3H64A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c) with two mn2+ atoms complexed with endothall
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
309
structure length
309
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 309
sequence length 309
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h64A00
2XMOA 4UT3A 1U32A 3H61A 3H69A 5GTUA 3DW8C 5INBA 4I5LC 4H2IA 1MF8A 3H60A 4MP0A 4MOYA 4DHLA 1TCOA 4OR9A 3N5UA 1WARA 4IYPC 4WWLA 3K7WC 1S3NA 3T1IA 4UT3B 2BQ8X 2NYLC 3H63A 4NZVA 2USHA 2R17A 4ORAA 5C1VA 1SU1A 3HVQA 1T70A 2QFRA 2O8GA 2Z06A 4I5NC 1S3MA 4V0VA 4IL1A 2HYOA 3PSOA 3ZTVA 3EGHA 5JJTA 1KBPA 3H64A 4ORBA 1Z2WA 1S70A 5HPEA 3E7BA 3V4YA 3RQZA 3LL8A 2NXFA 4B2OA 4H2BA 1IT6A 2GJUA 3H68A 3RL4A 1UTEA 1QFCA 3AV0A 4TUGA 4V0WA 4JA9A 4FBWA 2Z72A 1USHA 3E7AA 3P71C 4UWQA 4YKEA 4H2FA 3C5WC 1S8EA 2CV9A 4G9JA 1HP1A 3PSNA 4FBQA 2ZBMA 4UT2A 1HPUA 4LACC 3C9FA 4JA7A 4MOVA 3FGAC 3JYFA 4XPNA 3DSCA 4LU9A 2HY1A 4O5GA 1T71A 1XM7A 4H1YP 3ICFA 2DFJA 3QFOA 5B8IA 1S95A 2WDCA 4O24A 2WDDA 3THOB 4O4KA 5JPFA 2BDXA 4KBPA 3THNA 3QFMA 3IB8A 5EQVA 2P6BA 3AUZA 2NYMC 2O8AA 4J6OA 5DNYA 2IE3C 2KKNA 1HO5A 4FCXA 3IVDA 2BCDA 5F3WA 3H62B 4F0ZA 1AUIA 2YVTA 1XZWA 4DT2A 2IE4C 5J28A 3EGGA 3IVEA 2NPPC 4H2GA 1V73A 2JOGA 4ZVZA 1OIDA 1FJMA 5JPEA 2A22A 4DSYA 1UF3A 3QG5C 3QFKA 1NNWA 4O43A 3KBPA 1M63A 3H67A 4ORCA 2Z1AA 1II7A 3GVEA 3TGHA 3K7VC 3ZU0A 5IOHA 2QFPA 4TUIA 1OI8A 4FBKA 2WDEA 4HD0A 1W24A 3RL3A 3H66A 4H1SA 2AHDA 2QJCA 3DSDA 1OIEA 4M0VA 3IB7A 3RL5A 1JK7A 1Z2XA 4Q7FA 1QHWA 1WAO1 2Q8UA 2WDFA 4LTYA 2HYPA 3CK2A 2IAEC 4ZX2A 1G5BA 4V0XA 4KKZA 1S3LA 3QFNA
chains in the Genus database with same CATH superfamily
2XMOA 4UT3A 1U32A 3H61A 3H69A 5GTUA 3DW8C 5INBA 4I5LC 4H2IA 1MF8A 3H60A 4MP0A 4MOYA 3E0JA 4DHLA 1TCOA 4OR9A 2YEQA 1WARA 3N5UA 4IYPC 4WWLA 3K7WC 1S3NA 3T1IA 4UT3B 2BQ8X 2NYLC 3H63A 4NZVA 2USHA 2R17A 4ORAA 5C1VA 1SU1A 3HVQA 1T70A 2QFRA 2DXLA 2O8GA 2Z06A 4I5NC 1S3MA 4V0VA 4IL1A 2HYOA 3PSOA 3ZTVA 3EGHA 5JJTA 1KBPA 3H64A 4ORBA 1Z2WA 1S70A 2ZO9B 5HPEA 3E7BA 3V4YA 3RQZA 3LL8A 2NXFA 4B2OA 4H2BA 1IT6A 2GJUA 3H68A 3RL4A 1UTEA 1QFCA 3AV0A 4TUGA 4V0WA 4JA9A 4FBWA 2Z72A 1USHA 3E7AA 3P71C 4UWQA 4YKEA 4H2FA 3C5WC 1S8EA 2CV9A 4G9JA 1HP1A 3PSNA 4FBQA 2ZBMA 4UT2A 1HPUA 4LACC 3C9FA 4JA7A 4MOVA 3FGAC 3D03A 3JYFA 4XPNA 3DSCA 4LU9A 2HY1A 4O5GA 1T71A 1XM7A 4H1YP 3ICFA 2DFJA 3FLOA 3QFOA 5B8IA 1S95A 2WDCA 4O24A 2WDDA 3THOB 4O4KA 5JPFA 2BDXA 4KBPA 3THNA 3QFMA 3IB8A 2DXNA 2P6BA 5EQVA 3AUZA 2NYMC 2O8AA 4J6OA 5DNYA 2IE3C 2KKNA 1HO5A 4FCXA 3IVDA 2BCDA 5F3WA 3H62B 4F0ZA 1AUIA 2YVTA 1XZWA 4DT2A 2IE4C 5J28A 3EGGA 3IVEA 2NPPC 4H2GA 1V73A 2JOGA 4ZVZA 1OIDA 1FJMA 5JPEA 2A22A 2ZOAA 1UF3A 3QG5C 3QFKA 1NNWA 4O43A 3KBPA 4DSYA 1M63A 3H67A 4ORCA 2Z1AA 1II7A 3GVEA 3TGHA 3K7VC 3ZU0A 5IOHA 2QFPA 4TUIA 1OI8A 4FBKA 2WDEA 4HD0A 1W24A 3RL3A 3H66A 4H1SA 2AHDA 2QJCA 3DSDA 1OIEA 4M0VA 3IB7A 3RL5A 1JK7A 1Z2XA 4Q7FA 1QHWA 1WAO1 2Q8UA 2WDFA 4LTYA 2HYPA 3CK2A 2IAEC 4ZX2A 1G5BA 4V0XA 4KKZA 1S3LA 3QFNA
chains in the Genus database with same CATH topology
2XMOA 4UT3A 1U32A 3H61A 3H69A 5GTUA 3DW8C 5INBA 4I5LC 4H2IA 1MF8A 3H60A 4MP0A 4MOYA 3E0JA 4DHLA 1TCOA 4OR9A 2YEQA 1WARA 3N5UA 4IYPC 4WWLA 3K7WC 1S3NA 3T1IA 4UT3B 2BQ8X 2NYLC 3H63A 4NZVA 2USHA 2R17A 4ORAA 5C1VA 1SU1A 3HVQA 1T70A 2QFRA 2DXLA 2O8GA 2Z06A 4I5NC 1S3MA 4V0VA 4IL1A 2HYOA 3PSOA 3ZTVA 3EGHA 5JJTA 1KBPA 3H64A 4ORBA 1Z2WA 1S70A 2ZO9B 5HPEA 3E7BA 3V4YA 3RQZA 3LL8A 2NXFA 4B2OA 4H2BA 1IT6A 2GJUA 3H68A 3RL4A 1UTEA 1QFCA 3AV0A 4TUGA 4V0WA 4JA9A 4FBWA 2Z72A 1USHA 3E7AA 3P71C 4UWQA 4YKEA 4H2FA 3C5WC 1S8EA 2CV9A 4G9JA 1HP1A 3PSNA 4FBQA 2ZBMA 4UT2A 1HPUA 4LACC 3C9FA 4JA7A 4MOVA 3FGAC 3D03A 3JYFA 4XPNA 3DSCA 4LU9A 2HY1A 4O5GA 1T71A 1XM7A 4H1YP 3ICFA 2DFJA 3FLOA 3QFOA 5B8IA 1S95A 2WDCA 4O24A 2WDDA 3THOB 4O4KA 5JPFA 2BDXA 4KBPA 3THNA 3QFMA 3IB8A 2DXNA 2P6BA 5EQVA 3AUZA 2NYMC 2O8AA 4J6OA 5DNYA 2IE3C 2KKNA 1HO5A 4FCXA 3IVDA 2BCDA 5F3WA 3H62B 4F0ZA 1AUIA 2YVTA 1XZWA 4DT2A 2IE4C 5J28A 3EGGA 3IVEA 2NPPC 4H2GA 1V73A 2JOGA 4ZVZA 1OIDA 1FJMA 5JPEA 2A22A 2ZOAA 1UF3A 3QG5C 3QFKA 1NNWA 4O43A 3KBPA 4DSYA 1M63A 3H67A 4ORCA 2Z1AA 1II7A 3GVEA 3TGHA 3K7VC 3ZU0A 5IOHA 2QFPA 4TUIA 1OI8A 4FBKA 2WDEA 4HD0A 1W24A 3RL3A 3H66A 4H1SA 2AHDA 2QJCA 3DSDA 1OIEA 4M0VA 3IB7A 3RL5A 1JK7A 1Z2XA 4Q7FA 1QHWA 1WAO1 2Q8UA 2WDFA 4LTYA 2HYPA 3CK2A 2IAEC 4ZX2A 1G5BA 4V0XA 4KKZA 1S3LA 3QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMO A;  4UT3 A;  1U32 A;  3H61 A;  3H69 A;  5GTU A;  3DW8 C;  5INB A;  4I5L C;  4H2I A;  1MF8 A;  3H60 A;  4MP0 A;  4MOY A;  4DHL A;  1TCO A;  4OR9 A;  3N5U A;  1WAR A;  4IYP C;  4WWL A;  3K7W C;  1S3N A;  3T1I A;  4UT3 B;  2BQ8 X;  2NYL C;  3H63 A;  4NZV A;  2USH A;  2R17 A;  4ORA A;  5C1V A;  1SU1 A;  3HVQ A;  1T70 A;  2QFR A;  2O8G A;  2Z06 A;  4I5N C;  1S3M A;  4V0V A;  4IL1 A;  2HYO A;  3PSO A;  3ZTV A;  3EGH A;  5JJT A;  1KBP A;  3H64 A;  4ORB A;  1Z2W A;  1S70 A;  5HPE A;  3E7B A;  3V4Y A;  3RQZ A;  3LL8 A;  2NXF A;  4B2O A;  4H2B A;  1IT6 A;  2GJU A;  3H68 A;  3RL4 A;  1UTE A;  1QFC A;  3AV0 A;  4TUG A;  4V0W A;  4JA9 A;  4FBW A;  2Z72 A;  1USH A;  3E7A A;  3P71 C;  4UWQ A;  4YKE A;  4H2F A;  3C5W C;  1S8E A;  2CV9 A;  4G9J A;  1HP1 A;  3PSN A;  4FBQ A;  2ZBM A;  4UT2 A;  1HPU A;  4LAC C;  3C9F A;  4JA7 A;  4MOV A;  3FGA C;  3JYF A;  4XPN A;  3DSC A;  4LU9 A;  2HY1 A;  4O5G A;  1T71 A;  1XM7 A;  4H1Y P;  3ICF A;  2DFJ A;  3QFO A;  5B8I A;  1S95 A;  2WDC A;  4O24 A;  2WDD A;  3THO B;  4O4K A;  5JPF A;  2BDX A;  4KBP A;  3THN A;  3QFM A;  3IB8 A;  5EQV A;  2P6B A;  3AUZ A;  2NYM C;  2O8A A;  4J6O A;  5DNY A;  2IE3 C;  2KKN A;  1HO5 A;  4FCX A;  3IVD A;  2BCD A;  5F3W A;  3H62 B;  4F0Z A;  1AUI A;  2YVT A;  1XZW A;  4DT2 A;  2IE4 C;  5J28 A;  3EGG A;  3IVE A;  2NPP C;  4H2G A;  1V73 A;  2JOG A;  4ZVZ A;  1OID A;  1FJM A;  5JPE A;  2A22 A;  4DSY A;  1UF3 A;  3QG5 C;  3QFK A;  1NNW A;  4O43 A;  3KBP A;  1M63 A;  3H67 A;  4ORC A;  2Z1A A;  1II7 A;  3GVE A;  3TGH A;  3K7V C;  3ZU0 A;  5IOH A;  2QFP A;  4TUI A;  1OI8 A;  4FBK A;  2WDE A;  4HD0 A;  1W24 A;  3RL3 A;  3H66 A;  4H1S A;  2AHD A;  2QJC A;  3DSD A;  1OIE A;  4M0V A;  3IB7 A;  3RL5 A;  1JK7 A;  1Z2X A;  4Q7F A;  1QHW A;  1WAO 1;  2Q8U A;  2WDF A;  4LTY A;  2HYP A;  3CK2 A;  2IAE C;  4ZX2 A;  1G5B A;  4V0X A;  4KKZ A;  1S3L A;  3QFN A; 
#chains in the Genus database with same CATH topology
 2XMO A;  4UT3 A;  1U32 A;  3H61 A;  3H69 A;  5GTU A;  3DW8 C;  5INB A;  4I5L C;  4H2I A;  1MF8 A;  3H60 A;  4MP0 A;  4MOY A;  3E0J A;  4DHL A;  1TCO A;  4OR9 A;  2YEQ A;  1WAR A;  3N5U A;  4IYP C;  4WWL A;  3K7W C;  1S3N A;  3T1I A;  4UT3 B;  2BQ8 X;  2NYL C;  3H63 A;  4NZV A;  2USH A;  2R17 A;  4ORA A;  5C1V A;  1SU1 A;  3HVQ A;  1T70 A;  2QFR A;  2DXL A;  2O8G A;  2Z06 A;  4I5N C;  1S3M A;  4V0V A;  4IL1 A;  2HYO A;  3PSO A;  3ZTV A;  3EGH A;  5JJT A;  1KBP A;  3H64 A;  4ORB A;  1Z2W A;  1S70 A;  2ZO9 B;  5HPE A;  3E7B A;  3V4Y A;  3RQZ A;  3LL8 A;  2NXF A;  4B2O A;  4H2B A;  1IT6 A;  2GJU A;  3H68 A;  3RL4 A;  1UTE A;  1QFC A;  3AV0 A;  4TUG A;  4V0W A;  4JA9 A;  4FBW A;  2Z72 A;  1USH A;  3E7A A;  3P71 C;  4UWQ A;  4YKE A;  4H2F A;  3C5W C;  1S8E A;  2CV9 A;  4G9J A;  1HP1 A;  3PSN A;  4FBQ A;  2ZBM A;  4UT2 A;  1HPU A;  4LAC C;  3C9F A;  4JA7 A;  4MOV A;  3FGA C;  3D03 A;  3JYF A;  4XPN A;  3DSC A;  4LU9 A;  2HY1 A;  4O5G A;  1T71 A;  1XM7 A;  4H1Y P;  3ICF A;  2DFJ A;  3FLO A;  3QFO A;  5B8I A;  1S95 A;  2WDC A;  4O24 A;  2WDD A;  3THO B;  4O4K A;  5JPF A;  2BDX A;  4KBP A;  3THN A;  3QFM A;  3IB8 A;  2DXN A;  2P6B A;  5EQV A;  3AUZ A;  2NYM C;  2O8A A;  4J6O A;  5DNY A;  2IE3 C;  2KKN A;  1HO5 A;  4FCX A;  3IVD A;  2BCD A;  5F3W A;  3H62 B;  4F0Z A;  1AUI A;  2YVT A;  1XZW A;  4DT2 A;  2IE4 C;  5J28 A;  3EGG A;  3IVE A;  2NPP C;  4H2G A;  1V73 A;  2JOG A;  4ZVZ A;  1OID A;  1FJM A;  5JPE A;  2A22 A;  2ZOA A;  1UF3 A;  3QG5 C;  3QFK A;  1NNW A;  4O43 A;  3KBP A;  4DSY A;  1M63 A;  3H67 A;  4ORC A;  2Z1A A;  1II7 A;  3GVE A;  3TGH A;  3K7V C;  3ZU0 A;  5IOH A;  2QFP A;  4TUI A;  1OI8 A;  4FBK A;  2WDE A;  4HD0 A;  1W24 A;  3RL3 A;  3H66 A;  4H1S A;  2AHD A;  2QJC A;  3DSD A;  1OIE A;  4M0V A;  3IB7 A;  3RL5 A;  1JK7 A;  1Z2X A;  4Q7F A;  1QHW A;  1WAO 1;  2Q8U A;  2WDF A;  4LTY A;  2HYP A;  3CK2 A;  2IAE C;  4ZX2 A;  1G5B A;  4V0X A;  4KKZ A;  1S3L A;  3QFN A; 
#chains in the Genus database with same CATH homology
 2XMO A;  4UT3 A;  1U32 A;  3H61 A;  3H69 A;  5GTU A;  3DW8 C;  5INB A;  4I5L C;  4H2I A;  1MF8 A;  3H60 A;  4MP0 A;  4MOY A;  3E0J A;  4DHL A;  1TCO A;  4OR9 A;  2YEQ A;  1WAR A;  3N5U A;  4IYP C;  4WWL A;  3K7W C;  1S3N A;  3T1I A;  4UT3 B;  2BQ8 X;  2NYL C;  3H63 A;  4NZV A;  2USH A;  2R17 A;  4ORA A;  5C1V A;  1SU1 A;  3HVQ A;  1T70 A;  2QFR A;  2DXL A;  2O8G A;  2Z06 A;  4I5N C;  1S3M A;  4V0V A;  4IL1 A;  2HYO A;  3PSO A;  3ZTV A;  3EGH A;  5JJT A;  1KBP A;  3H64 A;  4ORB A;  1Z2W A;  1S70 A;  2ZO9 B;  5HPE A;  3E7B A;  3V4Y A;  3RQZ A;  3LL8 A;  2NXF A;  4B2O A;  4H2B A;  1IT6 A;  2GJU A;  3H68 A;  3RL4 A;  1UTE A;  1QFC A;  3AV0 A;  4TUG A;  4V0W A;  4JA9 A;  4FBW A;  2Z72 A;  1USH A;  3E7A A;  3P71 C;  4UWQ A;  4YKE A;  4H2F A;  3C5W C;  1S8E A;  2CV9 A;  4G9J A;  1HP1 A;  3PSN A;  4FBQ A;  2ZBM A;  4UT2 A;  1HPU A;  4LAC C;  3C9F A;  4JA7 A;  4MOV A;  3FGA C;  3D03 A;  3JYF A;  4XPN A;  3DSC A;  4LU9 A;  2HY1 A;  4O5G A;  1T71 A;  1XM7 A;  4H1Y P;  3ICF A;  2DFJ A;  3FLO A;  3QFO A;  5B8I A;  1S95 A;  2WDC A;  4O24 A;  2WDD A;  3THO B;  4O4K A;  5JPF A;  2BDX A;  4KBP A;  3THN A;  3QFM A;  3IB8 A;  2DXN A;  2P6B A;  5EQV A;  3AUZ A;  2NYM C;  2O8A A;  4J6O A;  5DNY A;  2IE3 C;  2KKN A;  1HO5 A;  4FCX A;  3IVD A;  2BCD A;  5F3W A;  3H62 B;  4F0Z A;  1AUI A;  2YVT A;  1XZW A;  4DT2 A;  2IE4 C;  5J28 A;  3EGG A;  3IVE A;  2NPP C;  4H2G A;  1V73 A;  2JOG A;  4ZVZ A;  1OID A;  1FJM A;  5JPE A;  2A22 A;  2ZOA A;  1UF3 A;  3QG5 C;  3QFK A;  1NNW A;  4O43 A;  3KBP A;  4DSY A;  1M63 A;  3H67 A;  4ORC A;  2Z1A A;  1II7 A;  3GVE A;  3TGH A;  3K7V C;  3ZU0 A;  5IOH A;  2QFP A;  4TUI A;  1OI8 A;  4FBK A;  2WDE A;  4HD0 A;  1W24 A;  3RL3 A;  3H66 A;  4H1S A;  2AHD A;  2QJC A;  3DSD A;  1OIE A;  4M0V A;  3IB7 A;  3RL5 A;  1JK7 A;  1Z2X A;  4Q7F A;  1QHW A;  1WAO 1;  2Q8U A;  2WDF A;  4LTY A;  2HYP A;  3CK2 A;  2IAE C;  4ZX2 A;  1G5B A;  4V0X A;  4KKZ A;  1S3L A;  3QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...