3EGGA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of spinophilin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eggA00
1S8EA 2QJCA 4LACC 1S3MA 4LU9A 2NYMC 5C1VA 3RL4A 4H2BA 3ZTVA 2BQ8X 2O8GA 3QFKA 4OR9A 1OI8A 3C9FA 4TUGA 1QFCA 1T71A 2Z06A 3H68A 2Q8UA 3H62B 3IVDA 4H2GA 4FBQA 2USHA 4H1SA 5DNYA 1HO5A 4JA9A 4XPNA 5INBA 2BCDA 3ICFA 3N5UA 4O4KA 3JYFA 4O5GA 1S3NA 3IB8A 1WAO1 2YVTA 3K7VC 2DFJA 2HYOA 1S95A 3V4YA 2BDXA 5HPEA 1W24A 4IL1A 4UT2A 2NPPC 1MF8A 3RQZA 4Q7FA 4F0ZA 4FBKA 3FGAC 5J28A 2CV9A 3THNA 1USHA 3HVQA 4H2IA 3QFMA 2ZBMA 2Z72A 1JK7A 1KBPA 2KKNA 4H1YP 3H61A 1S3LA 3IB7A 4V0WA 3GVEA 1XZWA 5F3WA 3QFOA 3T1IA 3DSCA 1NNWA 3PSOA 4FCXA 2WDDA 3QFNA 5JPEA 1Z2WA 1WARA 2HY1A 3RL5A 1SU1A 3CK2A 4UWQA 2Z1AA 1II7A 3H67A 4I5NC 2P6BA 1AUIA 2GJUA 3H64A 4MP0A 4ORBA 1HPUA 3DW8C 5GTUA 4J6OA 3EGHA 4WWLA 3QG5C 3TGHA 3AV0A 5JPFA 1QHWA 2O8AA 2NXFA 5B8IA 1M63A 1TCOA 4DHLA 3DSDA 2XMOA 2A22A 4I5LC 4B2OA 2QFRA 1UTEA 4O24A 1U32A 4YKEA 3PSNA 3K7WC 4UT3A 4UT3B 3ZU0A 4ORAA 1FJMA 3LL8A 3THOB 1OIDA 4IYPC 2IE4C 2IE3C 4NZVA 4O43A 3EGGA 4KKZA 1Z2XA 4MOYA 2NYLC 3AUZA 3IVEA 4M0VA 2AHDA 4V0VA 4DSYA 4ZX2A 1V73A 5EQVA 4ORCA 4DT2A 3C5WC 3KBPA 4G9JA 1S70A 2WDFA 3H63A 2WDCA 4TUIA 5IOHA 4FBWA 3P71C 1OIEA 3RL3A 4LTYA 1IT6A 4ZVZA 5JJTA 2HYPA 4HD0A 2WDEA 3H60A 3H66A 4V0XA 1UF3A 1XM7A 4KBPA 3E7BA 1HP1A 2JOGA 1G5BA 4MOVA 2QFPA 2R17A 3H69A 4JA7A 3E7AA 4H2FA 1T70A 2IAEC
chains in the Genus database with same CATH superfamily
1S8EA 2QJCA 4LACC 1S3MA 4LU9A 2NYMC 5C1VA 3RL4A 4H2BA 3ZTVA 2BQ8X 2O8GA 3QFKA 4OR9A 1OI8A 3C9FA 3E0JA 1QFCA 1T71A 2Z06A 4TUGA 3H68A 2Q8UA 3H62B 3IVDA 4H2GA 4FBQA 2USHA 4H1SA 5DNYA 1HO5A 4JA9A 4XPNA 5INBA 2BCDA 3ICFA 3N5UA 4O4KA 3JYFA 4O5GA 1S3NA 3IB8A 1WAO1 2YVTA 3K7VC 2DFJA 2HYOA 1S95A 3V4YA 2BDXA 5HPEA 1W24A 4IL1A 4UT2A 2NPPC 1MF8A 3RQZA 4Q7FA 4F0ZA 4FBKA 3FGAC 2ZOAA 5J28A 2CV9A 2YEQA 3THNA 1USHA 3HVQA 4H2IA 3QFMA 2ZBMA 3D03A 2Z72A 1JK7A 1KBPA 2KKNA 4H1YP 3H61A 1S3LA 3IB7A 4V0WA 2DXLA 3GVEA 1XZWA 5F3WA 3QFOA 3T1IA 3DSCA 1NNWA 3PSOA 4FCXA 2WDDA 3QFNA 5JPEA 1Z2WA 1WARA 2HY1A 3RL5A 1SU1A 3CK2A 4UWQA 2ZO9B 2Z1AA 1II7A 3H67A 4I5NC 2P6BA 1AUIA 2GJUA 3H64A 4MP0A 4ORBA 1HPUA 3DW8C 5GTUA 4J6OA 3EGHA 2DXNA 4WWLA 3QG5C 3TGHA 3AV0A 5JPFA 1QHWA 2O8AA 2NXFA 5B8IA 1M63A 1TCOA 4DHLA 3DSDA 2XMOA 2A22A 4I5LC 4B2OA 2QFRA 1UTEA 4O24A 1U32A 4YKEA 3PSNA 3K7WC 4UT3A 4UT3B 3ZU0A 4ORAA 1FJMA 3LL8A 3THOB 1OIDA 4IYPC 2IE4C 2IE3C 4NZVA 4O43A 3EGGA 4KKZA 1Z2XA 4MOYA 2NYLC 3AUZA 3IVEA 4M0VA 2AHDA 4V0VA 4DSYA 4ZX2A 1V73A 3FLOA 5EQVA 4ORCA 4DT2A 3C5WC 3KBPA 4G9JA 1S70A 2WDFA 3H63A 2WDCA 4TUIA 5IOHA 4FBWA 3P71C 1OIEA 3RL3A 4LTYA 1IT6A 4ZVZA 5JJTA 2HYPA 4HD0A 2WDEA 3H60A 3H66A 4V0XA 1UF3A 1XM7A 4KBPA 3E7BA 1HP1A 2JOGA 1G5BA 4MOVA 2QFPA 2R17A 3H69A 4JA7A 3E7AA 4H2FA 1T70A 2IAEC
chains in the Genus database with same CATH topology
1S8EA 2QJCA 4LACC 1S3MA 4LU9A 2NYMC 5C1VA 3RL4A 4H2BA 3ZTVA 2BQ8X 2O8GA 3QFKA 4OR9A 1OI8A 3C9FA 3E0JA 1QFCA 1T71A 2Z06A 4TUGA 3H68A 2Q8UA 3H62B 3IVDA 4H2GA 4FBQA 2USHA 4H1SA 5DNYA 1HO5A 4JA9A 4XPNA 5INBA 2BCDA 3ICFA 3N5UA 4O4KA 3JYFA 4O5GA 1S3NA 3IB8A 1WAO1 2YVTA 3K7VC 2DFJA 2HYOA 1S95A 3V4YA 2BDXA 5HPEA 1W24A 4IL1A 4UT2A 2NPPC 1MF8A 3RQZA 4Q7FA 4F0ZA 4FBKA 3FGAC 2ZOAA 5J28A 2CV9A 2YEQA 3THNA 1USHA 3HVQA 4H2IA 3QFMA 2ZBMA 3D03A 2Z72A 1JK7A 1KBPA 2KKNA 4H1YP 3H61A 1S3LA 3IB7A 4V0WA 2DXLA 3GVEA 1XZWA 5F3WA 3QFOA 3T1IA 3DSCA 1NNWA 3PSOA 4FCXA 2WDDA 3QFNA 5JPEA 1Z2WA 1WARA 2HY1A 3RL5A 1SU1A 3CK2A 4UWQA 2ZO9B 2Z1AA 1II7A 3H67A 4I5NC 2P6BA 1AUIA 2GJUA 3H64A 4MP0A 4ORBA 1HPUA 3DW8C 5GTUA 4J6OA 3EGHA 2DXNA 4WWLA 3QG5C 3TGHA 3AV0A 5JPFA 1QHWA 2O8AA 2NXFA 5B8IA 1M63A 1TCOA 4DHLA 3DSDA 2XMOA 2A22A 4I5LC 4B2OA 2QFRA 1UTEA 4O24A 1U32A 4YKEA 3PSNA 3K7WC 4UT3A 4UT3B 3ZU0A 4ORAA 1FJMA 3LL8A 3THOB 1OIDA 4IYPC 2IE4C 2IE3C 4NZVA 4O43A 3EGGA 4KKZA 1Z2XA 4MOYA 2NYLC 3AUZA 3IVEA 4M0VA 2AHDA 4V0VA 4DSYA 4ZX2A 1V73A 3FLOA 5EQVA 4ORCA 4DT2A 3C5WC 3KBPA 4G9JA 1S70A 2WDFA 3H63A 2WDCA 4TUIA 5IOHA 4FBWA 3P71C 1OIEA 3RL3A 4LTYA 1IT6A 4ZVZA 5JJTA 2HYPA 4HD0A 2WDEA 3H60A 3H66A 4V0XA 1UF3A 1XM7A 4KBPA 3E7BA 1HP1A 2JOGA 1G5BA 4MOVA 2QFPA 2R17A 3H69A 4JA7A 3E7AA 4H2FA 1T70A 2IAEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S8E A;  2QJC A;  4LAC C;  1S3M A;  4LU9 A;  2NYM C;  5C1V A;  3RL4 A;  4H2B A;  3ZTV A;  2BQ8 X;  2O8G A;  3QFK A;  4OR9 A;  1OI8 A;  3C9F A;  4TUG A;  1QFC A;  1T71 A;  2Z06 A;  3H68 A;  2Q8U A;  3H62 B;  3IVD A;  4H2G A;  4FBQ A;  2USH A;  4H1S A;  5DNY A;  1HO5 A;  4JA9 A;  4XPN A;  5INB A;  2BCD A;  3ICF A;  3N5U A;  4O4K A;  3JYF A;  4O5G A;  1S3N A;  3IB8 A;  1WAO 1;  2YVT A;  3K7V C;  2DFJ A;  2HYO A;  1S95 A;  3V4Y A;  2BDX A;  5HPE A;  1W24 A;  4IL1 A;  4UT2 A;  2NPP C;  1MF8 A;  3RQZ A;  4Q7F A;  4F0Z A;  4FBK A;  3FGA C;  5J28 A;  2CV9 A;  3THN A;  1USH A;  3HVQ A;  4H2I A;  3QFM A;  2ZBM A;  2Z72 A;  1JK7 A;  1KBP A;  2KKN A;  4H1Y P;  3H61 A;  1S3L A;  3IB7 A;  4V0W A;  3GVE A;  1XZW A;  5F3W A;  3QFO A;  3T1I A;  3DSC A;  1NNW A;  3PSO A;  4FCX A;  2WDD A;  3QFN A;  5JPE A;  1Z2W A;  1WAR A;  2HY1 A;  3RL5 A;  1SU1 A;  3CK2 A;  4UWQ A;  2Z1A A;  1II7 A;  3H67 A;  4I5N C;  2P6B A;  1AUI A;  2GJU A;  3H64 A;  4MP0 A;  4ORB A;  1HPU A;  3DW8 C;  5GTU A;  4J6O A;  3EGH A;  4WWL A;  3QG5 C;  3TGH A;  3AV0 A;  5JPF A;  1QHW A;  2O8A A;  2NXF A;  5B8I A;  1M63 A;  1TCO A;  4DHL A;  3DSD A;  2XMO A;  2A22 A;  4I5L C;  4B2O A;  2QFR A;  1UTE A;  4O24 A;  1U32 A;  4YKE A;  3PSN A;  3K7W C;  4UT3 A;  4UT3 B;  3ZU0 A;  4ORA A;  1FJM A;  3LL8 A;  3THO B;  1OID A;  4IYP C;  2IE4 C;  2IE3 C;  4NZV A;  4O43 A;  3EGG A;  4KKZ A;  1Z2X A;  4MOY A;  2NYL C;  3AUZ A;  3IVE A;  4M0V A;  2AHD A;  4V0V A;  4DSY A;  4ZX2 A;  1V73 A;  5EQV A;  4ORC A;  4DT2 A;  3C5W C;  3KBP A;  4G9J A;  1S70 A;  2WDF A;  3H63 A;  2WDC A;  4TUI A;  5IOH A;  4FBW A;  3P71 C;  1OIE A;  3RL3 A;  4LTY A;  1IT6 A;  4ZVZ A;  5JJT A;  2HYP A;  4HD0 A;  2WDE A;  3H60 A;  3H66 A;  4V0X A;  1UF3 A;  1XM7 A;  4KBP A;  3E7B A;  1HP1 A;  2JOG A;  1G5B A;  4MOV A;  2QFP A;  2R17 A;  3H69 A;  4JA7 A;  3E7A A;  4H2F A;  1T70 A;  2IAE C; 
#chains in the Genus database with same CATH topology
 1S8E A;  2QJC A;  4LAC C;  1S3M A;  4LU9 A;  2NYM C;  5C1V A;  3RL4 A;  4H2B A;  3ZTV A;  2BQ8 X;  2O8G A;  3QFK A;  4OR9 A;  1OI8 A;  3C9F A;  3E0J A;  1QFC A;  1T71 A;  2Z06 A;  4TUG A;  3H68 A;  2Q8U A;  3H62 B;  3IVD A;  4H2G A;  4FBQ A;  2USH A;  4H1S A;  5DNY A;  1HO5 A;  4JA9 A;  4XPN A;  5INB A;  2BCD A;  3ICF A;  3N5U A;  4O4K A;  3JYF A;  4O5G A;  1S3N A;  3IB8 A;  1WAO 1;  2YVT A;  3K7V C;  2DFJ A;  2HYO A;  1S95 A;  3V4Y A;  2BDX A;  5HPE A;  1W24 A;  4IL1 A;  4UT2 A;  2NPP C;  1MF8 A;  3RQZ A;  4Q7F A;  4F0Z A;  4FBK A;  3FGA C;  2ZOA A;  5J28 A;  2CV9 A;  2YEQ A;  3THN A;  1USH A;  3HVQ A;  4H2I A;  3QFM A;  2ZBM A;  3D03 A;  2Z72 A;  1JK7 A;  1KBP A;  2KKN A;  4H1Y P;  3H61 A;  1S3L A;  3IB7 A;  4V0W A;  2DXL A;  3GVE A;  1XZW A;  5F3W A;  3QFO A;  3T1I A;  3DSC A;  1NNW A;  3PSO A;  4FCX A;  2WDD A;  3QFN A;  5JPE A;  1Z2W A;  1WAR A;  2HY1 A;  3RL5 A;  1SU1 A;  3CK2 A;  4UWQ A;  2ZO9 B;  2Z1A A;  1II7 A;  3H67 A;  4I5N C;  2P6B A;  1AUI A;  2GJU A;  3H64 A;  4MP0 A;  4ORB A;  1HPU A;  3DW8 C;  5GTU A;  4J6O A;  3EGH A;  2DXN A;  4WWL A;  3QG5 C;  3TGH A;  3AV0 A;  5JPF A;  1QHW A;  2O8A A;  2NXF A;  5B8I A;  1M63 A;  1TCO A;  4DHL A;  3DSD A;  2XMO A;  2A22 A;  4I5L C;  4B2O A;  2QFR A;  1UTE A;  4O24 A;  1U32 A;  4YKE A;  3PSN A;  3K7W C;  4UT3 A;  4UT3 B;  3ZU0 A;  4ORA A;  1FJM A;  3LL8 A;  3THO B;  1OID A;  4IYP C;  2IE4 C;  2IE3 C;  4NZV A;  4O43 A;  3EGG A;  4KKZ A;  1Z2X A;  4MOY A;  2NYL C;  3AUZ A;  3IVE A;  4M0V A;  2AHD A;  4V0V A;  4DSY A;  4ZX2 A;  1V73 A;  3FLO A;  5EQV A;  4ORC A;  4DT2 A;  3C5W C;  3KBP A;  4G9J A;  1S70 A;  2WDF A;  3H63 A;  2WDC A;  4TUI A;  5IOH A;  4FBW A;  3P71 C;  1OIE A;  3RL3 A;  4LTY A;  1IT6 A;  4ZVZ A;  5JJT A;  2HYP A;  4HD0 A;  2WDE A;  3H60 A;  3H66 A;  4V0X A;  1UF3 A;  1XM7 A;  4KBP A;  3E7B A;  1HP1 A;  2JOG A;  1G5B A;  4MOV A;  2QFP A;  2R17 A;  3H69 A;  4JA7 A;  3E7A A;  4H2F A;  1T70 A;  2IAE C; 
#chains in the Genus database with same CATH homology
 1S8E A;  2QJC A;  4LAC C;  1S3M A;  4LU9 A;  2NYM C;  5C1V A;  3RL4 A;  4H2B A;  3ZTV A;  2BQ8 X;  2O8G A;  3QFK A;  4OR9 A;  1OI8 A;  3C9F A;  3E0J A;  1QFC A;  1T71 A;  2Z06 A;  4TUG A;  3H68 A;  2Q8U A;  3H62 B;  3IVD A;  4H2G A;  4FBQ A;  2USH A;  4H1S A;  5DNY A;  1HO5 A;  4JA9 A;  4XPN A;  5INB A;  2BCD A;  3ICF A;  3N5U A;  4O4K A;  3JYF A;  4O5G A;  1S3N A;  3IB8 A;  1WAO 1;  2YVT A;  3K7V C;  2DFJ A;  2HYO A;  1S95 A;  3V4Y A;  2BDX A;  5HPE A;  1W24 A;  4IL1 A;  4UT2 A;  2NPP C;  1MF8 A;  3RQZ A;  4Q7F A;  4F0Z A;  4FBK A;  3FGA C;  2ZOA A;  5J28 A;  2CV9 A;  2YEQ A;  3THN A;  1USH A;  3HVQ A;  4H2I A;  3QFM A;  2ZBM A;  3D03 A;  2Z72 A;  1JK7 A;  1KBP A;  2KKN A;  4H1Y P;  3H61 A;  1S3L A;  3IB7 A;  4V0W A;  2DXL A;  3GVE A;  1XZW A;  5F3W A;  3QFO A;  3T1I A;  3DSC A;  1NNW A;  3PSO A;  4FCX A;  2WDD A;  3QFN A;  5JPE A;  1Z2W A;  1WAR A;  2HY1 A;  3RL5 A;  1SU1 A;  3CK2 A;  4UWQ A;  2ZO9 B;  2Z1A A;  1II7 A;  3H67 A;  4I5N C;  2P6B A;  1AUI A;  2GJU A;  3H64 A;  4MP0 A;  4ORB A;  1HPU A;  3DW8 C;  5GTU A;  4J6O A;  3EGH A;  2DXN A;  4WWL A;  3QG5 C;  3TGH A;  3AV0 A;  5JPF A;  1QHW A;  2O8A A;  2NXF A;  5B8I A;  1M63 A;  1TCO A;  4DHL A;  3DSD A;  2XMO A;  2A22 A;  4I5L C;  4B2O A;  2QFR A;  1UTE A;  4O24 A;  1U32 A;  4YKE A;  3PSN A;  3K7W C;  4UT3 A;  4UT3 B;  3ZU0 A;  4ORA A;  1FJM A;  3LL8 A;  3THO B;  1OID A;  4IYP C;  2IE4 C;  2IE3 C;  4NZV A;  4O43 A;  3EGG A;  4KKZ A;  1Z2X A;  4MOY A;  2NYL C;  3AUZ A;  3IVE A;  4M0V A;  2AHD A;  4V0V A;  4DSY A;  4ZX2 A;  1V73 A;  3FLO A;  5EQV A;  4ORC A;  4DT2 A;  3C5W C;  3KBP A;  4G9J A;  1S70 A;  2WDF A;  3H63 A;  2WDC A;  4TUI A;  5IOH A;  4FBW A;  3P71 C;  1OIE A;  3RL3 A;  4LTY A;  1IT6 A;  4ZVZ A;  5JJT A;  2HYP A;  4HD0 A;  2WDE A;  3H60 A;  3H66 A;  4V0X A;  1UF3 A;  1XM7 A;  4KBP A;  3E7B A;  1HP1 A;  2JOG A;  1G5B A;  4MOV A;  2QFP A;  2R17 A;  3H69 A;  4JA7 A;  3E7A A;  4H2F A;  1T70 A;  2IAE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...