4G9JA

Protein ser/thr phosphatase-1 in complex with cell-permeable peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
292
structure length
292
Chain Sequence
LDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a Peptide that Selectively Activates Protein Phosphatase-1 in Living Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 100
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4g9jA00
3DW8C 2IE4C 2HY1A 2WDCA 1MF8A 3IVDA 2QFPA 3H67A 3ZTVA 3H64A 1USHA 4KBPA 3E7AA 3PSNA 1S3NA 4O24A 1WARA 2NPPC 2A22A 4MP0A 4JA9A 4M0VA 5GTUA 3GVEA 2BQ8X 2Z72A 4UWQA 4H2GA 4TUIA 3RL4A 4XPNA 4WWLA 2JOGA 4LACC 3QG5C 4Q7FA 4I5NC 4ORCA 1XM7A 4DHLA 2P6BA 1NNWA 2NXFA 1UTEA 4OR9A 4H2BA 3THNA 2IE3C 1QFCA 4H2IA 5IOHA 4MOVA 1T70A 3CK2A 3T1IA 1V73A 4H1YP 2ZBMA 4FBWA 5JPEA 1JK7A 1G5BA 1S8EA 1Z2WA 2HYPA 4V0WA 3IVEA 4DSYA 4O43A 2IAEC 3IB8A 2NYMC 4UT2A 3FGAC 2WDFA 3ZU0A 4I5LC 1XZWA 3RL5A 4V0XA 3EGHA 4O4KA 4ORAA 3H62B 4FBKA 1HO5A 4JA7A 3DSCA 1S70A 4HD0A 2R17A 3QFNA 4G9JA 5HPEA 3QFOA 4FCXA 1S3LA 5EQVA 3C5WC 1WAO1 2WDEA 3H68A 3LL8A 2QFRA 4NZVA 1T71A 1OI8A 2YVTA 3C9FA 3QFMA 4UT3A 3H63A 2HYOA 5INBA 5JPFA 3JYFA 5JJTA 3ICFA 4IYPC 1S95A 3PSOA 3V4YA 1M63A 2AHDA 3H66A 2BDXA 2KKNA 3DSDA 2BCDA 2CV9A 1SU1A 4LU9A 2Q8UA 3KBPA 4LTYA 4IL1A 3RL3A 4ZX2A 3EGGA 4FBQA 2Z1AA 1TCOA 2O8AA 3QFKA 4KKZA 2GJUA 3HVQA 4J6OA 5B8IA 1HP1A 3K7WC 1S3MA 4F0ZA 4H1SA 1KBPA 1QHWA 3IB7A 3AUZA 4V0VA 3H69A 4H2FA 4B2OA 1HPUA 2XMOA 2DFJA 2NYLC 5F3WA 1AUIA 1UF3A 4UT3B 4ZVZA 2USHA 3P71C 3THOB 2QJCA 4YKEA 3E7BA 4TUGA 3H60A 5DNYA 1II7A 1OIEA 1U32A 4DT2A 3AV0A 2O8GA 1IT6A 2Z06A 5C1VA 3TGHA 4MOYA 2WDDA 1W24A 3K7VC 3H61A 1OIDA 1Z2XA 3N5UA 4O5GA 4ORBA 3RQZA 1FJMA 5J28A
chains in the Genus database with same CATH superfamily
3DW8C 2IE4C 2HY1A 2WDCA 1MF8A 3IVDA 2QFPA 3H67A 3ZTVA 3H64A 1USHA 4KBPA 3E7AA 3PSNA 2DXLA 1S3NA 4O24A 1WARA 2NPPC 2A22A 4MP0A 4JA9A 4M0VA 5GTUA 3GVEA 2BQ8X 2Z72A 4UWQA 4H2GA 4TUIA 3RL4A 4XPNA 4WWLA 2JOGA 4LACC 3QG5C 4Q7FA 4I5NC 4ORCA 1XM7A 4DHLA 2P6BA 1NNWA 2NXFA 1UTEA 4OR9A 4H2BA 3THNA 2IE3C 1QFCA 4H2IA 5IOHA 4MOVA 1T70A 3CK2A 2ZO9B 3T1IA 1V73A 4H1YP 2ZBMA 4FBWA 5JPEA 1JK7A 1G5BA 1S8EA 3D03A 1Z2WA 2HYPA 4V0WA 3IVEA 4DSYA 4O43A 2IAEC 3IB8A 2NYMC 4UT2A 3FGAC 2WDFA 3ZU0A 4I5LC 1XZWA 3RL5A 4V0XA 3EGHA 4O4KA 4ORAA 3H62B 4FBKA 1HO5A 4JA7A 3DSCA 1S70A 4HD0A 2R17A 3QFNA 4G9JA 5HPEA 3QFOA 4FCXA 1S3LA 5EQVA 3C5WC 1WAO1 2WDEA 3H68A 3LL8A 2QFRA 2YEQA 4NZVA 1T71A 1OI8A 2YVTA 3C9FA 3QFMA 4UT3A 3H63A 2HYOA 5INBA 5JPFA 3JYFA 5JJTA 3ICFA 4IYPC 1S95A 3PSOA 3V4YA 1M63A 2AHDA 3H66A 2BDXA 2KKNA 3DSDA 2BCDA 2CV9A 1SU1A 4LU9A 2Q8UA 3KBPA 4LTYA 4IL1A 3RL3A 4ZX2A 3EGGA 4FBQA 2DXNA 2Z1AA 1TCOA 2O8AA 3QFKA 4KKZA 2GJUA 3HVQA 4J6OA 5B8IA 1HP1A 3K7WC 1S3MA 4F0ZA 4H1SA 2ZOAA 1KBPA 1QHWA 3IB7A 3AUZA 4V0VA 3H69A 4H2FA 4B2OA 1HPUA 2XMOA 2DFJA 2NYLC 5J28A 1AUIA 1UF3A 4UT3B 4ZVZA 5F3WA 2USHA 3P71C 3THOB 2QJCA 4YKEA 3E7BA 4TUGA 3H60A 5DNYA 1II7A 1OIEA 1U32A 4DT2A 3AV0A 2O8GA 1IT6A 2Z06A 3FLOA 5C1VA 4MOYA 3TGHA 2WDDA 1W24A 3K7VC 3H61A 1OIDA 1Z2XA 3N5UA 4O5GA 4ORBA 3RQZA 1FJMA 3E0JA
chains in the Genus database with same CATH topology
3DW8C 2IE4C 2HY1A 2WDCA 1MF8A 3IVDA 2QFPA 3H67A 3ZTVA 3H64A 1USHA 4KBPA 3E7AA 3PSNA 2DXLA 1S3NA 4O24A 1WARA 2NPPC 2A22A 4MP0A 4JA9A 4M0VA 5GTUA 3GVEA 2BQ8X 2Z72A 4UWQA 4H2GA 4TUIA 3RL4A 4XPNA 4WWLA 2JOGA 4LACC 3QG5C 4Q7FA 4I5NC 4ORCA 1XM7A 4DHLA 2P6BA 1NNWA 2NXFA 1UTEA 4OR9A 4H2BA 3THNA 2IE3C 1QFCA 4H2IA 5IOHA 4MOVA 1T70A 3CK2A 2ZO9B 3T1IA 1V73A 4H1YP 2ZBMA 4FBWA 5JPEA 1JK7A 1G5BA 1S8EA 3D03A 1Z2WA 2HYPA 4V0WA 3IVEA 4DSYA 4O43A 2IAEC 3IB8A 2NYMC 4UT2A 3FGAC 2WDFA 3ZU0A 4I5LC 1XZWA 3RL5A 4V0XA 3EGHA 4O4KA 4ORAA 3H62B 4FBKA 1HO5A 4JA7A 3DSCA 1S70A 4HD0A 2R17A 3QFNA 4G9JA 5HPEA 3QFOA 4FCXA 1S3LA 5EQVA 3C5WC 1WAO1 2WDEA 3H68A 3LL8A 2QFRA 2YEQA 4NZVA 1T71A 1OI8A 2YVTA 3C9FA 3QFMA 4UT3A 3H63A 2HYOA 5INBA 5JPFA 3JYFA 5JJTA 3ICFA 4IYPC 1S95A 3PSOA 3V4YA 1M63A 2AHDA 3H66A 2BDXA 2KKNA 3DSDA 2BCDA 2CV9A 1SU1A 4LU9A 2Q8UA 3KBPA 4LTYA 4IL1A 3RL3A 4ZX2A 3EGGA 4FBQA 2DXNA 2Z1AA 1TCOA 2O8AA 3QFKA 4KKZA 2GJUA 3HVQA 4J6OA 5B8IA 1HP1A 3K7WC 1S3MA 4F0ZA 4H1SA 2ZOAA 1KBPA 1QHWA 3IB7A 3AUZA 4V0VA 3H69A 4H2FA 4B2OA 1HPUA 2XMOA 2DFJA 2NYLC 5J28A 1AUIA 1UF3A 4UT3B 4ZVZA 5F3WA 2USHA 3P71C 3THOB 2QJCA 4YKEA 3E7BA 4TUGA 3H60A 5DNYA 1II7A 1OIEA 1U32A 4DT2A 3AV0A 2O8GA 1IT6A 2Z06A 3FLOA 5C1VA 4MOYA 3TGHA 2WDDA 1W24A 3K7VC 3H61A 1OIDA 1Z2XA 3N5UA 4O5GA 4ORBA 3RQZA 1FJMA 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DW8 C;  2IE4 C;  2HY1 A;  2WDC A;  1MF8 A;  3IVD A;  2QFP A;  3H67 A;  3ZTV A;  3H64 A;  1USH A;  4KBP A;  3E7A A;  3PSN A;  1S3N A;  4O24 A;  1WAR A;  2NPP C;  2A22 A;  4MP0 A;  4JA9 A;  4M0V A;  5GTU A;  3GVE A;  2BQ8 X;  2Z72 A;  4UWQ A;  4H2G A;  4TUI A;  3RL4 A;  4XPN A;  4WWL A;  2JOG A;  4LAC C;  3QG5 C;  4Q7F A;  4I5N C;  4ORC A;  1XM7 A;  4DHL A;  2P6B A;  1NNW A;  2NXF A;  1UTE A;  4OR9 A;  4H2B A;  3THN A;  2IE3 C;  1QFC A;  4H2I A;  5IOH A;  4MOV A;  1T70 A;  3CK2 A;  3T1I A;  1V73 A;  4H1Y P;  2ZBM A;  4FBW A;  5JPE A;  1JK7 A;  1G5B A;  1S8E A;  1Z2W A;  2HYP A;  4V0W A;  3IVE A;  4DSY A;  4O43 A;  2IAE C;  3IB8 A;  2NYM C;  4UT2 A;  3FGA C;  2WDF A;  3ZU0 A;  4I5L C;  1XZW A;  3RL5 A;  4V0X A;  3EGH A;  4O4K A;  4ORA A;  3H62 B;  4FBK A;  1HO5 A;  4JA7 A;  3DSC A;  1S70 A;  4HD0 A;  2R17 A;  3QFN A;  4G9J A;  5HPE A;  3QFO A;  4FCX A;  1S3L A;  5EQV A;  3C5W C;  1WAO 1;  2WDE A;  3H68 A;  3LL8 A;  2QFR A;  4NZV A;  1T71 A;  1OI8 A;  2YVT A;  3C9F A;  3QFM A;  4UT3 A;  3H63 A;  2HYO A;  5INB A;  5JPF A;  3JYF A;  5JJT A;  3ICF A;  4IYP C;  1S95 A;  3PSO A;  3V4Y A;  1M63 A;  2AHD A;  3H66 A;  2BDX A;  2KKN A;  3DSD A;  2BCD A;  2CV9 A;  1SU1 A;  4LU9 A;  2Q8U A;  3KBP A;  4LTY A;  4IL1 A;  3RL3 A;  4ZX2 A;  3EGG A;  4FBQ A;  2Z1A A;  1TCO A;  2O8A A;  3QFK A;  4KKZ A;  2GJU A;  3HVQ A;  4J6O A;  5B8I A;  1HP1 A;  3K7W C;  1S3M A;  4F0Z A;  4H1S A;  1KBP A;  1QHW A;  3IB7 A;  3AUZ A;  4V0V A;  3H69 A;  4H2F A;  4B2O A;  1HPU A;  2XMO A;  2DFJ A;  2NYL C;  5F3W A;  1AUI A;  1UF3 A;  4UT3 B;  4ZVZ A;  2USH A;  3P71 C;  3THO B;  2QJC A;  4YKE A;  3E7B A;  4TUG A;  3H60 A;  5DNY A;  1II7 A;  1OIE A;  1U32 A;  4DT2 A;  3AV0 A;  2O8G A;  1IT6 A;  2Z06 A;  5C1V A;  3TGH A;  4MOY A;  2WDD A;  1W24 A;  3K7V C;  3H61 A;  1OID A;  1Z2X A;  3N5U A;  4O5G A;  4ORB A;  3RQZ A;  1FJM A;  5J28 A; 
#chains in the Genus database with same CATH topology
 3DW8 C;  2IE4 C;  2HY1 A;  2WDC A;  1MF8 A;  3IVD A;  2QFP A;  3H67 A;  3ZTV A;  3H64 A;  1USH A;  4KBP A;  3E7A A;  3PSN A;  2DXL A;  1S3N A;  4O24 A;  1WAR A;  2NPP C;  2A22 A;  4MP0 A;  4JA9 A;  4M0V A;  5GTU A;  3GVE A;  2BQ8 X;  2Z72 A;  4UWQ A;  4H2G A;  4TUI A;  3RL4 A;  4XPN A;  4WWL A;  2JOG A;  4LAC C;  3QG5 C;  4Q7F A;  4I5N C;  4ORC A;  1XM7 A;  4DHL A;  2P6B A;  1NNW A;  2NXF A;  1UTE A;  4OR9 A;  4H2B A;  3THN A;  2IE3 C;  1QFC A;  4H2I A;  5IOH A;  4MOV A;  1T70 A;  3CK2 A;  2ZO9 B;  3T1I A;  1V73 A;  4H1Y P;  2ZBM A;  4FBW A;  5JPE A;  1JK7 A;  1G5B A;  1S8E A;  3D03 A;  1Z2W A;  2HYP A;  4V0W A;  3IVE A;  4DSY A;  4O43 A;  2IAE C;  3IB8 A;  2NYM C;  4UT2 A;  3FGA C;  2WDF A;  3ZU0 A;  4I5L C;  1XZW A;  3RL5 A;  4V0X A;  3EGH A;  4O4K A;  4ORA A;  3H62 B;  4FBK A;  1HO5 A;  4JA7 A;  3DSC A;  1S70 A;  4HD0 A;  2R17 A;  3QFN A;  4G9J A;  5HPE A;  3QFO A;  4FCX A;  1S3L A;  5EQV A;  3C5W C;  1WAO 1;  2WDE A;  3H68 A;  3LL8 A;  2QFR A;  2YEQ A;  4NZV A;  1T71 A;  1OI8 A;  2YVT A;  3C9F A;  3QFM A;  4UT3 A;  3H63 A;  2HYO A;  5INB A;  5JPF A;  3JYF A;  5JJT A;  3ICF A;  4IYP C;  1S95 A;  3PSO A;  3V4Y A;  1M63 A;  2AHD A;  3H66 A;  2BDX A;  2KKN A;  3DSD A;  2BCD A;  2CV9 A;  1SU1 A;  4LU9 A;  2Q8U A;  3KBP A;  4LTY A;  4IL1 A;  3RL3 A;  4ZX2 A;  3EGG A;  4FBQ A;  2DXN A;  2Z1A A;  1TCO A;  2O8A A;  3QFK A;  4KKZ A;  2GJU A;  3HVQ A;  4J6O A;  5B8I A;  1HP1 A;  3K7W C;  1S3M A;  4F0Z A;  4H1S A;  2ZOA A;  1KBP A;  1QHW A;  3IB7 A;  3AUZ A;  4V0V A;  3H69 A;  4H2F A;  4B2O A;  1HPU A;  2XMO A;  2DFJ A;  2NYL C;  5J28 A;  1AUI A;  1UF3 A;  4UT3 B;  4ZVZ A;  5F3W A;  2USH A;  3P71 C;  3THO B;  2QJC A;  4YKE A;  3E7B A;  4TUG A;  3H60 A;  5DNY A;  1II7 A;  1OIE A;  1U32 A;  4DT2 A;  3AV0 A;  2O8G A;  1IT6 A;  2Z06 A;  3FLO A;  5C1V A;  4MOY A;  3TGH A;  2WDD A;  1W24 A;  3K7V C;  3H61 A;  1OID A;  1Z2X A;  3N5U A;  4O5G A;  4ORB A;  3RQZ A;  1FJM A;  3E0J A; 
#chains in the Genus database with same CATH homology
 3DW8 C;  2IE4 C;  2HY1 A;  2WDC A;  1MF8 A;  3IVD A;  2QFP A;  3H67 A;  3ZTV A;  3H64 A;  1USH A;  4KBP A;  3E7A A;  3PSN A;  2DXL A;  1S3N A;  4O24 A;  1WAR A;  2NPP C;  2A22 A;  4MP0 A;  4JA9 A;  4M0V A;  5GTU A;  3GVE A;  2BQ8 X;  2Z72 A;  4UWQ A;  4H2G A;  4TUI A;  3RL4 A;  4XPN A;  4WWL A;  2JOG A;  4LAC C;  3QG5 C;  4Q7F A;  4I5N C;  4ORC A;  1XM7 A;  4DHL A;  2P6B A;  1NNW A;  2NXF A;  1UTE A;  4OR9 A;  4H2B A;  3THN A;  2IE3 C;  1QFC A;  4H2I A;  5IOH A;  4MOV A;  1T70 A;  3CK2 A;  2ZO9 B;  3T1I A;  1V73 A;  4H1Y P;  2ZBM A;  4FBW A;  5JPE A;  1JK7 A;  1G5B A;  1S8E A;  3D03 A;  1Z2W A;  2HYP A;  4V0W A;  3IVE A;  4DSY A;  4O43 A;  2IAE C;  3IB8 A;  2NYM C;  4UT2 A;  3FGA C;  2WDF A;  3ZU0 A;  4I5L C;  1XZW A;  3RL5 A;  4V0X A;  3EGH A;  4O4K A;  4ORA A;  3H62 B;  4FBK A;  1HO5 A;  4JA7 A;  3DSC A;  1S70 A;  4HD0 A;  2R17 A;  3QFN A;  4G9J A;  5HPE A;  3QFO A;  4FCX A;  1S3L A;  5EQV A;  3C5W C;  1WAO 1;  2WDE A;  3H68 A;  3LL8 A;  2QFR A;  2YEQ A;  4NZV A;  1T71 A;  1OI8 A;  2YVT A;  3C9F A;  3QFM A;  4UT3 A;  3H63 A;  2HYO A;  5INB A;  5JPF A;  3JYF A;  5JJT A;  3ICF A;  4IYP C;  1S95 A;  3PSO A;  3V4Y A;  1M63 A;  2AHD A;  3H66 A;  2BDX A;  2KKN A;  3DSD A;  2BCD A;  2CV9 A;  1SU1 A;  4LU9 A;  2Q8U A;  3KBP A;  4LTY A;  4IL1 A;  3RL3 A;  4ZX2 A;  3EGG A;  4FBQ A;  2DXN A;  2Z1A A;  1TCO A;  2O8A A;  3QFK A;  4KKZ A;  2GJU A;  3HVQ A;  4J6O A;  5B8I A;  1HP1 A;  3K7W C;  1S3M A;  4F0Z A;  4H1S A;  2ZOA A;  1KBP A;  1QHW A;  3IB7 A;  3AUZ A;  4V0V A;  3H69 A;  4H2F A;  4B2O A;  1HPU A;  2XMO A;  2DFJ A;  2NYL C;  5J28 A;  1AUI A;  1UF3 A;  4UT3 B;  4ZVZ A;  5F3W A;  2USH A;  3P71 C;  3THO B;  2QJC A;  4YKE A;  3E7B A;  4TUG A;  3H60 A;  5DNY A;  1II7 A;  1OIE A;  1U32 A;  4DT2 A;  3AV0 A;  2O8G A;  1IT6 A;  2Z06 A;  3FLO A;  5C1V A;  4MOY A;  3TGH A;  2WDD A;  1W24 A;  3K7V C;  3H61 A;  1OID A;  1Z2X A;  3N5U A;  4O5G A;  4ORB A;  3RQZ A;  1FJM A;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...