4O24A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
b'IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
molecule tags Dna binding protein/inhibitor
source organism Thermotoga maritima
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o24A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o24A01
4FBKA 3AV0A 1AUIA 1Z2XA 3QFKA 4H2GA 4I5LC 4MOYA 1JK7A 4V0WA 1KBPA 1WAO1 1MF8A 2BDXA 3P71C 4UT2A 1S95A 3H69A 1G5BA 1T71A 3HVQA 1S3MA 3H64A 3RL4A 4LU9A 3IB7A 1M63A 2AHDA 1W24A 4DSYA 5GTUA 3IVDA 1SU1A 2O8AA 1FJMA 3EGHA 3IVEA 4O4KA 2GJUA 4V0VA 2NPPC 2IE4C 1UF3A 1IT6A 3E7BA 2HY1A 5EQVA 1USHA 2Z1AA 2WDFA 3DW8C 4H1SA 1V73A 1QHWA 3QFMA 3DSCA 3T1IA 1OIEA 2NYLC 5JPEA 3DSDA 1S3NA 3ICFA 2IE3C 4LACC 1Z2WA 1HPUA 3QG5C 1T70A 3RQZA 3C5WC 4O24A 5B8IA 4JA7A 4KKZA 3H60A 4FCXA 4MP0A 4MOVA 2R17A 4FBWA 3PSNA 4XPNA 2P6BA 2WDCA 3V4YA 1S3LA 2USHA 2A22A 1TCOA 2BCDA 4UT3A 2HYPA 1HP1A 4NZVA 1HO5A 5IOHA 1XM7A 3ZU0A 4IL1A 3THOB 2NYMC 4UWQA 5F3WA 3THNA 4H2IA 4TUGA 4J6OA 4ZX2A 3H63A 2NXFA 4JA9A 3H61A 4OR9A 3C9FA 3IB8A 3RL5A 1S70A 3TGHA 3ZTVA 4H1YP 2WDDA 3N5UA 4ORCA 4O43A 1UTEA 4ORAA 3RL3A 3H62B 3H66A 3AUZA 4IYPC 1OIDA 2Z72A 1S8EA 2CV9A 4H2FA 3JYFA 4FBQA 4H2BA 2BQ8X 3K7VC 5HPEA 4HD0A 3EGGA 5JJTA 3E7AA 4LTYA 4Q7FA 5C1VA 4DHLA 2O8GA 2Q8UA 1U32A 5J28A 4ORBA 2XMOA 4F0ZA 3K7WC 5JPFA 1OI8A 2WDEA 3H67A 2Z06A 3QFNA 2YVTA 2KKNA 2ZBMA 3CK2A 4KBPA 4ZVZA 4B2OA 4YKEA 2HYOA 4DT2A 4O5GA 1WARA 4I5NC 4UT3B 1II7A 5INBA 2QFRA 1XZWA 2QJCA 3PSOA 3LL8A 2DFJA 2IAEC 5DNYA 2JOGA 3KBPA 4G9JA 2QFPA 4V0XA 1QFCA 3H68A 3QFOA 1NNWA 3FGAC 4TUIA 3GVEA 4M0VA 4WWLA
chains in the Genus database with same CATH superfamily
3BIDA 4YY3E 2EPUA 4FBKA 1I94E 1Z2XA 3QFKA 1WJPA 1P47A 2YU8A 2EPOA 2BDXA 2V89A 4F6MA 2V83A 3JU0A 3H64A 3C4TA 3RL4A 2EOXA 4JI1E 4LFBE 1M63A 2YRHA 5AASA 2LBSB 4BMJA 2V87A 3IVEA 5CFFE 4F2JC 2EOJA 2EM9A 2EQ0A 2L2NA 2N8XA 2KONA 4X9JA 2EMIA 1YFHA 2L6MA 4WXCA 2WBTA 4DV4E 4LF9E 3T1IA 3DSDA 2EN6A 1X3CA 5LL6R 1Z2WA 2K4VA 3QG5C 1PJSA 2EORA 2EOMA 4X65E 3ADLA 2ODRC 5A69A 4K0KE 2VQEE 2R76A 2EQ1A 3BGHA 4L5NC 4MP0A 2JVAA 2EMCA 3HPZA 1HNXE 4XPNA 2P6BA 2WDCA 1S3LA 2FV4B 2USHA 2LT7A 4NXNE 3J7AG 2YSPA 2WBSA 5A2QC 2LO3A 3EQ1A 4R2EA 4KHPE 2D9HA 1HP1A 4NZVA 1GQEA 2EMFA 4R03A 2NYMC 4B3TE 2EM3A 2KHXA 1X5WA 4H2IA 1TF6A 4J6OA 1PDAA 4X64E 2NXFA 2EOFA 3UK3C 3C9FA 3IB8A 3RL5A 1IMUA 2WDDA 2EE8A 3N5UA 2M1SA 4ORCA 4DHLA 2BBGA 3RL3A 2EMKA 3AUZA 1HR0E 4IYPC 2CV9A 2EJ4A 4ZYHA 3JYFA 1WHQA 2WZOA 2YTDA 1N34E 2ELYA 5AE1A 4I8OA 4DR2E 2BQ8X 3K7VC 1BBGA 4HD0A 5HPEA 2JY9A 1RMDA 2EMBA 4N4RB 3E7AA 1IBKE 2EM8A 3HXLA 4LFAE 5KL5A 5C1VA 2YRKA 2YTFA 5TSEA 2EPXA 1QU6A 2Q8UA 2YPNA 1RC7A 2PRTA 3P1XA 5IV8B 2ZM6E 2EPLX 3IWCA 4RHBB 2ELZA 2M9AA 2WDEA 3H67A 2HC5A 1A1GA 2LTRA 1N32E 3QFNA 2EL6A 2EMYA 4RH8A 2JWOA 2HYOA 3ECRA 4DT2A 2R1FA 1II7A 4JYAE 5INBA 2YU5A 1WXRA 2EM4A 1A1LA 3J7Yp 3JAMC 2F4VE 2QFRA 2DFJA 1N36E 3EPHA 4X66E 2JOGA 4B3SE 4G9JA 4M9VC 1DI2A 2YRMA 3EPKA 4OOGC 4BS9A 4DR7E 4H2GA 3BF2A 3J81C 4F54A 1JK7A 4V0WA 1KBPA 1WAO1 1MF8A 2NA2A 4Q28A 2I9IA 2YT4A 2YSOA 3OTOE 3HVQA 2FGGA 1S3MA 3C6MA 4DR3E 4X8WA 1W24A 2EN8A 2RS7A 2NUFA 1SU1A 2DXNA 2ADRA 4O4KA 4KWYA 2EMHA 2EMAA 2NPPC 2JR1A 1PJQA 4BBYA 1UF3A 3E7BA 5EQVA 2Z1AA 2MKNA 2FTXB 1KJKA 4R2RA 3H09A 2EMLA 2A25A 4MLQA 1QHWA 1A1IA 4R2PA 2GPIA 2LUPB 1JK2A 1OIEA 5JPEA 2IE3C 2VE7C 3L00A 1ZU1A 4GKKE 2ENCA 1T38A 4F9AB 5B8IA 3VYYA 2YTQA 2E1MA 4JA7A 4LF5E 2EWLA 1ZBTA 3E0JA 4FBWA 1XMQE 2ENHA 1TF3A 4LF7E 2A22A 3C6KA 2HGHA 1UN6B 2HYPA 1NCSA 1XM7A 3MSWA 1X49A 2ZOAA 3IWBA 2LVHA 4WXDA 5IT9C 2B7VA 3BBGA 3H63A 2V88A 2RSMA 2V8QB 1G2DC 3H61A 5AE3A 3VYXA 3TGHA 4MLVA 4ORAA 2MKDA 2RTXA 3H62B 2EPZA 1IQSA 1BBOA 5AC4A 4H2BA 2DRPA 2EL5A 2EM6A 2F8BA 4LTYA 4ZYEA 2HJJA 3ADJA 1MGTA 2O8GA 2CTDA 2EM2A 2EOIA 4M30A 4DMIA 4ORBA 3ADIA 2XMOA 2EOSA 4R8OA 3EPLA 3K7WC 1FKAE 2Z06A 2N3GA 3K6QA 2KKNA 4WPYA 4KBPA 4BC9A 2EOZA 1HNZE 2MDRA 1XNRE 2EPRA 4O5GA 2YTIA 2LTSA 3FIGA 4BC7A 4OX9E 4DV3E 1XZWA 3PSOA 3LL8A 2IAEC 2EZ6A 3KBPA 2E72A 2J7JA 2K7IA 1YPNA 3JTZA 3FLOA 1NNWA 2H36X 3T1HE 3TQMA 1STUA 4TUIA 3GVEA 2EPNA 1X48A 3ZOQB 2L33A 1YYOA 1Z1BA 4I5LC 1IBME 1AH5A 1NEIA 2NUGA 2LRSA 2YTPA 1T4LB 4LF6E 1SFEA 4R2AA 1S95A 2EMWA 1X6FA 1T71A 1RQ0A 5KL4A 2N3HA 4WFTA 3IB7A 3F6GA 1X6EA 2DB2A 2DIXA 2YZTA 3HPSA 5IXMB 1LLMC 1UHZA 3MHSC 2EMXA 3C4BA 2L2KB 4M2ZA 2LJUA 2O8AA 1FJMA 1WHNA 1HNWE 1BB8A 2IE4C 3D03A 1IT6A 2M4IA 5A6AA 2HY1A 4HTGA 3LLHA 2EQ3A 4H1SA 1V73A 3VK6A 4DV5E 4F6NA 3QFMA 4L8NA 1YZ9A 1S3NA 3ICFA 4WYQB 1UBDC 4LACC 1T70A 5A6KA 3RQZA 3C5WC 3EPJA 2VQFE 5A6BD 4R2SA 3PSNA 2JOXA 4DV6E 3T1YE 4JI5E 1A1KA 2ENAA 2BCDA 1KYQA 5IOHA 1EKZA 3ZU0A 2ZO9B 3THOB 2RPCA 5F3WA 2ODRD 1UILA 4R2CA 2EOEA 2JYAA 3THNA 1FJGE 4TUGA 2VF1A 4BCAA 1ZR9A 2LJHA 5AE2A 1S70A 2DXLA 4Q35B 2EPPA 1UTEA 2EN4A 3H66A 1ZBQA 1S8EA 4NHRA 1T39A 1X6HA 2YTJA 4FBQA 2WBUA 1YYKA 5JJTA 1N33E 4Q7FA 1GTKA 2JXPA 4J8ZA 2EN1A 2YTGA 5J28A 2JPAA 2EM5A 3OMLA 5BR8E 2CT1A 1YUIA 2YWQA 2NABA 1QNTA 3CK2A 3HQ1A 4WX9A 2EOHA 4YKEA 3DJWA 4F9BB 4B3ME 2M7QA 4IJDA 5IWAE 1WARA 2EPAA 4LF4E 4JV5E 3ADGA 2QJCA 3MHHC 2IHR1 4V0XA 2UUCE 3QFOA 1B69A 1XMOE 3M99B 4X62E 2LMZA 2EOOA 4M0VA 4WWLA 2LE2A 2LCEA 3AV0A 5T6JA 2GLIA 1ZAAC 1AUIA 4MOYA 1T4NA 3KZZA 2RS6A 2NUEA 3KWRA 1A1HA 1N3GA 5A6JA 3P71C 4UT2A 2UUAE 3H69A 1G5BA 2BB8A 2GHFA 2UUBE 4LU9A 2DMYA 2L92A 2MC6A 2AHDA 4JI3E 4DUZE 3HTXA 2DMIA 1GZ6A 1J5EE 5GTUA 4DSYA 2CPNA 1A1FA 3IVDA 2EPKX 1F2IG 2WCC3 2YTNA 3VHTB 3EGHA 1WRJA 2G7HA 2GJUA 2EN7A 1A1JA 4V0VA 5FLXC 4AQYE 1O0WA 3J80C 2UXBE 2L3CA 3IWDA 2UXCE 1USHA 2WDFA 3DW8C 5KL7A 1DGCA 3DSCA 2EMGA 4GZNC 2NYLC 2HHHE 2EPMX 4HEIA 4DKKA 1JK1A 4DR5E 1AAYA 1HPUA 4JI8E 2L2MA 4KZSA 5KL2A 3DF6A 4O24A 3LMLA 1IQOA 2DSYA 4KKZA 4ZYDA 3H60A 4FCXA 4DR1E 4MOVA 2R17A 4WSPA 5LLQA 4LFCE 5KL3A 1EH8A 2DLKA 2JOBA 3KZYA 1EH6A 5A6BA 4R2DA 1G2FC 3V4YA 1TCOA 4YHHE 1YSAC 4UT3A 1EH7A 1HO5A 1YYWA 4IL1A 4BHBA 2I13A 4DV1E 4UWQA 5AC5A 2UXDE 4ZYGA 2LV2A 1L4SA 5ADZA 2YEQA 2E5LE 4ZX2A 5LMUE 4R2QA 2EM0A 2KOUA 4LF8E 2EL4A 1T4OA 2EOQA 2MDGA 4JA9A 2DLQA 4OR9A 1YUJA 4F9CB 3ZTVA 1XNQE 4H1YP 2EN3A 4JI7E 4O43A 2V86A 4FK5C 1PJTA 1TN9A 4GKJE 1IBLE 1OIDA 2Z72A 4DR6E 4NXME 4H2FA 4DV0E 2B9DA 4JI4E 4BHCA 4IS1C 5KL6A 2EPCA 5LMNE 2JP9A 2UU9E 3EGGA 4P78A 4DUYE 4DR4E 2CSHA 2EN2A 2DGCA 4P7DA 4JI2E 3F6HA 1U32A 2RSIA 4GEQB 4F0ZA 5JPFA 1OI8A 2YVTA 2ZBMA 2MC5A 1DQ3A 2EOYA 2B3TB 4DV7E 4ZVZA 4B2OA 4WSGA 2LUQA 4I5NC 4UT3B 2VRDA 2B7TA 4JI0E 4JI6E 4B3RE 2RQLA 1MEYC 2YTOA 2EP3A 2L8TA 2L3JA 5DNYA 1PKPA 1X47A 2V85A 1QFCA 1J26A 2QFPA 3H68A 2EMZA 3FGAC 2YTEA 1SR9A 2EM7A 3RMPA 4DV2E
chains in the Genus database with same CATH topology
4FBKA 3AV0A 1AUIA 1Z2XA 3QFKA 4H2GA 4I5LC 4MOYA 1JK7A 4V0WA 1KBPA 1WAO1 1MF8A 2BDXA 3P71C 4UT2A 1S95A 3H69A 1G5BA 1T71A 3HVQA 1S3MA 3H64A 3RL4A 4LU9A 3IB7A 1M63A 2AHDA 1W24A 4DSYA 5GTUA 3IVDA 1SU1A 2DXNA 2O8AA 1FJMA 3EGHA 3IVEA 4O4KA 2GJUA 4V0VA 2NPPC 2IE4C 3D03A 1UF3A 1IT6A 3E7BA 2HY1A 5EQVA 1USHA 2Z1AA 2WDFA 3DW8C 4H1SA 1V73A 1QHWA 3QFMA 3DSCA 3T1IA 1OIEA 2NYLC 5JPEA 3DSDA 1S3NA 3ICFA 2IE3C 4LACC 1Z2WA 1HPUA 3QG5C 1T70A 3RQZA 3C5WC 4O24A 5B8IA 4JA7A 4KKZA 3H60A 4FCXA 4MP0A 4MOVA 2R17A 3E0JA 4FBWA 3PSNA 4XPNA 2P6BA 2WDCA 3V4YA 1S3LA 2USHA 2A22A 1TCOA 2BCDA 4UT3A 2HYPA 1HP1A 4NZVA 1HO5A 5IOHA 1XM7A 3ZU0A 4IL1A 2ZO9B 3THOB 2NYMC 4UWQA 2ZOAA 5F3WA 2YEQA 3THNA 4H2IA 4TUGA 4J6OA 4ZX2A 3H63A 2NXFA 4JA9A 3H61A 4OR9A 3C9FA 3IB8A 3RL5A 1S70A 3TGHA 2DXLA 3ZTVA 4H1YP 2WDDA 3N5UA 4ORCA 4O43A 1UTEA 4ORAA 3RL3A 3H62B 3H66A 3AUZA 4IYPC 1OIDA 2Z72A 1S8EA 2CV9A 4H2FA 3JYFA 4FBQA 4H2BA 2BQ8X 3K7VC 5HPEA 4HD0A 3EGGA 5JJTA 3E7AA 4LTYA 4Q7FA 5C1VA 4DHLA 2O8GA 2Q8UA 1U32A 5J28A 4ORBA 2XMOA 4F0ZA 3K7WC 5JPFA 1OI8A 2WDEA 3H67A 2Z06A 3QFNA 2YVTA 2KKNA 2ZBMA 3CK2A 4KBPA 4ZVZA 4B2OA 4YKEA 2HYOA 4DT2A 4O5GA 1WARA 4I5NC 4UT3B 1II7A 5INBA 2QFRA 1XZWA 2QJCA 3PSOA 3LL8A 2DFJA 2IAEC 5DNYA 2JOGA 3KBPA 4G9JA 2QFPA 4V0XA 1QFCA 3H68A 3QFOA 3FLOA 1NNWA 3FGAC 4TUIA 3GVEA 4M0VA 4WWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBK A;  3AV0 A;  1AUI A;  1Z2X A;  3QFK A;  4H2G A;  4I5L C;  4MOY A;  1JK7 A;  4V0W A;  1KBP A;  1WAO 1;  1MF8 A;  2BDX A;  3P71 C;  4UT2 A;  1S95 A;  3H69 A;  1G5B A;  1T71 A;  3HVQ A;  1S3M A;  3H64 A;  3RL4 A;  4LU9 A;  3IB7 A;  1M63 A;  2AHD A;  1W24 A;  4DSY A;  5GTU A;  3IVD A;  1SU1 A;  2O8A A;  1FJM A;  3EGH A;  3IVE A;  4O4K A;  2GJU A;  4V0V A;  2NPP C;  2IE4 C;  1UF3 A;  1IT6 A;  3E7B A;  2HY1 A;  5EQV A;  1USH A;  2Z1A A;  2WDF A;  3DW8 C;  4H1S A;  1V73 A;  1QHW A;  3QFM A;  3DSC A;  3T1I A;  1OIE A;  2NYL C;  5JPE A;  3DSD A;  1S3N A;  3ICF A;  2IE3 C;  4LAC C;  1Z2W A;  1HPU A;  3QG5 C;  1T70 A;  3RQZ A;  3C5W C;  4O24 A;  5B8I A;  4JA7 A;  4KKZ A;  3H60 A;  4FCX A;  4MP0 A;  4MOV A;  2R17 A;  4FBW A;  3PSN A;  4XPN A;  2P6B A;  2WDC A;  3V4Y A;  1S3L A;  2USH A;  2A22 A;  1TCO A;  2BCD A;  4UT3 A;  2HYP A;  1HP1 A;  4NZV A;  1HO5 A;  5IOH A;  1XM7 A;  3ZU0 A;  4IL1 A;  3THO B;  2NYM C;  4UWQ A;  5F3W A;  3THN A;  4H2I A;  4TUG A;  4J6O A;  4ZX2 A;  3H63 A;  2NXF A;  4JA9 A;  3H61 A;  4OR9 A;  3C9F A;  3IB8 A;  3RL5 A;  1S70 A;  3TGH A;  3ZTV A;  4H1Y P;  2WDD A;  3N5U A;  4ORC A;  4O43 A;  1UTE A;  4ORA A;  3RL3 A;  3H62 B;  3H66 A;  3AUZ A;  4IYP C;  1OID A;  2Z72 A;  1S8E A;  2CV9 A;  4H2F A;  3JYF A;  4FBQ A;  4H2B A;  2BQ8 X;  3K7V C;  5HPE A;  4HD0 A;  3EGG A;  5JJT A;  3E7A A;  4LTY A;  4Q7F A;  5C1V A;  4DHL A;  2O8G A;  2Q8U A;  1U32 A;  5J28 A;  4ORB A;  2XMO A;  4F0Z A;  3K7W C;  5JPF A;  1OI8 A;  2WDE A;  3H67 A;  2Z06 A;  3QFN A;  2YVT A;  2KKN A;  2ZBM A;  3CK2 A;  4KBP A;  4ZVZ A;  4B2O A;  4YKE A;  2HYO A;  4DT2 A;  4O5G A;  1WAR A;  4I5N C;  4UT3 B;  1II7 A;  5INB A;  2QFR A;  1XZW A;  2QJC A;  3PSO A;  3LL8 A;  2DFJ A;  2IAE C;  5DNY A;  2JOG A;  3KBP A;  4G9J A;  2QFP A;  4V0X A;  1QFC A;  3H68 A;  3QFO A;  1NNW A;  3FGA C;  4TUI A;  3GVE A;  4M0V A;  4WWL A; 
#chains in the Genus database with same CATH topology
 3BID A;  4YY3 E;  2EPU A;  4FBK A;  1I94 E;  1Z2X A;  3QFK A;  1WJP A;  1P47 A;  2YU8 A;  2EPO A;  2BDX A;  2V89 A;  4F6M A;  2V83 A;  3JU0 A;  3H64 A;  3C4T A;  3RL4 A;  2EOX A;  4JI1 E;  4LFB E;  1M63 A;  2YRH A;  5AAS A;  2LBS B;  4BMJ A;  2V87 A;  3IVE A;  5CFF E;  4F2J C;  2EOJ A;  2EM9 A;  2EQ0 A;  2L2N A;  2N8X A;  2KON A;  4X9J A;  2EMI A;  1YFH A;  2L6M A;  4WXC A;  2WBT A;  4DV4 E;  4LF9 E;  3T1I A;  3DSD A;  2EN6 A;  1X3C A;  5LL6 R;  1Z2W A;  2K4V A;  3QG5 C;  1PJS A;  2EOR A;  2EOM A;  4X65 E;  3ADL A;  2ODR C;  5A69 A;  4K0K E;  2VQE E;  2R76 A;  2EQ1 A;  3BGH A;  4L5N C;  4MP0 A;  2JVA A;  2EMC A;  3HPZ A;  1HNX E;  4XPN A;  2P6B A;  2WDC A;  1S3L A;  2FV4 B;  2USH A;  2LT7 A;  4NXN E;  3J7A G;  2YSP A;  2WBS A;  5A2Q C;  2LO3 A;  3EQ1 A;  4R2E A;  4KHP E;  2D9H A;  1HP1 A;  4NZV A;  1GQE A;  2EMF A;  4R03 A;  2NYM C;  4B3T E;  2EM3 A;  2KHX A;  1X5W A;  4H2I A;  1TF6 A;  4J6O A;  1PDA A;  4X64 E;  2NXF A;  2EOF A;  3UK3 C;  3C9F A;  3IB8 A;  3RL5 A;  1IMU A;  2WDD A;  2EE8 A;  3N5U A;  2M1S A;  4ORC A;  4DHL A;  2BBG A;  3RL3 A;  2EMK A;  3AUZ A;  1HR0 E;  4IYP C;  2CV9 A;  2EJ4 A;  4ZYH A;  3JYF A;  1WHQ A;  2WZO A;  2YTD A;  1N34 E;  2ELY A;  5AE1 A;  4I8O A;  4DR2 E;  2BQ8 X;  3K7V C;  1BBG A;  4HD0 A;  5HPE A;  2JY9 A;  1RMD A;  2EMB A;  4N4R B;  3E7A A;  1IBK E;  2EM8 A;  3HXL A;  4LFA E;  5KL5 A;  5C1V A;  2YRK A;  2YTF A;  5TSE A;  2EPX A;  1QU6 A;  2Q8U A;  2YPN A;  1RC7 A;  2PRT A;  3P1X A;  5IV8 B;  2ZM6 E;  2EPL X;  3IWC A;  4RHB B;  2ELZ A;  2M9A A;  2WDE A;  3H67 A;  2HC5 A;  1A1G A;  2LTR A;  1N32 E;  3QFN A;  2EL6 A;  2EMY A;  4RH8 A;  2JWO A;  2HYO A;  3ECR A;  4DT2 A;  2R1F A;  1II7 A;  4JYA E;  5INB A;  2YU5 A;  1WXR A;  2EM4 A;  1A1L A;  3J7Y p;  3JAM C;  2F4V E;  2QFR A;  2DFJ A;  1N36 E;  3EPH A;  4X66 E;  2JOG A;  4B3S E;  4G9J A;  4M9V C;  1DI2 A;  2YRM A;  3EPK A;  4OOG C;  4BS9 A;  4DR7 E;  4H2G A;  3BF2 A;  3J81 C;  4F54 A;  1JK7 A;  4V0W A;  1KBP A;  1WAO 1;  1MF8 A;  2NA2 A;  4Q28 A;  2I9I A;  2YT4 A;  2YSO A;  3OTO E;  3HVQ A;  2FGG A;  1S3M A;  3C6M A;  4DR3 E;  4X8W A;  1W24 A;  2EN8 A;  2RS7 A;  2NUF A;  1SU1 A;  2DXN A;  2ADR A;  4O4K A;  4KWY A;  2EMH A;  2EMA A;  2NPP C;  2JR1 A;  1PJQ A;  4BBY A;  1UF3 A;  3E7B A;  5EQV A;  2Z1A A;  2MKN A;  2FTX B;  1KJK A;  4R2R A;  3H09 A;  2EML A;  2A25 A;  4MLQ A;  1QHW A;  1A1I A;  4R2P A;  2GPI A;  2LUP B;  1JK2 A;  1OIE A;  5JPE A;  2IE3 C;  2VE7 C;  3L00 A;  1ZU1 A;  4GKK E;  2ENC A;  1T38 A;  4F9A B;  5B8I A;  3VYY A;  2YTQ A;  2E1M A;  4JA7 A;  4LF5 E;  2EWL A;  1ZBT A;  3E0J A;  4FBW A;  1XMQ E;  2ENH A;  1TF3 A;  4LF7 E;  2A22 A;  3C6K A;  2HGH A;  1UN6 B;  2HYP A;  1NCS A;  1XM7 A;  3MSW A;  1X49 A;  2ZOA A;  3IWB A;  2LVH A;  4WXD A;  5IT9 C;  2B7V A;  3BBG A;  3H63 A;  2V88 A;  2RSM A;  2V8Q B;  1G2D C;  3H61 A;  5AE3 A;  3VYX A;  3TGH A;  4MLV A;  4ORA A;  2MKD A;  2RTX A;  3H62 B;  2EPZ A;  1IQS A;  1BBO A;  5AC4 A;  4H2B A;  2DRP A;  2EL5 A;  2EM6 A;  2F8B A;  4LTY A;  4ZYE A;  2HJJ A;  3ADJ A;  1MGT A;  2O8G A;  2CTD A;  2EM2 A;  2EOI A;  4M30 A;  4DMI A;  4ORB A;  3ADI A;  2XMO A;  2EOS A;  4R8O A;  3EPL A;  3K7W C;  1FKA E;  2Z06 A;  2N3G A;  3K6Q A;  2KKN A;  4WPY A;  4KBP A;  4BC9 A;  2EOZ A;  1HNZ E;  2MDR A;  1XNR E;  2EPR A;  4O5G A;  2YTI A;  2LTS A;  3FIG A;  4BC7 A;  4OX9 E;  4DV3 E;  1XZW A;  3PSO A;  3LL8 A;  2IAE C;  2EZ6 A;  3KBP A;  2E72 A;  2J7J A;  2K7I A;  1YPN A;  3JTZ A;  3FLO A;  1NNW A;  2H36 X;  3T1H E;  3TQM A;  1STU A;  4TUI A;  3GVE A;  2EPN A;  1X48 A;  3ZOQ B;  2L33 A;  1YYO A;  1Z1B A;  4I5L C;  1IBM E;  1AH5 A;  1NEI A;  2NUG A;  2LRS A;  2YTP A;  1T4L B;  4LF6 E;  1SFE A;  4R2A A;  1S95 A;  2EMW A;  1X6F A;  1T71 A;  1RQ0 A;  5KL4 A;  2N3H A;  4WFT A;  3IB7 A;  3F6G A;  1X6E A;  2DB2 A;  2DIX A;  2YZT A;  3HPS A;  5IXM B;  1LLM C;  1UHZ A;  3MHS C;  2EMX A;  3C4B A;  2L2K B;  4M2Z A;  2LJU A;  2O8A A;  1FJM A;  1WHN A;  1HNW E;  1BB8 A;  2IE4 C;  3D03 A;  1IT6 A;  2M4I A;  5A6A A;  2HY1 A;  4HTG A;  3LLH A;  2EQ3 A;  4H1S A;  1V73 A;  3VK6 A;  4DV5 E;  4F6N A;  3QFM A;  4L8N A;  1YZ9 A;  1S3N A;  3ICF A;  4WYQ B;  1UBD C;  4LAC C;  1T70 A;  5A6K A;  3RQZ A;  3C5W C;  3EPJ A;  2VQF E;  5A6B D;  4R2S A;  3PSN A;  2JOX A;  4DV6 E;  3T1Y E;  4JI5 E;  1A1K A;  2ENA A;  2BCD A;  1KYQ A;  5IOH A;  1EKZ A;  3ZU0 A;  2ZO9 B;  3THO B;  2RPC A;  5F3W A;  2ODR D;  1UIL A;  4R2C A;  2EOE A;  2JYA A;  3THN A;  1FJG E;  4TUG A;  2VF1 A;  4BCA A;  1ZR9 A;  2LJH A;  5AE2 A;  1S70 A;  2DXL A;  4Q35 B;  2EPP A;  1UTE A;  2EN4 A;  3H66 A;  1ZBQ A;  1S8E A;  4NHR A;  1T39 A;  1X6H A;  2YTJ A;  4FBQ A;  2WBU A;  1YYK A;  5JJT A;  1N33 E;  4Q7F A;  1GTK A;  2JXP A;  4J8Z A;  2EN1 A;  2YTG A;  5J28 A;  2JPA A;  2EM5 A;  3OML A;  5BR8 E;  2CT1 A;  1YUI A;  2YWQ A;  2NAB A;  1QNT A;  3CK2 A;  3HQ1 A;  4WX9 A;  2EOH A;  4YKE A;  3DJW A;  4F9B B;  4B3M E;  2M7Q A;  4IJD A;  5IWA E;  1WAR A;  2EPA A;  4LF4 E;  4JV5 E;  3ADG A;  2QJC A;  3MHH C;  2IHR 1;  4V0X A;  2UUC E;  3QFO A;  1B69 A;  1XMO E;  3M99 B;  4X62 E;  2LMZ A;  2EOO A;  4M0V A;  4WWL A;  2LE2 A;  2LCE A;  3AV0 A;  5T6J A;  2GLI A;  1ZAA C;  1AUI A;  4MOY A;  1T4N A;  3KZZ A;  2RS6 A;  2NUE A;  3KWR A;  1A1H A;  1N3G A;  5A6J A;  3P71 C;  4UT2 A;  2UUA E;  3H69 A;  1G5B A;  2BB8 A;  2GHF A;  2UUB E;  4LU9 A;  2DMY A;  2L92 A;  2MC6 A;  2AHD A;  4JI3 E;  4DUZ E;  3HTX A;  2DMI A;  1GZ6 A;  1J5E E;  5GTU A;  4DSY A;  2CPN A;  1A1F A;  3IVD A;  2EPK X;  1F2I G;  2WCC 3;  2YTN A;  3VHT B;  3EGH A;  1WRJ A;  2G7H A;  2GJU A;  2EN7 A;  1A1J A;  4V0V A;  5FLX C;  4AQY E;  1O0W A;  3J80 C;  2UXB E;  2L3C A;  3IWD A;  2UXC E;  1USH A;  2WDF A;  3DW8 C;  5KL7 A;  1DGC A;  3DSC A;  2EMG A;  4GZN C;  2NYL C;  2HHH E;  2EPM X;  4HEI A;  4DKK A;  1JK1 A;  4DR5 E;  1AAY A;  1HPU A;  4JI8 E;  2L2M A;  4KZS A;  5KL2 A;  3DF6 A;  4O24 A;  3LML A;  1IQO A;  2DSY A;  4KKZ A;  4ZYD A;  3H60 A;  4FCX A;  4DR1 E;  4MOV A;  2R17 A;  4WSP A;  5LLQ A;  4LFC E;  5KL3 A;  1EH8 A;  2DLK A;  2JOB A;  3KZY A;  1EH6 A;  5A6B A;  4R2D A;  1G2F C;  3V4Y A;  1TCO A;  4YHH E;  1YSA C;  4UT3 A;  1EH7 A;  1HO5 A;  1YYW A;  4IL1 A;  4BHB A;  2I13 A;  4DV1 E;  4UWQ A;  5AC5 A;  2UXD E;  4ZYG A;  2LV2 A;  1L4S A;  5ADZ A;  2YEQ A;  2E5L E;  4ZX2 A;  5LMU E;  4R2Q A;  2EM0 A;  2KOU A;  4LF8 E;  2EL4 A;  1T4O A;  2EOQ A;  2MDG A;  4JA9 A;  2DLQ A;  4OR9 A;  1YUJ A;  4F9C B;  3ZTV A;  1XNQ E;  4H1Y P;  2EN3 A;  4JI7 E;  4O43 A;  2V86 A;  4FK5 C;  1PJT A;  1TN9 A;  4GKJ E;  1IBL E;  1OID A;  2Z72 A;  4DR6 E;  4NXM E;  4H2F A;  4DV0 E;  2B9D A;  4JI4 E;  4BHC A;  4IS1 C;  5KL6 A;  2EPC A;  5LMN E;  2JP9 A;  2UU9 E;  3EGG A;  4P78 A;  4DUY E;  4DR4 E;  2CSH A;  2EN2 A;  2DGC A;  4P7D A;  4JI2 E;  3F6H A;  1U32 A;  2RSI A;  4GEQ B;  4F0Z A;  5JPF A;  1OI8 A;  2YVT A;  2ZBM A;  2MC5 A;  1DQ3 A;  2EOY A;  2B3T B;  4DV7 E;  4ZVZ A;  4B2O A;  4WSG A;  2LUQ A;  4I5N C;  4UT3 B;  2VRD A;  2B7T A;  4JI0 E;  4JI6 E;  4B3R E;  2RQL A;  1MEY C;  2YTO A;  2EP3 A;  2L8T A;  2L3J A;  5DNY A;  1PKP A;  1X47 A;  2V85 A;  1QFC A;  1J26 A;  2QFP A;  3H68 A;  2EMZ A;  3FGA C;  2YTE A;  1SR9 A;  2EM7 A;  3RMP A;  4DV2 E; 
#chains in the Genus database with same CATH homology
 4FBK A;  3AV0 A;  1AUI A;  1Z2X A;  3QFK A;  4H2G A;  4I5L C;  4MOY A;  1JK7 A;  4V0W A;  1KBP A;  1WAO 1;  1MF8 A;  2BDX A;  3P71 C;  4UT2 A;  1S95 A;  3H69 A;  1G5B A;  1T71 A;  3HVQ A;  1S3M A;  3H64 A;  3RL4 A;  4LU9 A;  3IB7 A;  1M63 A;  2AHD A;  1W24 A;  4DSY A;  5GTU A;  3IVD A;  1SU1 A;  2DXN A;  2O8A A;  1FJM A;  3EGH A;  3IVE A;  4O4K A;  2GJU A;  4V0V A;  2NPP C;  2IE4 C;  3D03 A;  1UF3 A;  1IT6 A;  3E7B A;  2HY1 A;  5EQV A;  1USH A;  2Z1A A;  2WDF A;  3DW8 C;  4H1S A;  1V73 A;  1QHW A;  3QFM A;  3DSC A;  3T1I A;  1OIE A;  2NYL C;  5JPE A;  3DSD A;  1S3N A;  3ICF A;  2IE3 C;  4LAC C;  1Z2W A;  1HPU A;  3QG5 C;  1T70 A;  3RQZ A;  3C5W C;  4O24 A;  5B8I A;  4JA7 A;  4KKZ A;  3H60 A;  4FCX A;  4MP0 A;  4MOV A;  2R17 A;  3E0J A;  4FBW A;  3PSN A;  4XPN A;  2P6B A;  2WDC A;  3V4Y A;  1S3L A;  2USH A;  2A22 A;  1TCO A;  2BCD A;  4UT3 A;  2HYP A;  1HP1 A;  4NZV A;  1HO5 A;  5IOH A;  1XM7 A;  3ZU0 A;  4IL1 A;  2ZO9 B;  3THO B;  2NYM C;  4UWQ A;  2ZOA A;  5F3W A;  2YEQ A;  3THN A;  4H2I A;  4TUG A;  4J6O A;  4ZX2 A;  3H63 A;  2NXF A;  4JA9 A;  3H61 A;  4OR9 A;  3C9F A;  3IB8 A;  3RL5 A;  1S70 A;  3TGH A;  2DXL A;  3ZTV A;  4H1Y P;  2WDD A;  3N5U A;  4ORC A;  4O43 A;  1UTE A;  4ORA A;  3RL3 A;  3H62 B;  3H66 A;  3AUZ A;  4IYP C;  1OID A;  2Z72 A;  1S8E A;  2CV9 A;  4H2F A;  3JYF A;  4FBQ A;  4H2B A;  2BQ8 X;  3K7V C;  5HPE A;  4HD0 A;  3EGG A;  5JJT A;  3E7A A;  4LTY A;  4Q7F A;  5C1V A;  4DHL A;  2O8G A;  2Q8U A;  1U32 A;  5J28 A;  4ORB A;  2XMO A;  4F0Z A;  3K7W C;  5JPF A;  1OI8 A;  2WDE A;  3H67 A;  2Z06 A;  3QFN A;  2YVT A;  2KKN A;  2ZBM A;  3CK2 A;  4KBP A;  4ZVZ A;  4B2O A;  4YKE A;  2HYO A;  4DT2 A;  4O5G A;  1WAR A;  4I5N C;  4UT3 B;  1II7 A;  5INB A;  2QFR A;  1XZW A;  2QJC A;  3PSO A;  3LL8 A;  2DFJ A;  2IAE C;  5DNY A;  2JOG A;  3KBP A;  4G9J A;  2QFP A;  4V0X A;  1QFC A;  3H68 A;  3QFO A;  3FLO A;  1NNW A;  3FGA C;  4TUI A;  3GVE A;  4M0V A;  4WWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...