3EGGA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of spinophilin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 112
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eggA00
5F3WA 4TUIA 4ORBA 4V0XA 4JA9A 3DSDA 3THOB 4FBKA 1WARA 5INBA 2JOGA 2Z1AA 1IT6A 4I5NC 2NYMC 4H2FA 3AUZA 1V73A 4G9JA 3EGGA 2NYLC 1HO5A 4LTYA 4M0VA 4UWQA 4OR9A 4O24A 2WDDA 2HY1A 2IE4C 2QFRA 2Z06A 1USHA 3PSNA 2A22A 2NXFA 3C5WC 3H68A 2HYPA 1S8EA 3QG5C 3E7BA 4H2BA 4O43A 3H61A 2CV9A 3K7WC 4ORCA 4FBQA 4Q7FA 1FJMA 5DNYA 3CK2A 1T71A 3EGHA 2O8GA 4HD0A 5B8IA 1TCOA 4B2OA 2KKNA 3K7VC 1Z2WA 3LL8A 3IVDA 3PSOA 2XMOA 4XPNA 3T1IA 4F0ZA 4O4KA 5HPEA 4H2GA 4KKZA 1UTEA 2GJUA 1KBPA 4MOVA 2WDCA 3RQZA 4JA7A 2O8AA 2HYOA 4NZVA 3DW8C 1HPUA 1S3LA 3JYFA 5EQVA 4V0WA 4ZX2A 4LU9A 1T70A 4MP0A 3H67A 3QFNA 1G5BA 2USHA 4DT2A 3H60A 3IB8A 4FCXA 4WWLA 4FBWA 4UT2A 2BQ8X 5IOHA 3H69A 4J6OA 3ZU0A 2AHDA 2P6BA 1UF3A 1M63A 1OIEA 3RL3A 2IE3C 3QFKA 4ZVZA 3HVQA 3H63A 1S95A 5JJTA 2R17A 4UT3B 4TUGA 3DSCA 2QFPA 5J28A 4ORAA 1W24A 2Q8UA 3H62B 2NPPC 2YVTA 1HP1A 4V0VA 3V4YA 1OIDA 3H64A 3H66A 1Z2XA 1XM7A 3E7AA 4YKEA 3P71C 1QHWA 4IL1A 4H1SA 5GTUA 3QFMA 2Z72A 1S3MA 1S70A 1II7A 2WDFA 3N5UA 1QFCA 3RL5A 1AUIA 1OI8A 2WDEA 4LACC 4MOYA 3IVEA 1JK7A 1S3NA 4O5GA 5JPEA 3C9FA 2IAEC 3IB7A 3TGHA 1MF8A 3RL4A 1NNWA 4DHLA 3ICFA 5JPFA 1WAO1 1SU1A 5C1VA 2ZBMA 1U32A 3QFOA 3ZTVA 4DSYA 2QJCA 4I5LC 4H2IA 4IYPC 4KBPA 1XZWA 2BDXA 4H1YP 3AV0A 3THNA 3FGAC 2BCDA 3GVEA 3KBPA 4UT3A 2DFJA
chains in the Genus database with same CATH superfamily
5F3WA 4TUIA 4ORBA 4V0XA 4JA9A 3DSDA 3THOB 4FBKA 1WARA 5INBA 2JOGA 2Z1AA 1IT6A 4I5NC 2NYMC 3FLOA 4H2FA 3AUZA 1V73A 4G9JA 3EGGA 2NYLC 1HO5A 4LTYA 4M0VA 4UWQA 4OR9A 4O24A 2WDDA 2HY1A 2IE4C 2QFRA 2Z06A 1USHA 3PSNA 2A22A 2NXFA 3C5WC 3H68A 2HYPA 1S8EA 3QG5C 3E0JA 3E7BA 4H2BA 3H61A 2CV9A 3K7WC 4O43A 4FBQA 4ORCA 1FJMA 4Q7FA 3CK2A 5DNYA 1T71A 3EGHA 2O8GA 4HD0A 5B8IA 1TCOA 2ZOAA 4B2OA 2KKNA 3K7VC 1Z2WA 3LL8A 3IVDA 3PSOA 2XMOA 4XPNA 3T1IA 4F0ZA 4O4KA 5HPEA 4H2GA 4KKZA 1UTEA 2GJUA 1KBPA 4MOVA 2WDCA 3RQZA 4JA7A 2O8AA 2HYOA 4NZVA 3DW8C 1HPUA 1S3LA 3JYFA 5EQVA 4V0WA 4ZX2A 3D03A 4LU9A 1T70A 2YEQA 4MP0A 3H67A 3QFNA 1G5BA 2USHA 4DT2A 3H60A 3IB8A 4FCXA 4WWLA 4FBWA 4UT2A 2BQ8X 5IOHA 3H69A 4J6OA 3ZU0A 2AHDA 2P6BA 1UF3A 1M63A 1OIEA 3RL3A 2IE3C 3QFKA 4ZVZA 2ZO9B 3HVQA 3H63A 1S95A 5JJTA 2R17A 4UT3B 4TUGA 3DSCA 2QFPA 5J28A 4ORAA 1W24A 2Q8UA 3H62B 2NPPC 2YVTA 1HP1A 4V0VA 3V4YA 1OIDA 3H64A 3H66A 1Z2XA 1XM7A 3E7AA 4YKEA 3P71C 1QHWA 4IL1A 4H1SA 5GTUA 3QFMA 2Z72A 1S3MA 1S70A 1II7A 2WDFA 3N5UA 1QFCA 3RL5A 1AUIA 1OI8A 2WDEA 4LACC 4MOYA 3IVEA 1JK7A 1S3NA 4O5GA 2DXLA 5JPEA 3C9FA 2IAEC 2DXNA 3IB7A 3TGHA 1MF8A 3RL4A 1NNWA 4DHLA 3ICFA 5JPFA 1WAO1 1SU1A 5C1VA 2ZBMA 1U32A 3QFOA 3ZTVA 4DSYA 2QJCA 4I5LC 4H2IA 4IYPC 4KBPA 1XZWA 2BDXA 4H1YP 3AV0A 3THNA 3FGAC 2BCDA 3GVEA 3KBPA 4UT3A 2DFJA
chains in the Genus database with same CATH topology
5F3WA 4TUIA 4ORBA 4V0XA 4JA9A 3DSDA 3THOB 4FBKA 1WARA 5INBA 2JOGA 2Z1AA 1IT6A 4I5NC 2NYMC 3FLOA 4H2FA 3AUZA 1V73A 4G9JA 3EGGA 2NYLC 1HO5A 4LTYA 4M0VA 4UWQA 4OR9A 4O24A 2WDDA 2HY1A 2IE4C 2QFRA 2Z06A 1USHA 3PSNA 2A22A 2NXFA 3C5WC 3H68A 2HYPA 1S8EA 3QG5C 3E0JA 3E7BA 4H2BA 3H61A 2CV9A 3K7WC 4O43A 4FBQA 4ORCA 1FJMA 4Q7FA 3CK2A 5DNYA 1T71A 3EGHA 2O8GA 4HD0A 5B8IA 1TCOA 2ZOAA 4B2OA 2KKNA 3K7VC 1Z2WA 3LL8A 3IVDA 3PSOA 2XMOA 4XPNA 3T1IA 4F0ZA 4O4KA 5HPEA 4H2GA 4KKZA 1UTEA 2GJUA 1KBPA 4MOVA 2WDCA 3RQZA 4JA7A 2O8AA 2HYOA 4NZVA 3DW8C 1HPUA 1S3LA 3JYFA 5EQVA 4V0WA 4ZX2A 3D03A 4LU9A 1T70A 2YEQA 4MP0A 3H67A 3QFNA 1G5BA 2USHA 4DT2A 3H60A 3IB8A 4FCXA 4WWLA 4FBWA 4UT2A 2BQ8X 5IOHA 3H69A 4J6OA 3ZU0A 2AHDA 2P6BA 1UF3A 1M63A 1OIEA 3RL3A 2IE3C 3QFKA 4ZVZA 2ZO9B 3HVQA 3H63A 1S95A 5JJTA 2R17A 4UT3B 4TUGA 3DSCA 2QFPA 5J28A 4ORAA 1W24A 2Q8UA 3H62B 2NPPC 2YVTA 1HP1A 4V0VA 3V4YA 1OIDA 3H64A 3H66A 1Z2XA 1XM7A 3E7AA 4YKEA 3P71C 1QHWA 4IL1A 4H1SA 5GTUA 3QFMA 2Z72A 1S3MA 1S70A 1II7A 2WDFA 3N5UA 1QFCA 3RL5A 1AUIA 1OI8A 2WDEA 4LACC 4MOYA 3IVEA 1JK7A 1S3NA 4O5GA 2DXLA 5JPEA 3C9FA 2IAEC 2DXNA 3IB7A 3TGHA 1MF8A 3RL4A 1NNWA 4DHLA 3ICFA 5JPFA 1WAO1 1SU1A 5C1VA 2ZBMA 1U32A 3QFOA 3ZTVA 4DSYA 2QJCA 4I5LC 4H2IA 4IYPC 4KBPA 1XZWA 2BDXA 4H1YP 3AV0A 3THNA 3FGAC 2BCDA 3GVEA 3KBPA 4UT3A 2DFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3W A;  4TUI A;  4ORB A;  4V0X A;  4JA9 A;  3DSD A;  3THO B;  4FBK A;  1WAR A;  5INB A;  2JOG A;  2Z1A A;  1IT6 A;  4I5N C;  2NYM C;  4H2F A;  3AUZ A;  1V73 A;  4G9J A;  3EGG A;  2NYL C;  1HO5 A;  4LTY A;  4M0V A;  4UWQ A;  4OR9 A;  4O24 A;  2WDD A;  2HY1 A;  2IE4 C;  2QFR A;  2Z06 A;  1USH A;  3PSN A;  2A22 A;  2NXF A;  3C5W C;  3H68 A;  2HYP A;  1S8E A;  3QG5 C;  3E7B A;  4H2B A;  4O43 A;  3H61 A;  2CV9 A;  3K7W C;  4ORC A;  4FBQ A;  4Q7F A;  1FJM A;  5DNY A;  3CK2 A;  1T71 A;  3EGH A;  2O8G A;  4HD0 A;  5B8I A;  1TCO A;  4B2O A;  2KKN A;  3K7V C;  1Z2W A;  3LL8 A;  3IVD A;  3PSO A;  2XMO A;  4XPN A;  3T1I A;  4F0Z A;  4O4K A;  5HPE A;  4H2G A;  4KKZ A;  1UTE A;  2GJU A;  1KBP A;  4MOV A;  2WDC A;  3RQZ A;  4JA7 A;  2O8A A;  2HYO A;  4NZV A;  3DW8 C;  1HPU A;  1S3L A;  3JYF A;  5EQV A;  4V0W A;  4ZX2 A;  4LU9 A;  1T70 A;  4MP0 A;  3H67 A;  3QFN A;  1G5B A;  2USH A;  4DT2 A;  3H60 A;  3IB8 A;  4FCX A;  4WWL A;  4FBW A;  4UT2 A;  2BQ8 X;  5IOH A;  3H69 A;  4J6O A;  3ZU0 A;  2AHD A;  2P6B A;  1UF3 A;  1M63 A;  1OIE A;  3RL3 A;  2IE3 C;  3QFK A;  4ZVZ A;  3HVQ A;  3H63 A;  1S95 A;  5JJT A;  2R17 A;  4UT3 B;  4TUG A;  3DSC A;  2QFP A;  5J28 A;  4ORA A;  1W24 A;  2Q8U A;  3H62 B;  2NPP C;  2YVT A;  1HP1 A;  4V0V A;  3V4Y A;  1OID A;  3H64 A;  3H66 A;  1Z2X A;  1XM7 A;  3E7A A;  4YKE A;  3P71 C;  1QHW A;  4IL1 A;  4H1S A;  5GTU A;  3QFM A;  2Z72 A;  1S3M A;  1S70 A;  1II7 A;  2WDF A;  3N5U A;  1QFC A;  3RL5 A;  1AUI A;  1OI8 A;  2WDE A;  4LAC C;  4MOY A;  3IVE A;  1JK7 A;  1S3N A;  4O5G A;  5JPE A;  3C9F A;  2IAE C;  3IB7 A;  3TGH A;  1MF8 A;  3RL4 A;  1NNW A;  4DHL A;  3ICF A;  5JPF A;  1WAO 1;  1SU1 A;  5C1V A;  2ZBM A;  1U32 A;  3QFO A;  3ZTV A;  4DSY A;  2QJC A;  4I5L C;  4H2I A;  4IYP C;  4KBP A;  1XZW A;  2BDX A;  4H1Y P;  3AV0 A;  3THN A;  3FGA C;  2BCD A;  3GVE A;  3KBP A;  4UT3 A;  2DFJ A; 
#chains in the Genus database with same CATH topology
 5F3W A;  4TUI A;  4ORB A;  4V0X A;  4JA9 A;  3DSD A;  3THO B;  4FBK A;  1WAR A;  5INB A;  2JOG A;  2Z1A A;  1IT6 A;  4I5N C;  2NYM C;  3FLO A;  4H2F A;  3AUZ A;  1V73 A;  4G9J A;  3EGG A;  2NYL C;  1HO5 A;  4LTY A;  4M0V A;  4UWQ A;  4OR9 A;  4O24 A;  2WDD A;  2HY1 A;  2IE4 C;  2QFR A;  2Z06 A;  1USH A;  3PSN A;  2A22 A;  2NXF A;  3C5W C;  3H68 A;  2HYP A;  1S8E A;  3QG5 C;  3E0J A;  3E7B A;  4H2B A;  3H61 A;  2CV9 A;  3K7W C;  4O43 A;  4FBQ A;  4ORC A;  1FJM A;  4Q7F A;  3CK2 A;  5DNY A;  1T71 A;  3EGH A;  2O8G A;  4HD0 A;  5B8I A;  1TCO A;  2ZOA A;  4B2O A;  2KKN A;  3K7V C;  1Z2W A;  3LL8 A;  3IVD A;  3PSO A;  2XMO A;  4XPN A;  3T1I A;  4F0Z A;  4O4K A;  5HPE A;  4H2G A;  4KKZ A;  1UTE A;  2GJU A;  1KBP A;  4MOV A;  2WDC A;  3RQZ A;  4JA7 A;  2O8A A;  2HYO A;  4NZV A;  3DW8 C;  1HPU A;  1S3L A;  3JYF A;  5EQV A;  4V0W A;  4ZX2 A;  3D03 A;  4LU9 A;  1T70 A;  2YEQ A;  4MP0 A;  3H67 A;  3QFN A;  1G5B A;  2USH A;  4DT2 A;  3H60 A;  3IB8 A;  4FCX A;  4WWL A;  4FBW A;  4UT2 A;  2BQ8 X;  5IOH A;  3H69 A;  4J6O A;  3ZU0 A;  2AHD A;  2P6B A;  1UF3 A;  1M63 A;  1OIE A;  3RL3 A;  2IE3 C;  3QFK A;  4ZVZ A;  2ZO9 B;  3HVQ A;  3H63 A;  1S95 A;  5JJT A;  2R17 A;  4UT3 B;  4TUG A;  3DSC A;  2QFP A;  5J28 A;  4ORA A;  1W24 A;  2Q8U A;  3H62 B;  2NPP C;  2YVT A;  1HP1 A;  4V0V A;  3V4Y A;  1OID A;  3H64 A;  3H66 A;  1Z2X A;  1XM7 A;  3E7A A;  4YKE A;  3P71 C;  1QHW A;  4IL1 A;  4H1S A;  5GTU A;  3QFM A;  2Z72 A;  1S3M A;  1S70 A;  1II7 A;  2WDF A;  3N5U A;  1QFC A;  3RL5 A;  1AUI A;  1OI8 A;  2WDE A;  4LAC C;  4MOY A;  3IVE A;  1JK7 A;  1S3N A;  4O5G A;  2DXL A;  5JPE A;  3C9F A;  2IAE C;  2DXN A;  3IB7 A;  3TGH A;  1MF8 A;  3RL4 A;  1NNW A;  4DHL A;  3ICF A;  5JPF A;  1WAO 1;  1SU1 A;  5C1V A;  2ZBM A;  1U32 A;  3QFO A;  3ZTV A;  4DSY A;  2QJC A;  4I5L C;  4H2I A;  4IYP C;  4KBP A;  1XZW A;  2BDX A;  4H1Y P;  3AV0 A;  3THN A;  3FGA C;  2BCD A;  3GVE A;  3KBP A;  4UT3 A;  2DFJ A; 
#chains in the Genus database with same CATH homology
 5F3W A;  4TUI A;  4ORB A;  4V0X A;  4JA9 A;  3DSD A;  3THO B;  4FBK A;  1WAR A;  5INB A;  2JOG A;  2Z1A A;  1IT6 A;  4I5N C;  2NYM C;  3FLO A;  4H2F A;  3AUZ A;  1V73 A;  4G9J A;  3EGG A;  2NYL C;  1HO5 A;  4LTY A;  4M0V A;  4UWQ A;  4OR9 A;  4O24 A;  2WDD A;  2HY1 A;  2IE4 C;  2QFR A;  2Z06 A;  1USH A;  3PSN A;  2A22 A;  2NXF A;  3C5W C;  3H68 A;  2HYP A;  1S8E A;  3QG5 C;  3E0J A;  3E7B A;  4H2B A;  3H61 A;  2CV9 A;  3K7W C;  4O43 A;  4FBQ A;  4ORC A;  1FJM A;  4Q7F A;  3CK2 A;  5DNY A;  1T71 A;  3EGH A;  2O8G A;  4HD0 A;  5B8I A;  1TCO A;  2ZOA A;  4B2O A;  2KKN A;  3K7V C;  1Z2W A;  3LL8 A;  3IVD A;  3PSO A;  2XMO A;  4XPN A;  3T1I A;  4F0Z A;  4O4K A;  5HPE A;  4H2G A;  4KKZ A;  1UTE A;  2GJU A;  1KBP A;  4MOV A;  2WDC A;  3RQZ A;  4JA7 A;  2O8A A;  2HYO A;  4NZV A;  3DW8 C;  1HPU A;  1S3L A;  3JYF A;  5EQV A;  4V0W A;  4ZX2 A;  3D03 A;  4LU9 A;  1T70 A;  2YEQ A;  4MP0 A;  3H67 A;  3QFN A;  1G5B A;  2USH A;  4DT2 A;  3H60 A;  3IB8 A;  4FCX A;  4WWL A;  4FBW A;  4UT2 A;  2BQ8 X;  5IOH A;  3H69 A;  4J6O A;  3ZU0 A;  2AHD A;  2P6B A;  1UF3 A;  1M63 A;  1OIE A;  3RL3 A;  2IE3 C;  3QFK A;  4ZVZ A;  2ZO9 B;  3HVQ A;  3H63 A;  1S95 A;  5JJT A;  2R17 A;  4UT3 B;  4TUG A;  3DSC A;  2QFP A;  5J28 A;  4ORA A;  1W24 A;  2Q8U A;  3H62 B;  2NPP C;  2YVT A;  1HP1 A;  4V0V A;  3V4Y A;  1OID A;  3H64 A;  3H66 A;  1Z2X A;  1XM7 A;  3E7A A;  4YKE A;  3P71 C;  1QHW A;  4IL1 A;  4H1S A;  5GTU A;  3QFM A;  2Z72 A;  1S3M A;  1S70 A;  1II7 A;  2WDF A;  3N5U A;  1QFC A;  3RL5 A;  1AUI A;  1OI8 A;  2WDE A;  4LAC C;  4MOY A;  3IVE A;  1JK7 A;  1S3N A;  4O5G A;  2DXL A;  5JPE A;  3C9F A;  2IAE C;  2DXN A;  3IB7 A;  3TGH A;  1MF8 A;  3RL4 A;  1NNW A;  4DHL A;  3ICF A;  5JPF A;  1WAO 1;  1SU1 A;  5C1V A;  2ZBM A;  1U32 A;  3QFO A;  3ZTV A;  4DSY A;  2QJC A;  4I5L C;  4H2I A;  4IYP C;  4KBP A;  1XZW A;  2BDX A;  4H1Y P;  3AV0 A;  3THN A;  3FGA C;  2BCD A;  3GVE A;  3KBP A;  4UT3 A;  2DFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...