3EGGA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of spinophilin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 112
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eggA00
2HYOA 2IAEC 1WAO1 4H2FA 4M0VA 1KBPA 4XPNA 2HY1A 1T70A 2QFPA 4V0XA 1TCOA 2NYLC 1QHWA 1USHA 3AUZA 2BCDA 2DFJA 2WDDA 2YVTA 3V4YA 3EGGA 1G5BA 5J28A 4V0WA 3N5UA 4TUIA 1OI8A 4ORAA 2Z72A 3P71C 4MP0A 1FJMA 3PSNA 3IVEA 2Q8UA 3IB7A 4F0ZA 4HD0A 1S95A 4KKZA 5GTUA 3T1IA 1M63A 3H68A 3PSOA 3H69A 4OR9A 3THNA 2WDCA 2WDEA 5C1VA 5HPEA 4I5LC 3RL3A 3DSDA 4IYPC 4O24A 2ZBMA 4LU9A 2NPPC 4KBPA 1QFCA 3HVQA 3TGHA 5JJTA 1S8EA 1AUIA 3H60A 2Z1AA 4NZVA 1HO5A 3QG5C 3IB8A 3K7WC 4I5NC 2GJUA 1Z2WA 4JA9A 4DSYA 4TUGA 3H67A 3E7AA 2NYMC 5B8IA 3GVEA 2R17A 1IT6A 4WWLA 1S3LA 3RL4A 2O8AA 4JA7A 5EQVA 1U32A 3H62B 4O43A 2A22A 5F3WA 4UWQA 3H64A 4FBQA 1Z2XA 4ZVZA 3QFOA 4H1SA 4O4KA 4G9JA 5INBA 4B2OA 1JK7A 2BQ8X 4H2GA 3CK2A 4O5GA 3JYFA 5IOHA 1HP1A 2QFRA 3E7BA 4ZX2A 2O8GA 1OIEA 4ORCA 3H66A 3AV0A 4UT3A 2HYPA 3THOB 4H2IA 3H63A 4FBWA 5JPEA 1XM7A 4DT2A 2WDFA 3IVDA 4LTYA 1WARA 4UT2A 4H1YP 3RL5A 2XMOA 3ZU0A 1W24A 4UT3B 3C5WC 4J6OA 4ORBA 2KKNA 3QFKA 3ZTVA 2AHDA 2CV9A 4H2BA 4LACC 1V73A 3K7VC 1HPUA 2USHA 3RQZA 2IE3C 4Q7FA 2IE4C 3FGAC 2NXFA 5JPFA 3DSCA 4V0VA 2QJCA 2JOGA 4YKEA 3EGHA 1NNWA 3ICFA 1MF8A 4MOYA 1SU1A 4MOVA 1UF3A 5DNYA 4DHLA 1XZWA 3LL8A 4FCXA 2Z06A 2BDXA 3H61A 4FBKA 1T71A 1II7A 1OIDA 1S70A 1S3NA 3DW8C 4IL1A 3QFMA 2P6BA 1UTEA 3C9FA 1S3MA 3KBPA 3QFNA
chains in the Genus database with same CATH superfamily
2HYOA 2IAEC 1WAO1 4H2FA 4M0VA 1KBPA 4XPNA 2HY1A 1T70A 2QFPA 4V0XA 1TCOA 2WDDA 1QHWA 1USHA 3AUZA 2BCDA 2DFJA 2DXLA 2NYLC 2YVTA 3V4YA 3EGGA 1G5BA 5J28A 4V0WA 3N5UA 4TUIA 1OI8A 2ZOAA 4ORAA 2Z72A 3P71C 4MP0A 1FJMA 3PSNA 3IVEA 2Q8UA 3IB7A 4F0ZA 4HD0A 1S95A 4KKZA 5GTUA 3T1IA 1M63A 3H68A 3PSOA 3H69A 4OR9A 3THNA 2WDCA 2WDEA 5C1VA 5HPEA 4I5LC 3RL3A 3DSDA 4IYPC 4O24A 2ZBMA 4LU9A 2NPPC 4KBPA 1QFCA 3HVQA 3TGHA 5JJTA 1S8EA 1AUIA 3H60A 2Z1AA 4NZVA 1HO5A 3QG5C 3IB8A 3K7WC 4I5NC 2GJUA 1Z2WA 4JA9A 4DSYA 4TUGA 3H67A 3E7AA 2NYMC 5B8IA 3GVEA 2R17A 1IT6A 4WWLA 1S3LA 3RL4A 2O8AA 4JA7A 5EQVA 1U32A 3H62B 4O43A 2A22A 5F3WA 4UWQA 3H64A 4FBQA 1Z2XA 4ZVZA 3QFOA 2YEQA 4H1SA 3E0JA 4O4KA 4G9JA 5INBA 4B2OA 1JK7A 2BQ8X 4H2GA 3CK2A 4O5GA 3JYFA 5IOHA 1HP1A 2QFRA 3E7BA 4ZX2A 2O8GA 1OIEA 4ORCA 3H66A 3AV0A 4UT3A 3D03A 2HYPA 3THOB 4H2IA 3H63A 4FBWA 5JPEA 1XM7A 4DT2A 2WDFA 3IVDA 4LTYA 1WARA 4UT2A 4H1YP 3RL5A 2XMOA 3ZU0A 1W24A 4UT3B 3C5WC 4J6OA 4ORBA 2KKNA 3FLOA 3QFKA 3ZTVA 2AHDA 2CV9A 4H2BA 4LACC 1V73A 3K7VC 1HPUA 2USHA 2ZO9B 3RQZA 2IE3C 4Q7FA 2IE4C 3FGAC 2NXFA 5JPFA 3DSCA 4V0VA 2QJCA 2JOGA 4YKEA 3EGHA 1NNWA 3ICFA 1MF8A 4MOYA 1SU1A 4MOVA 1UF3A 5DNYA 4DHLA 1XZWA 3LL8A 4FCXA 2Z06A 2DXNA 2BDXA 3H61A 4FBKA 1T71A 1II7A 1OIDA 1S70A 1S3NA 3DW8C 4IL1A 3QFMA 2P6BA 1UTEA 3C9FA 1S3MA 3KBPA 3QFNA
chains in the Genus database with same CATH topology
2HYOA 2IAEC 1WAO1 4H2FA 4M0VA 1KBPA 4XPNA 2HY1A 1T70A 2QFPA 4V0XA 1TCOA 2WDDA 1QHWA 1USHA 3AUZA 2BCDA 2DFJA 2DXLA 2NYLC 2YVTA 3V4YA 3EGGA 1G5BA 5J28A 4V0WA 3N5UA 4TUIA 1OI8A 2ZOAA 4ORAA 2Z72A 3P71C 4MP0A 1FJMA 3PSNA 3IVEA 2Q8UA 3IB7A 4F0ZA 4HD0A 1S95A 4KKZA 5GTUA 3T1IA 1M63A 3H68A 3PSOA 3H69A 4OR9A 3THNA 2WDCA 2WDEA 5C1VA 5HPEA 4I5LC 3RL3A 3DSDA 4IYPC 4O24A 2ZBMA 4LU9A 2NPPC 4KBPA 1QFCA 3HVQA 3TGHA 5JJTA 1S8EA 1AUIA 3H60A 2Z1AA 4NZVA 1HO5A 3QG5C 3IB8A 3K7WC 4I5NC 2GJUA 1Z2WA 4JA9A 4DSYA 4TUGA 3H67A 3E7AA 2NYMC 5B8IA 3GVEA 2R17A 1IT6A 4WWLA 1S3LA 3RL4A 2O8AA 4JA7A 5EQVA 1U32A 3H62B 4O43A 2A22A 5F3WA 4UWQA 3H64A 4FBQA 1Z2XA 4ZVZA 3QFOA 2YEQA 4H1SA 3E0JA 4O4KA 4G9JA 5INBA 4B2OA 1JK7A 2BQ8X 4H2GA 3CK2A 4O5GA 3JYFA 5IOHA 1HP1A 2QFRA 3E7BA 4ZX2A 2O8GA 1OIEA 4ORCA 3H66A 3AV0A 4UT3A 3D03A 2HYPA 3THOB 4H2IA 3H63A 4FBWA 5JPEA 1XM7A 4DT2A 2WDFA 3IVDA 4LTYA 1WARA 4UT2A 4H1YP 3RL5A 2XMOA 3ZU0A 1W24A 4UT3B 3C5WC 4J6OA 4ORBA 2KKNA 3FLOA 3QFKA 3ZTVA 2AHDA 2CV9A 4H2BA 4LACC 1V73A 3K7VC 1HPUA 2USHA 2ZO9B 3RQZA 2IE3C 4Q7FA 2IE4C 3FGAC 2NXFA 5JPFA 3DSCA 4V0VA 2QJCA 2JOGA 4YKEA 3EGHA 1NNWA 3ICFA 1MF8A 4MOYA 1SU1A 4MOVA 1UF3A 5DNYA 4DHLA 1XZWA 3LL8A 4FCXA 2Z06A 2DXNA 2BDXA 3H61A 4FBKA 1T71A 1II7A 1OIDA 1S70A 1S3NA 3DW8C 4IL1A 3QFMA 2P6BA 1UTEA 3C9FA 1S3MA 3KBPA 3QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYO A;  2IAE C;  1WAO 1;  4H2F A;  4M0V A;  1KBP A;  4XPN A;  2HY1 A;  1T70 A;  2QFP A;  4V0X A;  1TCO A;  2NYL C;  1QHW A;  1USH A;  3AUZ A;  2BCD A;  2DFJ A;  2WDD A;  2YVT A;  3V4Y A;  3EGG A;  1G5B A;  5J28 A;  4V0W A;  3N5U A;  4TUI A;  1OI8 A;  4ORA A;  2Z72 A;  3P71 C;  4MP0 A;  1FJM A;  3PSN A;  3IVE A;  2Q8U A;  3IB7 A;  4F0Z A;  4HD0 A;  1S95 A;  4KKZ A;  5GTU A;  3T1I A;  1M63 A;  3H68 A;  3PSO A;  3H69 A;  4OR9 A;  3THN A;  2WDC A;  2WDE A;  5C1V A;  5HPE A;  4I5L C;  3RL3 A;  3DSD A;  4IYP C;  4O24 A;  2ZBM A;  4LU9 A;  2NPP C;  4KBP A;  1QFC A;  3HVQ A;  3TGH A;  5JJT A;  1S8E A;  1AUI A;  3H60 A;  2Z1A A;  4NZV A;  1HO5 A;  3QG5 C;  3IB8 A;  3K7W C;  4I5N C;  2GJU A;  1Z2W A;  4JA9 A;  4DSY A;  4TUG A;  3H67 A;  3E7A A;  2NYM C;  5B8I A;  3GVE A;  2R17 A;  1IT6 A;  4WWL A;  1S3L A;  3RL4 A;  2O8A A;  4JA7 A;  5EQV A;  1U32 A;  3H62 B;  4O43 A;  2A22 A;  5F3W A;  4UWQ A;  3H64 A;  4FBQ A;  1Z2X A;  4ZVZ A;  3QFO A;  4H1S A;  4O4K A;  4G9J A;  5INB A;  4B2O A;  1JK7 A;  2BQ8 X;  4H2G A;  3CK2 A;  4O5G A;  3JYF A;  5IOH A;  1HP1 A;  2QFR A;  3E7B A;  4ZX2 A;  2O8G A;  1OIE A;  4ORC A;  3H66 A;  3AV0 A;  4UT3 A;  2HYP A;  3THO B;  4H2I A;  3H63 A;  4FBW A;  5JPE A;  1XM7 A;  4DT2 A;  2WDF A;  3IVD A;  4LTY A;  1WAR A;  4UT2 A;  4H1Y P;  3RL5 A;  2XMO A;  3ZU0 A;  1W24 A;  4UT3 B;  3C5W C;  4J6O A;  4ORB A;  2KKN A;  3QFK A;  3ZTV A;  2AHD A;  2CV9 A;  4H2B A;  4LAC C;  1V73 A;  3K7V C;  1HPU A;  2USH A;  3RQZ A;  2IE3 C;  4Q7F A;  2IE4 C;  3FGA C;  2NXF A;  5JPF A;  3DSC A;  4V0V A;  2QJC A;  2JOG A;  4YKE A;  3EGH A;  1NNW A;  3ICF A;  1MF8 A;  4MOY A;  1SU1 A;  4MOV A;  1UF3 A;  5DNY A;  4DHL A;  1XZW A;  3LL8 A;  4FCX A;  2Z06 A;  2BDX A;  3H61 A;  4FBK A;  1T71 A;  1II7 A;  1OID A;  1S70 A;  1S3N A;  3DW8 C;  4IL1 A;  3QFM A;  2P6B A;  1UTE A;  3C9F A;  1S3M A;  3KBP A;  3QFN A; 
#chains in the Genus database with same CATH topology
 2HYO A;  2IAE C;  1WAO 1;  4H2F A;  4M0V A;  1KBP A;  4XPN A;  2HY1 A;  1T70 A;  2QFP A;  4V0X A;  1TCO A;  2WDD A;  1QHW A;  1USH A;  3AUZ A;  2BCD A;  2DFJ A;  2DXL A;  2NYL C;  2YVT A;  3V4Y A;  3EGG A;  1G5B A;  5J28 A;  4V0W A;  3N5U A;  4TUI A;  1OI8 A;  2ZOA A;  4ORA A;  2Z72 A;  3P71 C;  4MP0 A;  1FJM A;  3PSN A;  3IVE A;  2Q8U A;  3IB7 A;  4F0Z A;  4HD0 A;  1S95 A;  4KKZ A;  5GTU A;  3T1I A;  1M63 A;  3H68 A;  3PSO A;  3H69 A;  4OR9 A;  3THN A;  2WDC A;  2WDE A;  5C1V A;  5HPE A;  4I5L C;  3RL3 A;  3DSD A;  4IYP C;  4O24 A;  2ZBM A;  4LU9 A;  2NPP C;  4KBP A;  1QFC A;  3HVQ A;  3TGH A;  5JJT A;  1S8E A;  1AUI A;  3H60 A;  2Z1A A;  4NZV A;  1HO5 A;  3QG5 C;  3IB8 A;  3K7W C;  4I5N C;  2GJU A;  1Z2W A;  4JA9 A;  4DSY A;  4TUG A;  3H67 A;  3E7A A;  2NYM C;  5B8I A;  3GVE A;  2R17 A;  1IT6 A;  4WWL A;  1S3L A;  3RL4 A;  2O8A A;  4JA7 A;  5EQV A;  1U32 A;  3H62 B;  4O43 A;  2A22 A;  5F3W A;  4UWQ A;  3H64 A;  4FBQ A;  1Z2X A;  4ZVZ A;  3QFO A;  2YEQ A;  4H1S A;  3E0J A;  4O4K A;  4G9J A;  5INB A;  4B2O A;  1JK7 A;  2BQ8 X;  4H2G A;  3CK2 A;  4O5G A;  3JYF A;  5IOH A;  1HP1 A;  2QFR A;  3E7B A;  4ZX2 A;  2O8G A;  1OIE A;  4ORC A;  3H66 A;  3AV0 A;  4UT3 A;  3D03 A;  2HYP A;  3THO B;  4H2I A;  3H63 A;  4FBW A;  5JPE A;  1XM7 A;  4DT2 A;  2WDF A;  3IVD A;  4LTY A;  1WAR A;  4UT2 A;  4H1Y P;  3RL5 A;  2XMO A;  3ZU0 A;  1W24 A;  4UT3 B;  3C5W C;  4J6O A;  4ORB A;  2KKN A;  3FLO A;  3QFK A;  3ZTV A;  2AHD A;  2CV9 A;  4H2B A;  4LAC C;  1V73 A;  3K7V C;  1HPU A;  2USH A;  2ZO9 B;  3RQZ A;  2IE3 C;  4Q7F A;  2IE4 C;  3FGA C;  2NXF A;  5JPF A;  3DSC A;  4V0V A;  2QJC A;  2JOG A;  4YKE A;  3EGH A;  1NNW A;  3ICF A;  1MF8 A;  4MOY A;  1SU1 A;  4MOV A;  1UF3 A;  5DNY A;  4DHL A;  1XZW A;  3LL8 A;  4FCX A;  2Z06 A;  2DXN A;  2BDX A;  3H61 A;  4FBK A;  1T71 A;  1II7 A;  1OID A;  1S70 A;  1S3N A;  3DW8 C;  4IL1 A;  3QFM A;  2P6B A;  1UTE A;  3C9F A;  1S3M A;  3KBP A;  3QFN A; 
#chains in the Genus database with same CATH homology
 2HYO A;  2IAE C;  1WAO 1;  4H2F A;  4M0V A;  1KBP A;  4XPN A;  2HY1 A;  1T70 A;  2QFP A;  4V0X A;  1TCO A;  2WDD A;  1QHW A;  1USH A;  3AUZ A;  2BCD A;  2DFJ A;  2DXL A;  2NYL C;  2YVT A;  3V4Y A;  3EGG A;  1G5B A;  5J28 A;  4V0W A;  3N5U A;  4TUI A;  1OI8 A;  2ZOA A;  4ORA A;  2Z72 A;  3P71 C;  4MP0 A;  1FJM A;  3PSN A;  3IVE A;  2Q8U A;  3IB7 A;  4F0Z A;  4HD0 A;  1S95 A;  4KKZ A;  5GTU A;  3T1I A;  1M63 A;  3H68 A;  3PSO A;  3H69 A;  4OR9 A;  3THN A;  2WDC A;  2WDE A;  5C1V A;  5HPE A;  4I5L C;  3RL3 A;  3DSD A;  4IYP C;  4O24 A;  2ZBM A;  4LU9 A;  2NPP C;  4KBP A;  1QFC A;  3HVQ A;  3TGH A;  5JJT A;  1S8E A;  1AUI A;  3H60 A;  2Z1A A;  4NZV A;  1HO5 A;  3QG5 C;  3IB8 A;  3K7W C;  4I5N C;  2GJU A;  1Z2W A;  4JA9 A;  4DSY A;  4TUG A;  3H67 A;  3E7A A;  2NYM C;  5B8I A;  3GVE A;  2R17 A;  1IT6 A;  4WWL A;  1S3L A;  3RL4 A;  2O8A A;  4JA7 A;  5EQV A;  1U32 A;  3H62 B;  4O43 A;  2A22 A;  5F3W A;  4UWQ A;  3H64 A;  4FBQ A;  1Z2X A;  4ZVZ A;  3QFO A;  2YEQ A;  4H1S A;  3E0J A;  4O4K A;  4G9J A;  5INB A;  4B2O A;  1JK7 A;  2BQ8 X;  4H2G A;  3CK2 A;  4O5G A;  3JYF A;  5IOH A;  1HP1 A;  2QFR A;  3E7B A;  4ZX2 A;  2O8G A;  1OIE A;  4ORC A;  3H66 A;  3AV0 A;  4UT3 A;  3D03 A;  2HYP A;  3THO B;  4H2I A;  3H63 A;  4FBW A;  5JPE A;  1XM7 A;  4DT2 A;  2WDF A;  3IVD A;  4LTY A;  1WAR A;  4UT2 A;  4H1Y P;  3RL5 A;  2XMO A;  3ZU0 A;  1W24 A;  4UT3 B;  3C5W C;  4J6O A;  4ORB A;  2KKN A;  3FLO A;  3QFK A;  3ZTV A;  2AHD A;  2CV9 A;  4H2B A;  4LAC C;  1V73 A;  3K7V C;  1HPU A;  2USH A;  2ZO9 B;  3RQZ A;  2IE3 C;  4Q7F A;  2IE4 C;  3FGA C;  2NXF A;  5JPF A;  3DSC A;  4V0V A;  2QJC A;  2JOG A;  4YKE A;  3EGH A;  1NNW A;  3ICF A;  1MF8 A;  4MOY A;  1SU1 A;  4MOV A;  1UF3 A;  5DNY A;  4DHL A;  1XZW A;  3LL8 A;  4FCX A;  2Z06 A;  2DXN A;  2BDX A;  3H61 A;  4FBK A;  1T71 A;  1II7 A;  1OID A;  1S70 A;  1S3N A;  3DW8 C;  4IL1 A;  3QFM A;  2P6B A;  1UTE A;  3C9F A;  1S3M A;  3KBP A;  3QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...