3EGGA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of spinophilin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 112
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eggA00
4TUIA 2CV9A 1W24A 1OIDA 3AUZA 3QG5C 1QFCA 5J28A 1S95A 3IB8A 4FBQA 5HPEA 3PSNA 3C9FA 3FGAC 3QFMA 1AUIA 3LL8A 3THNA 2IE4C 5INBA 2IE3C 1Z2XA 4V0WA 1KBPA 3K7WC 1S70A 2A22A 2XMOA 4Q7FA 2QFRA 3THOB 1XZWA 5DNYA 2Z1AA 3H62B 4O4KA 2NPPC 4MP0A 1S3LA 4G9JA 4O43A 4YKEA 4TUGA 1USHA 2GJUA 5B8IA 1M63A 1II7A 3CK2A 5JPEA 4V0XA 3RL3A 4FBWA 4FBKA 4MOVA 2BQ8X 4LU9A 4V0VA 2WDFA 2O8GA 1UF3A 4F0ZA 4IL1A 4LTYA 1FJMA 4ZX2A 4H1YP 2WDEA 3EGGA 1S3NA 1UTEA 5C1VA 4ORBA 3H60A 2BDXA 1Z2WA 5JPFA 1T71A 2HYOA 2WDCA 2IAEC 4IYPC 3P71C 1G5BA 3RL4A 4WWLA 3DSCA 3RL5A 4UT3A 1HO5A 3QFNA 1OI8A 2O8AA 3ICFA 4MOYA 1XM7A 4H2BA 4M0VA 3EGHA 2Z06A 4DHLA 3DW8C 4ORAA 3ZU0A 4ORCA 4UWQA 5IOHA 3ZTVA 3DSDA 4KKZA 2QFPA 3GVEA 3N5UA 1QHWA 3E7BA 3H67A 4JA9A 2Z72A 4OR9A 1WARA 2USHA 1SU1A 3IVEA 2YVTA 4FCXA 1S3MA 2DFJA 2WDDA 4I5LC 1MF8A 4NZVA 4ZVZA 3QFOA 2NYMC 4H1SA 1WAO1 2P6BA 2R17A 4JA7A 3H68A 1NNWA 3H63A 3IB7A 3TGHA 3H61A 1JK7A 4O24A 4B2OA 1OIEA 4DT2A 3HVQA 4UT2A 3V4YA 4DSYA 1IT6A 2KKNA 5JJTA 3PSOA 3H64A 2AHDA 3C5WC 2JOGA 3H66A 4H2GA 4HD0A 1HP1A 2QJCA 1U32A 2NYLC 1T70A 2NXFA 3AV0A 3K7VC 3T1IA 3E7AA 3IVDA 4KBPA 2HYPA 2HY1A 4O5GA 3QFKA 5F3WA 5GTUA 4H2IA 4J6OA 4UT3B 4XPNA 2ZBMA 1S8EA 4H2FA 4I5NC 4LACC 2Q8UA 3KBPA 5EQVA 3JYFA 1TCOA 3RQZA 3H69A 2BCDA 1HPUA 1V73A
chains in the Genus database with same CATH superfamily
4TUIA 2CV9A 1W24A 1OIDA 3AUZA 3QG5C 1QFCA 5J28A 1S95A 3IB8A 4FBQA 5HPEA 3PSNA 3C9FA 3FGAC 3QFMA 1AUIA 3LL8A 3THNA 2IE4C 5INBA 2IE3C 1Z2XA 4V0WA 1KBPA 3K7WC 1S70A 2A22A 2XMOA 4Q7FA 2QFRA 3THOB 1XZWA 2ZOAA 5DNYA 2Z1AA 3H62B 4O4KA 2NPPC 4MP0A 1S3LA 4G9JA 4O43A 4YKEA 4TUGA 1USHA 2GJUA 5B8IA 1M63A 1II7A 3CK2A 5JPEA 4V0XA 3RL3A 4FBWA 4FBKA 4MOVA 2BQ8X 4LU9A 4V0VA 2WDFA 2O8GA 1UF3A 4F0ZA 4IL1A 4LTYA 1FJMA 4ZX2A 4H1YP 2WDEA 3EGGA 1S3NA 1UTEA 3FLOA 5C1VA 4ORBA 3H60A 2BDXA 1Z2WA 5JPFA 1T71A 2HYOA 2WDCA 2IAEC 4IYPC 3P71C 1G5BA 3RL4A 4WWLA 3DSCA 3RL5A 4UT3A 1HO5A 3QFNA 1OI8A 2O8AA 3ICFA 4MOYA 1XM7A 4H2BA 4M0VA 3EGHA 2Z06A 4DHLA 3DW8C 4ORAA 3ZU0A 4ORCA 4UWQA 5IOHA 3ZTVA 3DSDA 4KKZA 2QFPA 3E0JA 3GVEA 3N5UA 1QHWA 3E7BA 3H67A 4JA9A 2Z72A 4OR9A 1WARA 2USHA 1SU1A 3IVEA 2YVTA 4FCXA 1S3MA 2DFJA 2WDDA 4I5LC 1MF8A 4NZVA 4ZVZA 3QFOA 2NYMC 4H1SA 1WAO1 2DXNA 2P6BA 2R17A 4JA7A 3H68A 1NNWA 3H63A 3IB7A 3TGHA 3H61A 1JK7A 4O24A 4B2OA 1OIEA 4DT2A 3HVQA 4UT2A 3V4YA 4DSYA 2ZO9B 1IT6A 2KKNA 2DXLA 5JJTA 3PSOA 3H64A 2AHDA 3C5WC 2JOGA 3H66A 4H2GA 4HD0A 1HP1A 2QJCA 1U32A 2NYLC 1T70A 2NXFA 3AV0A 3K7VC 3T1IA 3E7AA 3IVDA 4KBPA 2HYPA 2HY1A 3D03A 4O5GA 3QFKA 5F3WA 5GTUA 4H2IA 4J6OA 4UT3B 4XPNA 2ZBMA 1S8EA 4H2FA 4I5NC 4LACC 2Q8UA 3KBPA 5EQVA 3JYFA 1TCOA 2YEQA 3H69A 2BCDA 3RQZA 1HPUA 1V73A
chains in the Genus database with same CATH topology
4TUIA 2CV9A 1W24A 1OIDA 3AUZA 3QG5C 1QFCA 5J28A 1S95A 3IB8A 4FBQA 5HPEA 3PSNA 3C9FA 3FGAC 3QFMA 1AUIA 3LL8A 3THNA 2IE4C 5INBA 2IE3C 1Z2XA 4V0WA 1KBPA 3K7WC 1S70A 2A22A 2XMOA 4Q7FA 2QFRA 3THOB 1XZWA 2ZOAA 5DNYA 2Z1AA 3H62B 4O4KA 2NPPC 4MP0A 1S3LA 4G9JA 4O43A 4YKEA 4TUGA 1USHA 2GJUA 5B8IA 1M63A 1II7A 3CK2A 5JPEA 4V0XA 3RL3A 4FBWA 4FBKA 4MOVA 2BQ8X 4LU9A 4V0VA 2WDFA 2O8GA 1UF3A 4F0ZA 4IL1A 4LTYA 1FJMA 4ZX2A 4H1YP 2WDEA 3EGGA 1S3NA 1UTEA 3FLOA 5C1VA 4ORBA 3H60A 2BDXA 1Z2WA 5JPFA 1T71A 2HYOA 2WDCA 2IAEC 4IYPC 3P71C 1G5BA 3RL4A 4WWLA 3DSCA 3RL5A 4UT3A 1HO5A 3QFNA 1OI8A 2O8AA 3ICFA 4MOYA 1XM7A 4H2BA 4M0VA 3EGHA 2Z06A 4DHLA 3DW8C 4ORAA 3ZU0A 4ORCA 4UWQA 5IOHA 3ZTVA 3DSDA 4KKZA 2QFPA 3E0JA 3GVEA 3N5UA 1QHWA 3E7BA 3H67A 4JA9A 2Z72A 4OR9A 1WARA 2USHA 1SU1A 3IVEA 2YVTA 4FCXA 1S3MA 2DFJA 2WDDA 4I5LC 1MF8A 4NZVA 4ZVZA 3QFOA 2NYMC 4H1SA 1WAO1 2DXNA 2P6BA 2R17A 4JA7A 3H68A 1NNWA 3H63A 3IB7A 3TGHA 3H61A 1JK7A 4O24A 4B2OA 1OIEA 4DT2A 3HVQA 4UT2A 3V4YA 4DSYA 2ZO9B 1IT6A 2KKNA 2DXLA 5JJTA 3PSOA 3H64A 2AHDA 3C5WC 2JOGA 3H66A 4H2GA 4HD0A 1HP1A 2QJCA 1U32A 2NYLC 1T70A 2NXFA 3AV0A 3K7VC 3T1IA 3E7AA 3IVDA 4KBPA 2HYPA 2HY1A 3D03A 4O5GA 3QFKA 5F3WA 5GTUA 4H2IA 4J6OA 4UT3B 4XPNA 2ZBMA 1S8EA 4H2FA 4I5NC 4LACC 2Q8UA 3KBPA 5EQVA 3JYFA 1TCOA 2YEQA 3H69A 2BCDA 3RQZA 1HPUA 1V73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUI A;  2CV9 A;  1W24 A;  1OID A;  3AUZ A;  3QG5 C;  1QFC A;  5J28 A;  1S95 A;  3IB8 A;  4FBQ A;  5HPE A;  3PSN A;  3C9F A;  3FGA C;  3QFM A;  1AUI A;  3LL8 A;  3THN A;  2IE4 C;  5INB A;  2IE3 C;  1Z2X A;  4V0W A;  1KBP A;  3K7W C;  1S70 A;  2A22 A;  2XMO A;  4Q7F A;  2QFR A;  3THO B;  1XZW A;  5DNY A;  2Z1A A;  3H62 B;  4O4K A;  2NPP C;  4MP0 A;  1S3L A;  4G9J A;  4O43 A;  4YKE A;  4TUG A;  1USH A;  2GJU A;  5B8I A;  1M63 A;  1II7 A;  3CK2 A;  5JPE A;  4V0X A;  3RL3 A;  4FBW A;  4FBK A;  4MOV A;  2BQ8 X;  4LU9 A;  4V0V A;  2WDF A;  2O8G A;  1UF3 A;  4F0Z A;  4IL1 A;  4LTY A;  1FJM A;  4ZX2 A;  4H1Y P;  2WDE A;  3EGG A;  1S3N A;  1UTE A;  5C1V A;  4ORB A;  3H60 A;  2BDX A;  1Z2W A;  5JPF A;  1T71 A;  2HYO A;  2WDC A;  2IAE C;  4IYP C;  3P71 C;  1G5B A;  3RL4 A;  4WWL A;  3DSC A;  3RL5 A;  4UT3 A;  1HO5 A;  3QFN A;  1OI8 A;  2O8A A;  3ICF A;  4MOY A;  1XM7 A;  4H2B A;  4M0V A;  3EGH A;  2Z06 A;  4DHL A;  3DW8 C;  4ORA A;  3ZU0 A;  4ORC A;  4UWQ A;  5IOH A;  3ZTV A;  3DSD A;  4KKZ A;  2QFP A;  3GVE A;  3N5U A;  1QHW A;  3E7B A;  3H67 A;  4JA9 A;  2Z72 A;  4OR9 A;  1WAR A;  2USH A;  1SU1 A;  3IVE A;  2YVT A;  4FCX A;  1S3M A;  2DFJ A;  2WDD A;  4I5L C;  1MF8 A;  4NZV A;  4ZVZ A;  3QFO A;  2NYM C;  4H1S A;  1WAO 1;  2P6B A;  2R17 A;  4JA7 A;  3H68 A;  1NNW A;  3H63 A;  3IB7 A;  3TGH A;  3H61 A;  1JK7 A;  4O24 A;  4B2O A;  1OIE A;  4DT2 A;  3HVQ A;  4UT2 A;  3V4Y A;  4DSY A;  1IT6 A;  2KKN A;  5JJT A;  3PSO A;  3H64 A;  2AHD A;  3C5W C;  2JOG A;  3H66 A;  4H2G A;  4HD0 A;  1HP1 A;  2QJC A;  1U32 A;  2NYL C;  1T70 A;  2NXF A;  3AV0 A;  3K7V C;  3T1I A;  3E7A A;  3IVD A;  4KBP A;  2HYP A;  2HY1 A;  4O5G A;  3QFK A;  5F3W A;  5GTU A;  4H2I A;  4J6O A;  4UT3 B;  4XPN A;  2ZBM A;  1S8E A;  4H2F A;  4I5N C;  4LAC C;  2Q8U A;  3KBP A;  5EQV A;  3JYF A;  1TCO A;  3RQZ A;  3H69 A;  2BCD A;  1HPU A;  1V73 A; 
#chains in the Genus database with same CATH topology
 4TUI A;  2CV9 A;  1W24 A;  1OID A;  3AUZ A;  3QG5 C;  1QFC A;  5J28 A;  1S95 A;  3IB8 A;  4FBQ A;  5HPE A;  3PSN A;  3C9F A;  3FGA C;  3QFM A;  1AUI A;  3LL8 A;  3THN A;  2IE4 C;  5INB A;  2IE3 C;  1Z2X A;  4V0W A;  1KBP A;  3K7W C;  1S70 A;  2A22 A;  2XMO A;  4Q7F A;  2QFR A;  3THO B;  1XZW A;  2ZOA A;  5DNY A;  2Z1A A;  3H62 B;  4O4K A;  2NPP C;  4MP0 A;  1S3L A;  4G9J A;  4O43 A;  4YKE A;  4TUG A;  1USH A;  2GJU A;  5B8I A;  1M63 A;  1II7 A;  3CK2 A;  5JPE A;  4V0X A;  3RL3 A;  4FBW A;  4FBK A;  4MOV A;  2BQ8 X;  4LU9 A;  4V0V A;  2WDF A;  2O8G A;  1UF3 A;  4F0Z A;  4IL1 A;  4LTY A;  1FJM A;  4ZX2 A;  4H1Y P;  2WDE A;  3EGG A;  1S3N A;  1UTE A;  3FLO A;  5C1V A;  4ORB A;  3H60 A;  2BDX A;  1Z2W A;  5JPF A;  1T71 A;  2HYO A;  2WDC A;  2IAE C;  4IYP C;  3P71 C;  1G5B A;  3RL4 A;  4WWL A;  3DSC A;  3RL5 A;  4UT3 A;  1HO5 A;  3QFN A;  1OI8 A;  2O8A A;  3ICF A;  4MOY A;  1XM7 A;  4H2B A;  4M0V A;  3EGH A;  2Z06 A;  4DHL A;  3DW8 C;  4ORA A;  3ZU0 A;  4ORC A;  4UWQ A;  5IOH A;  3ZTV A;  3DSD A;  4KKZ A;  2QFP A;  3E0J A;  3GVE A;  3N5U A;  1QHW A;  3E7B A;  3H67 A;  4JA9 A;  2Z72 A;  4OR9 A;  1WAR A;  2USH A;  1SU1 A;  3IVE A;  2YVT A;  4FCX A;  1S3M A;  2DFJ A;  2WDD A;  4I5L C;  1MF8 A;  4NZV A;  4ZVZ A;  3QFO A;  2NYM C;  4H1S A;  1WAO 1;  2DXN A;  2P6B A;  2R17 A;  4JA7 A;  3H68 A;  1NNW A;  3H63 A;  3IB7 A;  3TGH A;  3H61 A;  1JK7 A;  4O24 A;  4B2O A;  1OIE A;  4DT2 A;  3HVQ A;  4UT2 A;  3V4Y A;  4DSY A;  2ZO9 B;  1IT6 A;  2KKN A;  2DXL A;  5JJT A;  3PSO A;  3H64 A;  2AHD A;  3C5W C;  2JOG A;  3H66 A;  4H2G A;  4HD0 A;  1HP1 A;  2QJC A;  1U32 A;  2NYL C;  1T70 A;  2NXF A;  3AV0 A;  3K7V C;  3T1I A;  3E7A A;  3IVD A;  4KBP A;  2HYP A;  2HY1 A;  3D03 A;  4O5G A;  3QFK A;  5F3W A;  5GTU A;  4H2I A;  4J6O A;  4UT3 B;  4XPN A;  2ZBM A;  1S8E A;  4H2F A;  4I5N C;  4LAC C;  2Q8U A;  3KBP A;  5EQV A;  3JYF A;  1TCO A;  2YEQ A;  3H69 A;  2BCD A;  3RQZ A;  1HPU A;  1V73 A; 
#chains in the Genus database with same CATH homology
 4TUI A;  2CV9 A;  1W24 A;  1OID A;  3AUZ A;  3QG5 C;  1QFC A;  5J28 A;  1S95 A;  3IB8 A;  4FBQ A;  5HPE A;  3PSN A;  3C9F A;  3FGA C;  3QFM A;  1AUI A;  3LL8 A;  3THN A;  2IE4 C;  5INB A;  2IE3 C;  1Z2X A;  4V0W A;  1KBP A;  3K7W C;  1S70 A;  2A22 A;  2XMO A;  4Q7F A;  2QFR A;  3THO B;  1XZW A;  2ZOA A;  5DNY A;  2Z1A A;  3H62 B;  4O4K A;  2NPP C;  4MP0 A;  1S3L A;  4G9J A;  4O43 A;  4YKE A;  4TUG A;  1USH A;  2GJU A;  5B8I A;  1M63 A;  1II7 A;  3CK2 A;  5JPE A;  4V0X A;  3RL3 A;  4FBW A;  4FBK A;  4MOV A;  2BQ8 X;  4LU9 A;  4V0V A;  2WDF A;  2O8G A;  1UF3 A;  4F0Z A;  4IL1 A;  4LTY A;  1FJM A;  4ZX2 A;  4H1Y P;  2WDE A;  3EGG A;  1S3N A;  1UTE A;  3FLO A;  5C1V A;  4ORB A;  3H60 A;  2BDX A;  1Z2W A;  5JPF A;  1T71 A;  2HYO A;  2WDC A;  2IAE C;  4IYP C;  3P71 C;  1G5B A;  3RL4 A;  4WWL A;  3DSC A;  3RL5 A;  4UT3 A;  1HO5 A;  3QFN A;  1OI8 A;  2O8A A;  3ICF A;  4MOY A;  1XM7 A;  4H2B A;  4M0V A;  3EGH A;  2Z06 A;  4DHL A;  3DW8 C;  4ORA A;  3ZU0 A;  4ORC A;  4UWQ A;  5IOH A;  3ZTV A;  3DSD A;  4KKZ A;  2QFP A;  3E0J A;  3GVE A;  3N5U A;  1QHW A;  3E7B A;  3H67 A;  4JA9 A;  2Z72 A;  4OR9 A;  1WAR A;  2USH A;  1SU1 A;  3IVE A;  2YVT A;  4FCX A;  1S3M A;  2DFJ A;  2WDD A;  4I5L C;  1MF8 A;  4NZV A;  4ZVZ A;  3QFO A;  2NYM C;  4H1S A;  1WAO 1;  2DXN A;  2P6B A;  2R17 A;  4JA7 A;  3H68 A;  1NNW A;  3H63 A;  3IB7 A;  3TGH A;  3H61 A;  1JK7 A;  4O24 A;  4B2O A;  1OIE A;  4DT2 A;  3HVQ A;  4UT2 A;  3V4Y A;  4DSY A;  2ZO9 B;  1IT6 A;  2KKN A;  2DXL A;  5JJT A;  3PSO A;  3H64 A;  2AHD A;  3C5W C;  2JOG A;  3H66 A;  4H2G A;  4HD0 A;  1HP1 A;  2QJC A;  1U32 A;  2NYL C;  1T70 A;  2NXF A;  3AV0 A;  3K7V C;  3T1I A;  3E7A A;  3IVD A;  4KBP A;  2HYP A;  2HY1 A;  3D03 A;  4O5G A;  3QFK A;  5F3W A;  5GTU A;  4H2I A;  4J6O A;  4UT3 B;  4XPN A;  2ZBM A;  1S8E A;  4H2F A;  4I5N C;  4LAC C;  2Q8U A;  3KBP A;  5EQV A;  3JYF A;  1TCO A;  2YEQ A;  3H69 A;  2BCD A;  3RQZ A;  1HPU A;  1V73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...