4O24A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o24A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o24A01
3FGAC 1S8EA 1KBPA 2HY1A 4LU9A 4O5GA 1HPUA 2Q8UA 3DW8C 3K7VC 4TUIA 4B2OA 2O8GA 3H62B 5EQVA 1M63A 4IYPC 4H2GA 3ZTVA 3H61A 3JYFA 1S95A 1II7A 4H1SA 5INBA 3DSCA 5GTUA 4H2IA 5HPEA 3IVDA 1SU1A 3H68A 2JOGA 1WARA 4DT2A 4MOVA 3H63A 4DSYA 4ZX2A 2O8AA 4LACC 1TCOA 2QFRA 3CK2A 4UT2A 5C1VA 1JK7A 1OIEA 3P71C 1XZWA 2IE3C 2IE4C 2WDEA 5IOHA 2IAEC 1XM7A 5DNYA 4H1YP 1OIDA 4M0VA 4ZVZA 3AV0A 3E7AA 4V0VA 2AHDA 3H60A 2Z72A 1S70A 1FJMA 1UF3A 4V0WA 3THNA 2BCDA 4XPNA 2WDDA 1S3MA 1V73A 4NZVA 3N5UA 4YKEA 2CV9A 5JJTA 4KBPA 1S3NA 4J6OA 1HO5A 3IB8A 3EGGA 2P6BA 4ORBA 3T1IA 4ORAA 4JA9A 3PSNA 5F3WA 2KKNA 1G5BA 4H2BA 4HD0A 1AUIA 1W24A 1S3LA 2ZBMA 5JPEA 1OI8A 1Z2XA 1MF8A 3QFNA 2A22A 2WDCA 1T71A 2YVTA 3GVEA 3QFOA 2QJCA 4UT3B 2QFPA 4ORCA 5JPFA 4I5LC 2USHA 4KKZA 4UT3A 3RL3A 3H64A 2GJUA 5B8IA 2NPPC 2BDXA 2HYPA 3THOB 2NYLC 4FBQA 4TUGA 4I5NC 3AUZA 1NNWA 1IT6A 3V4YA 4UWQA 3QFMA 3QFKA 1HP1A 3C9FA 1USHA 2WDFA 3RQZA 4Q7FA 1T70A 3RL5A 3ZU0A 4O43A 3H67A 4IL1A 4OR9A 4MOYA 4V0XA 2NXFA 2BQ8X 3EGHA 1QFCA 1UTEA 2R17A 3H69A 1QHWA 4FCXA 2Z06A 3LL8A 4FBKA 3IVEA 1Z2WA 4DHLA 4H2FA 2Z1AA 4MP0A 4F0ZA 3KBPA 4O4KA 3IB7A 3C5WC 2XMOA 3RL4A 3DSDA 3QG5C 1U32A 4O24A 2NYMC 3ICFA 4JA7A 4G9JA 5J28A 3H66A 4FBWA 1WAO1 3E7BA 2DFJA 3HVQA 2HYOA 4LTYA 3K7WC 3PSOA 4WWLA 3TGHA
chains in the Genus database with same CATH superfamily
4M9VC 5IWAE 4BHCA 2JP9A 2RS7A 4R2SA 2EPKX 3DW8C 4R2EA 2EMLA 4X8WA 4JI5E 1NCSA 3H62B 4GEQB 3MSWA 2EMKA 4WX9A 2DB2A 4RH8A 1AH5A 1RMDA 2EOSA 1S95A 3DSCA 4LF7E 2EZ6A 2VQFE 4WXCA 2E72A 2YTPA 5HPEA 2EOZA 1WHQA 2EMWA 2LJHA 1LLMC 1SU1A 4ZX2A 4DV5E 4BMJA 2NUEA 3ECRA 5C1VA 2EQ0A 3P71C 2IE4C 5A6BA 3D03A 2WBTA 3F6GA 2YTEA 1HNZE 2EWLA 1OIDA 2UU9E 4ZVZA 3AV0A 3H60A 2I13A 4V0WA 1F2IG 2GHFA 3THNA 2EM9A 4XPNA 2WDDA 4YKEA 1HNXE 1EH8A 2A25A 1N32E 4J6OA 1HO5A 3IB8A 5AE1A 1A1LA 3EGGA 2P6BA 4ORBA 4ORAA 2HGHA 5F3WA 1A1KA 2ELYA 1TF3A 5LMUE 3J81C 4JI3E 4NXME 1UN6B 1AUIA 1G5BA 1W24A 3EPJA 4H2BA 5TSEA 5FLXC 3QFOA 2YTIA 3ADJA 2VF1A 2QJCA 2EMGA 4UT3B 4ORCA 2YT4A 2JPAA 3RL3A 2EPZA 3BF2A 2M4IA 5KL2A 1NEIA 2R1FA 2EM4A 1NNWA 4NHRA 1PJTA 3IWBA 2LT7A 4HEIA 5KL7A 4LF6E 4Q7FA 5AC5A 2L92A 1GQEA 3L00A 4WSGA 2V83A 5CFFE 1YSAC 2EPLX 2KONA 4GKKE 1HNWE 4MOYA 5AE2A 2MDGA 2ENCA 4R2QA 2MKNA 1N33E 3EGHA 3LMLA 4ZYDA 1UTEA 2R17A 4JV5E 4B3SE 1QHWA 2V89A 3LL8A 4AQYE 2L2NA 1XMQE 4JYAE 4YHHE 2YSOA 2EN2A 5AC4A 4R2CA 1X6EA 4DV7E 1JK2A 1YPNA 2EOJA 1UILA 5AE3A 3ADGA 2CT1A 3C5WC 1YZ9A 2MDRA 3VHTB 2FTXB 1PJSA 2LJUA 1PJQA 4BCAA 1FKAE 3J7Yp 3H66A 2WCC3 3T1YE 3JAMC 3E7BA 1A1JA 4DV3E 3HVQA 2HYOA 4F54A 3EQ1A 2B3TB 5A6BD 3K7WC 4WWLA 1QNTA 1IBKE 2L6MA 1B69A 4BS9A 2DRPA 5AASA 1KBPA 2HY1A 3EPHA 1IQOA 1EH7A 1HR0E 3HPSA 3K7VC 2G7HA 2EOYA 2LUQA 3JTZA 2V8QB 2JY9A 3ZTVA 3K6QA 3KZYA 2FGGA 3H61A 2M9AA 2LE2A 1II7A 5INBA 5GTUA 2EM5A 5A6AA 2K7IA 3E0JA 1A1HA 4DT2A 3FLOA 2EOHA 5IT9C 2ENHA 2D9HA 2YWQA 1JK1A 2RTXA 2EN6A 2NABA 2E5LE 2LMZA 1X6FA 2O8AA 4LACC 2EN1A 4UT2A 2EM7A 1OIEA 2KHXA 4M30A 5DNYA 2ZOAA 4M0VA 4LF4E 4J8ZA 1IMUA 2Z72A 2YRKA 1S70A 2CTDA 4R2AA 1N34E 3C4TA 3J7AG 1WJPA 2ODRD 3N5UA 5LLQA 1YUIA 2R76A 1YYWA 3JU0A 4JI2E 2LVHA 2V87A 1Z2XA 3DJWA 1XNQE 1T71A 4JI8E 2NUGA 4R2PA 1BBGA 3IWCA 3F6HA 5JPFA 2UUCE 3VYXA 2GJUA 2NPPC 3EPLA 5A6JA 2WBSA 1X3CA 4X9JA 4LF5E 1ZAAC 2NYLC 4TUGA 4I5NC 1SFEA 1P47A 1IT6A 3C6MA 2IHR1 2HJJA 3V4YA 5KL4A 2EPNA 4UWQA 3ADIA 3QFKA 1I94E 1HP1A 3RMPA 2JOXA 4JI6E 2UUBE 3RL5A 3IWDA 1T39A 1L4SA 2EN7A 2RSIA 2EQ3A 5A69A 1YYOA 2EOXA 1STUA 1WXRA 2EPPA 2ODRC 1TN9A 1QFCA 3H69A 3H09A 4R03A 2Z06A 4FBKA 1WRJA 2EPUA 1J5EE 2YU8A 2GLIA 1T38A 4F0ZA 3KBPA 3IB7A 4WXDA 3HPZA 1GZ6A 2EL6A 2YRHA 4WSPA 3KWRA 4JI1E 1DI2A 2XMOA 2EL5A 1U32A 4ZYHA 4LFAE 3EPKA 2ADRA 4N4RB 2NUFA 4DUZE 5ADZA 1X6HA 2EJ4A 4LF8E 2YZTA 2EM8A 3PSOA 2WBUA 3FGAC 4O5GA 1HPUA 2EOQA 2DSYA 4R8OA 1X47A 2EMZA 4B2OA 4LFBE 5EQVA 2NA2A 2RQLA 4H2GA 4B3ME 3P1XA 4WFTA 3JYFA 2JYAA 4DMIA 5KL5A 2UUAE 4MLQA 4R2DA 1ZU1A 3OTOE 2WZOA 5IV8B 3IVDA 3H68A 1ZR9A 2JXPA 1PKPA 2N8XA 2UXCE 3H63A 2LUPB 3CK2A 1KJKA 2WDEA 2EM0A 2N3HA 1XM7A 2EPOA 1PDAA 5T6JA 3E7AA 2EOMA 2AHDA 1UF3A 1X49A 2EMYA 2L2KB 2B7TA 2J7JA 2BCDA 1V73A 5JJTA 3LLHA 1UBDC 4KBPA 3TGHA 4I8OA 4GZNC 2EPAA 2MKDA 2L3JA 4F6MA 4JI4E 4WYQB 2RSMA 4F9AB 1S3LA 2ZBMA 1IBME 4DUYE 4DR5E 1OI8A 1MF8A 4BBYA 2YRMA 2WDCA 1EH6A 2YVTA 3GVEA 2RPCA 2BB8A 1X48A 2EQ1A 3FIGA 2F4VE 2QFPA 4I5LC 2USHA 4KKZA 4X66E 1O0WA 1Z1BA 3H64A 2L3CA 4B3RE 4L5NC 2EOIA 2HYPA 3THOB 4L8NA 5KL3A 1TF6A 1N3GA 2ENAA 4YY3E 1A1FA 2KOUA 1EKZA 4WPYA 1T4LB 1N36E 2B9DA 3QFMA 4DV6E 2JVAA 3VK6A 1USHA 2EMAA 2DXLA 3C9FA 2LCEA 3C4BA 2EN4A 3UK3C 2PRTA 1DQ3A 4OX9E 1T70A 2V88A 3H67A 2EPXA 1A1GA 2EPRA 3BBGA 1FJGE 2YTNA 2EMXA 2EP3A 4FCXA 2EOFA 2FV4B 2EOOA 2L8TA 4IJDA 4H2FA 4DV0E 2Z1AA 3C6KA 1AAYA 4O4KA 1BBOA 1MEYC 2EMFA 1RC7A 2EN3A 2YEQA 4DR6E 4F9CB 3RL4A 2EMBA 2ELZA 2CSHA 3KZZA 3QG5C 4DV4E 1IBLE 4JA7A 1SR9A 4G9JA 4ZYGA 1GTKA 2M7QA 5A2QC 2V86A 1T4NA 2E1MA 1DGCA 2LV2A 1WAO1 3BGHA 4F2JC 3ADLA 2DFJA 4GKJE 1J26A 4LTYA 1UHZA 4DR4E 2YTFA 4R2RA 2UXDE 2EL4A 1MGTA 1T4OA 1S8EA 4LU9A 1A1IA 4JI0E 1X5WA 2Q8UA 2EORA 3ZOQB 4TUIA 3HQ1A 4X62E 2O8GA 2L2MA 1M63A 3MHHC 4IYPC 2ZM6E 4H1SA 2LTSA 4OOGC 4H2IA 2N3GA 3VYYA 4BC7A 4KHPE 2JOGA 1WARA 4MOVA 2YU5A 1ZBQA 4DSYA 2YSPA 1TCOA 2EM6A 4DV2E 2QFRA 2VRDA 4M2ZA 1G2FC 1JK7A 4P78A 1XZWA 2IE3C 5IOHA 2DXNA 4HTGA 2IAEC 4DKKA 2DMIA 4H1YP 4KWYA 4V0VA 4F9BB 1QU6A 2CPNA 3J80C 3M99B 1FJMA 4X64E 2YTQA 2MC5A 2DMYA 1S3MA 4NZVA 2CV9A 2YTOA 1S3NA 1BB8A 4DR3E 2DLKA 4JI7E 3T1IA 4JA9A 3PSNA 1KYQA 1IQSA 2KKNA 2BBGA 2V85A 4Q35B 4HD0A 4DR7E 5JPEA 2YTGA 2EPCA 4P7DA 1XNRE 3QFNA 2VE7C 2A22A 5LMNE 2YTDA 2JWOA 1YYKA 3OMLA 5A6KA 2LO3A 4UT3A 2EE8A 3T1HE 2K4VA 5B8IA 2DIXA 2BDXA 4LF9E 4IS1C 2B7VA 3MHSC 4FBQA 2EMCA 4DR1E 2LTRA 4LFCE 2LRSA 3AUZA 2EMHA 1G2DC 2WDFA 4MLVA 1ZBTA 2L33A 3RQZA 2DLQA 2JOBA 5LL6R 3ZU0A 4O43A 2EM2A 2RS6A 5KL6A 4IL1A 4X65E 4OR9A 4ZYEA 4V0XA 2NXFA 2BQ8X 4RHBB 1XMOE 2EPMX 4KZSA 2I9IA 3DF6A 2HC5A 2M1SA 1RQ0A 2EOEA 2MC6A 1YFHA 2DGCA 4B3TE 3HTXA 3IVEA 2EMIA 2F8BA 2H36X 2YPNA 1Z2WA 4DHLA 2YTJA 3TQMA 4MP0A 2HHHE 2EM3A 3BIDA 2EN8A 1WHNA 5BR8E 1YUJA 4DR2E 4NXNE 4K0KE 5IXMB 3DSDA 4BHBA 4FK5C 2JR1A 4DV1E 4O24A 2NYMC 4Q28A 3ICFA 2VQEE 2GPIA 5J28A 4BC9A 4F6NA 2UXBE 4FBWA 3HXLA 2LBSB 2ZO9B
chains in the Genus database with same CATH topology
3FGAC 1S8EA 1KBPA 2HY1A 4LU9A 4O5GA 1HPUA 2Q8UA 3DW8C 3K7VC 4TUIA 4B2OA 2O8GA 3H62B 5EQVA 1M63A 4IYPC 4H2GA 3ZTVA 3H61A 3JYFA 1S95A 1II7A 4H1SA 3DSCA 5INBA 5GTUA 4H2IA 3E0JA 3IVDA 1SU1A 3H68A 2JOGA 1WARA 4DT2A 3FLOA 4MOVA 3H63A 4DSYA 4ZX2A 2O8AA 4LACC 1TCOA 2QFRA 3CK2A 4UT2A 5C1VA 1JK7A 1OIEA 3P71C 1XZWA 2IE3C 2IE4C 2WDEA 5IOHA 2DXNA 3D03A 2IAEC 1XM7A 2ZOAA 5DNYA 4H1YP 1OIDA 4M0VA 4ZVZA 3AV0A 3E7AA 4V0VA 2AHDA 3H60A 2Z72A 1S70A 1FJMA 1UF3A 4V0WA 3THNA 2BCDA 4XPNA 2WDDA 1S3MA 1V73A 4NZVA 3N5UA 4YKEA 2CV9A 5JJTA 4KBPA 1S3NA 4J6OA 1HO5A 3TGHA 3IB8A 3EGGA 2P6BA 4ORBA 3T1IA 4ORAA 4JA9A 3PSNA 5F3WA 2KKNA 1G5BA 4H2BA 4HD0A 1AUIA 1W24A 1S3LA 2ZBMA 5JPEA 1OI8A 1Z2XA 1MF8A 3QFNA 2A22A 2WDCA 1T71A 2YVTA 3GVEA 3QFOA 2QJCA 4UT3B 2QFPA 4ORCA 5JPFA 4I5LC 2USHA 4KKZA 4UT3A 3RL3A 3H64A 2GJUA 5B8IA 2NPPC 2BDXA 2HYPA 3THOB 2NYLC 4FBQA 4TUGA 4I5NC 3AUZA 1NNWA 1IT6A 3V4YA 4UWQA 3QFMA 3QFKA 1HP1A 2DXLA 1USHA 3C9FA 2WDFA 3RQZA 4Q7FA 1T70A 3RL5A 3ZU0A 4O43A 3H67A 4IL1A 4OR9A 4MOYA 4V0XA 2NXFA 2BQ8X 3EGHA 1QFCA 1UTEA 2R17A 3H69A 1QHWA 4FCXA 2Z06A 3LL8A 4FBKA 3IVEA 1Z2WA 4DHLA 4H2FA 5HPEA 2Z1AA 4MP0A 4F0ZA 3KBPA 4O4KA 3IB7A 2YEQA 3C5WC 2XMOA 3RL4A 3DSDA 3QG5C 1U32A 4O24A 2NYMC 3ICFA 4JA7A 4G9JA 5J28A 3H66A 4FBWA 1WAO1 3E7BA 2DFJA 3HVQA 2HYOA 4LTYA 3K7WC 3PSOA 4WWLA 2ZO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA C;  1S8E A;  1KBP A;  2HY1 A;  4LU9 A;  4O5G A;  1HPU A;  2Q8U A;  3DW8 C;  3K7V C;  4TUI A;  4B2O A;  2O8G A;  3H62 B;  5EQV A;  1M63 A;  4IYP C;  4H2G A;  3ZTV A;  3H61 A;  3JYF A;  1S95 A;  1II7 A;  4H1S A;  5INB A;  3DSC A;  5GTU A;  4H2I A;  5HPE A;  3IVD A;  1SU1 A;  3H68 A;  2JOG A;  1WAR A;  4DT2 A;  4MOV A;  3H63 A;  4DSY A;  4ZX2 A;  2O8A A;  4LAC C;  1TCO A;  2QFR A;  3CK2 A;  4UT2 A;  5C1V A;  1JK7 A;  1OIE A;  3P71 C;  1XZW A;  2IE3 C;  2IE4 C;  2WDE A;  5IOH A;  2IAE C;  1XM7 A;  5DNY A;  4H1Y P;  1OID A;  4M0V A;  4ZVZ A;  3AV0 A;  3E7A A;  4V0V A;  2AHD A;  3H60 A;  2Z72 A;  1S70 A;  1FJM A;  1UF3 A;  4V0W A;  3THN A;  2BCD A;  4XPN A;  2WDD A;  1S3M A;  1V73 A;  4NZV A;  3N5U A;  4YKE A;  2CV9 A;  5JJT A;  4KBP A;  1S3N A;  4J6O A;  1HO5 A;  3IB8 A;  3EGG A;  2P6B A;  4ORB A;  3T1I A;  4ORA A;  4JA9 A;  3PSN A;  5F3W A;  2KKN A;  1G5B A;  4H2B A;  4HD0 A;  1AUI A;  1W24 A;  1S3L A;  2ZBM A;  5JPE A;  1OI8 A;  1Z2X A;  1MF8 A;  3QFN A;  2A22 A;  2WDC A;  1T71 A;  2YVT A;  3GVE A;  3QFO A;  2QJC A;  4UT3 B;  2QFP A;  4ORC A;  5JPF A;  4I5L C;  2USH A;  4KKZ A;  4UT3 A;  3RL3 A;  3H64 A;  2GJU A;  5B8I A;  2NPP C;  2BDX A;  2HYP A;  3THO B;  2NYL C;  4FBQ A;  4TUG A;  4I5N C;  3AUZ A;  1NNW A;  1IT6 A;  3V4Y A;  4UWQ A;  3QFM A;  3QFK A;  1HP1 A;  3C9F A;  1USH A;  2WDF A;  3RQZ A;  4Q7F A;  1T70 A;  3RL5 A;  3ZU0 A;  4O43 A;  3H67 A;  4IL1 A;  4OR9 A;  4MOY A;  4V0X A;  2NXF A;  2BQ8 X;  3EGH A;  1QFC A;  1UTE A;  2R17 A;  3H69 A;  1QHW A;  4FCX A;  2Z06 A;  3LL8 A;  4FBK A;  3IVE A;  1Z2W A;  4DHL A;  4H2F A;  2Z1A A;  4MP0 A;  4F0Z A;  3KBP A;  4O4K A;  3IB7 A;  3C5W C;  2XMO A;  3RL4 A;  3DSD A;  3QG5 C;  1U32 A;  4O24 A;  2NYM C;  3ICF A;  4JA7 A;  4G9J A;  5J28 A;  3H66 A;  4FBW A;  1WAO 1;  3E7B A;  2DFJ A;  3HVQ A;  2HYO A;  4LTY A;  3K7W C;  3PSO A;  4WWL A;  3TGH A; 
#chains in the Genus database with same CATH topology
 4M9V C;  5IWA E;  4BHC A;  2JP9 A;  2RS7 A;  4R2S A;  2EPK X;  3DW8 C;  4R2E A;  2EML A;  4X8W A;  4JI5 E;  1NCS A;  3H62 B;  4GEQ B;  3MSW A;  2EMK A;  4WX9 A;  2DB2 A;  4RH8 A;  1AH5 A;  1RMD A;  2EOS A;  1S95 A;  3DSC A;  4LF7 E;  2EZ6 A;  2VQF E;  4WXC A;  2E72 A;  2YTP A;  5HPE A;  2EOZ A;  1WHQ A;  2EMW A;  2LJH A;  1LLM C;  1SU1 A;  4ZX2 A;  4DV5 E;  4BMJ A;  2NUE A;  3ECR A;  5C1V A;  2EQ0 A;  3P71 C;  2IE4 C;  5A6B A;  3D03 A;  2WBT A;  3F6G A;  2YTE A;  1HNZ E;  2EWL A;  1OID A;  2UU9 E;  4ZVZ A;  3AV0 A;  3H60 A;  2I13 A;  4V0W A;  1F2I G;  2GHF A;  3THN A;  2EM9 A;  4XPN A;  2WDD A;  4YKE A;  1HNX E;  1EH8 A;  2A25 A;  1N32 E;  4J6O A;  1HO5 A;  3IB8 A;  5AE1 A;  1A1L A;  3EGG A;  2P6B A;  4ORB A;  4ORA A;  2HGH A;  5F3W A;  1A1K A;  2ELY A;  1TF3 A;  5LMU E;  3J81 C;  4JI3 E;  4NXM E;  1UN6 B;  1AUI A;  1G5B A;  1W24 A;  3EPJ A;  4H2B A;  5TSE A;  5FLX C;  3QFO A;  2YTI A;  3ADJ A;  2VF1 A;  2QJC A;  2EMG A;  4UT3 B;  4ORC A;  2YT4 A;  2JPA A;  3RL3 A;  2EPZ A;  3BF2 A;  2M4I A;  5KL2 A;  1NEI A;  2R1F A;  2EM4 A;  1NNW A;  4NHR A;  1PJT A;  3IWB A;  2LT7 A;  4HEI A;  5KL7 A;  4LF6 E;  4Q7F A;  5AC5 A;  2L92 A;  1GQE A;  3L00 A;  4WSG A;  2V83 A;  5CFF E;  1YSA C;  2EPL X;  2KON A;  4GKK E;  1HNW E;  4MOY A;  5AE2 A;  2MDG A;  2ENC A;  4R2Q A;  2MKN A;  1N33 E;  3EGH A;  3LML A;  4ZYD A;  1UTE A;  2R17 A;  4JV5 E;  4B3S E;  1QHW A;  2V89 A;  3LL8 A;  4AQY E;  2L2N A;  1XMQ E;  4JYA E;  4YHH E;  2YSO A;  2EN2 A;  5AC4 A;  4R2C A;  1X6E A;  4DV7 E;  1JK2 A;  1YPN A;  2EOJ A;  1UIL A;  5AE3 A;  3ADG A;  2CT1 A;  3C5W C;  1YZ9 A;  2MDR A;  3VHT B;  2FTX B;  1PJS A;  2LJU A;  1PJQ A;  4BCA A;  1FKA E;  3J7Y p;  3H66 A;  2WCC 3;  3T1Y E;  3JAM C;  3E7B A;  1A1J A;  4DV3 E;  3HVQ A;  2HYO A;  4F54 A;  3EQ1 A;  2B3T B;  5A6B D;  3K7W C;  4WWL A;  1QNT A;  1IBK E;  2L6M A;  1B69 A;  4BS9 A;  2DRP A;  5AAS A;  1KBP A;  2HY1 A;  3EPH A;  1IQO A;  1EH7 A;  1HR0 E;  3HPS A;  3K7V C;  2G7H A;  2EOY A;  2LUQ A;  3JTZ A;  2V8Q B;  2JY9 A;  3ZTV A;  3K6Q A;  3KZY A;  2FGG A;  3H61 A;  2M9A A;  2LE2 A;  1II7 A;  5INB A;  5GTU A;  2EM5 A;  5A6A A;  2K7I A;  3E0J A;  1A1H A;  4DT2 A;  3FLO A;  2EOH A;  5IT9 C;  2ENH A;  2D9H A;  2YWQ A;  1JK1 A;  2RTX A;  2EN6 A;  2NAB A;  2E5L E;  2LMZ A;  1X6F A;  2O8A A;  4LAC C;  2EN1 A;  4UT2 A;  2EM7 A;  1OIE A;  2KHX A;  4M30 A;  5DNY A;  2ZOA A;  4M0V A;  4LF4 E;  4J8Z A;  1IMU A;  2Z72 A;  2YRK A;  1S70 A;  2CTD A;  4R2A A;  1N34 E;  3C4T A;  3J7A G;  1WJP A;  2ODR D;  3N5U A;  5LLQ A;  1YUI A;  2R76 A;  1YYW A;  3JU0 A;  4JI2 E;  2LVH A;  2V87 A;  1Z2X A;  3DJW A;  1XNQ E;  1T71 A;  4JI8 E;  2NUG A;  4R2P A;  1BBG A;  3IWC A;  3F6H A;  5JPF A;  2UUC E;  3VYX A;  2GJU A;  2NPP C;  3EPL A;  5A6J A;  2WBS A;  1X3C A;  4X9J A;  4LF5 E;  1ZAA C;  2NYL C;  4TUG A;  4I5N C;  1SFE A;  1P47 A;  1IT6 A;  3C6M A;  2IHR 1;  2HJJ A;  3V4Y A;  5KL4 A;  2EPN A;  4UWQ A;  3ADI A;  3QFK A;  1I94 E;  1HP1 A;  3RMP A;  2JOX A;  4JI6 E;  2UUB E;  3RL5 A;  3IWD A;  1T39 A;  1L4S A;  2EN7 A;  2RSI A;  2EQ3 A;  5A69 A;  1YYO A;  2EOX A;  1STU A;  1WXR A;  2EPP A;  2ODR C;  1TN9 A;  1QFC A;  3H69 A;  3H09 A;  4R03 A;  2Z06 A;  4FBK A;  1WRJ A;  2EPU A;  1J5E E;  2YU8 A;  2GLI A;  1T38 A;  4F0Z A;  3KBP A;  3IB7 A;  4WXD A;  3HPZ A;  1GZ6 A;  2EL6 A;  2YRH A;  4WSP A;  3KWR A;  4JI1 E;  1DI2 A;  2XMO A;  2EL5 A;  1U32 A;  4ZYH A;  4LFA E;  3EPK A;  2ADR A;  4N4R B;  2NUF A;  4DUZ E;  5ADZ A;  1X6H A;  2EJ4 A;  4LF8 E;  2YZT A;  2EM8 A;  3PSO A;  2WBU A;  3FGA C;  4O5G A;  1HPU A;  2EOQ A;  2DSY A;  4R8O A;  1X47 A;  2EMZ A;  4B2O A;  4LFB E;  5EQV A;  2NA2 A;  2RQL A;  4H2G A;  4B3M E;  3P1X A;  4WFT A;  3JYF A;  2JYA A;  4DMI A;  5KL5 A;  2UUA E;  4MLQ A;  4R2D A;  1ZU1 A;  3OTO E;  2WZO A;  5IV8 B;  3IVD A;  3H68 A;  1ZR9 A;  2JXP A;  1PKP A;  2N8X A;  2UXC E;  3H63 A;  2LUP B;  3CK2 A;  1KJK A;  2WDE A;  2EM0 A;  2N3H A;  1XM7 A;  2EPO A;  1PDA A;  5T6J A;  3E7A A;  2EOM A;  2AHD A;  1UF3 A;  1X49 A;  2EMY A;  2L2K B;  2B7T A;  2J7J A;  2BCD A;  1V73 A;  5JJT A;  3LLH A;  1UBD C;  4KBP A;  3TGH A;  4I8O A;  4GZN C;  2EPA A;  2MKD A;  2L3J A;  4F6M A;  4JI4 E;  4WYQ B;  2RSM A;  4F9A B;  1S3L A;  2ZBM A;  1IBM E;  4DUY E;  4DR5 E;  1OI8 A;  1MF8 A;  4BBY A;  2YRM A;  2WDC A;  1EH6 A;  2YVT A;  3GVE A;  2RPC A;  2BB8 A;  1X48 A;  2EQ1 A;  3FIG A;  2F4V E;  2QFP A;  4I5L C;  2USH A;  4KKZ A;  4X66 E;  1O0W A;  1Z1B A;  3H64 A;  2L3C A;  4B3R E;  4L5N C;  2EOI A;  2HYP A;  3THO B;  4L8N A;  5KL3 A;  1TF6 A;  1N3G A;  2ENA A;  4YY3 E;  1A1F A;  2KOU A;  1EKZ A;  4WPY A;  1T4L B;  1N36 E;  2B9D A;  3QFM A;  4DV6 E;  2JVA A;  3VK6 A;  1USH A;  2EMA A;  2DXL A;  3C9F A;  2LCE A;  3C4B A;  2EN4 A;  3UK3 C;  2PRT A;  1DQ3 A;  4OX9 E;  1T70 A;  2V88 A;  3H67 A;  2EPX A;  1A1G A;  2EPR A;  3BBG A;  1FJG E;  2YTN A;  2EMX A;  2EP3 A;  4FCX A;  2EOF A;  2FV4 B;  2EOO A;  2L8T A;  4IJD A;  4H2F A;  4DV0 E;  2Z1A A;  3C6K A;  1AAY A;  4O4K A;  1BBO A;  1MEY C;  2EMF A;  1RC7 A;  2EN3 A;  2YEQ A;  4DR6 E;  4F9C B;  3RL4 A;  2EMB A;  2ELZ A;  2CSH A;  3KZZ A;  3QG5 C;  4DV4 E;  1IBL E;  4JA7 A;  1SR9 A;  4G9J A;  4ZYG A;  1GTK A;  2M7Q A;  5A2Q C;  2V86 A;  1T4N A;  2E1M A;  1DGC A;  2LV2 A;  1WAO 1;  3BGH A;  4F2J C;  3ADL A;  2DFJ A;  4GKJ E;  1J26 A;  4LTY A;  1UHZ A;  4DR4 E;  2YTF A;  4R2R A;  2UXD E;  2EL4 A;  1MGT A;  1T4O A;  1S8E A;  4LU9 A;  1A1I A;  4JI0 E;  1X5W A;  2Q8U A;  2EOR A;  3ZOQ B;  4TUI A;  3HQ1 A;  4X62 E;  2O8G A;  2L2M A;  1M63 A;  3MHH C;  4IYP C;  2ZM6 E;  4H1S A;  2LTS A;  4OOG C;  4H2I A;  2N3G A;  3VYY A;  4BC7 A;  4KHP E;  2JOG A;  1WAR A;  4MOV A;  2YU5 A;  1ZBQ A;  4DSY A;  2YSP A;  1TCO A;  2EM6 A;  4DV2 E;  2QFR A;  2VRD A;  4M2Z A;  1G2F C;  1JK7 A;  4P78 A;  1XZW A;  2IE3 C;  5IOH A;  2DXN A;  4HTG A;  2IAE C;  4DKK A;  2DMI A;  4H1Y P;  4KWY A;  4V0V A;  4F9B B;  1QU6 A;  2CPN A;  3J80 C;  3M99 B;  1FJM A;  4X64 E;  2YTQ A;  2MC5 A;  2DMY A;  1S3M A;  4NZV A;  2CV9 A;  2YTO A;  1S3N A;  1BB8 A;  4DR3 E;  2DLK A;  4JI7 E;  3T1I A;  4JA9 A;  3PSN A;  1KYQ A;  1IQS A;  2KKN A;  2BBG A;  2V85 A;  4Q35 B;  4HD0 A;  4DR7 E;  5JPE A;  2YTG A;  2EPC A;  4P7D A;  1XNR E;  3QFN A;  2VE7 C;  2A22 A;  5LMN E;  2YTD A;  2JWO A;  1YYK A;  3OML A;  5A6K A;  2LO3 A;  4UT3 A;  2EE8 A;  3T1H E;  2K4V A;  5B8I A;  2DIX A;  2BDX A;  4LF9 E;  4IS1 C;  2B7V A;  3MHS C;  4FBQ A;  2EMC A;  4DR1 E;  2LTR A;  4LFC E;  2LRS A;  3AUZ A;  2EMH A;  1G2D C;  2WDF A;  4MLV A;  1ZBT A;  2L33 A;  3RQZ A;  2DLQ A;  2JOB A;  5LL6 R;  3ZU0 A;  4O43 A;  2EM2 A;  2RS6 A;  5KL6 A;  4IL1 A;  4X65 E;  4OR9 A;  4ZYE A;  4V0X A;  2NXF A;  2BQ8 X;  4RHB B;  1XMO E;  2EPM X;  4KZS A;  2I9I A;  3DF6 A;  2HC5 A;  2M1S A;  1RQ0 A;  2EOE A;  2MC6 A;  1YFH A;  2DGC A;  4B3T E;  3HTX A;  3IVE A;  2EMI A;  2F8B A;  2H36 X;  2YPN A;  1Z2W A;  4DHL A;  2YTJ A;  3TQM A;  4MP0 A;  2HHH E;  2EM3 A;  3BID A;  2EN8 A;  1WHN A;  5BR8 E;  1YUJ A;  4DR2 E;  4NXN E;  4K0K E;  5IXM B;  3DSD A;  4BHB A;  4FK5 C;  2JR1 A;  4DV1 E;  4O24 A;  2NYM C;  4Q28 A;  3ICF A;  2VQE E;  2GPI A;  5J28 A;  4BC9 A;  4F6N A;  2UXB E;  4FBW A;  3HXL A;  2LBS B;  2ZO9 B; 
#chains in the Genus database with same CATH homology
 3FGA C;  1S8E A;  1KBP A;  2HY1 A;  4LU9 A;  4O5G A;  1HPU A;  2Q8U A;  3DW8 C;  3K7V C;  4TUI A;  4B2O A;  2O8G A;  3H62 B;  5EQV A;  1M63 A;  4IYP C;  4H2G A;  3ZTV A;  3H61 A;  3JYF A;  1S95 A;  1II7 A;  4H1S A;  3DSC A;  5INB A;  5GTU A;  4H2I A;  3E0J A;  3IVD A;  1SU1 A;  3H68 A;  2JOG A;  1WAR A;  4DT2 A;  3FLO A;  4MOV A;  3H63 A;  4DSY A;  4ZX2 A;  2O8A A;  4LAC C;  1TCO A;  2QFR A;  3CK2 A;  4UT2 A;  5C1V A;  1JK7 A;  1OIE A;  3P71 C;  1XZW A;  2IE3 C;  2IE4 C;  2WDE A;  5IOH A;  2DXN A;  3D03 A;  2IAE C;  1XM7 A;  2ZOA A;  5DNY A;  4H1Y P;  1OID A;  4M0V A;  4ZVZ A;  3AV0 A;  3E7A A;  4V0V A;  2AHD A;  3H60 A;  2Z72 A;  1S70 A;  1FJM A;  1UF3 A;  4V0W A;  3THN A;  2BCD A;  4XPN A;  2WDD A;  1S3M A;  1V73 A;  4NZV A;  3N5U A;  4YKE A;  2CV9 A;  5JJT A;  4KBP A;  1S3N A;  4J6O A;  1HO5 A;  3TGH A;  3IB8 A;  3EGG A;  2P6B A;  4ORB A;  3T1I A;  4ORA A;  4JA9 A;  3PSN A;  5F3W A;  2KKN A;  1G5B A;  4H2B A;  4HD0 A;  1AUI A;  1W24 A;  1S3L A;  2ZBM A;  5JPE A;  1OI8 A;  1Z2X A;  1MF8 A;  3QFN A;  2A22 A;  2WDC A;  1T71 A;  2YVT A;  3GVE A;  3QFO A;  2QJC A;  4UT3 B;  2QFP A;  4ORC A;  5JPF A;  4I5L C;  2USH A;  4KKZ A;  4UT3 A;  3RL3 A;  3H64 A;  2GJU A;  5B8I A;  2NPP C;  2BDX A;  2HYP A;  3THO B;  2NYL C;  4FBQ A;  4TUG A;  4I5N C;  3AUZ A;  1NNW A;  1IT6 A;  3V4Y A;  4UWQ A;  3QFM A;  3QFK A;  1HP1 A;  2DXL A;  1USH A;  3C9F A;  2WDF A;  3RQZ A;  4Q7F A;  1T70 A;  3RL5 A;  3ZU0 A;  4O43 A;  3H67 A;  4IL1 A;  4OR9 A;  4MOY A;  4V0X A;  2NXF A;  2BQ8 X;  3EGH A;  1QFC A;  1UTE A;  2R17 A;  3H69 A;  1QHW A;  4FCX A;  2Z06 A;  3LL8 A;  4FBK A;  3IVE A;  1Z2W A;  4DHL A;  4H2F A;  5HPE A;  2Z1A A;  4MP0 A;  4F0Z A;  3KBP A;  4O4K A;  3IB7 A;  2YEQ A;  3C5W C;  2XMO A;  3RL4 A;  3DSD A;  3QG5 C;  1U32 A;  4O24 A;  2NYM C;  3ICF A;  4JA7 A;  4G9J A;  5J28 A;  3H66 A;  4FBW A;  1WAO 1;  3E7B A;  2DFJ A;  3HVQ A;  2HYO A;  4LTY A;  3K7W C;  3PSO A;  4WWL A;  2ZO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...