4O24A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o24A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o24A01
1QFCA 2NPPC 2Z72A 3JYFA 3EGHA 5B8IA 3EGGA 4M0VA 1M63A 3H67A 3E7BA 4UWQA 1USHA 1TCOA 3IB8A 4FCXA 5J28A 1WAO1 4JA7A 4MOYA 2WDFA 2O8AA 3QFOA 3TGHA 3H62B 4XPNA 4HD0A 4O43A 4DT2A 4Q7FA 1U32A 3N5UA 1S70A 2Z1AA 3IVDA 1JK7A 3PSNA 3RL4A 4O24A 3H63A 3GVEA 3H60A 4FBQA 3H68A 4LU9A 2O8GA 2HYPA 3DW8C 3K7WC 3THNA 4V0VA 4YKEA 4ORAA 2IE3C 2BQ8X 3DSCA 1S8EA 1WARA 3LL8A 3ZU0A 4ZX2A 3H61A 4ZVZA 4WWLA 1Z2WA 3PSOA 3CK2A 4I5NC 1OI8A 5DNYA 4KBPA 3THOB 4I5LC 2WDCA 5HPEA 4LACC 4KKZA 1IT6A 2A22A 1W24A 3ICFA 1HPUA 2NXFA 2XMOA 3KBPA 4UT3A 2Z06A 5C1VA 4TUIA 4FBWA 3H69A 3H64A 3C5WC 3RQZA 2IAEC 4ORBA 2QFRA 2JOGA 4O4KA 2WDDA 5INBA 4TUGA 3FGAC 1MF8A 4V0XA 4NZVA 4IL1A 2P6BA 1G5BA 1UF3A 4F0ZA 4FBKA 4DSYA 1OIEA 3RL3A 3DSDA 3P71C 1OIDA 4O5GA 3IVEA 1II7A 3AV0A 4J6OA 2HYOA 2NYMC 1T71A 1KBPA 4H1SA 5IOHA 2CV9A 3RL5A 2Q8UA 2YVTA 4B2OA 4OR9A 2KKNA 1QHWA 4H2BA 3AUZA 4UT2A 3IB7A 1S3LA 3HVQA 1AUIA 1S3MA 1UTEA 2ZBMA 4IYPC 4MOVA 2USHA 2IE4C 4UT3B 4H2IA 2QFPA 3ZTVA 1S95A 1HP1A 2R17A 1T70A 3V4YA 3H66A 1FJMA 1XM7A 4H2FA 4MP0A 1XZWA 5JJTA 1NNWA 1S3NA 2DFJA 3QFMA 4DHLA 4JA9A 4V0WA 1Z2XA 2AHDA 3E7AA 3QFKA 2QJCA 3C9FA 2BDXA 4G9JA 4H2GA 2NYLC 5GTUA 1SU1A 5EQVA 5JPEA 2BCDA 3QG5C 1V73A 4ORCA 3T1IA 5JPFA 4H1YP 1HO5A 5F3WA 3QFNA 2GJUA 2HY1A 4LTYA 3K7VC 2WDEA
chains in the Genus database with same CATH superfamily
2EMLA 1N3GA 2VQEE 2NPPC 1X6EA 2EN7A 2Z72A 2EMBA 3LLHA 2ENCA 2EMAA 1NCSA 1I94E 2EMKA 2L2MA 2LVHA 1YSAC 1P47A 4WFTA 5IV8B 1HNXE 4JA7A 2L2NA 2L3CA 2WDFA 3TGHA 3QFOA 2LE2A 3C6MA 2EOJA 4OOGC 4DR2E 4HD0A 2EPCA 4F9AB 4Q7FA 3P1XA 2ADRA 2RTXA 4LFAE 3PSNA 3FLOA 2KOUA 4WSPA 3F6GA 1LLMC 2EQ1A 2MC5A 2DIXA 3VYYA 4Q28A 2I9IA 5AASA 4ORAA 2MKDA 2IE3C 3DSCA 4NXME 3C6KA 3ZU0A 1X5WA 4ZX2A 1BBOA 5ADZA 2VRDA 3H61A 4LF7E 4WWLA 2EQ0A 3J7Yp 4DV6E 2J7JA 3TQMA 1FJGE 2EOOA 2L92A 5DNYA 2N3HA 3THOB 1QU6A 4R2PA 2EJ4A 2ZOAA 5FLXC 2G7HA 2Z06A 4KZSA 5LL6R 2EPZA 2LCEA 2EM0A 1EH7A 3HQ1A 2M9AA 2JOGA 2QFRA 2MC6A 4BC7A 1ZBTA 3LMLA 2UU9E 2N8XA 1MF8A 2EN6A 2ENHA 1ZR9A 4F0ZA 3MHHC 2DMYA 3EPLA 3RL3A 2YEQA 4HTGA 3F6HA 3P71C 4O5GA 1EH8A 1II7A 1EKZA 2ODRD 1T71A 4M2ZA 3MHSC 4R03A 4WX9A 2EM2A 2EOQA 3E0JA 1QHWA 4OR9A 2M4IA 2WZOA 2EPOA 5KL7A 2EPMX 2YTDA 2ZO9B 2L2KB 2L6MA 3JTZA 1UTEA 2ZBMA 4IJDA 2EM9A 2QFPA 2JOBA 4K0KE 1IMUA 3H09A 5A69A 1IBLE 2ELYA 2EM4A 1MEYC 2CT1A 3ADJA 1S3NA 2EMXA 4DR7E 3C9FA 1MGTA 5KL3A 4NHRA 3ADIA 3ADGA 2RSMA 3KZYA 5GTUA 1V73A 2NABA 1GQEA 1DGCA 1X6HA 1GTKA 3IWCA 4X66E 5IT9C 2NUEA 4R2CA 2LT7A 4R2AA 1HO5A 4ZYEA 1JK2A 3OTOE 4MLQA 2N3GA 3L00A 3RMPA 5AE2A 4DV1E 2M7QA 1HR0E 2DB2A 3EGHA 3JAMC 1T4OA 5KL4A 1N34E 4UWQA 4DV4E 3IWBA 2YPNA 2YWQA 2YTGA 4MOYA 4P78A 2YTIA 4XPNA 3BF2A 5KL5A 1XMQE 1G2FC 2EE8A 2YRHA 1X3CA 2YU8A 2I13A 4LFCE 2E5LE 2V8QB 1S70A 1STUA 2EMZA 4DMIA 2DXLA 2Z1AA 1A1HA 3IVDA 1JK7A 4O24A 3GVEA 2FV4B 1J5EE 3H68A 2CPNA 2GPIA 2O8GA 2DXNA 4GEQB 2LTRA 2ELZA 4GKKE 4V0VA 4JI2E 1S8EA 3J80C 5BR8E 4Q35B 1Z1BA 4DR3E 1UBDC 4DR4E 5KL6A 3ZOQB 1FKAE 1Z2WA 2EPXA 2EN2A 4I5NC 1YUIA 3DJWA 2K4VA 4I5LC 3MSWA 1IT6A 2JR1A 1W24A 2F8BA 2UXDE 4UT3A 4F6NA 5C1VA 4R2RA 3H69A 3H64A 3C5WC 2JOXA 4DUZE 4J8ZA 2YSPA 4N4RB 2LUQA 4O4KA 2WDDA 2UXBE 4AQYE 4IL1A 2ENAA 1UF3A 1PKPA 1ZU1A 4WXDA 2UUCE 4GZNC 4YHHE 3AV0A 4LF6E 2HYOA 2YSOA 1XNRE 2LJUA 1KBPA 4H1SA 4WPYA 2B9DA 2YVTA 2JWOA 4B2OA 2EN8A 4F9CB 4X65E 4LFBE 3IB7A 2YRKA 2K7IA 1S3LA 1X48A 1AUIA 2EM8A 1A1IA 4I8OA 1IQSA 2EPLX 2MDGA 2YTEA 2IE4C 2USHA 4UT3B 1PDAA 2EPPA 2LO3A 4JI3E 3KZZA 1S95A 2V89A 1HP1A 2R17A 5AC5A 2A25A 4DV7E 3FIGA 4ZYGA 3V4YA 2EOYA 1XM7A 4H2FA 5A6BA 2WCC3 2YZTA 4GKJE 1XZWA 1T39A 1NNWA 4MP0A 2NUGA 1Z2XA 1BBGA 1KYQA 4B3RE 3E7AA 4BHCA 1L4SA 3HTXA 2EMFA 2L3JA 3JU0A 2E72A 3EPJA 2EMWA 1T4LB 1SU1A 2LJHA 2D9HA 3QG5C 2VF1A 2EOSA 4X9JA 3T1IA 1J26A 2V83A 2YTOA 4DKKA 2EM5A 2R76A 2GJUA 2LMZA 2WDEA 4R2QA 4L8NA 2GLIA 3DF6A 2EL4A 2EORA 1IQOA 2BB8A 2EPAA 1X47A 4X62E 2WBUA 3JYFA 2EL6A 2EOXA 2EWLA 5A6AA 5B8IA 5AE3A 1M63A 1PJQA 4DV5E 3H67A 2JYAA 3E7BA 2JPAA 2LRSA 2YTPA 2MDRA 1TCOA 4BMJA 1USHA 4RH8A 5A6JA 1WAO1 3IB8A 4FCXA 5J28A 2V87A 3VYXA 2M1SA 3H62B 2EMIA 2YTJA 4M30A 4KHPE 4DT2A 4JV5E 1U32A 1JK1A 3N5UA 1NEIA 4NXNE 2EZ6A 4BBYA 1BB8A 1A1FA 3RL4A 5LMNE 3H63A 5KL2A 1RC7A 4FBQA 4LU9A 4L5NC 3J81C 2HYPA 4F6MA 3DW8C 4LF5E 4ZYHA 3THNA 4X8WA 1O0WA 2GHFA 4DR6E 2V86A 2BQ8X 1WARA 2HJJA 4DV2E 1YYKA 1F2IG 2YU5A 4DV0E 1ZAAC 1X49A 2EM6A 4DV3E 1A1LA 3PSOA 3CK2A 1DI2A 1OI8A 4P7DA 2PRTA 2WDCA 2EN1A 5HPEA 4KKZA 3BIDA 2A22A 5A2QC 4BCAA 3C4TA 4FBWA 1T38A 1TN9A 1IBME 2HHHE 3HPZA 3C4BA 1YYOA 1YPNA 4JI8E 2EMYA 3ECRA 4DR1E 2IAEC 4ORBA 1WRJA 1TF3A 2DGCA 2HGHA 2EN3A 2EPUA 2HC5A 4OX9E 2RSIA 2DLQA 4FBKA 4DSYA 2R1FA 1OIEA 4JI7E 3DSDA 4J6OA 2YTFA 2EM3A 3M99B 2EOEA 2B7VA 3VK6A 3RL5A 4WYQB 4H2BA 1UILA 3AUZA 4UT2A 3VHTB 2EOZA 1YUJA 4R2DA 2EOFA 5A6KA 1XNQE 2EOMA 4HEIA 1S3MA 3EPHA 2YTQA 4F9BB 1G2DC 1RMDA 2EP3A 1YYWA 4H2IA 3J7AG 5TSEA 2CSHA 3OMLA 4B3SE 2B7TA 4WSGA 2LBSB 1T70A 4KWYA 5JJTA 1WXRA 4DHLA 4LF9E 1WJPA 1IBKE 4JI4E 1A1GA 1YZ9A 4JA9A 5AC4A 4JI0E 3ADLA 4G9JA 3T1HE 4H2GA 2NYLC 1WHNA 2BCDA 2FTXB 4JI1E 4R2EA 5JPFA 2RS6A 1WHQA 4B3TE 4JI6E 5IWAE 4FK5C 2ZM6E 2DRPA 2DSYA 5F3WA 1N36E 3QFNA 2HY1A 3K7VC 4R2SA 2EMCA 3EQ1A 1QFCA 1AH5A 1UHZA 3BGHA 2MKNA 4JI5E 4YY3E 4M0VA 3EGGA 2EMGA 1SR9A 2EM7A 2O8AA 2DLKA 4O43A 1ZBQA 2EN4A 5A6BD 4DUYE 3KWRA 3UK3C 4F2JC 2L33A 3H60A 2L8TA 1N32E 1SFEA 2JP9A 2KONA 2YTNA 4LF4E 3K7WC 4JYAE 4YKEA 1UN6B 3HXLA 4B3ME 3LL8A 2EQ3A 3HPSA 4ZVZA 2VE7C 5LMUE 2WBSA 1XMOE 2FGGA 4KBPA 4LACC 1TF6A 4MLVA 1YFHA 2RPCA 3ICFA 2BBGA 1HPUA 2NXFA 2XMOA 3KBPA 4TUIA 2EMHA 3RQZA 1QNTA 2CTDA 2JY9A 2YRMA 1HNZE 1RQ0A 5INBA 4TUGA 2YT4A 2UUBE 3FGAC 4DR5E 1AAYA 4LF8E 4NZVA 4V0XA 3D03A 2P6BA 1G5BA 3EPKA 1GZ6A 2UXCE 4R8OA 1PJSA 2WBTA 1B69A 2EL5A 4WXCA 3IWDA 1OIDA 3IVEA 1HNWE 2V88A 1PJTA 2KHXA 2NYMC 1DQ3A 5IOHA 2RS7A 2CV9A 2Q8UA 2KKNA 2E1MA 2F4VE 2EPKX 4BS9A 2LUPB 3HVQA 5LLQA 2ODRC 2VQFE 4X64E 5AE1A 4IYPC 2EPRA 2JXPA 4MOVA 2EOIA 3T1YE 2NUFA 3ZTVA 4BHBA 2EOHA 4ZYDA 1T4NA 3H66A 2LTSA 3K6QA 1FJMA 2EPNA 3BBGA 1X6FA 2DFJA 3QFMA 2H36X 5IXMB 2AHDA 4V0WA 2RQLA 2B3TB 1EH6A 2IHR1 5T6JA 1N33E 2UUAE 1KJKA 2DMIA 2BDXA 2QJCA 3QFKA 1A1KA 4BC9A 2NA2A 5EQVA 2V85A 5JPEA 2LV2A 4ORCA 4M9VC 1A1JA 5CFFE 4H1YP 4F54A 4RHBB 4IS1C 4LTYA 2JVAA
chains in the Genus database with same CATH topology
1QFCA 2NPPC 2Z72A 3JYFA 3EGHA 5B8IA 3EGGA 4M0VA 1M63A 3H67A 3E7BA 4UWQA 1USHA 1TCOA 3IB8A 4FCXA 5J28A 1WAO1 4JA7A 4MOYA 2WDFA 2O8AA 3QFOA 3TGHA 3H62B 4XPNA 4HD0A 4O43A 4DT2A 4Q7FA 1U32A 3N5UA 1S70A 2DXLA 2Z1AA 3IVDA 1JK7A 3PSNA 3RL4A 4O24A 3FLOA 3H63A 3GVEA 3H60A 4FBQA 3H68A 4LU9A 2O8GA 2DXNA 2HYPA 3DW8C 3K7WC 3THNA 4V0VA 4YKEA 4ORAA 2IE3C 3DSCA 2BQ8X 1S8EA 1WARA 3LL8A 3ZU0A 4ZX2A 3H61A 4ZVZA 4WWLA 1Z2WA 3PSOA 3CK2A 4I5NC 1OI8A 5DNYA 4KBPA 3THOB 4I5LC 2WDCA 5HPEA 4LACC 4KKZA 1IT6A 2A22A 1W24A 2ZOAA 3ICFA 1HPUA 2NXFA 2XMOA 3KBPA 4UT3A 2Z06A 5C1VA 4TUIA 4FBWA 3H69A 3H64A 3C5WC 3RQZA 2IAEC 4ORBA 2JOGA 2QFRA 4O4KA 2WDDA 5INBA 4TUGA 3FGAC 1MF8A 4V0XA 4NZVA 4IL1A 3D03A 2P6BA 1G5BA 1UF3A 4F0ZA 4FBKA 4DSYA 1OIEA 3RL3A 3DSDA 2YEQA 3P71C 1OIDA 4O5GA 3IVEA 1II7A 3AV0A 4J6OA 2HYOA 2NYMC 1T71A 1KBPA 4H1SA 5IOHA 2CV9A 3RL5A 2Q8UA 2YVTA 4B2OA 3E0JA 2KKNA 1QHWA 4H2BA 4OR9A 3AUZA 4UT2A 3IB7A 1S3LA 3HVQA 2ZO9B 1AUIA 1S3MA 1UTEA 2ZBMA 4IYPC 4MOVA 2USHA 2IE4C 4UT3B 4H2IA 2QFPA 3ZTVA 1S95A 1HP1A 2R17A 1T70A 3V4YA 3H66A 1FJMA 1XM7A 4H2FA 4MP0A 1XZWA 5JJTA 1NNWA 1S3NA 2DFJA 3QFMA 4DHLA 4JA9A 4V0WA 1Z2XA 2AHDA 3E7AA 3QFKA 2QJCA 3C9FA 2BDXA 4G9JA 4H2GA 2NYLC 5GTUA 1SU1A 5EQVA 5JPEA 2BCDA 3QG5C 1V73A 4ORCA 3T1IA 5JPFA 4H1YP 1HO5A 5F3WA 3QFNA 2GJUA 2HY1A 4LTYA 3K7VC 2WDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFC A;  2NPP C;  2Z72 A;  3JYF A;  3EGH A;  5B8I A;  3EGG A;  4M0V A;  1M63 A;  3H67 A;  3E7B A;  4UWQ A;  1USH A;  1TCO A;  3IB8 A;  4FCX A;  5J28 A;  1WAO 1;  4JA7 A;  4MOY A;  2WDF A;  2O8A A;  3QFO A;  3TGH A;  3H62 B;  4XPN A;  4HD0 A;  4O43 A;  4DT2 A;  4Q7F A;  1U32 A;  3N5U A;  1S70 A;  2Z1A A;  3IVD A;  1JK7 A;  3PSN A;  3RL4 A;  4O24 A;  3H63 A;  3GVE A;  3H60 A;  4FBQ A;  3H68 A;  4LU9 A;  2O8G A;  2HYP A;  3DW8 C;  3K7W C;  3THN A;  4V0V A;  4YKE A;  4ORA A;  2IE3 C;  2BQ8 X;  3DSC A;  1S8E A;  1WAR A;  3LL8 A;  3ZU0 A;  4ZX2 A;  3H61 A;  4ZVZ A;  4WWL A;  1Z2W A;  3PSO A;  3CK2 A;  4I5N C;  1OI8 A;  5DNY A;  4KBP A;  3THO B;  4I5L C;  2WDC A;  5HPE A;  4LAC C;  4KKZ A;  1IT6 A;  2A22 A;  1W24 A;  3ICF A;  1HPU A;  2NXF A;  2XMO A;  3KBP A;  4UT3 A;  2Z06 A;  5C1V A;  4TUI A;  4FBW A;  3H69 A;  3H64 A;  3C5W C;  3RQZ A;  2IAE C;  4ORB A;  2QFR A;  2JOG A;  4O4K A;  2WDD A;  5INB A;  4TUG A;  3FGA C;  1MF8 A;  4V0X A;  4NZV A;  4IL1 A;  2P6B A;  1G5B A;  1UF3 A;  4F0Z A;  4FBK A;  4DSY A;  1OIE A;  3RL3 A;  3DSD A;  3P71 C;  1OID A;  4O5G A;  3IVE A;  1II7 A;  3AV0 A;  4J6O A;  2HYO A;  2NYM C;  1T71 A;  1KBP A;  4H1S A;  5IOH A;  2CV9 A;  3RL5 A;  2Q8U A;  2YVT A;  4B2O A;  4OR9 A;  2KKN A;  1QHW A;  4H2B A;  3AUZ A;  4UT2 A;  3IB7 A;  1S3L A;  3HVQ A;  1AUI A;  1S3M A;  1UTE A;  2ZBM A;  4IYP C;  4MOV A;  2USH A;  2IE4 C;  4UT3 B;  4H2I A;  2QFP A;  3ZTV A;  1S95 A;  1HP1 A;  2R17 A;  1T70 A;  3V4Y A;  3H66 A;  1FJM A;  1XM7 A;  4H2F A;  4MP0 A;  1XZW A;  5JJT A;  1NNW A;  1S3N A;  2DFJ A;  3QFM A;  4DHL A;  4JA9 A;  4V0W A;  1Z2X A;  2AHD A;  3E7A A;  3QFK A;  2QJC A;  3C9F A;  2BDX A;  4G9J A;  4H2G A;  2NYL C;  5GTU A;  1SU1 A;  5EQV A;  5JPE A;  2BCD A;  3QG5 C;  1V73 A;  4ORC A;  3T1I A;  5JPF A;  4H1Y P;  1HO5 A;  5F3W A;  3QFN A;  2GJU A;  2HY1 A;  4LTY A;  3K7V C;  2WDE A; 
#chains in the Genus database with same CATH topology
 2EML A;  1N3G A;  2VQE E;  2NPP C;  1X6E A;  2EN7 A;  2Z72 A;  2EMB A;  3LLH A;  2ENC A;  2EMA A;  1NCS A;  1I94 E;  2EMK A;  2L2M A;  2LVH A;  1YSA C;  1P47 A;  4WFT A;  5IV8 B;  1HNX E;  4JA7 A;  2L2N A;  2L3C A;  2WDF A;  3TGH A;  3QFO A;  2LE2 A;  3C6M A;  2EOJ A;  4OOG C;  4DR2 E;  4HD0 A;  2EPC A;  4F9A B;  4Q7F A;  3P1X A;  2ADR A;  2RTX A;  4LFA E;  3PSN A;  3FLO A;  2KOU A;  4WSP A;  3F6G A;  1LLM C;  2EQ1 A;  2MC5 A;  2DIX A;  3VYY A;  4Q28 A;  2I9I A;  5AAS A;  4ORA A;  2MKD A;  2IE3 C;  3DSC A;  4NXM E;  3C6K A;  3ZU0 A;  1X5W A;  4ZX2 A;  1BBO A;  5ADZ A;  2VRD A;  3H61 A;  4LF7 E;  4WWL A;  2EQ0 A;  3J7Y p;  4DV6 E;  2J7J A;  3TQM A;  1FJG E;  2EOO A;  2L92 A;  5DNY A;  2N3H A;  3THO B;  1QU6 A;  4R2P A;  2EJ4 A;  2ZOA A;  5FLX C;  2G7H A;  2Z06 A;  4KZS A;  5LL6 R;  2EPZ A;  2LCE A;  2EM0 A;  1EH7 A;  3HQ1 A;  2M9A A;  2JOG A;  2QFR A;  2MC6 A;  4BC7 A;  1ZBT A;  3LML A;  2UU9 E;  2N8X A;  1MF8 A;  2EN6 A;  2ENH A;  1ZR9 A;  4F0Z A;  3MHH C;  2DMY A;  3EPL A;  3RL3 A;  2YEQ A;  4HTG A;  3F6H A;  3P71 C;  4O5G A;  1EH8 A;  1II7 A;  1EKZ A;  2ODR D;  1T71 A;  4M2Z A;  3MHS C;  4R03 A;  4WX9 A;  2EM2 A;  2EOQ A;  3E0J A;  1QHW A;  4OR9 A;  2M4I A;  2WZO A;  2EPO A;  5KL7 A;  2EPM X;  2YTD A;  2ZO9 B;  2L2K B;  2L6M A;  3JTZ A;  1UTE A;  2ZBM A;  4IJD A;  2EM9 A;  2QFP A;  2JOB A;  4K0K E;  1IMU A;  3H09 A;  5A69 A;  1IBL E;  2ELY A;  2EM4 A;  1MEY C;  2CT1 A;  3ADJ A;  1S3N A;  2EMX A;  4DR7 E;  3C9F A;  1MGT A;  5KL3 A;  4NHR A;  3ADI A;  3ADG A;  2RSM A;  3KZY A;  5GTU A;  1V73 A;  2NAB A;  1GQE A;  1DGC A;  1X6H A;  1GTK A;  3IWC A;  4X66 E;  5IT9 C;  2NUE A;  4R2C A;  2LT7 A;  4R2A A;  1HO5 A;  4ZYE A;  1JK2 A;  3OTO E;  4MLQ A;  2N3G A;  3L00 A;  3RMP A;  5AE2 A;  4DV1 E;  2M7Q A;  1HR0 E;  2DB2 A;  3EGH A;  3JAM C;  1T4O A;  5KL4 A;  1N34 E;  4UWQ A;  4DV4 E;  3IWB A;  2YPN A;  2YWQ A;  2YTG A;  4MOY A;  4P78 A;  2YTI A;  4XPN A;  3BF2 A;  5KL5 A;  1XMQ E;  1G2F C;  2EE8 A;  2YRH A;  1X3C A;  2YU8 A;  2I13 A;  4LFC E;  2E5L E;  2V8Q B;  1S70 A;  1STU A;  2EMZ A;  4DMI A;  2DXL A;  2Z1A A;  1A1H A;  3IVD A;  1JK7 A;  4O24 A;  3GVE A;  2FV4 B;  1J5E E;  3H68 A;  2CPN A;  2GPI A;  2O8G A;  2DXN A;  4GEQ B;  2LTR A;  2ELZ A;  4GKK E;  4V0V A;  4JI2 E;  1S8E A;  3J80 C;  5BR8 E;  4Q35 B;  1Z1B A;  4DR3 E;  1UBD C;  4DR4 E;  5KL6 A;  3ZOQ B;  1FKA E;  1Z2W A;  2EPX A;  2EN2 A;  4I5N C;  1YUI A;  3DJW A;  2K4V A;  4I5L C;  3MSW A;  1IT6 A;  2JR1 A;  1W24 A;  2F8B A;  2UXD E;  4UT3 A;  4F6N A;  5C1V A;  4R2R A;  3H69 A;  3H64 A;  3C5W C;  2JOX A;  4DUZ E;  4J8Z A;  2YSP A;  4N4R B;  2LUQ A;  4O4K A;  2WDD A;  2UXB E;  4AQY E;  4IL1 A;  2ENA A;  1UF3 A;  1PKP A;  1ZU1 A;  4WXD A;  2UUC E;  4GZN C;  4YHH E;  3AV0 A;  4LF6 E;  2HYO A;  2YSO A;  1XNR E;  2LJU A;  1KBP A;  4H1S A;  4WPY A;  2B9D A;  2YVT A;  2JWO A;  4B2O A;  2EN8 A;  4F9C B;  4X65 E;  4LFB E;  3IB7 A;  2YRK A;  2K7I A;  1S3L A;  1X48 A;  1AUI A;  2EM8 A;  1A1I A;  4I8O A;  1IQS A;  2EPL X;  2MDG A;  2YTE A;  2IE4 C;  2USH A;  4UT3 B;  1PDA A;  2EPP A;  2LO3 A;  4JI3 E;  3KZZ A;  1S95 A;  2V89 A;  1HP1 A;  2R17 A;  5AC5 A;  2A25 A;  4DV7 E;  3FIG A;  4ZYG A;  3V4Y A;  2EOY A;  1XM7 A;  4H2F A;  5A6B A;  2WCC 3;  2YZT A;  4GKJ E;  1XZW A;  1T39 A;  1NNW A;  4MP0 A;  2NUG A;  1Z2X A;  1BBG A;  1KYQ A;  4B3R E;  3E7A A;  4BHC A;  1L4S A;  3HTX A;  2EMF A;  2L3J A;  3JU0 A;  2E72 A;  3EPJ A;  2EMW A;  1T4L B;  1SU1 A;  2LJH A;  2D9H A;  3QG5 C;  2VF1 A;  2EOS A;  4X9J A;  3T1I A;  1J26 A;  2V83 A;  2YTO A;  4DKK A;  2EM5 A;  2R76 A;  2GJU A;  2LMZ A;  2WDE A;  4R2Q A;  4L8N A;  2GLI A;  3DF6 A;  2EL4 A;  2EOR A;  1IQO A;  2BB8 A;  2EPA A;  1X47 A;  4X62 E;  2WBU A;  3JYF A;  2EL6 A;  2EOX A;  2EWL A;  5A6A A;  5B8I A;  5AE3 A;  1M63 A;  1PJQ A;  4DV5 E;  3H67 A;  2JYA A;  3E7B A;  2JPA A;  2LRS A;  2YTP A;  2MDR A;  1TCO A;  4BMJ A;  1USH A;  4RH8 A;  5A6J A;  1WAO 1;  3IB8 A;  4FCX A;  5J28 A;  2V87 A;  3VYX A;  2M1S A;  3H62 B;  2EMI A;  2YTJ A;  4M30 A;  4KHP E;  4DT2 A;  4JV5 E;  1U32 A;  1JK1 A;  3N5U A;  1NEI A;  4NXN E;  2EZ6 A;  4BBY A;  1BB8 A;  1A1F A;  3RL4 A;  5LMN E;  3H63 A;  5KL2 A;  1RC7 A;  4FBQ A;  4LU9 A;  4L5N C;  3J81 C;  2HYP A;  4F6M A;  3DW8 C;  4LF5 E;  4ZYH A;  3THN A;  4X8W A;  1O0W A;  2GHF A;  4DR6 E;  2V86 A;  2BQ8 X;  1WAR A;  2HJJ A;  4DV2 E;  1YYK A;  1F2I G;  2YU5 A;  4DV0 E;  1ZAA C;  1X49 A;  2EM6 A;  4DV3 E;  1A1L A;  3PSO A;  3CK2 A;  1DI2 A;  1OI8 A;  4P7D A;  2PRT A;  2WDC A;  2EN1 A;  5HPE A;  4KKZ A;  3BID A;  2A22 A;  5A2Q C;  4BCA A;  3C4T A;  4FBW A;  1T38 A;  1TN9 A;  1IBM E;  2HHH E;  3HPZ A;  3C4B A;  1YYO A;  1YPN A;  4JI8 E;  2EMY A;  3ECR A;  4DR1 E;  2IAE C;  4ORB A;  1WRJ A;  1TF3 A;  2DGC A;  2HGH A;  2EN3 A;  2EPU A;  2HC5 A;  4OX9 E;  2RSI A;  2DLQ A;  4FBK A;  4DSY A;  2R1F A;  1OIE A;  4JI7 E;  3DSD A;  4J6O A;  2YTF A;  2EM3 A;  3M99 B;  2EOE A;  2B7V A;  3VK6 A;  3RL5 A;  4WYQ B;  4H2B A;  1UIL A;  3AUZ A;  4UT2 A;  3VHT B;  2EOZ A;  1YUJ A;  4R2D A;  2EOF A;  5A6K A;  1XNQ E;  2EOM A;  4HEI A;  1S3M A;  3EPH A;  2YTQ A;  4F9B B;  1G2D C;  1RMD A;  2EP3 A;  1YYW A;  4H2I A;  3J7A G;  5TSE A;  2CSH A;  3OML A;  4B3S E;  2B7T A;  4WSG A;  2LBS B;  1T70 A;  4KWY A;  5JJT A;  1WXR A;  4DHL A;  4LF9 E;  1WJP A;  1IBK E;  4JI4 E;  1A1G A;  1YZ9 A;  4JA9 A;  5AC4 A;  4JI0 E;  3ADL A;  4G9J A;  3T1H E;  4H2G A;  2NYL C;  1WHN A;  2BCD A;  2FTX B;  4JI1 E;  4R2E A;  5JPF A;  2RS6 A;  1WHQ A;  4B3T E;  4JI6 E;  5IWA E;  4FK5 C;  2ZM6 E;  2DRP A;  2DSY A;  5F3W A;  1N36 E;  3QFN A;  2HY1 A;  3K7V C;  4R2S A;  2EMC A;  3EQ1 A;  1QFC A;  1AH5 A;  1UHZ A;  3BGH A;  2MKN A;  4JI5 E;  4YY3 E;  4M0V A;  3EGG A;  2EMG A;  1SR9 A;  2EM7 A;  2O8A A;  2DLK A;  4O43 A;  1ZBQ A;  2EN4 A;  5A6B D;  4DUY E;  3KWR A;  3UK3 C;  4F2J C;  2L33 A;  3H60 A;  2L8T A;  1N32 E;  1SFE A;  2JP9 A;  2KON A;  2YTN A;  4LF4 E;  3K7W C;  4JYA E;  4YKE A;  1UN6 B;  3HXL A;  4B3M E;  3LL8 A;  2EQ3 A;  3HPS A;  4ZVZ A;  2VE7 C;  5LMU E;  2WBS A;  1XMO E;  2FGG A;  4KBP A;  4LAC C;  1TF6 A;  4MLV A;  1YFH A;  2RPC A;  3ICF A;  2BBG A;  1HPU A;  2NXF A;  2XMO A;  3KBP A;  4TUI A;  2EMH A;  3RQZ A;  1QNT A;  2CTD A;  2JY9 A;  2YRM A;  1HNZ E;  1RQ0 A;  5INB A;  4TUG A;  2YT4 A;  2UUB E;  3FGA C;  4DR5 E;  1AAY A;  4LF8 E;  4NZV A;  4V0X A;  3D03 A;  2P6B A;  1G5B A;  3EPK A;  1GZ6 A;  2UXC E;  4R8O A;  1PJS A;  2WBT A;  1B69 A;  2EL5 A;  4WXC A;  3IWD A;  1OID A;  3IVE A;  1HNW E;  2V88 A;  1PJT A;  2KHX A;  2NYM C;  1DQ3 A;  5IOH A;  2RS7 A;  2CV9 A;  2Q8U A;  2KKN A;  2E1M A;  2F4V E;  2EPK X;  4BS9 A;  2LUP B;  3HVQ A;  5LLQ A;  2ODR C;  2VQF E;  4X64 E;  5AE1 A;  4IYP C;  2EPR A;  2JXP A;  4MOV A;  2EOI A;  3T1Y E;  2NUF A;  3ZTV A;  4BHB A;  2EOH A;  4ZYD A;  1T4N A;  3H66 A;  2LTS A;  3K6Q A;  1FJM A;  2EPN A;  3BBG A;  1X6F A;  2DFJ A;  3QFM A;  2H36 X;  5IXM B;  2AHD A;  4V0W A;  2RQL A;  2B3T B;  1EH6 A;  2IHR 1;  5T6J A;  1N33 E;  2UUA E;  1KJK A;  2DMI A;  2BDX A;  2QJC A;  3QFK A;  1A1K A;  4BC9 A;  2NA2 A;  5EQV A;  2V85 A;  5JPE A;  2LV2 A;  4ORC A;  4M9V C;  1A1J A;  5CFF E;  4H1Y P;  4F54 A;  4RHB B;  4IS1 C;  4LTY A;  2JVA A; 
#chains in the Genus database with same CATH homology
 1QFC A;  2NPP C;  2Z72 A;  3JYF A;  3EGH A;  5B8I A;  3EGG A;  4M0V A;  1M63 A;  3H67 A;  3E7B A;  4UWQ A;  1USH A;  1TCO A;  3IB8 A;  4FCX A;  5J28 A;  1WAO 1;  4JA7 A;  4MOY A;  2WDF A;  2O8A A;  3QFO A;  3TGH A;  3H62 B;  4XPN A;  4HD0 A;  4O43 A;  4DT2 A;  4Q7F A;  1U32 A;  3N5U A;  1S70 A;  2DXL A;  2Z1A A;  3IVD A;  1JK7 A;  3PSN A;  3RL4 A;  4O24 A;  3FLO A;  3H63 A;  3GVE A;  3H60 A;  4FBQ A;  3H68 A;  4LU9 A;  2O8G A;  2DXN A;  2HYP A;  3DW8 C;  3K7W C;  3THN A;  4V0V A;  4YKE A;  4ORA A;  2IE3 C;  3DSC A;  2BQ8 X;  1S8E A;  1WAR A;  3LL8 A;  3ZU0 A;  4ZX2 A;  3H61 A;  4ZVZ A;  4WWL A;  1Z2W A;  3PSO A;  3CK2 A;  4I5N C;  1OI8 A;  5DNY A;  4KBP A;  3THO B;  4I5L C;  2WDC A;  5HPE A;  4LAC C;  4KKZ A;  1IT6 A;  2A22 A;  1W24 A;  2ZOA A;  3ICF A;  1HPU A;  2NXF A;  2XMO A;  3KBP A;  4UT3 A;  2Z06 A;  5C1V A;  4TUI A;  4FBW A;  3H69 A;  3H64 A;  3C5W C;  3RQZ A;  2IAE C;  4ORB A;  2JOG A;  2QFR A;  4O4K A;  2WDD A;  5INB A;  4TUG A;  3FGA C;  1MF8 A;  4V0X A;  4NZV A;  4IL1 A;  3D03 A;  2P6B A;  1G5B A;  1UF3 A;  4F0Z A;  4FBK A;  4DSY A;  1OIE A;  3RL3 A;  3DSD A;  2YEQ A;  3P71 C;  1OID A;  4O5G A;  3IVE A;  1II7 A;  3AV0 A;  4J6O A;  2HYO A;  2NYM C;  1T71 A;  1KBP A;  4H1S A;  5IOH A;  2CV9 A;  3RL5 A;  2Q8U A;  2YVT A;  4B2O A;  3E0J A;  2KKN A;  1QHW A;  4H2B A;  4OR9 A;  3AUZ A;  4UT2 A;  3IB7 A;  1S3L A;  3HVQ A;  2ZO9 B;  1AUI A;  1S3M A;  1UTE A;  2ZBM A;  4IYP C;  4MOV A;  2USH A;  2IE4 C;  4UT3 B;  4H2I A;  2QFP A;  3ZTV A;  1S95 A;  1HP1 A;  2R17 A;  1T70 A;  3V4Y A;  3H66 A;  1FJM A;  1XM7 A;  4H2F A;  4MP0 A;  1XZW A;  5JJT A;  1NNW A;  1S3N A;  2DFJ A;  3QFM A;  4DHL A;  4JA9 A;  4V0W A;  1Z2X A;  2AHD A;  3E7A A;  3QFK A;  2QJC A;  3C9F A;  2BDX A;  4G9J A;  4H2G A;  2NYL C;  5GTU A;  1SU1 A;  5EQV A;  5JPE A;  2BCD A;  3QG5 C;  1V73 A;  4ORC A;  3T1I A;  5JPF A;  4H1Y P;  1HO5 A;  5F3W A;  3QFN A;  2GJU A;  2HY1 A;  4LTY A;  3K7V C;  2WDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...