4G9JA

Protein ser/thr phosphatase-1 in complex with cell-permeable peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
292
structure length
292
Chain Sequence
LDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Development of a Peptide that Selectively Activates Protein Phosphatase-1 in Living Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 100
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4g9jA00
4MP0A 3PSNA 2IE3C 3LL8A 5IOHA 3AUZA 5JPEA 4OR9A 5F3WA 3FGAC 3THNA 1T71A 4ZX2A 4MOVA 2NXFA 3RL4A 2CV9A 1IT6A 2Q8UA 2USHA 1SU1A 4YKEA 1XZWA 5J28A 1S95A 1Z2WA 3AV0A 3QG5C 1Z2XA 2KKNA 3ZTVA 1HP1A 4FBQA 1XM7A 4ORAA 2O8GA 2Z72A 4ORBA 1WARA 1USHA 2XMOA 4FBKA 3THOB 3H68A 4H1SA 2AHDA 2DFJA 3TGHA 2IAEC 1S3MA 5JJTA 2QFRA 4O43A 2WDDA 3EGHA 4ZVZA 3QFMA 4I5LC 2A22A 3ZU0A 4TUIA 3RL3A 1OIDA 2BDXA 4Q7FA 4FBWA 3DSDA 1HPUA 4H2GA 5HPEA 2Z06A 2YVTA 3QFKA 4DT2A 1MF8A 3JYFA 2O8AA 1QFCA 2NPPC 1W24A 1AUIA 3H69A 5C1VA 2HYPA 1M63A 4B2OA 2WDCA 4F0ZA 3H62B 1S8EA 1JK7A 2ZBMA 3QFOA 1UTEA 2QFPA 1S70A 1S3NA 3PSOA 1FJMA 2BQ8X 4TUGA 1HO5A 5B8IA 4LTYA 4IYPC 3H63A 2Z1AA 4MOYA 4H2FA 3P71C 1QHWA 3V4YA 1WAO1 2QJCA 3IVEA 1NNWA 3IB7A 3K7VC 4NZVA 3KBPA 3ICFA 4DHLA 5EQVA 3N5UA 4H2IA 4O5GA 4UT3B 3RL5A 2WDFA 4G9JA 3C9FA 2NYMC 3H60A 4LACC 1TCOA 4JA7A 4FCXA 4UWQA 4J6OA 1U32A 4H1YP 4KKZA 4UT3A 2GJUA 4O24A 4IL1A 3C5WC 3EGGA 2JOGA 3IVDA 3QFNA 2IE4C 3IB8A 4WWLA 3H64A 3K7WC 3CK2A 4JA9A 2BCDA 1KBPA 4KBPA 2NYLC 3HVQA 4V0XA 5DNYA 3DW8C 4I5NC 4V0WA 1V73A 4LU9A 1S3LA 1OI8A 1G5BA 4UT2A 2R17A 5JPFA 2WDEA 4M0VA 2HY1A 1UF3A 4V0VA 4XPNA 3T1IA 3E7BA 3GVEA 2P6BA 4DSYA 5INBA 3RQZA 4H2BA 1OIEA 4HD0A 1T70A 4O4KA 3DSCA 5GTUA 4ORCA 3E7AA 2HYOA 3H67A 3H61A 3H66A 1II7A
chains in the Genus database with same CATH superfamily
4MP0A 3PSNA 2IE3C 3LL8A 5IOHA 3AUZA 5JPEA 4OR9A 5F3WA 3FGAC 3THNA 1T71A 4ZX2A 4MOVA 2NXFA 3RL4A 2CV9A 1IT6A 2Q8UA 3E0JA 2USHA 1SU1A 4YKEA 1XZWA 5J28A 2ZO9B 1S95A 1Z2WA 3AV0A 3QG5C 1Z2XA 2KKNA 3ZTVA 1HP1A 4FBQA 1XM7A 4ORAA 2O8GA 2Z72A 4ORBA 1WARA 1USHA 2XMOA 4FBKA 3THOB 3H68A 4H1SA 2AHDA 2DFJA 3TGHA 2IAEC 1S3MA 5JJTA 2QFRA 4O43A 2WDDA 3EGHA 4ZVZA 3QFMA 4I5LC 3FLOA 2A22A 3ZU0A 4TUIA 3RL3A 1OIDA 2BDXA 4Q7FA 4FBWA 3DSDA 1HPUA 4H2GA 2DXLA 2Z06A 5HPEA 2YVTA 3QFKA 4DT2A 1MF8A 3JYFA 2O8AA 1QFCA 2NPPC 1W24A 1AUIA 3H69A 5C1VA 2HYPA 1M63A 4B2OA 2WDCA 4F0ZA 3H62B 1S8EA 1JK7A 2ZBMA 3QFOA 1UTEA 2QFPA 2ZOAA 1S70A 1S3NA 3PSOA 1FJMA 2BQ8X 4TUGA 1HO5A 5B8IA 4LTYA 4IYPC 3H63A 2DXNA 2Z1AA 4H2FA 4MOYA 3P71C 1QHWA 3V4YA 1WAO1 2QJCA 3IVEA 1NNWA 3IB7A 3K7VC 4NZVA 3KBPA 3ICFA 4DHLA 5EQVA 3N5UA 4H2IA 4O5GA 4UT3B 3RL5A 2WDFA 4G9JA 3C9FA 2NYMC 3H60A 4LACC 1TCOA 4JA7A 4FCXA 4UWQA 4J6OA 1U32A 4H1YP 4KKZA 4UT3A 2GJUA 4O24A 4IL1A 3C5WC 3EGGA 2JOGA 3IVDA 3QFNA 2IE4C 3IB8A 4WWLA 3H64A 3K7WC 3CK2A 4JA9A 2BCDA 1KBPA 4KBPA 2NYLC 3D03A 3HVQA 4V0XA 5DNYA 3DW8C 4I5NC 4V0WA 1V73A 4LU9A 1S3LA 2YEQA 1OI8A 1G5BA 4UT2A 2R17A 5JPFA 2WDEA 4M0VA 2HY1A 1UF3A 4V0VA 4XPNA 3T1IA 3E7BA 3GVEA 2P6BA 4DSYA 5INBA 3RQZA 4H2BA 1OIEA 4HD0A 1T70A 4O4KA 3DSCA 5GTUA 4ORCA 3E7AA 2HYOA 3H67A 3H61A 3H66A 1II7A
chains in the Genus database with same CATH topology
4MP0A 3PSNA 2IE3C 3LL8A 5IOHA 3AUZA 5JPEA 4OR9A 5F3WA 3FGAC 3THNA 1T71A 4ZX2A 4MOVA 2NXFA 3RL4A 2CV9A 1IT6A 2Q8UA 3E0JA 2USHA 1SU1A 4YKEA 1XZWA 5J28A 2ZO9B 1S95A 1Z2WA 3AV0A 3QG5C 1Z2XA 2KKNA 3ZTVA 1HP1A 4FBQA 1XM7A 4ORAA 2O8GA 2Z72A 4ORBA 1WARA 1USHA 2XMOA 4FBKA 3THOB 3H68A 4H1SA 2AHDA 2DFJA 3TGHA 2IAEC 1S3MA 5JJTA 2QFRA 4O43A 2WDDA 3EGHA 4ZVZA 3QFMA 4I5LC 3FLOA 2A22A 3ZU0A 4TUIA 3RL3A 1OIDA 2BDXA 4Q7FA 4FBWA 3DSDA 1HPUA 4H2GA 2DXLA 2Z06A 5HPEA 2YVTA 3QFKA 4DT2A 1MF8A 3JYFA 2O8AA 1QFCA 2NPPC 1W24A 1AUIA 3H69A 5C1VA 2HYPA 1M63A 4B2OA 2WDCA 4F0ZA 3H62B 1S8EA 1JK7A 2ZBMA 3QFOA 1UTEA 2QFPA 2ZOAA 1S70A 1S3NA 3PSOA 1FJMA 2BQ8X 4TUGA 1HO5A 5B8IA 4LTYA 4IYPC 3H63A 2DXNA 2Z1AA 4H2FA 4MOYA 3P71C 1QHWA 3V4YA 1WAO1 2QJCA 3IVEA 1NNWA 3IB7A 3K7VC 4NZVA 3KBPA 3ICFA 4DHLA 5EQVA 3N5UA 4H2IA 4O5GA 4UT3B 3RL5A 2WDFA 4G9JA 3C9FA 2NYMC 3H60A 4LACC 1TCOA 4JA7A 4FCXA 4UWQA 4J6OA 1U32A 4H1YP 4KKZA 4UT3A 2GJUA 4O24A 4IL1A 3C5WC 3EGGA 2JOGA 3IVDA 3QFNA 2IE4C 3IB8A 4WWLA 3H64A 3K7WC 3CK2A 4JA9A 2BCDA 1KBPA 4KBPA 2NYLC 3D03A 3HVQA 4V0XA 5DNYA 3DW8C 4I5NC 4V0WA 1V73A 4LU9A 1S3LA 2YEQA 1OI8A 1G5BA 4UT2A 2R17A 5JPFA 2WDEA 4M0VA 2HY1A 1UF3A 4V0VA 4XPNA 3T1IA 3E7BA 3GVEA 2P6BA 4DSYA 5INBA 3RQZA 4H2BA 1OIEA 4HD0A 1T70A 4O4KA 3DSCA 5GTUA 4ORCA 3E7AA 2HYOA 3H67A 3H61A 3H66A 1II7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MP0 A;  3PSN A;  2IE3 C;  3LL8 A;  5IOH A;  3AUZ A;  5JPE A;  4OR9 A;  5F3W A;  3FGA C;  3THN A;  1T71 A;  4ZX2 A;  4MOV A;  2NXF A;  3RL4 A;  2CV9 A;  1IT6 A;  2Q8U A;  2USH A;  1SU1 A;  4YKE A;  1XZW A;  5J28 A;  1S95 A;  1Z2W A;  3AV0 A;  3QG5 C;  1Z2X A;  2KKN A;  3ZTV A;  1HP1 A;  4FBQ A;  1XM7 A;  4ORA A;  2O8G A;  2Z72 A;  4ORB A;  1WAR A;  1USH A;  2XMO A;  4FBK A;  3THO B;  3H68 A;  4H1S A;  2AHD A;  2DFJ A;  3TGH A;  2IAE C;  1S3M A;  5JJT A;  2QFR A;  4O43 A;  2WDD A;  3EGH A;  4ZVZ A;  3QFM A;  4I5L C;  2A22 A;  3ZU0 A;  4TUI A;  3RL3 A;  1OID A;  2BDX A;  4Q7F A;  4FBW A;  3DSD A;  1HPU A;  4H2G A;  5HPE A;  2Z06 A;  2YVT A;  3QFK A;  4DT2 A;  1MF8 A;  3JYF A;  2O8A A;  1QFC A;  2NPP C;  1W24 A;  1AUI A;  3H69 A;  5C1V A;  2HYP A;  1M63 A;  4B2O A;  2WDC A;  4F0Z A;  3H62 B;  1S8E A;  1JK7 A;  2ZBM A;  3QFO A;  1UTE A;  2QFP A;  1S70 A;  1S3N A;  3PSO A;  1FJM A;  2BQ8 X;  4TUG A;  1HO5 A;  5B8I A;  4LTY A;  4IYP C;  3H63 A;  2Z1A A;  4MOY A;  4H2F A;  3P71 C;  1QHW A;  3V4Y A;  1WAO 1;  2QJC A;  3IVE A;  1NNW A;  3IB7 A;  3K7V C;  4NZV A;  3KBP A;  3ICF A;  4DHL A;  5EQV A;  3N5U A;  4H2I A;  4O5G A;  4UT3 B;  3RL5 A;  2WDF A;  4G9J A;  3C9F A;  2NYM C;  3H60 A;  4LAC C;  1TCO A;  4JA7 A;  4FCX A;  4UWQ A;  4J6O A;  1U32 A;  4H1Y P;  4KKZ A;  4UT3 A;  2GJU A;  4O24 A;  4IL1 A;  3C5W C;  3EGG A;  2JOG A;  3IVD A;  3QFN A;  2IE4 C;  3IB8 A;  4WWL A;  3H64 A;  3K7W C;  3CK2 A;  4JA9 A;  2BCD A;  1KBP A;  4KBP A;  2NYL C;  3HVQ A;  4V0X A;  5DNY A;  3DW8 C;  4I5N C;  4V0W A;  1V73 A;  4LU9 A;  1S3L A;  1OI8 A;  1G5B A;  4UT2 A;  2R17 A;  5JPF A;  2WDE A;  4M0V A;  2HY1 A;  1UF3 A;  4V0V A;  4XPN A;  3T1I A;  3E7B A;  3GVE A;  2P6B A;  4DSY A;  5INB A;  3RQZ A;  4H2B A;  1OIE A;  4HD0 A;  1T70 A;  4O4K A;  3DSC A;  5GTU A;  4ORC A;  3E7A A;  2HYO A;  3H67 A;  3H61 A;  3H66 A;  1II7 A; 
#chains in the Genus database with same CATH topology
 4MP0 A;  3PSN A;  2IE3 C;  3LL8 A;  5IOH A;  3AUZ A;  5JPE A;  4OR9 A;  5F3W A;  3FGA C;  3THN A;  1T71 A;  4ZX2 A;  4MOV A;  2NXF A;  3RL4 A;  2CV9 A;  1IT6 A;  2Q8U A;  3E0J A;  2USH A;  1SU1 A;  4YKE A;  1XZW A;  5J28 A;  2ZO9 B;  1S95 A;  1Z2W A;  3AV0 A;  3QG5 C;  1Z2X A;  2KKN A;  3ZTV A;  1HP1 A;  4FBQ A;  1XM7 A;  4ORA A;  2O8G A;  2Z72 A;  4ORB A;  1WAR A;  1USH A;  2XMO A;  4FBK A;  3THO B;  3H68 A;  4H1S A;  2AHD A;  2DFJ A;  3TGH A;  2IAE C;  1S3M A;  5JJT A;  2QFR A;  4O43 A;  2WDD A;  3EGH A;  4ZVZ A;  3QFM A;  4I5L C;  3FLO A;  2A22 A;  3ZU0 A;  4TUI A;  3RL3 A;  1OID A;  2BDX A;  4Q7F A;  4FBW A;  3DSD A;  1HPU A;  4H2G A;  2DXL A;  2Z06 A;  5HPE A;  2YVT A;  3QFK A;  4DT2 A;  1MF8 A;  3JYF A;  2O8A A;  1QFC A;  2NPP C;  1W24 A;  1AUI A;  3H69 A;  5C1V A;  2HYP A;  1M63 A;  4B2O A;  2WDC A;  4F0Z A;  3H62 B;  1S8E A;  1JK7 A;  2ZBM A;  3QFO A;  1UTE A;  2QFP A;  2ZOA A;  1S70 A;  1S3N A;  3PSO A;  1FJM A;  2BQ8 X;  4TUG A;  1HO5 A;  5B8I A;  4LTY A;  4IYP C;  3H63 A;  2DXN A;  2Z1A A;  4H2F A;  4MOY A;  3P71 C;  1QHW A;  3V4Y A;  1WAO 1;  2QJC A;  3IVE A;  1NNW A;  3IB7 A;  3K7V C;  4NZV A;  3KBP A;  3ICF A;  4DHL A;  5EQV A;  3N5U A;  4H2I A;  4O5G A;  4UT3 B;  3RL5 A;  2WDF A;  4G9J A;  3C9F A;  2NYM C;  3H60 A;  4LAC C;  1TCO A;  4JA7 A;  4FCX A;  4UWQ A;  4J6O A;  1U32 A;  4H1Y P;  4KKZ A;  4UT3 A;  2GJU A;  4O24 A;  4IL1 A;  3C5W C;  3EGG A;  2JOG A;  3IVD A;  3QFN A;  2IE4 C;  3IB8 A;  4WWL A;  3H64 A;  3K7W C;  3CK2 A;  4JA9 A;  2BCD A;  1KBP A;  4KBP A;  2NYL C;  3D03 A;  3HVQ A;  4V0X A;  5DNY A;  3DW8 C;  4I5N C;  4V0W A;  1V73 A;  4LU9 A;  1S3L A;  2YEQ A;  1OI8 A;  1G5B A;  4UT2 A;  2R17 A;  5JPF A;  2WDE A;  4M0V A;  2HY1 A;  1UF3 A;  4V0V A;  4XPN A;  3T1I A;  3E7B A;  3GVE A;  2P6B A;  4DSY A;  5INB A;  3RQZ A;  4H2B A;  1OIE A;  4HD0 A;  1T70 A;  4O4K A;  3DSC A;  5GTU A;  4ORC A;  3E7A A;  2HYO A;  3H67 A;  3H61 A;  3H66 A;  1II7 A; 
#chains in the Genus database with same CATH homology
 4MP0 A;  3PSN A;  2IE3 C;  3LL8 A;  5IOH A;  3AUZ A;  5JPE A;  4OR9 A;  5F3W A;  3FGA C;  3THN A;  1T71 A;  4ZX2 A;  4MOV A;  2NXF A;  3RL4 A;  2CV9 A;  1IT6 A;  2Q8U A;  3E0J A;  2USH A;  1SU1 A;  4YKE A;  1XZW A;  5J28 A;  2ZO9 B;  1S95 A;  1Z2W A;  3AV0 A;  3QG5 C;  1Z2X A;  2KKN A;  3ZTV A;  1HP1 A;  4FBQ A;  1XM7 A;  4ORA A;  2O8G A;  2Z72 A;  4ORB A;  1WAR A;  1USH A;  2XMO A;  4FBK A;  3THO B;  3H68 A;  4H1S A;  2AHD A;  2DFJ A;  3TGH A;  2IAE C;  1S3M A;  5JJT A;  2QFR A;  4O43 A;  2WDD A;  3EGH A;  4ZVZ A;  3QFM A;  4I5L C;  3FLO A;  2A22 A;  3ZU0 A;  4TUI A;  3RL3 A;  1OID A;  2BDX A;  4Q7F A;  4FBW A;  3DSD A;  1HPU A;  4H2G A;  2DXL A;  2Z06 A;  5HPE A;  2YVT A;  3QFK A;  4DT2 A;  1MF8 A;  3JYF A;  2O8A A;  1QFC A;  2NPP C;  1W24 A;  1AUI A;  3H69 A;  5C1V A;  2HYP A;  1M63 A;  4B2O A;  2WDC A;  4F0Z A;  3H62 B;  1S8E A;  1JK7 A;  2ZBM A;  3QFO A;  1UTE A;  2QFP A;  2ZOA A;  1S70 A;  1S3N A;  3PSO A;  1FJM A;  2BQ8 X;  4TUG A;  1HO5 A;  5B8I A;  4LTY A;  4IYP C;  3H63 A;  2DXN A;  2Z1A A;  4H2F A;  4MOY A;  3P71 C;  1QHW A;  3V4Y A;  1WAO 1;  2QJC A;  3IVE A;  1NNW A;  3IB7 A;  3K7V C;  4NZV A;  3KBP A;  3ICF A;  4DHL A;  5EQV A;  3N5U A;  4H2I A;  4O5G A;  4UT3 B;  3RL5 A;  2WDF A;  4G9J A;  3C9F A;  2NYM C;  3H60 A;  4LAC C;  1TCO A;  4JA7 A;  4FCX A;  4UWQ A;  4J6O A;  1U32 A;  4H1Y P;  4KKZ A;  4UT3 A;  2GJU A;  4O24 A;  4IL1 A;  3C5W C;  3EGG A;  2JOG A;  3IVD A;  3QFN A;  2IE4 C;  3IB8 A;  4WWL A;  3H64 A;  3K7W C;  3CK2 A;  4JA9 A;  2BCD A;  1KBP A;  4KBP A;  2NYL C;  3D03 A;  3HVQ A;  4V0X A;  5DNY A;  3DW8 C;  4I5N C;  4V0W A;  1V73 A;  4LU9 A;  1S3L A;  2YEQ A;  1OI8 A;  1G5B A;  4UT2 A;  2R17 A;  5JPF A;  2WDE A;  4M0V A;  2HY1 A;  1UF3 A;  4V0V A;  4XPN A;  3T1I A;  3E7B A;  3GVE A;  2P6B A;  4DSY A;  5INB A;  3RQZ A;  4H2B A;  1OIE A;  4HD0 A;  1T70 A;  4O4K A;  3DSC A;  5GTU A;  4ORC A;  3E7A A;  2HYO A;  3H67 A;  3H61 A;  3H66 A;  1II7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...