4G9JA

Protein ser/thr phosphatase-1 in complex with cell-permeable peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
292
structure length
292
Chain Sequence
LDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a Peptide that Selectively Activates Protein Phosphatase-1 in Living Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 100
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4g9jA00
3PSNA 2Z1AA 1XM7A 5JPEA 1XZWA 3JYFA 4MOYA 4F0ZA 4H1SA 3DW8C 4V0WA 1T70A 3THOB 4FBWA 2GJUA 3EGHA 4LU9A 3IVDA 2ZBMA 1OIEA 4ORBA 5F3WA 5JPFA 1AUIA 2XMOA 3E7BA 1FJMA 2HY1A 3H60A 4DHLA 4DSYA 2WDFA 2A22A 1USHA 4J6OA 3THNA 5IOHA 1W24A 3LL8A 1G5BA 1HO5A 2BQ8X 1Z2XA 2HYOA 4DT2A 5B8IA 4ORAA 3RQZA 2YVTA 1TCOA 3IB8A 3QFMA 4I5LC 3ZU0A 5J28A 1IT6A 5JJTA 4M0VA 5DNYA 4V0VA 2NPPC 3QG5C 2CV9A 4IYPC 4LTYA 3TGHA 3H61A 4TUIA 3H68A 1S95A 1JK7A 2KKNA 4ORCA 5C1VA 3RL3A 4KKZA 3FGAC 2Z06A 1KBPA 4FBKA 2NXFA 4JA9A 4WWLA 4FCXA 4O4KA 1S3NA 4UT2A 2O8AA 3IB7A 4O24A 3N5UA 2P6BA 2O8GA 2JOGA 4H2GA 3T1IA 4Q7FA 3AV0A 3H67A 3H69A 1QHWA 4ZVZA 4O43A 2HYPA 4OR9A 4NZVA 5EQVA 4UT3A 3DSDA 3H62B 2Z72A 4G9JA 3H64A 2NYMC 2IAEC 4H2FA 3K7VC 2R17A 3QFOA 2USHA 3AUZA 4UWQA 3ZTVA 1UTEA 3RL4A 2AHDA 4H2BA 1WAO1 3HVQA 3E7AA 3RL5A 3IVEA 2DFJA 2WDCA 4ZX2A 3K7WC 3V4YA 4I5NC 2QFPA 2WDEA 3GVEA 4XPNA 4B2OA 3P71C 2IE3C 1OIDA 2Q8UA 4IL1A 3H66A 1MF8A 1S3LA 1UF3A 5GTUA 4KBPA 4YKEA 1SU1A 1QFCA 1U32A 1M63A 1NNWA 1HP1A 2QFRA 1S3MA 3DSCA 1S70A 4HD0A 3H63A 4TUGA 5INBA 1OI8A 2IE4C 5HPEA 1WARA 4O5GA 4LACC 3PSOA 3QFKA 4V0XA 3C5WC 4MOVA 3EGGA 4JA7A 3CK2A 3ICFA 3C9FA 4FBQA 4H2IA 2QJCA 4H1YP 1T71A 2WDDA 4UT3B 2NYLC 1II7A 1S8EA 1V73A 3KBPA 2BCDA 2BDXA 1HPUA 1Z2WA 4MP0A 3QFNA
chains in the Genus database with same CATH superfamily
3PSNA 2Z1AA 1XM7A 5JPEA 1XZWA 3JYFA 4MOYA 4F0ZA 4H1SA 3DW8C 4V0WA 1T70A 3THOB 2DXLA 4FBWA 2GJUA 3EGHA 4LU9A 3IVDA 2ZBMA 1OIEA 4ORBA 5F3WA 5JPFA 1AUIA 2XMOA 3E7BA 1FJMA 2HY1A 3H60A 4DHLA 4DSYA 2WDFA 2A22A 1USHA 4J6OA 3THNA 5IOHA 1W24A 3LL8A 1G5BA 1HO5A 2BQ8X 1Z2XA 2HYOA 4DT2A 5B8IA 4ORAA 3RQZA 2YVTA 1TCOA 3IB8A 3QFMA 4I5LC 3ZU0A 5J28A 1IT6A 5JJTA 4M0VA 5DNYA 2YEQA 4V0VA 2NPPC 3QG5C 2CV9A 4IYPC 4LTYA 3TGHA 3H61A 4TUIA 3H68A 1S95A 1JK7A 2KKNA 4ORCA 5C1VA 3RL3A 4KKZA 3FGAC 2Z06A 1KBPA 4FBKA 2NXFA 4JA9A 4WWLA 4FCXA 4O4KA 1S3NA 4UT2A 2O8AA 3IB7A 2ZOAA 4O24A 3N5UA 2P6BA 2O8GA 2DXNA 2JOGA 4H2GA 3T1IA 4Q7FA 3AV0A 3H67A 3H69A 3E0JA 1QHWA 4ZVZA 4O43A 2HYPA 4OR9A 4NZVA 5EQVA 4UT3A 3DSDA 3H62B 2Z72A 4G9JA 3H64A 2NYMC 3D03A 2IAEC 4H2FA 3K7VC 2R17A 3QFOA 2USHA 3AUZA 4UWQA 3ZTVA 1UTEA 3RL4A 2AHDA 4H2BA 1WAO1 3HVQA 3E7AA 3RL5A 3IVEA 2DFJA 2WDCA 4ZX2A 3K7WC 3V4YA 4I5NC 2QFPA 2WDEA 3GVEA 4XPNA 4B2OA 3P71C 2IE3C 1OIDA 2Q8UA 4IL1A 3H66A 1MF8A 1S3LA 1UF3A 5GTUA 4KBPA 4YKEA 1SU1A 1QFCA 1U32A 1M63A 2ZO9B 3FLOA 1NNWA 1HP1A 2QFRA 1S3MA 3DSCA 1S70A 4HD0A 3H63A 4TUGA 5INBA 1OI8A 2IE4C 5HPEA 1WARA 4O5GA 4LACC 3PSOA 3QFKA 4V0XA 3C5WC 4MOVA 3EGGA 4JA7A 3CK2A 3ICFA 3C9FA 4FBQA 4H2IA 2QJCA 4H1YP 1T71A 2WDDA 4UT3B 2NYLC 1II7A 1S8EA 1V73A 3KBPA 2BCDA 2BDXA 1HPUA 1Z2WA 4MP0A 3QFNA
chains in the Genus database with same CATH topology
3PSNA 2Z1AA 1XM7A 5JPEA 1XZWA 3JYFA 4MOYA 4F0ZA 4H1SA 3DW8C 4V0WA 1T70A 3THOB 2DXLA 4FBWA 2GJUA 3EGHA 4LU9A 3IVDA 2ZBMA 1OIEA 4ORBA 5F3WA 5JPFA 1AUIA 2XMOA 3E7BA 1FJMA 2HY1A 3H60A 4DHLA 4DSYA 2WDFA 2A22A 1USHA 4J6OA 3THNA 5IOHA 1W24A 3LL8A 1G5BA 1HO5A 2BQ8X 1Z2XA 2HYOA 4DT2A 5B8IA 4ORAA 3RQZA 2YVTA 1TCOA 3IB8A 3QFMA 4I5LC 3ZU0A 5J28A 1IT6A 5JJTA 4M0VA 5DNYA 2YEQA 4V0VA 2NPPC 3QG5C 2CV9A 4IYPC 4LTYA 3TGHA 3H61A 4TUIA 3H68A 1S95A 1JK7A 2KKNA 4ORCA 5C1VA 3RL3A 4KKZA 3FGAC 2Z06A 1KBPA 4FBKA 2NXFA 4JA9A 4WWLA 4FCXA 4O4KA 1S3NA 4UT2A 2O8AA 3IB7A 2ZOAA 4O24A 3N5UA 2P6BA 2O8GA 2DXNA 2JOGA 4H2GA 3T1IA 4Q7FA 3AV0A 3H67A 3H69A 3E0JA 1QHWA 4ZVZA 4O43A 2HYPA 4OR9A 4NZVA 5EQVA 4UT3A 3DSDA 3H62B 2Z72A 4G9JA 3H64A 2NYMC 3D03A 2IAEC 4H2FA 3K7VC 2R17A 3QFOA 2USHA 3AUZA 4UWQA 3ZTVA 1UTEA 3RL4A 2AHDA 4H2BA 1WAO1 3HVQA 3E7AA 3RL5A 3IVEA 2DFJA 2WDCA 4ZX2A 3K7WC 3V4YA 4I5NC 2QFPA 2WDEA 3GVEA 4XPNA 4B2OA 3P71C 2IE3C 1OIDA 2Q8UA 4IL1A 3H66A 1MF8A 1S3LA 1UF3A 5GTUA 4KBPA 4YKEA 1SU1A 1QFCA 1U32A 1M63A 2ZO9B 3FLOA 1NNWA 1HP1A 2QFRA 1S3MA 3DSCA 1S70A 4HD0A 3H63A 4TUGA 5INBA 1OI8A 2IE4C 5HPEA 1WARA 4O5GA 4LACC 3PSOA 3QFKA 4V0XA 3C5WC 4MOVA 3EGGA 4JA7A 3CK2A 3ICFA 3C9FA 4FBQA 4H2IA 2QJCA 4H1YP 1T71A 2WDDA 4UT3B 2NYLC 1II7A 1S8EA 1V73A 3KBPA 2BCDA 2BDXA 1HPUA 1Z2WA 4MP0A 3QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSN A;  2Z1A A;  1XM7 A;  5JPE A;  1XZW A;  3JYF A;  4MOY A;  4F0Z A;  4H1S A;  3DW8 C;  4V0W A;  1T70 A;  3THO B;  4FBW A;  2GJU A;  3EGH A;  4LU9 A;  3IVD A;  2ZBM A;  1OIE A;  4ORB A;  5F3W A;  5JPF A;  1AUI A;  2XMO A;  3E7B A;  1FJM A;  2HY1 A;  3H60 A;  4DHL A;  4DSY A;  2WDF A;  2A22 A;  1USH A;  4J6O A;  3THN A;  5IOH A;  1W24 A;  3LL8 A;  1G5B A;  1HO5 A;  2BQ8 X;  1Z2X A;  2HYO A;  4DT2 A;  5B8I A;  4ORA A;  3RQZ A;  2YVT A;  1TCO A;  3IB8 A;  3QFM A;  4I5L C;  3ZU0 A;  5J28 A;  1IT6 A;  5JJT A;  4M0V A;  5DNY A;  4V0V A;  2NPP C;  3QG5 C;  2CV9 A;  4IYP C;  4LTY A;  3TGH A;  3H61 A;  4TUI A;  3H68 A;  1S95 A;  1JK7 A;  2KKN A;  4ORC A;  5C1V A;  3RL3 A;  4KKZ A;  3FGA C;  2Z06 A;  1KBP A;  4FBK A;  2NXF A;  4JA9 A;  4WWL A;  4FCX A;  4O4K A;  1S3N A;  4UT2 A;  2O8A A;  3IB7 A;  4O24 A;  3N5U A;  2P6B A;  2O8G A;  2JOG A;  4H2G A;  3T1I A;  4Q7F A;  3AV0 A;  3H67 A;  3H69 A;  1QHW A;  4ZVZ A;  4O43 A;  2HYP A;  4OR9 A;  4NZV A;  5EQV A;  4UT3 A;  3DSD A;  3H62 B;  2Z72 A;  4G9J A;  3H64 A;  2NYM C;  2IAE C;  4H2F A;  3K7V C;  2R17 A;  3QFO A;  2USH A;  3AUZ A;  4UWQ A;  3ZTV A;  1UTE A;  3RL4 A;  2AHD A;  4H2B A;  1WAO 1;  3HVQ A;  3E7A A;  3RL5 A;  3IVE A;  2DFJ A;  2WDC A;  4ZX2 A;  3K7W C;  3V4Y A;  4I5N C;  2QFP A;  2WDE A;  3GVE A;  4XPN A;  4B2O A;  3P71 C;  2IE3 C;  1OID A;  2Q8U A;  4IL1 A;  3H66 A;  1MF8 A;  1S3L A;  1UF3 A;  5GTU A;  4KBP A;  4YKE A;  1SU1 A;  1QFC A;  1U32 A;  1M63 A;  1NNW A;  1HP1 A;  2QFR A;  1S3M A;  3DSC A;  1S70 A;  4HD0 A;  3H63 A;  4TUG A;  5INB A;  1OI8 A;  2IE4 C;  5HPE A;  1WAR A;  4O5G A;  4LAC C;  3PSO A;  3QFK A;  4V0X A;  3C5W C;  4MOV A;  3EGG A;  4JA7 A;  3CK2 A;  3ICF A;  3C9F A;  4FBQ A;  4H2I A;  2QJC A;  4H1Y P;  1T71 A;  2WDD A;  4UT3 B;  2NYL C;  1II7 A;  1S8E A;  1V73 A;  3KBP A;  2BCD A;  2BDX A;  1HPU A;  1Z2W A;  4MP0 A;  3QFN A; 
#chains in the Genus database with same CATH topology
 3PSN A;  2Z1A A;  1XM7 A;  5JPE A;  1XZW A;  3JYF A;  4MOY A;  4F0Z A;  4H1S A;  3DW8 C;  4V0W A;  1T70 A;  3THO B;  2DXL A;  4FBW A;  2GJU A;  3EGH A;  4LU9 A;  3IVD A;  2ZBM A;  1OIE A;  4ORB A;  5F3W A;  5JPF A;  1AUI A;  2XMO A;  3E7B A;  1FJM A;  2HY1 A;  3H60 A;  4DHL A;  4DSY A;  2WDF A;  2A22 A;  1USH A;  4J6O A;  3THN A;  5IOH A;  1W24 A;  3LL8 A;  1G5B A;  1HO5 A;  2BQ8 X;  1Z2X A;  2HYO A;  4DT2 A;  5B8I A;  4ORA A;  3RQZ A;  2YVT A;  1TCO A;  3IB8 A;  3QFM A;  4I5L C;  3ZU0 A;  5J28 A;  1IT6 A;  5JJT A;  4M0V A;  5DNY A;  2YEQ A;  4V0V A;  2NPP C;  3QG5 C;  2CV9 A;  4IYP C;  4LTY A;  3TGH A;  3H61 A;  4TUI A;  3H68 A;  1S95 A;  1JK7 A;  2KKN A;  4ORC A;  5C1V A;  3RL3 A;  4KKZ A;  3FGA C;  2Z06 A;  1KBP A;  4FBK A;  2NXF A;  4JA9 A;  4WWL A;  4FCX A;  4O4K A;  1S3N A;  4UT2 A;  2O8A A;  3IB7 A;  2ZOA A;  4O24 A;  3N5U A;  2P6B A;  2O8G A;  2DXN A;  2JOG A;  4H2G A;  3T1I A;  4Q7F A;  3AV0 A;  3H67 A;  3H69 A;  3E0J A;  1QHW A;  4ZVZ A;  4O43 A;  2HYP A;  4OR9 A;  4NZV A;  5EQV A;  4UT3 A;  3DSD A;  3H62 B;  2Z72 A;  4G9J A;  3H64 A;  2NYM C;  3D03 A;  2IAE C;  4H2F A;  3K7V C;  2R17 A;  3QFO A;  2USH A;  3AUZ A;  4UWQ A;  3ZTV A;  1UTE A;  3RL4 A;  2AHD A;  4H2B A;  1WAO 1;  3HVQ A;  3E7A A;  3RL5 A;  3IVE A;  2DFJ A;  2WDC A;  4ZX2 A;  3K7W C;  3V4Y A;  4I5N C;  2QFP A;  2WDE A;  3GVE A;  4XPN A;  4B2O A;  3P71 C;  2IE3 C;  1OID A;  2Q8U A;  4IL1 A;  3H66 A;  1MF8 A;  1S3L A;  1UF3 A;  5GTU A;  4KBP A;  4YKE A;  1SU1 A;  1QFC A;  1U32 A;  1M63 A;  2ZO9 B;  3FLO A;  1NNW A;  1HP1 A;  2QFR A;  1S3M A;  3DSC A;  1S70 A;  4HD0 A;  3H63 A;  4TUG A;  5INB A;  1OI8 A;  2IE4 C;  5HPE A;  1WAR A;  4O5G A;  4LAC C;  3PSO A;  3QFK A;  4V0X A;  3C5W C;  4MOV A;  3EGG A;  4JA7 A;  3CK2 A;  3ICF A;  3C9F A;  4FBQ A;  4H2I A;  2QJC A;  4H1Y P;  1T71 A;  2WDD A;  4UT3 B;  2NYL C;  1II7 A;  1S8E A;  1V73 A;  3KBP A;  2BCD A;  2BDX A;  1HPU A;  1Z2W A;  4MP0 A;  3QFN A; 
#chains in the Genus database with same CATH homology
 3PSN A;  2Z1A A;  1XM7 A;  5JPE A;  1XZW A;  3JYF A;  4MOY A;  4F0Z A;  4H1S A;  3DW8 C;  4V0W A;  1T70 A;  3THO B;  2DXL A;  4FBW A;  2GJU A;  3EGH A;  4LU9 A;  3IVD A;  2ZBM A;  1OIE A;  4ORB A;  5F3W A;  5JPF A;  1AUI A;  2XMO A;  3E7B A;  1FJM A;  2HY1 A;  3H60 A;  4DHL A;  4DSY A;  2WDF A;  2A22 A;  1USH A;  4J6O A;  3THN A;  5IOH A;  1W24 A;  3LL8 A;  1G5B A;  1HO5 A;  2BQ8 X;  1Z2X A;  2HYO A;  4DT2 A;  5B8I A;  4ORA A;  3RQZ A;  2YVT A;  1TCO A;  3IB8 A;  3QFM A;  4I5L C;  3ZU0 A;  5J28 A;  1IT6 A;  5JJT A;  4M0V A;  5DNY A;  2YEQ A;  4V0V A;  2NPP C;  3QG5 C;  2CV9 A;  4IYP C;  4LTY A;  3TGH A;  3H61 A;  4TUI A;  3H68 A;  1S95 A;  1JK7 A;  2KKN A;  4ORC A;  5C1V A;  3RL3 A;  4KKZ A;  3FGA C;  2Z06 A;  1KBP A;  4FBK A;  2NXF A;  4JA9 A;  4WWL A;  4FCX A;  4O4K A;  1S3N A;  4UT2 A;  2O8A A;  3IB7 A;  2ZOA A;  4O24 A;  3N5U A;  2P6B A;  2O8G A;  2DXN A;  2JOG A;  4H2G A;  3T1I A;  4Q7F A;  3AV0 A;  3H67 A;  3H69 A;  3E0J A;  1QHW A;  4ZVZ A;  4O43 A;  2HYP A;  4OR9 A;  4NZV A;  5EQV A;  4UT3 A;  3DSD A;  3H62 B;  2Z72 A;  4G9J A;  3H64 A;  2NYM C;  3D03 A;  2IAE C;  4H2F A;  3K7V C;  2R17 A;  3QFO A;  2USH A;  3AUZ A;  4UWQ A;  3ZTV A;  1UTE A;  3RL4 A;  2AHD A;  4H2B A;  1WAO 1;  3HVQ A;  3E7A A;  3RL5 A;  3IVE A;  2DFJ A;  2WDC A;  4ZX2 A;  3K7W C;  3V4Y A;  4I5N C;  2QFP A;  2WDE A;  3GVE A;  4XPN A;  4B2O A;  3P71 C;  2IE3 C;  1OID A;  2Q8U A;  4IL1 A;  3H66 A;  1MF8 A;  1S3L A;  1UF3 A;  5GTU A;  4KBP A;  4YKE A;  1SU1 A;  1QFC A;  1U32 A;  1M63 A;  2ZO9 B;  3FLO A;  1NNW A;  1HP1 A;  2QFR A;  1S3M A;  3DSC A;  1S70 A;  4HD0 A;  3H63 A;  4TUG A;  5INB A;  1OI8 A;  2IE4 C;  5HPE A;  1WAR A;  4O5G A;  4LAC C;  3PSO A;  3QFK A;  4V0X A;  3C5W C;  4MOV A;  3EGG A;  4JA7 A;  3CK2 A;  3ICF A;  3C9F A;  4FBQ A;  4H2I A;  2QJC A;  4H1Y P;  1T71 A;  2WDD A;  4UT3 B;  2NYL C;  1II7 A;  1S8E A;  1V73 A;  3KBP A;  2BCD A;  2BDX A;  1HPU A;  1Z2W A;  4MP0 A;  3QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...