2HYOA

Crystal structure of rv0805 n97a mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
227
Chain Sequence
PRPDYVLLHISDTHLIDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGAHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCGCNLVHVYPDTVVHSVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rv0805N97A
publication title Structural and Biochemical Analysis of the Rv0805 Cyclic Nucleotide Phosphodiesterase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 70
structure length 227
sequence length 256
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2hyoA00
3QG5C 5IOHA 2USHA 4XPNA 4NZVA 1WARA 4ORAA 2BCDA 5C1VA 4WWLA 3V4YA 2Z1AA 3LL8A 4HD0A 4DHLA 3RL4A 2O8AA 2YVTA 4LU9A 2IE3C 1MF8A 2WDDA 3AUZA 3H69A 2HYPA 5JPEA 5JJTA 2WDCA 4H2FA 3AV0A 2Q8UA 5J28A 3DSDA 3IVEA 4FBQA 4I5LC 1UTEA 4H1SA 4JA9A 4LACC 2WDFA 2Z72A 4MOYA 2Z06A 1S8EA 3C5WC 4I5NC 3THNA 3EGGA 4OR9A 4G9JA 4IYPC 1XM7A 4O43A 4M0VA 3N5UA 2XMOA 2NPPC 2QJCA 1USHA 3H61A 4B2OA 3RL5A 1T70A 2P6BA 4ZVZA 1S3LA 3H64A 1FJMA 2CV9A 2NYLC 1AUIA 4H2IA 1XZWA 3QFOA 2DFJA 4V0WA 1V73A 3P71C 4O5GA 3H60A 5GTUA 2O8GA 2QFPA 1NNWA 3ICFA 2IE4C 4H2BA 2QFRA 4V0VA 4O4KA 5EQVA 3PSNA 4ZX2A 2JOGA 2R17A 1S95A 4Q7FA 2WDEA 3THOB 3H67A 1KBPA 3H62B 1TCOA 1HO5A 1QHWA 1T71A 4FCXA 4LTYA 1G5BA 3PSOA 2IAEC 4MOVA 4FBWA 2HY1A 1S70A 4UT3A 2AHDA 4V0XA 3T1IA 3IB8A 4IL1A 3E7BA 1OIEA 4ORBA 2NYMC 3H66A 3EGHA 3IB7A 3IVDA 3QFKA 2BDXA 1IT6A 3H63A 4ORCA 3K7WC 3GVEA 2A22A 4UT3B 2KKNA 1SU1A 3KBPA 1HP1A 4DT2A 1WAO1 5HPEA 1HPUA 1Z2XA 3FGAC 3E7AA 4UT2A 1Z2WA 3JYFA 1U32A 3C9FA 5B8IA 4TUGA 4KKZA 1S3NA 3QFNA 4MP0A 4YKEA 4F0ZA 3CK2A 3TGHA 4UWQA 2GJUA 5DNYA 4KBPA 1JK7A 1OIDA 3H68A 3DW8C 1II7A 4H2GA 1W24A 4FBKA 4TUIA 4DSYA 3RQZA 2ZBMA 1OI8A 5JPFA 2NXFA 3ZTVA 3QFMA 3ZU0A 3K7VC 1QFCA 5F3WA 1UF3A 4O24A 4H1YP 4JA7A 2BQ8X 3HVQA 3RL3A 5INBA 1M63A 3DSCA 4J6OA 2HYOA 1S3MA
chains in the Genus database with same CATH superfamily
3QG5C 5IOHA 2USHA 4XPNA 4NZVA 2YEQA 1WARA 4ORAA 2BCDA 5C1VA 4WWLA 3V4YA 2Z1AA 3LL8A 4HD0A 4DHLA 3RL4A 2O8AA 2YVTA 4LU9A 2IE3C 1MF8A 2WDDA 3AUZA 3H69A 2HYPA 5JPEA 5JJTA 2WDCA 4H2FA 3AV0A 2Q8UA 5J28A 3DSDA 3IVEA 4FBQA 4I5LC 1UTEA 4H1SA 4JA9A 4LACC 2WDFA 2Z72A 4MOYA 2Z06A 1S8EA 3C5WC 4I5NC 3THNA 3EGGA 4OR9A 4G9JA 4IYPC 1XM7A 4O43A 4M0VA 3N5UA 2XMOA 2DXLA 2NPPC 2ZO9B 2QJCA 1USHA 3H61A 4B2OA 3RL5A 1T70A 2P6BA 4ZVZA 1S3LA 3H64A 1FJMA 2CV9A 2NYLC 1AUIA 4H2IA 1XZWA 3QFOA 2DFJA 4V0WA 1V73A 3P71C 4O5GA 3H60A 5GTUA 2O8GA 2QFPA 1NNWA 3ICFA 2IE4C 4H2BA 2QFRA 4V0VA 4O4KA 5EQVA 3PSNA 4ZX2A 2JOGA 2R17A 2DXNA 1S95A 4Q7FA 2WDEA 3THOB 3H67A 1KBPA 3H62B 1TCOA 1HO5A 1QHWA 1T71A 4FCXA 4LTYA 1G5BA 3PSOA 2IAEC 4MOVA 4FBWA 2HY1A 1S70A 4UT3A 2AHDA 4V0XA 3T1IA 3IB8A 4IL1A 3E7BA 1OIEA 4ORBA 2NYMC 2ZOAA 3EGHA 3H66A 3IB7A 3IVDA 2BDXA 1IT6A 3H63A 3QFKA 4ORCA 3K7WC 3GVEA 2A22A 4UT3B 2KKNA 1SU1A 3KBPA 1HP1A 4DT2A 1WAO1 5HPEA 1HPUA 1Z2XA 3FGAC 3E7AA 4UT2A 1Z2WA 3FLOA 3JYFA 1U32A 3C9FA 3E0JA 5B8IA 4TUGA 4KKZA 1S3NA 3QFNA 4MP0A 4YKEA 4F0ZA 3CK2A 3TGHA 4UWQA 2GJUA 5DNYA 4KBPA 1JK7A 1OIDA 3H68A 3DW8C 1II7A 4H2GA 1W24A 4FBKA 4TUIA 4DSYA 3RQZA 2ZBMA 1OI8A 3D03A 5JPFA 2NXFA 3ZTVA 3QFMA 3ZU0A 3K7VC 1QFCA 5F3WA 1UF3A 4O24A 4H1YP 4JA7A 2BQ8X 3HVQA 3RL3A 5INBA 1M63A 3DSCA 4J6OA 2HYOA 1S3MA
chains in the Genus database with same CATH topology
3QG5C 5IOHA 2USHA 4XPNA 4NZVA 2YEQA 1WARA 4ORAA 2BCDA 5C1VA 4WWLA 3V4YA 2Z1AA 3LL8A 4HD0A 4DHLA 3RL4A 2O8AA 2YVTA 4LU9A 2IE3C 1MF8A 2WDDA 3AUZA 3H69A 2HYPA 5JPEA 5JJTA 2WDCA 4H2FA 3AV0A 2Q8UA 5J28A 3DSDA 3IVEA 4FBQA 4I5LC 1UTEA 4H1SA 4JA9A 4LACC 2WDFA 2Z72A 4MOYA 2Z06A 1S8EA 3C5WC 4I5NC 3THNA 3EGGA 4OR9A 4G9JA 4IYPC 1XM7A 4O43A 4M0VA 3N5UA 2XMOA 2DXLA 2NPPC 2ZO9B 2QJCA 1USHA 3H61A 4B2OA 3RL5A 1T70A 2P6BA 4ZVZA 1S3LA 3H64A 1FJMA 2CV9A 2NYLC 1AUIA 4H2IA 1XZWA 3QFOA 2DFJA 4V0WA 1V73A 3P71C 4O5GA 3H60A 5GTUA 2O8GA 2QFPA 1NNWA 3ICFA 2IE4C 4H2BA 2QFRA 4V0VA 4O4KA 5EQVA 3PSNA 4ZX2A 2JOGA 2R17A 2DXNA 1S95A 4Q7FA 2WDEA 3THOB 3H67A 1KBPA 3H62B 1TCOA 1HO5A 1QHWA 1T71A 4FCXA 4LTYA 1G5BA 3PSOA 2IAEC 4MOVA 4FBWA 2HY1A 1S70A 4UT3A 2AHDA 4V0XA 3T1IA 3IB8A 4IL1A 3E7BA 1OIEA 4ORBA 2NYMC 2ZOAA 3EGHA 3H66A 3IB7A 3IVDA 2BDXA 1IT6A 3H63A 3QFKA 4ORCA 3K7WC 3GVEA 2A22A 4UT3B 2KKNA 1SU1A 3KBPA 1HP1A 4DT2A 1WAO1 5HPEA 1HPUA 1Z2XA 3FGAC 3E7AA 4UT2A 1Z2WA 3FLOA 3JYFA 1U32A 3C9FA 3E0JA 5B8IA 4TUGA 4KKZA 1S3NA 3QFNA 4MP0A 4YKEA 4F0ZA 3CK2A 3TGHA 4UWQA 2GJUA 5DNYA 4KBPA 1JK7A 1OIDA 3H68A 3DW8C 1II7A 4H2GA 1W24A 4FBKA 4TUIA 4DSYA 3RQZA 2ZBMA 1OI8A 3D03A 5JPFA 2NXFA 3ZTVA 3QFMA 3ZU0A 3K7VC 1QFCA 5F3WA 1UF3A 4O24A 4H1YP 4JA7A 2BQ8X 3HVQA 3RL3A 5INBA 1M63A 3DSCA 4J6OA 2HYOA 1S3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG5 C;  5IOH A;  2USH A;  4XPN A;  4NZV A;  1WAR A;  4ORA A;  2BCD A;  5C1V A;  4WWL A;  3V4Y A;  2Z1A A;  3LL8 A;  4HD0 A;  4DHL A;  3RL4 A;  2O8A A;  2YVT A;  4LU9 A;  2IE3 C;  1MF8 A;  2WDD A;  3AUZ A;  3H69 A;  2HYP A;  5JPE A;  5JJT A;  2WDC A;  4H2F A;  3AV0 A;  2Q8U A;  5J28 A;  3DSD A;  3IVE A;  4FBQ A;  4I5L C;  1UTE A;  4H1S A;  4JA9 A;  4LAC C;  2WDF A;  2Z72 A;  4MOY A;  2Z06 A;  1S8E A;  3C5W C;  4I5N C;  3THN A;  3EGG A;  4OR9 A;  4G9J A;  4IYP C;  1XM7 A;  4O43 A;  4M0V A;  3N5U A;  2XMO A;  2NPP C;  2QJC A;  1USH A;  3H61 A;  4B2O A;  3RL5 A;  1T70 A;  2P6B A;  4ZVZ A;  1S3L A;  3H64 A;  1FJM A;  2CV9 A;  2NYL C;  1AUI A;  4H2I A;  1XZW A;  3QFO A;  2DFJ A;  4V0W A;  1V73 A;  3P71 C;  4O5G A;  3H60 A;  5GTU A;  2O8G A;  2QFP A;  1NNW A;  3ICF A;  2IE4 C;  4H2B A;  2QFR A;  4V0V A;  4O4K A;  5EQV A;  3PSN A;  4ZX2 A;  2JOG A;  2R17 A;  1S95 A;  4Q7F A;  2WDE A;  3THO B;  3H67 A;  1KBP A;  3H62 B;  1TCO A;  1HO5 A;  1QHW A;  1T71 A;  4FCX A;  4LTY A;  1G5B A;  3PSO A;  2IAE C;  4MOV A;  4FBW A;  2HY1 A;  1S70 A;  4UT3 A;  2AHD A;  4V0X A;  3T1I A;  3IB8 A;  4IL1 A;  3E7B A;  1OIE A;  4ORB A;  2NYM C;  3H66 A;  3EGH A;  3IB7 A;  3IVD A;  3QFK A;  2BDX A;  1IT6 A;  3H63 A;  4ORC A;  3K7W C;  3GVE A;  2A22 A;  4UT3 B;  2KKN A;  1SU1 A;  3KBP A;  1HP1 A;  4DT2 A;  1WAO 1;  5HPE A;  1HPU A;  1Z2X A;  3FGA C;  3E7A A;  4UT2 A;  1Z2W A;  3JYF A;  1U32 A;  3C9F A;  5B8I A;  4TUG A;  4KKZ A;  1S3N A;  3QFN A;  4MP0 A;  4YKE A;  4F0Z A;  3CK2 A;  3TGH A;  4UWQ A;  2GJU A;  5DNY A;  4KBP A;  1JK7 A;  1OID A;  3H68 A;  3DW8 C;  1II7 A;  4H2G A;  1W24 A;  4FBK A;  4TUI A;  4DSY A;  3RQZ A;  2ZBM A;  1OI8 A;  5JPF A;  2NXF A;  3ZTV A;  3QFM A;  3ZU0 A;  3K7V C;  1QFC A;  5F3W A;  1UF3 A;  4O24 A;  4H1Y P;  4JA7 A;  2BQ8 X;  3HVQ A;  3RL3 A;  5INB A;  1M63 A;  3DSC A;  4J6O A;  2HYO A;  1S3M A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  5IOH A;  2USH A;  4XPN A;  4NZV A;  2YEQ A;  1WAR A;  4ORA A;  2BCD A;  5C1V A;  4WWL A;  3V4Y A;  2Z1A A;  3LL8 A;  4HD0 A;  4DHL A;  3RL4 A;  2O8A A;  2YVT A;  4LU9 A;  2IE3 C;  1MF8 A;  2WDD A;  3AUZ A;  3H69 A;  2HYP A;  5JPE A;  5JJT A;  2WDC A;  4H2F A;  3AV0 A;  2Q8U A;  5J28 A;  3DSD A;  3IVE A;  4FBQ A;  4I5L C;  1UTE A;  4H1S A;  4JA9 A;  4LAC C;  2WDF A;  2Z72 A;  4MOY A;  2Z06 A;  1S8E A;  3C5W C;  4I5N C;  3THN A;  3EGG A;  4OR9 A;  4G9J A;  4IYP C;  1XM7 A;  4O43 A;  4M0V A;  3N5U A;  2XMO A;  2DXL A;  2NPP C;  2ZO9 B;  2QJC A;  1USH A;  3H61 A;  4B2O A;  3RL5 A;  1T70 A;  2P6B A;  4ZVZ A;  1S3L A;  3H64 A;  1FJM A;  2CV9 A;  2NYL C;  1AUI A;  4H2I A;  1XZW A;  3QFO A;  2DFJ A;  4V0W A;  1V73 A;  3P71 C;  4O5G A;  3H60 A;  5GTU A;  2O8G A;  2QFP A;  1NNW A;  3ICF A;  2IE4 C;  4H2B A;  2QFR A;  4V0V A;  4O4K A;  5EQV A;  3PSN A;  4ZX2 A;  2JOG A;  2R17 A;  2DXN A;  1S95 A;  4Q7F A;  2WDE A;  3THO B;  3H67 A;  1KBP A;  3H62 B;  1TCO A;  1HO5 A;  1QHW A;  1T71 A;  4FCX A;  4LTY A;  1G5B A;  3PSO A;  2IAE C;  4MOV A;  4FBW A;  2HY1 A;  1S70 A;  4UT3 A;  2AHD A;  4V0X A;  3T1I A;  3IB8 A;  4IL1 A;  3E7B A;  1OIE A;  4ORB A;  2NYM C;  2ZOA A;  3EGH A;  3H66 A;  3IB7 A;  3IVD A;  2BDX A;  1IT6 A;  3H63 A;  3QFK A;  4ORC A;  3K7W C;  3GVE A;  2A22 A;  4UT3 B;  2KKN A;  1SU1 A;  3KBP A;  1HP1 A;  4DT2 A;  1WAO 1;  5HPE A;  1HPU A;  1Z2X A;  3FGA C;  3E7A A;  4UT2 A;  1Z2W A;  3FLO A;  3JYF A;  1U32 A;  3C9F A;  3E0J A;  5B8I A;  4TUG A;  4KKZ A;  1S3N A;  3QFN A;  4MP0 A;  4YKE A;  4F0Z A;  3CK2 A;  3TGH A;  4UWQ A;  2GJU A;  5DNY A;  4KBP A;  1JK7 A;  1OID A;  3H68 A;  3DW8 C;  1II7 A;  4H2G A;  1W24 A;  4FBK A;  4TUI A;  4DSY A;  3RQZ A;  2ZBM A;  1OI8 A;  3D03 A;  5JPF A;  2NXF A;  3ZTV A;  3QFM A;  3ZU0 A;  3K7V C;  1QFC A;  5F3W A;  1UF3 A;  4O24 A;  4H1Y P;  4JA7 A;  2BQ8 X;  3HVQ A;  3RL3 A;  5INB A;  1M63 A;  3DSC A;  4J6O A;  2HYO A;  1S3M A; 
#chains in the Genus database with same CATH homology
 3QG5 C;  5IOH A;  2USH A;  4XPN A;  4NZV A;  2YEQ A;  1WAR A;  4ORA A;  2BCD A;  5C1V A;  4WWL A;  3V4Y A;  2Z1A A;  3LL8 A;  4HD0 A;  4DHL A;  3RL4 A;  2O8A A;  2YVT A;  4LU9 A;  2IE3 C;  1MF8 A;  2WDD A;  3AUZ A;  3H69 A;  2HYP A;  5JPE A;  5JJT A;  2WDC A;  4H2F A;  3AV0 A;  2Q8U A;  5J28 A;  3DSD A;  3IVE A;  4FBQ A;  4I5L C;  1UTE A;  4H1S A;  4JA9 A;  4LAC C;  2WDF A;  2Z72 A;  4MOY A;  2Z06 A;  1S8E A;  3C5W C;  4I5N C;  3THN A;  3EGG A;  4OR9 A;  4G9J A;  4IYP C;  1XM7 A;  4O43 A;  4M0V A;  3N5U A;  2XMO A;  2DXL A;  2NPP C;  2ZO9 B;  2QJC A;  1USH A;  3H61 A;  4B2O A;  3RL5 A;  1T70 A;  2P6B A;  4ZVZ A;  1S3L A;  3H64 A;  1FJM A;  2CV9 A;  2NYL C;  1AUI A;  4H2I A;  1XZW A;  3QFO A;  2DFJ A;  4V0W A;  1V73 A;  3P71 C;  4O5G A;  3H60 A;  5GTU A;  2O8G A;  2QFP A;  1NNW A;  3ICF A;  2IE4 C;  4H2B A;  2QFR A;  4V0V A;  4O4K A;  5EQV A;  3PSN A;  4ZX2 A;  2JOG A;  2R17 A;  2DXN A;  1S95 A;  4Q7F A;  2WDE A;  3THO B;  3H67 A;  1KBP A;  3H62 B;  1TCO A;  1HO5 A;  1QHW A;  1T71 A;  4FCX A;  4LTY A;  1G5B A;  3PSO A;  2IAE C;  4MOV A;  4FBW A;  2HY1 A;  1S70 A;  4UT3 A;  2AHD A;  4V0X A;  3T1I A;  3IB8 A;  4IL1 A;  3E7B A;  1OIE A;  4ORB A;  2NYM C;  2ZOA A;  3EGH A;  3H66 A;  3IB7 A;  3IVD A;  2BDX A;  1IT6 A;  3H63 A;  3QFK A;  4ORC A;  3K7W C;  3GVE A;  2A22 A;  4UT3 B;  2KKN A;  1SU1 A;  3KBP A;  1HP1 A;  4DT2 A;  1WAO 1;  5HPE A;  1HPU A;  1Z2X A;  3FGA C;  3E7A A;  4UT2 A;  1Z2W A;  3FLO A;  3JYF A;  1U32 A;  3C9F A;  3E0J A;  5B8I A;  4TUG A;  4KKZ A;  1S3N A;  3QFN A;  4MP0 A;  4YKE A;  4F0Z A;  3CK2 A;  3TGH A;  4UWQ A;  2GJU A;  5DNY A;  4KBP A;  1JK7 A;  1OID A;  3H68 A;  3DW8 C;  1II7 A;  4H2G A;  1W24 A;  4FBK A;  4TUI A;  4DSY A;  3RQZ A;  2ZBM A;  1OI8 A;  3D03 A;  5JPF A;  2NXF A;  3ZTV A;  3QFM A;  3ZU0 A;  3K7V C;  1QFC A;  5F3W A;  1UF3 A;  4O24 A;  4H1Y P;  4JA7 A;  2BQ8 X;  3HVQ A;  3RL3 A;  5INB A;  1M63 A;  3DSC A;  4J6O A;  2HYO A;  1S3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...