2HYOA

Crystal structure of rv0805 n97a mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
227
Chain Sequence
PRPDYVLLHISDTHLIDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGAHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCGCNLVHVYPDTVVHSVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Rv0805N97A
publication title Structural and Biochemical Analysis of the Rv0805 Cyclic Nucleotide Phosphodiesterase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 70
structure length 227
sequence length 256
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2hyoA00
1T71A 5DNYA 4MOVA 1U32A 4O4KA 5INBA 2QJCA 2QFRA 4V0WA 5EQVA 3K7WC 4JA7A 3AV0A 3H69A 2Z72A 3AUZA 3H62B 4WWLA 4ZVZA 3DSDA 1WAO1 3TGHA 2DFJA 1HPUA 4LTYA 4FBKA 3RQZA 3ICFA 4UWQA 2AHDA 4KKZA 3V4YA 3H60A 3RL4A 3QG5C 3N5UA 1M63A 4LACC 1TCOA 3H67A 1QHWA 5JJTA 4O5GA 2NXFA 5HPEA 3E7BA 3IB7A 3P71C 4MP0A 1HO5A 1MF8A 3IB8A 3QFNA 3DW8C 3THOB 3T1IA 2O8AA 3JYFA 3C5WC 1KBPA 4JA9A 1HP1A 1AUIA 3CK2A 3ZTVA 4DT2A 3H68A 1NNWA 1UF3A 3E7AA 3EGHA 3QFOA 4XPNA 4MOYA 1XZWA 2O8GA 4HD0A 2BCDA 5JPFA 3ZU0A 2WDDA 2BQ8X 1FJMA 3IVEA 2HYPA 3H66A 3GVEA 3KBPA 4IYPC 4H2BA 4Q7FA 3QFKA 4ORAA 1OIDA 1W24A 4ORBA 1OI8A 2R17A 4YKEA 2NYMC 3H64A 2KKNA 4I5LC 4H1SA 3FGAC 4ZX2A 2Q8UA 4DSYA 4B2OA 3H63A 1S3LA 1IT6A 3H61A 4G9JA 4F0ZA 1Z2WA 4UT3B 2WDEA 4V0XA 5GTUA 1WARA 1V73A 4H2GA 3RL5A 3C9FA 3LL8A 1G5BA 2A22A 4H2IA 1QFCA 4KBPA 4NZVA 2IAEC 2P6BA 4FBWA 4DHLA 1Z2XA 1S3NA 3IVDA 3PSOA 4LU9A 4O24A 1XM7A 3DSCA 3THNA 4ORCA 4IL1A 2Z1AA 5F3WA 3QFMA 2NYLC 5JPEA 1S8EA 2HYOA 4M0VA 1S70A 1SU1A 1S3MA 1JK7A 1USHA 2YVTA 2Z06A 4V0VA 5J28A 5IOHA 5C1VA 2ZBMA 4I5NC 2NPPC 2BDXA 2IE3C 2CV9A 4H1YP 4O43A 1S95A 4OR9A 5B8IA 1II7A 2GJUA 1UTEA 3K7VC 4FBQA 4FCXA 1T70A 3PSNA 4TUIA 2JOGA 3EGGA 2XMOA 2WDFA 4UT3A 4TUGA 2IE4C 4UT2A 4J6OA 3HVQA 2USHA 1OIEA 4H2FA 3RL3A 2WDCA 2HY1A 2QFPA
chains in the Genus database with same CATH superfamily
1T71A 5DNYA 4MOVA 1U32A 4O4KA 5INBA 2QJCA 2QFRA 4V0WA 5EQVA 3K7WC 4JA7A 3AV0A 3H69A 2Z72A 3AUZA 3H62B 4WWLA 4ZVZA 3DSDA 1WAO1 3TGHA 2DFJA 1HPUA 4LTYA 4FBKA 2DXNA 3ICFA 3RQZA 4UWQA 2AHDA 4KKZA 3V4YA 3H60A 3RL4A 3QG5C 3N5UA 1M63A 4LACC 1TCOA 3H67A 1QHWA 5JJTA 4O5GA 2NXFA 5HPEA 3E7BA 3IB7A 3P71C 4MP0A 1HO5A 1MF8A 3IB8A 3QFNA 3DW8C 3THOB 3T1IA 2O8AA 3JYFA 3C5WC 1KBPA 4JA9A 1HP1A 1AUIA 3CK2A 3ZTVA 4DT2A 3H68A 1NNWA 1UF3A 3E7AA 3EGHA 3QFOA 4XPNA 4MOYA 1XZWA 2O8GA 3D03A 2BCDA 4HD0A 5JPFA 3ZU0A 2WDDA 2BQ8X 1FJMA 3IVEA 2HYPA 3H66A 3GVEA 3KBPA 4IYPC 4H2BA 4Q7FA 3QFKA 4ORAA 1OIDA 1W24A 4ORBA 1OI8A 2R17A 4YKEA 2NYMC 3H64A 2KKNA 4I5LC 4H1SA 3FGAC 4ZX2A 2Q8UA 4DSYA 4B2OA 2DXLA 3H63A 1S3LA 1IT6A 3H61A 4G9JA 4F0ZA 1Z2WA 4UT3B 2WDEA 4V0XA 5GTUA 1WARA 1V73A 4H2GA 3RL5A 3C9FA 3E0JA 2YEQA 1G5BA 3LL8A 2A22A 4H2IA 1QFCA 2ZOAA 4KBPA 4NZVA 2IAEC 2P6BA 4FBWA 4DHLA 1Z2XA 2ZO9B 1S3NA 3IVDA 3PSOA 4LU9A 4O24A 1XM7A 3DSCA 3THNA 4ORCA 4IL1A 2Z1AA 5F3WA 3QFMA 2NYLC 5JPEA 1S8EA 2HYOA 4M0VA 1S70A 1SU1A 1S3MA 1JK7A 1USHA 2YVTA 2Z06A 4V0VA 5J28A 5IOHA 5C1VA 2ZBMA 4I5NC 2NPPC 2BDXA 2IE3C 2CV9A 4H1YP 4O43A 1S95A 4OR9A 5B8IA 1II7A 2GJUA 1UTEA 3K7VC 4FBQA 4FCXA 3FLOA 1T70A 3PSNA 4TUIA 2JOGA 3EGGA 2XMOA 2WDFA 4UT3A 4TUGA 2IE4C 4UT2A 4J6OA 3HVQA 2USHA 1OIEA 4H2FA 3RL3A 2WDCA 2HY1A 2QFPA
chains in the Genus database with same CATH topology
1T71A 5DNYA 4MOVA 1U32A 4O4KA 5INBA 2QJCA 2QFRA 4V0WA 5EQVA 3K7WC 4JA7A 3AV0A 3H69A 2Z72A 3AUZA 3H62B 4WWLA 4ZVZA 3DSDA 1WAO1 3TGHA 2DFJA 1HPUA 4LTYA 4FBKA 2DXNA 3ICFA 3RQZA 4UWQA 2AHDA 4KKZA 3V4YA 3H60A 3RL4A 3QG5C 3N5UA 1M63A 4LACC 1TCOA 3H67A 1QHWA 5JJTA 4O5GA 2NXFA 5HPEA 3E7BA 3IB7A 3P71C 4MP0A 1HO5A 1MF8A 3IB8A 3QFNA 3DW8C 3THOB 3T1IA 2O8AA 3JYFA 3C5WC 1KBPA 4JA9A 1HP1A 1AUIA 3CK2A 3ZTVA 4DT2A 3H68A 1NNWA 1UF3A 3E7AA 3EGHA 3QFOA 4XPNA 4MOYA 1XZWA 2O8GA 3D03A 2BCDA 4HD0A 5JPFA 3ZU0A 2WDDA 2BQ8X 1FJMA 3IVEA 2HYPA 3H66A 3GVEA 3KBPA 4IYPC 4H2BA 4Q7FA 3QFKA 4ORAA 1OIDA 1W24A 4ORBA 1OI8A 2R17A 4YKEA 2NYMC 3H64A 2KKNA 4I5LC 4H1SA 3FGAC 4ZX2A 2Q8UA 4DSYA 4B2OA 2DXLA 3H63A 1S3LA 1IT6A 3H61A 4G9JA 4F0ZA 1Z2WA 4UT3B 2WDEA 4V0XA 5GTUA 1WARA 1V73A 4H2GA 3RL5A 3C9FA 3E0JA 2YEQA 1G5BA 3LL8A 2A22A 4H2IA 1QFCA 2ZOAA 4KBPA 4NZVA 2IAEC 2P6BA 4FBWA 4DHLA 1Z2XA 2ZO9B 1S3NA 3IVDA 3PSOA 4LU9A 4O24A 1XM7A 3DSCA 3THNA 4ORCA 4IL1A 2Z1AA 5F3WA 3QFMA 2NYLC 5JPEA 1S8EA 2HYOA 4M0VA 1S70A 1SU1A 1S3MA 1JK7A 1USHA 2YVTA 2Z06A 4V0VA 5J28A 5IOHA 5C1VA 2ZBMA 4I5NC 2NPPC 2BDXA 2IE3C 2CV9A 4H1YP 4O43A 1S95A 4OR9A 5B8IA 1II7A 2GJUA 1UTEA 3K7VC 4FBQA 4FCXA 3FLOA 1T70A 3PSNA 4TUIA 2JOGA 3EGGA 2XMOA 2WDFA 4UT3A 4TUGA 2IE4C 4UT2A 4J6OA 3HVQA 2USHA 1OIEA 4H2FA 3RL3A 2WDCA 2HY1A 2QFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T71 A;  5DNY A;  4MOV A;  1U32 A;  4O4K A;  5INB A;  2QJC A;  2QFR A;  4V0W A;  5EQV A;  3K7W C;  4JA7 A;  3AV0 A;  3H69 A;  2Z72 A;  3AUZ A;  3H62 B;  4WWL A;  4ZVZ A;  3DSD A;  1WAO 1;  3TGH A;  2DFJ A;  1HPU A;  4LTY A;  4FBK A;  3RQZ A;  3ICF A;  4UWQ A;  2AHD A;  4KKZ A;  3V4Y A;  3H60 A;  3RL4 A;  3QG5 C;  3N5U A;  1M63 A;  4LAC C;  1TCO A;  3H67 A;  1QHW A;  5JJT A;  4O5G A;  2NXF A;  5HPE A;  3E7B A;  3IB7 A;  3P71 C;  4MP0 A;  1HO5 A;  1MF8 A;  3IB8 A;  3QFN A;  3DW8 C;  3THO B;  3T1I A;  2O8A A;  3JYF A;  3C5W C;  1KBP A;  4JA9 A;  1HP1 A;  1AUI A;  3CK2 A;  3ZTV A;  4DT2 A;  3H68 A;  1NNW A;  1UF3 A;  3E7A A;  3EGH A;  3QFO A;  4XPN A;  4MOY A;  1XZW A;  2O8G A;  4HD0 A;  2BCD A;  5JPF A;  3ZU0 A;  2WDD A;  2BQ8 X;  1FJM A;  3IVE A;  2HYP A;  3H66 A;  3GVE A;  3KBP A;  4IYP C;  4H2B A;  4Q7F A;  3QFK A;  4ORA A;  1OID A;  1W24 A;  4ORB A;  1OI8 A;  2R17 A;  4YKE A;  2NYM C;  3H64 A;  2KKN A;  4I5L C;  4H1S A;  3FGA C;  4ZX2 A;  2Q8U A;  4DSY A;  4B2O A;  3H63 A;  1S3L A;  1IT6 A;  3H61 A;  4G9J A;  4F0Z A;  1Z2W A;  4UT3 B;  2WDE A;  4V0X A;  5GTU A;  1WAR A;  1V73 A;  4H2G A;  3RL5 A;  3C9F A;  3LL8 A;  1G5B A;  2A22 A;  4H2I A;  1QFC A;  4KBP A;  4NZV A;  2IAE C;  2P6B A;  4FBW A;  4DHL A;  1Z2X A;  1S3N A;  3IVD A;  3PSO A;  4LU9 A;  4O24 A;  1XM7 A;  3DSC A;  3THN A;  4ORC A;  4IL1 A;  2Z1A A;  5F3W A;  3QFM A;  2NYL C;  5JPE A;  1S8E A;  2HYO A;  4M0V A;  1S70 A;  1SU1 A;  1S3M A;  1JK7 A;  1USH A;  2YVT A;  2Z06 A;  4V0V A;  5J28 A;  5IOH A;  5C1V A;  2ZBM A;  4I5N C;  2NPP C;  2BDX A;  2IE3 C;  2CV9 A;  4H1Y P;  4O43 A;  1S95 A;  4OR9 A;  5B8I A;  1II7 A;  2GJU A;  1UTE A;  3K7V C;  4FBQ A;  4FCX A;  1T70 A;  3PSN A;  4TUI A;  2JOG A;  3EGG A;  2XMO A;  2WDF A;  4UT3 A;  4TUG A;  2IE4 C;  4UT2 A;  4J6O A;  3HVQ A;  2USH A;  1OIE A;  4H2F A;  3RL3 A;  2WDC A;  2HY1 A;  2QFP A; 
#chains in the Genus database with same CATH topology
 1T71 A;  5DNY A;  4MOV A;  1U32 A;  4O4K A;  5INB A;  2QJC A;  2QFR A;  4V0W A;  5EQV A;  3K7W C;  4JA7 A;  3AV0 A;  3H69 A;  2Z72 A;  3AUZ A;  3H62 B;  4WWL A;  4ZVZ A;  3DSD A;  1WAO 1;  3TGH A;  2DFJ A;  1HPU A;  4LTY A;  4FBK A;  2DXN A;  3ICF A;  3RQZ A;  4UWQ A;  2AHD A;  4KKZ A;  3V4Y A;  3H60 A;  3RL4 A;  3QG5 C;  3N5U A;  1M63 A;  4LAC C;  1TCO A;  3H67 A;  1QHW A;  5JJT A;  4O5G A;  2NXF A;  5HPE A;  3E7B A;  3IB7 A;  3P71 C;  4MP0 A;  1HO5 A;  1MF8 A;  3IB8 A;  3QFN A;  3DW8 C;  3THO B;  3T1I A;  2O8A A;  3JYF A;  3C5W C;  1KBP A;  4JA9 A;  1HP1 A;  1AUI A;  3CK2 A;  3ZTV A;  4DT2 A;  3H68 A;  1NNW A;  1UF3 A;  3E7A A;  3EGH A;  3QFO A;  4XPN A;  4MOY A;  1XZW A;  2O8G A;  3D03 A;  2BCD A;  4HD0 A;  5JPF A;  3ZU0 A;  2WDD A;  2BQ8 X;  1FJM A;  3IVE A;  2HYP A;  3H66 A;  3GVE A;  3KBP A;  4IYP C;  4H2B A;  4Q7F A;  3QFK A;  4ORA A;  1OID A;  1W24 A;  4ORB A;  1OI8 A;  2R17 A;  4YKE A;  2NYM C;  3H64 A;  2KKN A;  4I5L C;  4H1S A;  3FGA C;  4ZX2 A;  2Q8U A;  4DSY A;  4B2O A;  2DXL A;  3H63 A;  1S3L A;  1IT6 A;  3H61 A;  4G9J A;  4F0Z A;  1Z2W A;  4UT3 B;  2WDE A;  4V0X A;  5GTU A;  1WAR A;  1V73 A;  4H2G A;  3RL5 A;  3C9F A;  3E0J A;  2YEQ A;  1G5B A;  3LL8 A;  2A22 A;  4H2I A;  1QFC A;  2ZOA A;  4KBP A;  4NZV A;  2IAE C;  2P6B A;  4FBW A;  4DHL A;  1Z2X A;  2ZO9 B;  1S3N A;  3IVD A;  3PSO A;  4LU9 A;  4O24 A;  1XM7 A;  3DSC A;  3THN A;  4ORC A;  4IL1 A;  2Z1A A;  5F3W A;  3QFM A;  2NYL C;  5JPE A;  1S8E A;  2HYO A;  4M0V A;  1S70 A;  1SU1 A;  1S3M A;  1JK7 A;  1USH A;  2YVT A;  2Z06 A;  4V0V A;  5J28 A;  5IOH A;  5C1V A;  2ZBM A;  4I5N C;  2NPP C;  2BDX A;  2IE3 C;  2CV9 A;  4H1Y P;  4O43 A;  1S95 A;  4OR9 A;  5B8I A;  1II7 A;  2GJU A;  1UTE A;  3K7V C;  4FBQ A;  4FCX A;  3FLO A;  1T70 A;  3PSN A;  4TUI A;  2JOG A;  3EGG A;  2XMO A;  2WDF A;  4UT3 A;  4TUG A;  2IE4 C;  4UT2 A;  4J6O A;  3HVQ A;  2USH A;  1OIE A;  4H2F A;  3RL3 A;  2WDC A;  2HY1 A;  2QFP A; 
#chains in the Genus database with same CATH homology
 1T71 A;  5DNY A;  4MOV A;  1U32 A;  4O4K A;  5INB A;  2QJC A;  2QFR A;  4V0W A;  5EQV A;  3K7W C;  4JA7 A;  3AV0 A;  3H69 A;  2Z72 A;  3AUZ A;  3H62 B;  4WWL A;  4ZVZ A;  3DSD A;  1WAO 1;  3TGH A;  2DFJ A;  1HPU A;  4LTY A;  4FBK A;  2DXN A;  3ICF A;  3RQZ A;  4UWQ A;  2AHD A;  4KKZ A;  3V4Y A;  3H60 A;  3RL4 A;  3QG5 C;  3N5U A;  1M63 A;  4LAC C;  1TCO A;  3H67 A;  1QHW A;  5JJT A;  4O5G A;  2NXF A;  5HPE A;  3E7B A;  3IB7 A;  3P71 C;  4MP0 A;  1HO5 A;  1MF8 A;  3IB8 A;  3QFN A;  3DW8 C;  3THO B;  3T1I A;  2O8A A;  3JYF A;  3C5W C;  1KBP A;  4JA9 A;  1HP1 A;  1AUI A;  3CK2 A;  3ZTV A;  4DT2 A;  3H68 A;  1NNW A;  1UF3 A;  3E7A A;  3EGH A;  3QFO A;  4XPN A;  4MOY A;  1XZW A;  2O8G A;  3D03 A;  2BCD A;  4HD0 A;  5JPF A;  3ZU0 A;  2WDD A;  2BQ8 X;  1FJM A;  3IVE A;  2HYP A;  3H66 A;  3GVE A;  3KBP A;  4IYP C;  4H2B A;  4Q7F A;  3QFK A;  4ORA A;  1OID A;  1W24 A;  4ORB A;  1OI8 A;  2R17 A;  4YKE A;  2NYM C;  3H64 A;  2KKN A;  4I5L C;  4H1S A;  3FGA C;  4ZX2 A;  2Q8U A;  4DSY A;  4B2O A;  2DXL A;  3H63 A;  1S3L A;  1IT6 A;  3H61 A;  4G9J A;  4F0Z A;  1Z2W A;  4UT3 B;  2WDE A;  4V0X A;  5GTU A;  1WAR A;  1V73 A;  4H2G A;  3RL5 A;  3C9F A;  3E0J A;  2YEQ A;  1G5B A;  3LL8 A;  2A22 A;  4H2I A;  1QFC A;  2ZOA A;  4KBP A;  4NZV A;  2IAE C;  2P6B A;  4FBW A;  4DHL A;  1Z2X A;  2ZO9 B;  1S3N A;  3IVD A;  3PSO A;  4LU9 A;  4O24 A;  1XM7 A;  3DSC A;  3THN A;  4ORC A;  4IL1 A;  2Z1A A;  5F3W A;  3QFM A;  2NYL C;  5JPE A;  1S8E A;  2HYO A;  4M0V A;  1S70 A;  1SU1 A;  1S3M A;  1JK7 A;  1USH A;  2YVT A;  2Z06 A;  4V0V A;  5J28 A;  5IOH A;  5C1V A;  2ZBM A;  4I5N C;  2NPP C;  2BDX A;  2IE3 C;  2CV9 A;  4H1Y P;  4O43 A;  1S95 A;  4OR9 A;  5B8I A;  1II7 A;  2GJU A;  1UTE A;  3K7V C;  4FBQ A;  4FCX A;  3FLO A;  1T70 A;  3PSN A;  4TUI A;  2JOG A;  3EGG A;  2XMO A;  2WDF A;  4UT3 A;  4TUG A;  2IE4 C;  4UT2 A;  4J6O A;  3HVQ A;  2USH A;  1OIE A;  4H2F A;  3RL3 A;  2WDC A;  2HY1 A;  2QFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...