4O24A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o24A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o24A01
1KBPA 3H63A 2R17A 4LU9A 4O5GA 4WWLA 5INBA 4M0VA 1S3LA 3GVEA 3FGAC 1HO5A 3H64A 4O43A 3THNA 1UF3A 5HPEA 3QG5C 4KBPA 1JK7A 3ZU0A 5DNYA 1OI8A 1QFCA 2NPPC 4G9JA 3KBPA 2AHDA 4KKZA 3QFKA 4F0ZA 4LACC 3H67A 4FCXA 5JPFA 2BCDA 1MF8A 2ZBMA 3H62B 4UT2A 2NYLC 4FBQA 5J28A 4H1YP 4O24A 3ZTVA 4XPNA 4IL1A 2JOGA 3E7AA 3LL8A 2USHA 4MP0A 3N5UA 3T1IA 4UT3B 2WDCA 3H69A 3QFMA 4FBWA 1U32A 1S95A 4DSYA 4H1SA 1XM7A 3EGHA 3IB7A 2QFPA 4H2GA 1XZWA 1Z2XA 3IVEA 1W24A 3H61A 4YKEA 2IE4C 4OR9A 4I5LC 1T70A 4HD0A 4NZVA 2NXFA 3H60A 1G5BA 1OIEA 1II7A 1HPUA 5GTUA 4ZX2A 1WAO1 2HY1A 1OIDA 5C1VA 3DSDA 4B2OA 5EQVA 3K7VC 1Z2WA 4DHLA 3P71C 5B8IA 2KKNA 4FBKA 4JA9A 2CV9A 4ORBA 4UWQA 4H2IA 1WARA 3DW8C 3AV0A 4TUGA 4V0WA 4JA7A 3RL4A 2WDEA 2HYOA 3IB8A 1IT6A 3V4YA 2GJUA 5JJTA 4MOVA 4UT3A 2NYMC 4TUIA 2Q8UA 2Z72A 4H2FA 1S3NA 1S70A 2A22A 4V0XA 3QFOA 3ICFA 3PSNA 3RQZA 1T71A 4I5NC 2WDFA 4V0VA 3QFNA 3IVDA 1FJMA 3RL3A 4LTYA 4Q7FA 5IOHA 3DSCA 1SU1A 3H66A 1M63A 4ZVZA 4DT2A 4ORCA 3PSOA 3JYFA 1AUIA 1S8EA 4MOYA 4J6OA 1V73A 2IAEC 3TGHA 2O8AA 3C9FA 3CK2A 1NNWA 3H68A 2P6BA 1TCOA 1QHWA 3AUZA 4H2BA 2YVTA 3C5WC 2QFRA 4IYPC 2Z06A 5JPEA 4ORAA 3RL5A 1UTEA 3EGGA 1HP1A 2QJCA 2Z1AA 3K7WC 2HYPA 2IE3C 2WDDA 3HVQA 2XMOA 3E7BA 5F3WA 2BQ8X 4O4KA 2DFJA 2BDXA 2O8GA 1USHA 1S3MA 3THOB
chains in the Genus database with same CATH superfamily
4LU9A 3IWCA 1IQOA 3KZZA 2DXLA 2LCEA 4X62E 4M0VA 2N3GA 4YY3E 1O0WA 1BB8A 1YFHA 5ADZA 3C4BA 4F2JC 2M7QA 2DIXA 4KBPA 2NPPC 1X3CA 2EM5A 4MLVA 4LACC 4DV5E 2BCDA 1IBME 2DLQA 4FBQA 1LLMC 2F8BA 4B3SE 2EMZA 5AC5A 1N3GA 3ADIA 2EMBA 4ZYEA 2EPUA 3LL8A 5AE3A 3MHHC 3T1IA 4GZNC 2EPRA 2WDCA 3H69A 2EORA 4DV4E 5IV8B 5BR8E 1N32E 2V87A 4X66E 2VQEE 3IVEA 4LF6E 4DV7E 1G5BA 2GPIA 2LRSA 2L2MA 1II7A 1ZAAC 3BBGA 5KL4A 4ZX2A 1WAO1 2HY1A 2V85A 4R2SA 4F9CB 2M4IA 3VYXA 5B8IA 2LUPB 1XNRE 2YPNA 4NXNE 5AE1A 2UXDE 2WBSA 2RTXA 4KWYA 3J80C 4BHCA 4R2PA 4LF5E 4TUGA 4V0WA 4LFBE 2WDEA 2HYOA 5TSEA 1DGCA 3EPKA 4R2CA 1T39A 2MKNA 4B3ME 1X6HA 5A69A 4JI1E 1S3NA 2R1FA 1S70A 1BBGA 3QFOA 3ICFA 3RQZA 1T71A 2LT7A 1RC7A 2B7VA 4GKJE 2YSPA 1GTKA 3QFNA 2G7HA 4R2DA 2E1MA 2JY9A 3EPJA 1A1LA 1RQ0A 2HGHA 1YUIA 1N34E 1A1GA 3H66A 2EN6A 3JYFA 2RS6A 4M9VC 1AUIA 1S8EA 1TN9A 2L33A 3J81C 3TGHA 2O8AA 1YYKA 2CT1A 2YTDA 3CK2A 4JI0E 2YTQA 3AUZA 4H2BA 2EWLA 2K4VA 1WHQA 3C5WC 4DV2E 2JXPA 2MDRA 3K7WC 2YTPA 3HTXA 2XMOA 2WCC3 5KL7A 4WYQB 2V83A 3E7BA 1YYWA 2BQ8X 3ECRA 2DFJA 1USHA 2V8QB 2NUFA 1EKZA 2YTGA 4DR7E 1KBPA 3H63A 2EQ0A 4DUZE 2EPPA 1A1HA 2EPNA 2LTRA 2VRDA 2EM7A 1S3LA 2CPNA 3H64A 2LJHA 2LUQA 4O43A 1UF3A 4RH8A 2L2NA 3ZU0A 1AAYA 2ODRD 1ZBQA 3C4TA 2AHDA 3QFKA 2NUEA 4X65E 5JPFA 2EQ1A 4R03A 3L00A 2ZBMA 3H62B 5AASA 5J28A 2EMHA 3BIDA 1EH6A 3BGHA 2NUGA 4K0KE 4BBYA 2EN4A 1F2IG 4XPNA 2JOGA 3IWBA 5KL2A 1WXRA 3E7AA 1X47A 2B7TA 2YWQA 2EPCA 4UT3B 3QFMA 1U32A 1A1KA 4X8WA 1XM7A 1SR9A 4H1SA 3EGHA 3IB7A 1Z2XA 3H61A 1BBOA 2IE4C 1X5WA 1X48A 1JK2A 4HD0A 2R76A 2NXFA 4I5LC 4GKKE 5KL5A 2J7JA 5GTUA 4R8OA 2L8TA 2YRKA 4DR4E 3P1XA 2EMIA 2ENAA 3UK3C 3DSDA 3VHTB 4OOGC 3P71C 2KKNA 3EQ1A 2EPZA 2UUBE 4FBKA 4JA9A 5IXMB 4ORBA 3VYYA 1WARA 4L8NA 3TQMA 3C6MA 2RS7A 2EPXA 4JA7A 3RL4A 1Z1BA 1DI2A 3IB8A 1IT6A 2GJUA 2EM9A 2WBUA 4MOVA 4AQYE 4UT3A 2EM8A 2NYMC 4TUIA 2EN7A 2JOXA 3C6KA 4HEIA 4BHBA 4WXCA 4JV5E 2Z72A 4H2FA 2A22A 4V0XA 1J26A 4ZYDA 4DR2E 2WDFA 1RMDA 2NA2A 4JI6E 1XMOE 3JU0A 4ZYGA 1IBLE 2EMCA 4IS1C 4JI5E 3IVDA 2KONA 2LO3A 1FJMA 4LTYA 4Q7FA 2EOQA 2YU8A 4DKKA 1M63A 4ZVZA 4ORCA 3T1HE 1QNTA 1AH5A 4R2RA 3DF6A 4J6OA 1V73A 2IAEC 2V89A 4R2AA 2B9DA 3HQ1A 3HPZA 1NNWA 5LMUE 2EOOA 3E0JA 2YVTA 4IYPC 5JPEA 4I8OA 1HP1A 4KHPE 3K6QA 2EM0A 4J8ZA 1PKPA 5LLQA 2QJCA 2D9HA 2HYPA 3F6HA 1YYOA 2YTFA 3KZYA 3DW8C 2FTXB 5A6KA 2VQFE 1B69A 2DMIA 4O5GA 1X49A 4P7DA 1T4NA 2EMWA 2EMKA 4DMIA 3GVEA 2EMGA 1GQEA 2LVHA 5HPEA 3QG5C 4LF9E 1JK7A 5DNYA 5A6JA 1QFCA 5A6BA 1J5EE 4KKZA 2EPKX 2MC6A 1L4SA 4F0ZA 4WFTA 2EM4A 2BB8A 3H67A 3J7Yp 2JP9A 1MGTA 4JI4E 1MF8A 4BCAA 2EZ6A 2RSIA 1HR0E 4O24A 2YRMA 1A1FA 3EPLA 4IL1A 3EPHA 2USHA 1X6EA 1NEIA 4ZYHA 4FBWA 1HNZE 4JI3E 2EPAA 2YT4A 4Q35B 2QFPA 2ZO9B 4H2GA 1XZWA 3DJWA 1W24A 4YKEA 3F6GA 2EL4A 5A6BD 3H60A 3HXLA 2EOIA 4DR5E 4WSGA 2MC5A 4DUYE 2VE7C 1ZU1A 1KJKA 1T4OA 4B2OA 4LF7E 5EQVA 2VF1A 2WZOA 3K7VC 1Z2WA 4FK5C 5IWAE 1A1IA 4Q28A 2DSYA 2M1SA 2EM2A 4DR1E 2CV9A 2N8XA 1YSAC 4JI2E 1IQSA 2YTOA 2EMFA 3ADJA 1TF3A 2YTJA 2EM6A 2PRTA 5JJTA 3ADGA 2KOUA 2MDGA 2N3HA 4KZSA 3H09A 2EM3A 2HJJA 4F6NA 4P78A 1T38A 3PSNA 2FV4B 1I94E 4F54A 4V0VA 1KYQA 2EOXA 3LLHA 5KL6A 2EJ4A 1T4LB 2DXNA 5IOHA 3DSCA 1TF6A 1YZ9A 1SU1A 2GLIA 2DB2A 2YU5A 4DT2A 3HPSA 4LFAE 4MOYA 2YSOA 1STUA 2EPOA 3JTZA 1FJGE 1YPNA 2UXBE 4HTGA 3OTOE 2DMYA 1UHZA 4N4RB 1UN6B 3M99B 4DV0E 4RHBB 2B3TB 4X9JA 5CFFE 1UILA 2EOFA 2EPLX 2RPCA 2YTNA 2UXCE 1TCOA 2ELZA 4F9BB 2IHR1 3RMPA 2JYAA 2UU9E 4ORAA 1UTEA 3EGGA 2E5LE 2JVAA 4WPYA 5A2QC 2RQLA 2EN8A 1G2DC 1N36E 4R2EA 2EOEA 1PJSA 1HNWE 4O4KA 2EMYA 3J7AG 2BDXA 2O8GA 2UUCE 2YZTA 2EOZA 2RSMA 2M9AA 3THOB 4BS9A 1P47A 2DLKA 2EOHA 4WSPA 2R17A 4NHRA 2JR1A 2LE2A 4WWLA 5INBA 4WX9A 2EL5A 2BBGA 2EOYA 5T6JA 1FKAE 3IWDA 2DGCA 2ODRC 1HO5A 3FGAC 3THNA 1EH8A 4F6MA 2GHFA 2EN2A 3D03A 2EN1A 3MHSC 1OI8A 2EQ3A 4G9JA 1SFEA 3MSWA 3FIGA 4BC7A 4LF4E 3KBPA 2I9IA 2E72A 1JK1A 2WBTA 4FCXA 2L3JA 4OX9E 4UT2A 2ZOAA 1N33E 2NYLC 4YHHE 4H1YP 5IT9C 3ZTVA 1XNQE 3OMLA 1IMUA 2ADRA 2L3CA 4MP0A 1YUJA 4DV1E 3N5UA 2L92A 1ZR9A 2FGGA 1S95A 2LBSB 4DSYA 2F4VE 4DR3E 3KWRA 2CTDA 1ZBTA 2CSHA 4OR9A 3ADLA 1T70A 4NZVA 4BMJA 1DQ3A 2ENHA 1OIEA 2EMXA 4IJDA 1HPUA 4X64E 2NABA 2I13A 2KHXA 1OIDA 4LFCE 5C1VA 2ENCA 3VK6A 4DHLA 2LMZA 1PJTA 1A1JA 2JWOA 2EOJA 4UWQA 2LTSA 4M2ZA 4H2IA 2ELYA 3AV0A 5KL3A 5AE2A 3V4YA 4F9AB 4DR6E 1X6FA 5A6AA 3T1YE 4NXME 2EPMX 1IBKE 2L6MA 2Q8UA 5LMNE 4M30A 2EOMA 4I5NC 3LMLA 1WRJA 2HC5A 2YTIA 4R2QA 4GEQB 2EMAA 3RL3A 2UUAE 4DV3E 1G2FC 1NCSA 2EP3A 2V88A 4JI7E 5FLXC 2YEQA 2EOSA 2ZM6E 2HHHE 2K7IA 3PSOA 2V86A 4B3RE 2YTEA 2EMLA 2H36X 4MLQA 2YRHA 2DRPA 4WXDA 1QU6A 2LJUA 4LF8E 4JYAE 3C9FA 4B3TE 4BC9A 3BF2A 1PDAA 2L2KB 2P6BA 3H68A 1QHWA 5LL6R 1UBDC 1WJPA 2EN3A 2JPAA 5AC4A 2QFRA 2Z06A 3RL5A 1WHNA 4DV6E 1HNXE 3ZOQB 3FLOA 2Z1AA 1GZ6A 2IE3C 1EH7A 2WDDA 3HVQA 2LV2A 1PJQA 2EE8A 2MKDA 5F3WA 1MEYC 2EL6A 1XMQE 4L5NC 1S3MA 3JAMC 2JOBA 4JI8E 2A25A
chains in the Genus database with same CATH topology
1KBPA 3H63A 2R17A 4LU9A 2DXLA 4O5GA 4WWLA 5INBA 4M0VA 1S3LA 3GVEA 3FGAC 1HO5A 3H64A 4O43A 3THNA 1UF3A 5HPEA 3QG5C 4KBPA 1JK7A 3D03A 3ZU0A 5DNYA 1OI8A 1QFCA 2NPPC 4G9JA 3KBPA 2AHDA 4KKZA 3QFKA 4F0ZA 4LACC 3H67A 4FCXA 5JPFA 2BCDA 1MF8A 2ZBMA 2ZOAA 3H62B 4UT2A 2NYLC 4FBQA 5J28A 4H1YP 4O24A 3ZTVA 4XPNA 4IL1A 2JOGA 3E7AA 3LL8A 2USHA 4MP0A 3N5UA 3T1IA 4UT3B 2WDCA 3H69A 3QFMA 4FBWA 1U32A 1S95A 4DSYA 4H1SA 1XM7A 3EGHA 3IB7A 2QFPA 2ZO9B 4H2GA 1XZWA 1Z2XA 3IVEA 1W24A 3H61A 4YKEA 2IE4C 4OR9A 4I5LC 4HD0A 1T70A 4NZVA 2NXFA 3H60A 1G5BA 1OIEA 1II7A 1HPUA 5GTUA 4ZX2A 1WAO1 2HY1A 1OIDA 5C1VA 3DSDA 4B2OA 5EQVA 3K7VC 1Z2WA 4DHLA 3P71C 5B8IA 2KKNA 4FBKA 4JA9A 2CV9A 4ORBA 4UWQA 4H2IA 1WARA 3DW8C 3AV0A 4TUGA 4V0WA 4JA7A 3RL4A 2WDEA 2HYOA 3IB8A 1IT6A 3V4YA 2GJUA 5JJTA 4MOVA 4UT3A 2NYMC 4TUIA 2Q8UA 2Z72A 4H2FA 1S3NA 1S70A 2A22A 4V0XA 3QFOA 3ICFA 3PSNA 3RQZA 1T71A 4I5NC 2WDFA 4V0VA 3QFNA 2DXNA 3IVDA 1FJMA 3RL3A 4LTYA 4Q7FA 3DSCA 5IOHA 2YEQA 1SU1A 3H66A 1M63A 4ZVZA 4DT2A 4ORCA 3PSOA 3JYFA 1AUIA 1S8EA 4MOYA 4J6OA 1V73A 2IAEC 3TGHA 2O8AA 3C9FA 3CK2A 1NNWA 3H68A 2P6BA 1TCOA 1QHWA 3AUZA 4H2BA 3E0JA 2YVTA 3C5WC 2QFRA 4IYPC 2Z06A 5JPEA 4ORAA 3RL5A 1UTEA 3EGGA 1HP1A 3FLOA 2QJCA 2Z1AA 3K7WC 2HYPA 2IE3C 2WDDA 3HVQA 2XMOA 3E7BA 5F3WA 2BQ8X 4O4KA 2DFJA 2BDXA 2O8GA 1USHA 1S3MA 3THOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBP A;  3H63 A;  2R17 A;  4LU9 A;  4O5G A;  4WWL A;  5INB A;  4M0V A;  1S3L A;  3GVE A;  3FGA C;  1HO5 A;  3H64 A;  4O43 A;  3THN A;  1UF3 A;  5HPE A;  3QG5 C;  4KBP A;  1JK7 A;  3ZU0 A;  5DNY A;  1OI8 A;  1QFC A;  2NPP C;  4G9J A;  3KBP A;  2AHD A;  4KKZ A;  3QFK A;  4F0Z A;  4LAC C;  3H67 A;  4FCX A;  5JPF A;  2BCD A;  1MF8 A;  2ZBM A;  3H62 B;  4UT2 A;  2NYL C;  4FBQ A;  5J28 A;  4H1Y P;  4O24 A;  3ZTV A;  4XPN A;  4IL1 A;  2JOG A;  3E7A A;  3LL8 A;  2USH A;  4MP0 A;  3N5U A;  3T1I A;  4UT3 B;  2WDC A;  3H69 A;  3QFM A;  4FBW A;  1U32 A;  1S95 A;  4DSY A;  4H1S A;  1XM7 A;  3EGH A;  3IB7 A;  2QFP A;  4H2G A;  1XZW A;  1Z2X A;  3IVE A;  1W24 A;  3H61 A;  4YKE A;  2IE4 C;  4OR9 A;  4I5L C;  1T70 A;  4HD0 A;  4NZV A;  2NXF A;  3H60 A;  1G5B A;  1OIE A;  1II7 A;  1HPU A;  5GTU A;  4ZX2 A;  1WAO 1;  2HY1 A;  1OID A;  5C1V A;  3DSD A;  4B2O A;  5EQV A;  3K7V C;  1Z2W A;  4DHL A;  3P71 C;  5B8I A;  2KKN A;  4FBK A;  4JA9 A;  2CV9 A;  4ORB A;  4UWQ A;  4H2I A;  1WAR A;  3DW8 C;  3AV0 A;  4TUG A;  4V0W A;  4JA7 A;  3RL4 A;  2WDE A;  2HYO A;  3IB8 A;  1IT6 A;  3V4Y A;  2GJU A;  5JJT A;  4MOV A;  4UT3 A;  2NYM C;  4TUI A;  2Q8U A;  2Z72 A;  4H2F A;  1S3N A;  1S70 A;  2A22 A;  4V0X A;  3QFO A;  3ICF A;  3PSN A;  3RQZ A;  1T71 A;  4I5N C;  2WDF A;  4V0V A;  3QFN A;  3IVD A;  1FJM A;  3RL3 A;  4LTY A;  4Q7F A;  5IOH A;  3DSC A;  1SU1 A;  3H66 A;  1M63 A;  4ZVZ A;  4DT2 A;  4ORC A;  3PSO A;  3JYF A;  1AUI A;  1S8E A;  4MOY A;  4J6O A;  1V73 A;  2IAE C;  3TGH A;  2O8A A;  3C9F A;  3CK2 A;  1NNW A;  3H68 A;  2P6B A;  1TCO A;  1QHW A;  3AUZ A;  4H2B A;  2YVT A;  3C5W C;  2QFR A;  4IYP C;  2Z06 A;  5JPE A;  4ORA A;  3RL5 A;  1UTE A;  3EGG A;  1HP1 A;  2QJC A;  2Z1A A;  3K7W C;  2HYP A;  2IE3 C;  2WDD A;  3HVQ A;  2XMO A;  3E7B A;  5F3W A;  2BQ8 X;  4O4K A;  2DFJ A;  2BDX A;  2O8G A;  1USH A;  1S3M A;  3THO B; 
#chains in the Genus database with same CATH topology
 4LU9 A;  3IWC A;  1IQO A;  3KZZ A;  2DXL A;  2LCE A;  4X62 E;  4M0V A;  2N3G A;  4YY3 E;  1O0W A;  1BB8 A;  1YFH A;  5ADZ A;  3C4B A;  4F2J C;  2M7Q A;  2DIX A;  4KBP A;  2NPP C;  1X3C A;  2EM5 A;  4MLV A;  4LAC C;  4DV5 E;  2BCD A;  1IBM E;  2DLQ A;  4FBQ A;  1LLM C;  2F8B A;  4B3S E;  2EMZ A;  5AC5 A;  1N3G A;  3ADI A;  2EMB A;  4ZYE A;  2EPU A;  3LL8 A;  5AE3 A;  3MHH C;  3T1I A;  4GZN C;  2EPR A;  2WDC A;  3H69 A;  2EOR A;  4DV4 E;  5IV8 B;  5BR8 E;  1N32 E;  2V87 A;  4X66 E;  2VQE E;  3IVE A;  4LF6 E;  4DV7 E;  1G5B A;  2GPI A;  2LRS A;  2L2M A;  1II7 A;  1ZAA C;  3BBG A;  5KL4 A;  4ZX2 A;  1WAO 1;  2HY1 A;  2V85 A;  4R2S A;  4F9C B;  2M4I A;  3VYX A;  5B8I A;  2LUP B;  1XNR E;  2YPN A;  4NXN E;  5AE1 A;  2UXD E;  2WBS A;  2RTX A;  4KWY A;  3J80 C;  4BHC A;  4R2P A;  4LF5 E;  4TUG A;  4V0W A;  4LFB E;  2WDE A;  2HYO A;  5TSE A;  1DGC A;  3EPK A;  4R2C A;  1T39 A;  2MKN A;  4B3M E;  1X6H A;  5A69 A;  4JI1 E;  1S3N A;  2R1F A;  1S70 A;  1BBG A;  3QFO A;  3ICF A;  3RQZ A;  1T71 A;  2LT7 A;  1RC7 A;  2B7V A;  4GKJ E;  2YSP A;  1GTK A;  3QFN A;  2G7H A;  4R2D A;  2E1M A;  2JY9 A;  3EPJ A;  1A1L A;  1RQ0 A;  2HGH A;  1YUI A;  1N34 E;  1A1G A;  3H66 A;  2EN6 A;  3JYF A;  2RS6 A;  4M9V C;  1AUI A;  1S8E A;  1TN9 A;  2L33 A;  3J81 C;  3TGH A;  2O8A A;  1YYK A;  2CT1 A;  2YTD A;  3CK2 A;  4JI0 E;  2YTQ A;  3AUZ A;  4H2B A;  2EWL A;  2K4V A;  1WHQ A;  3C5W C;  4DV2 E;  2JXP A;  2MDR A;  3K7W C;  2YTP A;  3HTX A;  2XMO A;  2WCC 3;  5KL7 A;  4WYQ B;  2V83 A;  3E7B A;  1YYW A;  2BQ8 X;  3ECR A;  2DFJ A;  1USH A;  2V8Q B;  2NUF A;  1EKZ A;  2YTG A;  4DR7 E;  1KBP A;  3H63 A;  2EQ0 A;  4DUZ E;  2EPP A;  1A1H A;  2EPN A;  2LTR A;  2VRD A;  2EM7 A;  1S3L A;  2CPN A;  3H64 A;  2LJH A;  2LUQ A;  4O43 A;  1UF3 A;  4RH8 A;  2L2N A;  3ZU0 A;  1AAY A;  2ODR D;  1ZBQ A;  3C4T A;  2AHD A;  3QFK A;  2NUE A;  4X65 E;  5JPF A;  2EQ1 A;  4R03 A;  3L00 A;  2ZBM A;  3H62 B;  5AAS A;  5J28 A;  2EMH A;  3BID A;  1EH6 A;  3BGH A;  2NUG A;  4K0K E;  4BBY A;  2EN4 A;  1F2I G;  4XPN A;  2JOG A;  3IWB A;  5KL2 A;  1WXR A;  3E7A A;  1X47 A;  2B7T A;  2YWQ A;  2EPC A;  4UT3 B;  3QFM A;  1U32 A;  1A1K A;  4X8W A;  1XM7 A;  1SR9 A;  4H1S A;  3EGH A;  3IB7 A;  1Z2X A;  3H61 A;  1BBO A;  2IE4 C;  1X5W A;  1X48 A;  1JK2 A;  4HD0 A;  2R76 A;  2NXF A;  4I5L C;  4GKK E;  5KL5 A;  2J7J A;  5GTU A;  4R8O A;  2L8T A;  2YRK A;  4DR4 E;  3P1X A;  2EMI A;  2ENA A;  3UK3 C;  3DSD A;  3VHT B;  4OOG C;  3P71 C;  2KKN A;  3EQ1 A;  2EPZ A;  2UUB E;  4FBK A;  4JA9 A;  5IXM B;  4ORB A;  3VYY A;  1WAR A;  4L8N A;  3TQM A;  3C6M A;  2RS7 A;  2EPX A;  4JA7 A;  3RL4 A;  1Z1B A;  1DI2 A;  3IB8 A;  1IT6 A;  2GJU A;  2EM9 A;  2WBU A;  4MOV A;  4AQY E;  4UT3 A;  2EM8 A;  2NYM C;  4TUI A;  2EN7 A;  2JOX A;  3C6K A;  4HEI A;  4BHB A;  4WXC A;  4JV5 E;  2Z72 A;  4H2F A;  2A22 A;  4V0X A;  1J26 A;  4ZYD A;  4DR2 E;  2WDF A;  1RMD A;  2NA2 A;  4JI6 E;  1XMO E;  3JU0 A;  4ZYG A;  1IBL E;  2EMC A;  4IS1 C;  4JI5 E;  3IVD A;  2KON A;  2LO3 A;  1FJM A;  4LTY A;  4Q7F A;  2EOQ A;  2YU8 A;  4DKK A;  1M63 A;  4ZVZ A;  4ORC A;  3T1H E;  1QNT A;  1AH5 A;  4R2R A;  3DF6 A;  4J6O A;  1V73 A;  2IAE C;  2V89 A;  4R2A A;  2B9D A;  3HQ1 A;  3HPZ A;  1NNW A;  5LMU E;  2EOO A;  3E0J A;  2YVT A;  4IYP C;  5JPE A;  4I8O A;  1HP1 A;  4KHP E;  3K6Q A;  2EM0 A;  4J8Z A;  1PKP A;  5LLQ A;  2QJC A;  2D9H A;  2HYP A;  3F6H A;  1YYO A;  2YTF A;  3KZY A;  3DW8 C;  2FTX B;  5A6K A;  2VQF E;  1B69 A;  2DMI A;  4O5G A;  1X49 A;  4P7D A;  1T4N A;  2EMW A;  2EMK A;  4DMI A;  3GVE A;  2EMG A;  1GQE A;  2LVH A;  5HPE A;  3QG5 C;  4LF9 E;  1JK7 A;  5DNY A;  5A6J A;  1QFC A;  5A6B A;  1J5E E;  4KKZ A;  2EPK X;  2MC6 A;  1L4S A;  4F0Z A;  4WFT A;  2EM4 A;  2BB8 A;  3H67 A;  3J7Y p;  2JP9 A;  1MGT A;  4JI4 E;  1MF8 A;  4BCA A;  2EZ6 A;  2RSI A;  1HR0 E;  4O24 A;  2YRM A;  1A1F A;  3EPL A;  4IL1 A;  3EPH A;  2USH A;  1X6E A;  1NEI A;  4ZYH A;  4FBW A;  1HNZ E;  4JI3 E;  2EPA A;  2YT4 A;  4Q35 B;  2QFP A;  2ZO9 B;  4H2G A;  1XZW A;  3DJW A;  1W24 A;  4YKE A;  3F6G A;  2EL4 A;  5A6B D;  3H60 A;  3HXL A;  2EOI A;  4DR5 E;  4WSG A;  2MC5 A;  4DUY E;  2VE7 C;  1ZU1 A;  1KJK A;  1T4O A;  4B2O A;  4LF7 E;  5EQV A;  2VF1 A;  2WZO A;  3K7V C;  1Z2W A;  4FK5 C;  5IWA E;  1A1I A;  4Q28 A;  2DSY A;  2M1S A;  2EM2 A;  4DR1 E;  2CV9 A;  2N8X A;  1YSA C;  4JI2 E;  1IQS A;  2YTO A;  2EMF A;  3ADJ A;  1TF3 A;  2YTJ A;  2EM6 A;  2PRT A;  5JJT A;  3ADG A;  2KOU A;  2MDG A;  2N3H A;  4KZS A;  3H09 A;  2EM3 A;  2HJJ A;  4F6N A;  4P78 A;  1T38 A;  3PSN A;  2FV4 B;  1I94 E;  4F54 A;  4V0V A;  1KYQ A;  2EOX A;  3LLH A;  5KL6 A;  2EJ4 A;  1T4L B;  2DXN A;  5IOH A;  3DSC A;  1TF6 A;  1YZ9 A;  1SU1 A;  2GLI A;  2DB2 A;  2YU5 A;  4DT2 A;  3HPS A;  4LFA E;  4MOY A;  2YSO A;  1STU A;  2EPO A;  3JTZ A;  1FJG E;  1YPN A;  2UXB E;  4HTG A;  3OTO E;  2DMY A;  1UHZ A;  4N4R B;  1UN6 B;  3M99 B;  4DV0 E;  4RHB B;  2B3T B;  4X9J A;  5CFF E;  1UIL A;  2EOF A;  2EPL X;  2RPC A;  2YTN A;  2UXC E;  1TCO A;  2ELZ A;  4F9B B;  2IHR 1;  3RMP A;  2JYA A;  2UU9 E;  4ORA A;  1UTE A;  3EGG A;  2E5L E;  2JVA A;  4WPY A;  5A2Q C;  2RQL A;  2EN8 A;  1G2D C;  1N36 E;  4R2E A;  2EOE A;  1PJS A;  1HNW E;  4O4K A;  2EMY A;  3J7A G;  2BDX A;  2O8G A;  2UUC E;  2YZT A;  2EOZ A;  2RSM A;  2M9A A;  3THO B;  4BS9 A;  1P47 A;  2DLK A;  2EOH A;  4WSP A;  2R17 A;  4NHR A;  2JR1 A;  2LE2 A;  4WWL A;  5INB A;  4WX9 A;  2EL5 A;  2BBG A;  2EOY A;  5T6J A;  1FKA E;  3IWD A;  2DGC A;  2ODR C;  1HO5 A;  3FGA C;  3THN A;  1EH8 A;  4F6M A;  2GHF A;  2EN2 A;  3D03 A;  2EN1 A;  3MHS C;  1OI8 A;  2EQ3 A;  4G9J A;  1SFE A;  3MSW A;  3FIG A;  4BC7 A;  4LF4 E;  3KBP A;  2I9I A;  2E72 A;  1JK1 A;  2WBT A;  4FCX A;  2L3J A;  4OX9 E;  4UT2 A;  2ZOA A;  1N33 E;  2NYL C;  4YHH E;  4H1Y P;  5IT9 C;  3ZTV A;  1XNQ E;  3OML A;  1IMU A;  2ADR A;  2L3C A;  4MP0 A;  1YUJ A;  4DV1 E;  3N5U A;  2L92 A;  1ZR9 A;  2FGG A;  1S95 A;  2LBS B;  4DSY A;  2F4V E;  4DR3 E;  3KWR A;  2CTD A;  1ZBT A;  2CSH A;  4OR9 A;  3ADL A;  1T70 A;  4NZV A;  4BMJ A;  1DQ3 A;  2ENH A;  1OIE A;  2EMX A;  4IJD A;  1HPU A;  4X64 E;  2NAB A;  2I13 A;  2KHX A;  1OID A;  4LFC E;  5C1V A;  2ENC A;  3VK6 A;  4DHL A;  2LMZ A;  1PJT A;  1A1J A;  2JWO A;  2EOJ A;  4UWQ A;  2LTS A;  4M2Z A;  4H2I A;  2ELY A;  3AV0 A;  5KL3 A;  5AE2 A;  3V4Y A;  4F9A B;  4DR6 E;  1X6F A;  5A6A A;  3T1Y E;  4NXM E;  2EPM X;  1IBK E;  2L6M A;  2Q8U A;  5LMN E;  4M30 A;  2EOM A;  4I5N C;  3LML A;  1WRJ A;  2HC5 A;  2YTI A;  4R2Q A;  4GEQ B;  2EMA A;  3RL3 A;  2UUA E;  4DV3 E;  1G2F C;  1NCS A;  2EP3 A;  2V88 A;  4JI7 E;  5FLX C;  2YEQ A;  2EOS A;  2ZM6 E;  2HHH E;  2K7I A;  3PSO A;  2V86 A;  4B3R E;  2YTE A;  2EML A;  2H36 X;  4MLQ A;  2YRH A;  2DRP A;  4WXD A;  1QU6 A;  2LJU A;  4LF8 E;  4JYA E;  3C9F A;  4B3T E;  4BC9 A;  3BF2 A;  1PDA A;  2L2K B;  2P6B A;  3H68 A;  1QHW A;  5LL6 R;  1UBD C;  1WJP A;  2EN3 A;  2JPA A;  5AC4 A;  2QFR A;  2Z06 A;  3RL5 A;  1WHN A;  4DV6 E;  1HNX E;  3ZOQ B;  3FLO A;  2Z1A A;  1GZ6 A;  2IE3 C;  1EH7 A;  2WDD A;  3HVQ A;  2LV2 A;  1PJQ A;  2EE8 A;  2MKD A;  5F3W A;  1MEY C;  2EL6 A;  1XMQ E;  4L5N C;  1S3M A;  3JAM C;  2JOB A;  4JI8 E;  2A25 A; 
#chains in the Genus database with same CATH homology
 1KBP A;  3H63 A;  2R17 A;  4LU9 A;  2DXL A;  4O5G A;  4WWL A;  5INB A;  4M0V A;  1S3L A;  3GVE A;  3FGA C;  1HO5 A;  3H64 A;  4O43 A;  3THN A;  1UF3 A;  5HPE A;  3QG5 C;  4KBP A;  1JK7 A;  3D03 A;  3ZU0 A;  5DNY A;  1OI8 A;  1QFC A;  2NPP C;  4G9J A;  3KBP A;  2AHD A;  4KKZ A;  3QFK A;  4F0Z A;  4LAC C;  3H67 A;  4FCX A;  5JPF A;  2BCD A;  1MF8 A;  2ZBM A;  2ZOA A;  3H62 B;  4UT2 A;  2NYL C;  4FBQ A;  5J28 A;  4H1Y P;  4O24 A;  3ZTV A;  4XPN A;  4IL1 A;  2JOG A;  3E7A A;  3LL8 A;  2USH A;  4MP0 A;  3N5U A;  3T1I A;  4UT3 B;  2WDC A;  3H69 A;  3QFM A;  4FBW A;  1U32 A;  1S95 A;  4DSY A;  4H1S A;  1XM7 A;  3EGH A;  3IB7 A;  2QFP A;  2ZO9 B;  4H2G A;  1XZW A;  1Z2X A;  3IVE A;  1W24 A;  3H61 A;  4YKE A;  2IE4 C;  4OR9 A;  4I5L C;  4HD0 A;  1T70 A;  4NZV A;  2NXF A;  3H60 A;  1G5B A;  1OIE A;  1II7 A;  1HPU A;  5GTU A;  4ZX2 A;  1WAO 1;  2HY1 A;  1OID A;  5C1V A;  3DSD A;  4B2O A;  5EQV A;  3K7V C;  1Z2W A;  4DHL A;  3P71 C;  5B8I A;  2KKN A;  4FBK A;  4JA9 A;  2CV9 A;  4ORB A;  4UWQ A;  4H2I A;  1WAR A;  3DW8 C;  3AV0 A;  4TUG A;  4V0W A;  4JA7 A;  3RL4 A;  2WDE A;  2HYO A;  3IB8 A;  1IT6 A;  3V4Y A;  2GJU A;  5JJT A;  4MOV A;  4UT3 A;  2NYM C;  4TUI A;  2Q8U A;  2Z72 A;  4H2F A;  1S3N A;  1S70 A;  2A22 A;  4V0X A;  3QFO A;  3ICF A;  3PSN A;  3RQZ A;  1T71 A;  4I5N C;  2WDF A;  4V0V A;  3QFN A;  2DXN A;  3IVD A;  1FJM A;  3RL3 A;  4LTY A;  4Q7F A;  3DSC A;  5IOH A;  2YEQ A;  1SU1 A;  3H66 A;  1M63 A;  4ZVZ A;  4DT2 A;  4ORC A;  3PSO A;  3JYF A;  1AUI A;  1S8E A;  4MOY A;  4J6O A;  1V73 A;  2IAE C;  3TGH A;  2O8A A;  3C9F A;  3CK2 A;  1NNW A;  3H68 A;  2P6B A;  1TCO A;  1QHW A;  3AUZ A;  4H2B A;  3E0J A;  2YVT A;  3C5W C;  2QFR A;  4IYP C;  2Z06 A;  5JPE A;  4ORA A;  3RL5 A;  1UTE A;  3EGG A;  1HP1 A;  3FLO A;  2QJC A;  2Z1A A;  3K7W C;  2HYP A;  2IE3 C;  2WDD A;  3HVQ A;  2XMO A;  3E7B A;  5F3W A;  2BQ8 X;  4O4K A;  2DFJ A;  2BDX A;  2O8G A;  1USH A;  1S3M A;  3THO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...