH A;  2HYO A;  4FCX A;  1HPU A;  2BCD A;  1AUI A;  3IB8 A;  3IVE A;  2HY1 A;  2IE3 C;  4DSY A;  4I5N C;  3P71 C;  4I5L C;  2WDE A;  4Q7F A;  3ZU0 A;  3EGH A;  1S3N A;  3HVQ A;  3PSO A;  5F3W A;  3KBP A;  1S3M A;  4H2G A;  1U32 A;  1WAO 1;  4MP0 A;  2DFJ A;  4H2B A;  4O5G A;  1S70 A;  2YEQ A;  2BDX A;  2GJU A;  4YKE A;  5DNY A;  1JK7 A;  4LAC C;  4V0V A;  1KBP A;  4H2I A;  4V0W A;  3RL4 A;  3T1I A;  3RL3 A;  5JPE A;  4O24 A;  4IYP C;  2IE4 C;  4ORB A;  1SU1 A;  5INB A;  3H67 A;  3THO B;  3H62 B;  4KKZ A;  4G9J A;  3H60 A;  4XPN A;  4TUI A;  3H61 A;  2O8G A;  2WDF A;  4FBK A;  2ZOA A;  4FBW A;  1Z2X A;  2R17 A;  4KBP A;  3H64 A;  4UWQ A;  3PSN A;  5HPE A;  2DXN A;  2Q8U A;  1USH A;  4UT2 A;  3QFK A;  4JA9 A;  4V0X A;  2IAE C;  5JJT A;  1IT6 A;  4OR9 A;  2NYM C;  3RQZ A;  5C1V A;  3AV0 A;  1FJM A;  5GTU A;  1XM7 A;  1W24 A;  2QFR A;  3IVD A;  5J28 A;  3E7B A;  4O4K A;  4ORC A;  4ZVZ A;  3FGA C;  1NNW A;  4F0Z A;  1QFC A;  3QFN A; 
#chains in the Genus database with same CATH homology
 2CV9 A;  5B8I A;  3V4Y A;  4MOV A;  3QG5 C;  4DHL A;  1Z2W A;  2O8A A;  2ZO9 B;  2QJC A;  2HYP A;  1XZW A;  3K7W C;  4IL1 A;  4B2O A;  4ORA A;  4TUG A;  3QFO A;  2QFP A;  1OID A;  1M63 A;  3D03 A;  1T71 A;  1QHW A;  4WWL A;  3RL5 A;  1II7 A;  2NPP C;  4H2F A;  4LU9 A;  3THN A;  3LL8 A;  2Z72 A;  3ZTV A;  5IOH A;  2P6B A;  2WDD A;  4MOY A;  3H69 A;  3H63 A;  4UT3 B;  1UF3 A;  3H68 A;  4J6O A;  5JPF A;  3DSD A;  4JA7 A;  2DXL A;  3QFM A;  3E0J A;  4O43 A;  4NZV A;  2A22 A;  4M0V A;  2YVT A;  1UTE A;  4DT2 A;  3DW8 C;  3E7A A;  1T70 A;  3N5U A;  1TCO A;  4FBQ A;  4LTY A;  1G5B A;  3IB7 A;  2Z1A A;  2NXF A;  5EQV A;  3C5W C;  2AHD A;  2JOG A;  3DSC A;  1S95 A;  1S8E A;  4H1S A;  3EGG A;  1OI8 A;  2XMO A;  1HP1 A;  3CK2 A;  3C9F A;  2WDC A;  3JYF A;  3H66 A;  2USH A;  4HD0 A;  3GVE A;  3FLO A;  1V73 A;  1S3L A;  4UT3 A;  2KKN A;  2Z06 A;  3K7V C;  1OIE A;  4H1Y P;  1WAR A;  2BQ8 X;  1HO5 A;  1MF8 A;  3AUZ A;  2NYL C;  2ZBM A;  4ZX2 A;  3ICF A;  3TGH A;  2HYO A;  4FCX A;  1HPU A;  2BCD A;  1AUI A;  3IB8 A;  3IVE A;  2HY1 A;  2IE3 C;  4DSY A;  4I5N C;  3P71 C;  4I5L C;  2WDE A;  4Q7F A;  3ZU0 A;  3EGH A;  1S3N A;  3HVQ A;  3PSO A;  5F3W A;  3KBP A;  1S3M A;  4H2G A;  1U32 A;  1WAO 1;  4MP0 A;  2DFJ A;  4H2B A;  4O5G A;  1S70 A;  2YEQ A;  2BDX A;  2GJU A;  4YKE A;  5DNY A;  1JK7 A;  4LAC C;  4V0V A;  1KBP A;  4H2I A;  4V0W A;  3RL4 A;  3T1I A;  3RL3 A;  5JPE A;  4O24 A;  4IYP C;  2IE4 C;  4ORB A;  1SU1 A;  5INB A;  3H67 A;  3THO B;  3H62 B;  4KKZ A;  4G9J A;  3H60 A;  4XPN A;  4TUI A;  3H61 A;  2O8G A;  2WDF A;  4FBK A;  2ZOA A;  4FBW A;  1Z2X A;  2R17 A;  4KBP A;  3H64 A;  4UWQ A;  3PSN A;  5HPE A;  2DXN A;  2Q8U A;  1USH A;  4UT2 A;  3QFK A;  4JA9 A;  4V0X A;  2IAE C;  5JJT A;  1IT6 A;  4OR9 A;  2NYM C;  3RQZ A;  5C1V A;  3AV0 A;  1FJM A;  5GTU A;  1XM7 A;  1W24 A;  2QFR A;  3IVD A;  5J28 A;  3E7B A;  4O4K A;  4ORC A;  4ZVZ A;  3FGA C;  1NNW A;  4F0Z A;  1QFC A;  3QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...