3H64A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c) with two mn2+ atoms complexed with endothall
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
309
structure length
309
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 5
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 108
structure length 309
sequence length 309
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h64A00
2P6BA 4ZX2A 4UWQA 3IVEA 4JA7A 4ORAA 2Z06A 4ORBA 1HPUA 4FBKA 4JA9A 3PSNA 5JJTA 4UT2A 5IOHA 1USHA 3FGAC 3THOB 1G5BA 3QFKA 1W24A 2NYMC 3H63A 4NZVA 3DSCA 2BDXA 1MF8A 2NPPC 4O43A 3QFOA 3H64A 3ICFA 4XPNA 3K7WC 2A22A 2DFJA 2IAEC 4H2IA 1S8EA 1AUIA 3THNA 1U32A 3CK2A 3H61A 5J28A 1QHWA 3H60A 4G9JA 2AHDA 2YVTA 3N5UA 4M0VA 1XZWA 2HY1A 5JPFA 4UT3B 2QJCA 4H2BA 1OIEA 4WWLA 2Z1AA 4FBWA 4H1YP 2KKNA 3H69A 5INBA 4DSYA 3IB7A 2JOGA 3KBPA 2XMOA 4KBPA 3H62B 3DSDA 5EQVA 3AV0A 4TUIA 5HPEA 3ZU0A 2NYLC 3RL5A 1JK7A 1II7A 2WDCA 1WAO1 4O5GA 5JPEA 3K7VC 4FCXA 4UT3A 4H2GA 4MOVA 3ZTVA 4J6OA 1IT6A 3RL4A 1HO5A 1UF3A 4H2FA 1SU1A 3LL8A 1S70A 4H1SA 2WDDA 5GTUA 2WDEA 2O8AA 2WDFA 1WARA 5C1VA 1KBPA 4I5LC 1HP1A 3JYFA 2ZBMA 3EGGA 3H67A 1UTEA 4ZVZA 2CV9A 3C5WC 3IB8A 4LACC 2QFRA 3C9FA 2QFPA 2NXFA 4YKEA 3T1IA 1TCOA 4MOYA 4V0WA 4LU9A 4V0XA 1FJMA 3DW8C 4DT2A 4HD0A 4KKZA 2BCDA 3AUZA 2R17A 3GVEA 1S95A 3PSOA 4OR9A 5B8IA 1S3LA 2Z72A 3H66A 4B2OA 1Z2XA 4F0ZA 4I5NC 1T71A 3IVDA 4DHLA 4LTYA 1OI8A 4FBQA 1OIDA 1Z2WA 1T70A 1NNWA 2IE3C 4IYPC 1QFCA 3H68A 3V4YA 4Q7FA 3P71C 2HYOA 3HVQA 5F3WA 4ORCA 4TUGA 2BQ8X 2IE4C 3E7AA 3QG5C 1XM7A 4V0VA 3RL3A 3QFNA 1V73A 4MP0A 4O24A 3TGHA 1M63A 1S3MA 3E7BA 2USHA 3RQZA 4O4KA 2O8GA 4IL1A 3EGHA 3QFMA 5DNYA 2GJUA 2Q8UA 1S3NA 2HYPA
chains in the Genus database with same CATH superfamily
2P6BA 4ZX2A 4UWQA 2ZO9B 3IVEA 4JA7A 2Z06A 4ORAA 4ORBA 1HPUA 4FBKA 4JA9A 3PSNA 5JJTA 4UT2A 5IOHA 1USHA 3FGAC 3THOB 1G5BA 3QFKA 1W24A 2NYMC 3H63A 4NZVA 3DSCA 3D03A 2BDXA 1MF8A 2NPPC 4O43A 3QFOA 3H64A 3ICFA 4XPNA 3K7WC 2A22A 2DFJA 2IAEC 4H2IA 1S8EA 1AUIA 3THNA 1U32A 3CK2A 3H61A 5J28A 1QHWA 3H60A 4G9JA 2AHDA 2YVTA 3N5UA 4M0VA 1XZWA 2HY1A 5JPFA 4UT3B 2QJCA 4H2BA 1OIEA 4WWLA 2Z1AA 4FBWA 4H1YP 2KKNA 3H69A 5INBA 4DSYA 3IB7A 2JOGA 3KBPA 2XMOA 4KBPA 3FLOA 2YEQA 3H62B 3DSDA 5EQVA 3AV0A 4TUIA 5HPEA 3ZU0A 2NYLC 3RL5A 1JK7A 1II7A 2WDCA 1WAO1 4O5GA 5JPEA 3K7VC 4FCXA 4UT3A 4H2GA 4MOVA 3ZTVA 4J6OA 1IT6A 3RL4A 1HO5A 1UF3A 4H2FA 1SU1A 3LL8A 1S70A 4H1SA 2WDDA 5GTUA 2WDEA 2O8AA 2WDFA 1WARA 5C1VA 1KBPA 2DXNA 4I5LC 1HP1A 3JYFA 2ZBMA 3EGGA 3H67A 1UTEA 4ZVZA 2CV9A 3C5WC 2DXLA 3IB8A 4LACC 2QFRA 3C9FA 2QFPA 2NXFA 4YKEA 3T1IA 1TCOA 4MOYA 4V0WA 4LU9A 4V0XA 1FJMA 3DW8C 4DT2A 4HD0A 4KKZA 2BCDA 3AUZA 2R17A 3GVEA 1S95A 3PSOA 4OR9A 5B8IA 1S3LA 2Z72A 3H66A 4B2OA 1Z2XA 4F0ZA 4I5NC 3E0JA 1T71A 3IVDA 4DHLA 4LTYA 1OI8A 4FBQA 1OIDA 1Z2WA 1T70A 1NNWA 2IE3C 4IYPC 1QFCA 3H68A 3V4YA 4Q7FA 3P71C 2HYOA 3HVQA 5F3WA 4ORCA 4TUGA 2BQ8X 2IE4C 3E7AA 3QG5C 1XM7A 4V0VA 2ZOAA 3RL3A 3QFNA 1V73A 4MP0A 4O24A 3TGHA 1M63A 1S3MA 3E7BA 2USHA 3RQZA 4O4KA 2O8GA 4IL1A 3EGHA 3QFMA 5DNYA 2GJUA 2Q8UA 1S3NA 2HYPA
chains in the Genus database with same CATH topology
2P6BA 4ZX2A 4UWQA 2ZO9B 3IVEA 4JA7A 2Z06A 4ORAA 4ORBA 1HPUA 4FBKA 4JA9A 3PSNA 5JJTA 4UT2A 5IOHA 1USHA 3FGAC 3THOB 1G5BA 3QFKA 1W24A 2NYMC 3H63A 4NZVA 3DSCA 3D03A 2BDXA 1MF8A 2NPPC 4O43A 3QFOA 3H64A 3ICFA 4XPNA 3K7WC 2A22A 2DFJA 2IAEC 4H2IA 1S8EA 1AUIA 3THNA 1U32A 3CK2A 3H61A 5J28A 1QHWA 3H60A 4G9JA 2AHDA 2YVTA 3N5UA 4M0VA 1XZWA 2HY1A 5JPFA 4UT3B 2QJCA 4H2BA 1OIEA 4WWLA 2Z1AA 4FBWA 4H1YP 2KKNA 3H69A 5INBA 4DSYA 3IB7A 2JOGA 3KBPA 2XMOA 4KBPA 3FLOA 2YEQA 3H62B 3DSDA 5EQVA 3AV0A 4TUIA 5HPEA 3ZU0A 2NYLC 3RL5A 1JK7A 1II7A 2WDCA 1WAO1 4O5GA 5JPEA 3K7VC 4FCXA 4UT3A 4H2GA 4MOVA 3ZTVA 4J6OA 1IT6A 3RL4A 1HO5A 1UF3A 4H2FA 1SU1A 3LL8A 1S70A 4H1SA 2WDDA 5GTUA 2WDEA 2O8AA 2WDFA 1WARA 5C1VA 1KBPA 2DXNA 4I5LC 1HP1A 3JYFA 2ZBMA 3EGGA 3H67A 1UTEA 4ZVZA 2CV9A 3C5WC 2DXLA 3IB8A 4LACC 2QFRA 3C9FA 2QFPA 2NXFA 4YKEA 3T1IA 1TCOA 4MOYA 4V0WA 4LU9A 4V0XA 1FJMA 3DW8C 4DT2A 4HD0A 4KKZA 2BCDA 3AUZA 2R17A 3GVEA 1S95A 3PSOA 4OR9A 5B8IA 1S3LA 2Z72A 3H66A 4B2OA 1Z2XA 4F0ZA 4I5NC 3E0JA 1T71A 3IVDA 4DHLA 4LTYA 1OI8A 4FBQA 1OIDA 1Z2WA 1T70A 1NNWA 2IE3C 4IYPC 1QFCA 3H68A 3V4YA 4Q7FA 3P71C 2HYOA 3HVQA 5F3WA 4ORCA 4TUGA 2BQ8X 2IE4C 3E7AA 3QG5C 1XM7A 4V0VA 2ZOAA 3RL3A 3QFNA 1V73A 4MP0A 4O24A 3TGHA 1M63A 1S3MA 3E7BA 2USHA 3RQZA 4O4KA 2O8GA 4IL1A 3EGHA 3QFMA 5DNYA 2GJUA 2Q8UA 1S3NA 2HYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6B A;  4ZX2 A;  4UWQ A;  3IVE A;  4JA7 A;  4ORA A;  2Z06 A;  4ORB A;  1HPU A;  4FBK A;  4JA9 A;  3PSN A;  5JJT A;  4UT2 A;  5IOH A;  1USH A;  3FGA C;  3THO B;  1G5B A;  3QFK A;  1W24 A;  2NYM C;  3H63 A;  4NZV A;  3DSC A;  2BDX A;  1MF8 A;  2NPP C;  4O43 A;  3QFO A;  3H64 A;  3ICF A;  4XPN A;  3K7W C;  2A22 A;  2DFJ A;  2IAE C;  4H2I A;  1S8E A;  1AUI A;  3THN A;  1U32 A;  3CK2 A;  3H61 A;  5J28 A;  1QHW A;  3H60 A;  4G9J A;  2AHD A;  2YVT A;  3N5U A;  4M0V A;  1XZW A;  2HY1 A;  5JPF A;  4UT3 B;  2QJC A;  4H2B A;  1OIE A;  4WWL A;  2Z1A A;  4FBW A;  4H1Y P;  2KKN A;  3H69 A;  5INB A;  4DSY A;  3IB7 A;  2JOG A;  3KBP A;  2XMO A;  4KBP A;  3H62 B;  3DSD A;  5EQV A;  3AV0 A;  4TUI A;  5HPE A;  3ZU0 A;  2NYL C;  3RL5 A;  1JK7 A;  1II7 A;  2WDC A;  1WAO 1;  4O5G A;  5JPE A;  3K7V C;  4FCX A;  4UT3 A;  4H2G A;  4MOV A;  3ZTV A;  4J6O A;  1IT6 A;  3RL4 A;  1HO5 A;  1UF3 A;  4H2F A;  1SU1 A;  3LL8 A;  1S70 A;  4H1S A;  2WDD A;  5GTU A;  2WDE A;  2O8A A;  2WDF A;  1WAR A;  5C1V A;  1KBP A;  4I5L C;  1HP1 A;  3JYF A;  2ZBM A;  3EGG A;  3H67 A;  1UTE A;  4ZVZ A;  2CV9 A;  3C5W C;  3IB8 A;  4LAC C;  2QFR A;  3C9F A;  2QFP A;  2NXF A;  4YKE A;  3T1I A;  1TCO A;  4MOY A;  4V0W A;  4LU9 A;  4V0X A;  1FJM A;  3DW8 C;  4DT2 A;  4HD0 A;  4KKZ A;  2BCD A;  3AUZ A;  2R17 A;  3GVE A;  1S95 A;  3PSO A;  4OR9 A;  5B8I A;  1S3L A;  2Z72 A;  3H66 A;  4B2O A;  1Z2X A;  4F0Z A;  4I5N C;  1T71 A;  3IVD A;  4DHL A;  4LTY A;  1OI8 A;  4FBQ A;  1OID A;  1Z2W A;  1T70 A;  1NNW A;  2IE3 C;  4IYP C;  1QFC A;  3H68 A;  3V4Y A;  4Q7F A;  3P71 C;  2HYO A;  3HVQ A;  5F3W A;  4ORC A;  4TUG A;  2BQ8 X;  2IE4 C;  3E7A A;  3QG5 C;  1XM7 A;  4V0V A;  3RL3 A;  3QFN A;  1V73 A;  4MP0 A;  4O24 A;  3TGH A;  1M63 A;  1S3M A;  3E7B A;  2USH A;  3RQZ A;  4O4K A;  2O8G A;  4IL1 A;  3EGH A;  3QFM A;  5DNY A;  2GJU A;  2Q8U A;  1S3N A;  2HYP A; 
#chains in the Genus database with same CATH topology
 2P6B A;  4ZX2 A;  4UWQ A;  2ZO9 B;  3IVE A;  4JA7 A;  2Z06 A;  4ORA A;  4ORB A;  1HPU A;  4FBK A;  4JA9 A;  3PSN A;  5JJT A;  4UT2 A;  5IOH A;  1USH A;  3FGA C;  3THO B;  1G5B A;  3QFK A;  1W24 A;  2NYM C;  3H63 A;  4NZV A;  3DSC A;  3D03 A;  2BDX A;  1MF8 A;  2NPP C;  4O43 A;  3QFO A;  3H64 A;  3ICF A;  4XPN A;  3K7W C;  2A22 A;  2DFJ A;  2IAE C;  4H2I A;  1S8E A;  1AUI A;  3THN A;  1U32 A;  3CK2 A;  3H61 A;  5J28 A;  1QHW A;  3H60 A;  4G9J A;  2AHD A;  2YVT A;  3N5U A;  4M0V A;  1XZW A;  2HY1 A;  5JPF A;  4UT3 B;  2QJC A;  4H2B A;  1OIE A;  4WWL A;  2Z1A A;  4FBW A;  4H1Y P;  2KKN A;  3H69 A;  5INB A;  4DSY A;  3IB7 A;  2JOG A;  3KBP A;  2XMO A;  4KBP A;  3FLO A;  2YEQ A;  3H62 B;  3DSD A;  5EQV A;  3AV0 A;  4TUI A;  5HPE A;  3ZU0 A;  2NYL C;  3RL5 A;  1JK7 A;  1II7 A;  2WDC A;  1WAO 1;  4O5G A;  5JPE A;  3K7V C;  4FCX A;  4UT3 A;  4H2G A;  4MOV A;  3ZTV A;  4J6O A;  1IT6 A;  3RL4 A;  1HO5 A;  1UF3 A;  4H2F A;  1SU1 A;  3LL8 A;  1S70 A;  4H1S A;  2WDD A;  5GTU A;  2WDE A;  2O8A A;  2WDF A;  1WAR A;  5C1V A;  1KBP A;  2DXN A;  4I5L C;  1HP1 A;  3JYF A;  2ZBM A;  3EGG A;  3H67 A;  1UTE A;  4ZVZ A;  2CV9 A;  3C5W C;  2DXL A;  3IB8 A;  4LAC C;  2QFR A;  3C9F A;  2QFP A;  2NXF A;  4YKE A;  3T1I A;  1TCO A;  4MOY A;  4V0W A;  4LU9 A;  4V0X A;  1FJM A;  3DW8 C;  4DT2 A;  4HD0 A;  4KKZ A;  2BCD A;  3AUZ A;  2R17 A;  3GVE A;  1S95 A;  3PSO A;  4OR9 A;  5B8I A;  1S3L A;  2Z72 A;  3H66 A;  4B2O A;  1Z2X A;  4F0Z A;  4I5N C;  3E0J A;  1T71 A;  3IVD A;  4DHL A;  4LTY A;  1OI8 A;  4FBQ A;  1OID A;  1Z2W A;  1T70 A;  1NNW A;  2IE3 C;  4IYP C;  1QFC A;  3H68 A;  3V4Y A;  4Q7F A;  3P71 C;  2HYO A;  3HVQ A;  5F3W A;  4ORC A;  4TUG A;  2BQ8 X;  2IE4 C;  3E7A A;  3QG5 C;  1XM7 A;  4V0V A;  2ZOA A;  3RL3 A;  3QFN A;  1V73 A;  4MP0 A;  4O24 A;  3TGH A;  1M63 A;  1S3M A;  3E7B A;  2USH A;  3RQZ A;  4O4K A;  2O8G A;  4IL1 A;  3EGH A;  3QFM A;  5DNY A;  2GJU A;  2Q8U A;  1S3N A;  2HYP A; 
#chains in the Genus database with same CATH homology
 2P6B A;  4ZX2 A;  4UWQ A;  2ZO9 B;  3IVE A;  4JA7 A;  2Z06 A;  4ORA A;  4ORB A;  1HPU A;  4FBK A;  4JA9 A;  3PSN A;  5JJT A;  4UT2 A;  5IOH A;  1USH A;  3FGA C;  3THO B;  1G5B A;  3QFK A;  1W24 A;  2NYM C;  3H63 A;  4NZV A;  3DSC A;  3D03 A;  2BDX A;  1MF8 A;  2NPP C;  4O43 A;  3QFO A;  3H64 A;  3ICF A;  4XPN A;  3K7W C;  2A22 A;  2DFJ A;  2IAE C;  4H2I A;  1S8E A;  1AUI A;  3THN A;  1U32 A;  3CK2 A;  3H61 A;  5J28 A;  1QHW A;  3H60 A;  4G9J A;  2AHD A;  2YVT A;  3N5U A;  4M0V A;  1XZW A;  2HY1 A;  5JPF A;  4UT3 B;  2QJC A;  4H2B A;  1OIE A;  4WWL A;  2Z1A A;  4FBW A;  4H1Y P;  2KKN A;  3H69 A;  5INB A;  4DSY A;  3IB7 A;  2JOG A;  3KBP A;  2XMO A;  4KBP A;  3FLO A;  2YEQ A;  3H62 B;  3DSD A;  5EQV A;  3AV0 A;  4TUI A;  5HPE A;  3ZU0 A;  2NYL C;  3RL5 A;  1JK7 A;  1II7 A;  2WDC A;  1WAO 1;  4O5G A;  5JPE A;  3K7V C;  4FCX A;  4UT3 A;  4H2G A;  4MOV A;  3ZTV A;  4J6O A;  1IT6 A;  3RL4 A;  1HO5 A;  1UF3 A;  4H2F A;  1SU1 A;  3LL8 A;  1S70 A;  4H1S A;  2WDD A;  5GTU A;  2WDE A;  2O8A A;  2WDF A;  1WAR A;  5C1V A;  1KBP A;  2DXN A;  4I5L C;  1HP1 A;  3JYF A;  2ZBM A;  3EGG A;  3H67 A;  1UTE A;  4ZVZ A;  2CV9 A;  3C5W C;  2DXL A;  3IB8 A;  4LAC C;  2QFR A;  3C9F A;  2QFP A;  2NXF A;  4YKE A;  3T1I A;  1TCO A;  4MOY A;  4V0W A;  4LU9 A;  4V0X A;  1FJM A;  3DW8 C;  4DT2 A;  4HD0 A;  4KKZ A;  2BCD A;  3AUZ A;  2R17 A;  3GVE A;  1S95 A;  3PSO A;  4OR9 A;  5B8I A;  1S3L A;  2Z72 A;  3H66 A;  4B2O A;  1Z2X A;  4F0Z A;  4I5N C;  3E0J A;  1T71 A;  3IVD A;  4DHL A;  4LTY A;  1OI8 A;  4FBQ A;  1OID A;  1Z2W A;  1T70 A;  1NNW A;  2IE3 C;  4IYP C;  1QFC A;  3H68 A;  3V4Y A;  4Q7F A;  3P71 C;  2HYO A;  3HVQ A;  5F3W A;  4ORC A;  4TUG A;  2BQ8 X;  2IE4 C;  3E7A A;  3QG5 C;  1XM7 A;  4V0V A;  2ZOA A;  3RL3 A;  3QFN A;  1V73 A;  4MP0 A;  4O24 A;  3TGH A;  1M63 A;  1S3M A;  3E7B A;  2USH A;  3RQZ A;  4O4K A;  2O8G A;  4IL1 A;  3EGH A;  3QFM A;  5DNY A;  2GJU A;  2Q8U A;  1S3N A;  2HYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...