4O24A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o24A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o24A01
2BQ8X 1HO5A 4V0WA 3ZU0A 3E7AA 3IVDA 3PSNA 2O8GA 3AV0A 3IB7A 4YKEA 2HYPA 3H64A 3EGGA 3T1IA 4LU9A 4DHLA 1W24A 2KKNA 4FCXA 4MOYA 4ORBA 3HVQA 3H63A 1OIEA 3H60A 3H62B 5GTUA 1S3MA 1WAO1 1XZWA 2IE3C 4M0VA 1S95A 1QFCA 1SU1A 3QFOA 1KBPA 3C5WC 2NYMC 4ORAA 4XPNA 2CV9A 1IT6A 2R17A 2QFRA 3CK2A 3PSOA 4H2IA 4DT2A 4JA9A 1OIDA 2YVTA 2QFPA 1II7A 4JA7A 1S3NA 4Q7FA 3P71C 4B2OA 4ORCA 2XMOA 3DSDA 2WDCA 3N5UA 2IAEC 1HPUA 4LACC 3QFMA 5DNYA 5INBA 1Z2WA 4UT3B 4V0VA 3RL3A 2GJUA 2P6BA 5JPEA 4O24A 3H61A 4DSYA 4MP0A 2Q8UA 3RL5A 4KKZA 3H68A 5JJTA 4ZX2A 1UF3A 5F3WA 4UT2A 1TCOA 2WDEA 4I5NC 3RL4A 2NPPC 3H67A 2IE4C 2O8AA 2Z06A 4H2BA 4O5GA 4V0XA 4H1YP 4UWQA 3V4YA 2WDFA 2Z72A 3DW8C 3E7BA 4ZVZA 3ZTVA 1S8EA 5J28A 1FJMA 1WARA 3AUZA 3RQZA 1OI8A 1T70A 1HP1A 3JYFA 4I5LC 4KBPA 3C9FA 4TUIA 2HYOA 3K7VC 5IOHA 1JK7A 3H69A 4J6OA 2NXFA 5B8IA 3THNA 1UTEA 2NYLC 1MF8A 3KBPA 5JPFA 4MOVA 4OR9A 1AUIA 4NZVA 4H2FA 1U32A 4F0ZA 3DSCA 1G5BA 2BCDA 3QG5C 3H66A 1QHWA 3ICFA 1XM7A 4LTYA 4HD0A 1USHA 4FBWA 3IB8A 1S3LA 1T71A 1Z2XA 3EGHA 2USHA 4TUGA 4IYPC 3IVEA 3THOB 3QFNA 3QFKA 1S70A 4IL1A 2ZBMA 4O4KA 2BDXA 3GVEA 4FBKA 2JOGA 4O43A 4H2GA 4G9JA 3FGAC 4H1SA 2DFJA 4UT3A 2A22A 3LL8A 1V73A 2HY1A 1NNWA 3TGHA 2QJCA 2AHDA 3K7WC 4FBQA 5EQVA 4WWLA 1M63A 5C1VA 5HPEA 2WDDA 2Z1AA
chains in the Genus database with same CATH superfamily
1Z1BA 3ZU0A 3C4TA 4JI4E 3PSNA 1GQEA 5KL4A 3J7Yp 1J5EE 4DUZE 3IB7A 2F4VE 3F6HA 2HYPA 5LLQA 3H64A 4DHLA 2KKNA 1IBLE 4MOYA 3HVQA 4OX9E 4X8WA 3H60A 1ZBTA 2H36X 2EPKX 4M0VA 5AE3A 1QFCA 2BB8A 1SU1A 1WHNA 3P1XA 3C5WC 2NYMC 2DIXA 2LCEA 3C4BA 1ZU1A 4DR6E 3CK2A 4DR2E 3PSOA 2V89A 1X3CA 4DT2A 1WXRA 2QFPA 2JY9A 1II7A 2YTEA 1S3NA 3FLOA 1SR9A 2EL4A 2G7HA 2CSHA 2JOXA 2WCC3 4DV5E 5DNYA 2EOFA 5A6BA 2MDRA 4LF4E 1Z2WA 2MKNA 4JYAE 4R2SA 5IXMB 4NXME 4O24A 5AASA 4DSYA 4MP0A 2IHR1 1YUIA 2Q8UA 3RL5A 2WZOA 1YZ9A 3KZZA 1PJSA 5F3WA 1DGCA 2EPLX 3E0JA 2L8TA 2YRKA 1L4SA 1N34E 2RS7A 5KL5A 1GZ6A 4DV3E 4IJDA 4UWQA 2B7TA 1UHZA 4JI5E 3DJWA 1TF6A 2NUEA 2EL6A 3HXLA 2J7JA 3E7BA 2EOQA 2NA2A 2L3JA 5J28A 1XNRE 1FJMA 1WARA 2JP9A 1UN6B 1T70A 1HP1A 4I5LC 4KZSA 2JXPA 5IOHA 5AE1A 2HJJA 2GLIA 4JI2E 3H69A 4J6OA 5KL7A 5B8IA 2EPMX 3OTOE 2VRDA 3KBPA 3ZOQB 2WBUA 4OR9A 4JI3E 2LE2A 2DLKA 3DSCA 3QG5C 3C6KA 1I94E 4P7DA 3ICFA 2EN8A 3VK6A 4HD0A 1YYWA 2YTGA 2E1MA 3BIDA 2YTNA 2EM2A 1Z2XA 3EGHA 3QFNA 2YTJA 2EOEA 2E72A 3HQ1A 2ADRA 2YU8A 2R1FA 2V86A 4F2JC 1AAYA 1HR0E 1PJTA 4RHBB 2A22A 5A2QC 1V73A 1YYOA 4KHPE 2QJCA 4ZYHA 1BBGA 2RSIA 2N8XA 2UU9E 1YSAC 5C1VA 1NEIA 5AE2A 1HO5A 3EPKA 2EMCA 1PKPA 2RQLA 4J8ZA 1X6HA 4DKKA 1BB8A 2O8GA 3OMLA 4DV4E 2EOYA 4F9BB 3TQMA 4FK5C 4K0KE 3T1IA 2YEQA 2L3CA 4FCXA 5A6JA 4ORBA 3ECRA 3H63A 2DMIA 1OIEA 3H62B 5AC4A 2RPCA 3MHHC 5LMNE 4DR1E 4LF9E 1YUJA 1LLMC 2L2KB 4R2DA 1S95A 2IE3C 2EPNA 2EN7A 4GKKE 4M9VC 3QFOA 1KBPA 4F9CB 4DR3E 3JU0A 2UXDE 1IT6A 1T4OA 1XNQE 4H2IA 2FV4B 1JK1A 2DXLA 1OIDA 4JA9A 2LVHA 4JA7A 4KWYA 2LTRA 2PRTA 2V88A 3K6QA 1EKZA 2ZOAA 1N3GA 2LRSA 3C6MA 3VYXA 1HPUA 4LACC 1KYQA 2JR1A 1BBOA 1YPNA 2L6MA 5ADZA 4UT3B 3RL3A 3KZYA 3H61A 2EPOA 2JPAA 3H68A 4ZX2A 1WHQA 2FTXB 2UUCE 2EM0A 2EPUA 4RH8A 2ZM6E 1X6FA 2EM7A 4MLQA 1X6EA 2EPCA 2O8AA 4O5GA 1A1KA 4H1YP 2B7VA 3ADGA 2WDFA 1T39A 4OOGC 4ZYDA 2Z72A 2MC6A 1EH6A 3DW8C 1ZBQA 2N3HA 3LMLA 4ZVZA 2CPNA 2D9HA 3J7AG 3ZTVA 5BR8E 1G2FC 4WX9A 4AQYE 1X47A 2EOJA 3RMPA 2WBTA 3C9FA 4TUIA 2EPXA 2YTQA 4R2AA 2NXFA 4BHBA 4R8OA 3THNA 1X48A 4ZYGA 5KL3A 1UTEA 4MOVA 3ADLA 4R2EA 2NABA 2YRHA 2YSOA 1U32A 4L5NC 4HTGA 2UUBE 2EMWA 4BCAA 2LBSB 1IMUA 4JI7E 2M1SA 4B3ME 2YRMA 1USHA 4FBWA 1A1LA 4LF7E 2LMZA 2ENHA 2DMYA 3EPJA 2EORA 4BS9A 4GKJE 4X62E 4DR7E 1IBKE 4IYPC 3QFKA 4WFTA 2V87A 4IL1A 3D03A 2L92A 1A1JA 2YTOA 2ZBMA 1P47A 4FBKA 2EMLA 3T1YE 4H2GA 4BMJA 2EN1A 4G9JA 1YFHA 4H1SA 2M7QA 2EM8A 4UT3A 2DXNA 2I9IA 2KOUA 3KWRA 1HNWE 1DI2A 2HY1A 1NNWA 1T4LB 2EN3A 2VE7C 2MC5A 4ZYEA 2WBSA 1MEYC 1QNTA 4BC9A 2EN6A 2LT7A 2L33A 5GTUA 2Z1AA 4DR5E 4V0WA 2EOXA 4N4RB 4WXCA 2EOOA 3E7AA 5IWAE 5FLXC 3AV0A 1T38A 3EPHA 4YKEA 2EM9A 1RC7A 2EOZA 5A6AA 1N32E 4LU9A 1T4NA 1ZAAC 1W24A 4NXNE 1RQ0A 2HHHE 2EMAA 1FJGE 1S3MA 1XZWA 2I13A 4X65E 4B3TE 2WDDA 5A6BD 3HTXA 2UXBE 4BBYA 2QFRA 3JTZA 1X5WA 4F9AB 4B2OA 4Q7FA 1WRJA 2YWQA 2XMOA 2WDCA 2EN2A 2LUQA 1WJPA 4V0VA 1DQ3A 1FKAE 2EPAA 2P6BA 5JPEA 4NHRA 4KKZA 4WSPA 4L8NA 5JJTA 1J26A 5TSEA 3H09A 2UUAE 1TCOA 3ADJA 2WDEA 4I5NC 3RL4A 2NPPC 3H67A 2IE4C 1UILA 4V0XA 2YTFA 3V4YA 2EPZA 2YSPA 1N33E 4GZNC 2ODRC 2N3GA 1EH7A 1A1IA 1A1GA 4DV1E 5KL2A 4R03A 3AUZA 1N36E 2BBGA 1IQOA 3RQZA 2MDGA 1JK7A 1TF3A 3J80C 2EM4A 1G2DC 2VF1A 2M4IA 4BC7A 2EZ6A 5JPFA 4R2RA 3FIGA 1TN9A 4NZVA 1ZR9A 1HNZE 2K4VA 1NCSA 2EM5A 2EN4A 2YTDA 1QHWA 1STUA 4GEQB 2RS6A 2EMBA 4R2CA 2JYAA 2VQEE 3T1HE 2YTIA 2DB2A 2LO3A 4M30A 2MKDA 4DMIA 2USHA 4TUGA 4JI6E 3THOB 3J81C 2B3TB 1S70A 2JWOA 2YU5A 2BDXA 2JOGA 4O43A 2CT1A 1IBME 2V83A 2NUFA 3FGAC 3VHTB 2DFJA 2DRPA 2EMGA 4DV0E 2EPRA 3TGHA 2EQ3A 3IWCA 4JV5E 2EOIA 3EQ1A 2CTDA 2AHDA 2LTSA 2KONA 2EL5A 2EOMA 1PDAA 5EQVA 4WWLA 5HPEA 2BQ8X 2GHFA 5IV8B 3IVDA 2ENAA 3DF6A 2K7IA 2YT4A 2V8QB 4F6MA 2DLQA 3EGGA 4X9JA 2UXCE 1GTKA 2FGGA 4LF6E 4LFBE 1WAO1 2ELYA 3L00A 2EJ4A 4LFCE 4IS1C 4I8OA 2EOSA 1YYKA 4ORAA 4XPNA 1XMOE 2CV9A 1B69A 2A25A 4WXDA 2EMHA 4WYQB 3JAMC 2ELZA 3UK3C 1UBDC 4DV6E 4DR4E 2R17A 2ZO9B 4X64E 2ENCA 2YVTA 2GPIA 2F8BA 2M9AA 3P71C 2HGHA 2YTPA 4ORCA 2ODRD 2R76A 3DSDA 3N5UA 3MSWA 2IAEC 2RSMA 3QFMA 5A6KA 4F6NA 5INBA 4YY3E 2GJUA 2EM6A 4JI8E 2V85A 4R2QA 1SFEA 2LUPB 1UF3A 4LF5E 4WSGA 1QU6A 4UT2A 2EE8A 3LLHA 2LJHA 4LFAE 3BGHA 2Z06A 4H2BA 3IWDA 1F2IG 4JI1E 2EMXA 3ADIA 3BF2A 2EMFA 1KJKA 1AH5A 2JVAA 2EMKA 4LF8E 4MLVA 1S8EA 5T6JA 2VQFE 1A1HA 1OI8A 3JYFA 3F6GA 4KBPA 2NUGA 4HEIA 2LJUA 2HYOA 3K7VC 2EM3A 2RTXA 3EPLA 5IT9C 2EQ0A 2L2MA 2NYLC 3BBGA 4R2PA 1MF8A 5CFFE 4X66E 2L2NA 4BHCA 1AUIA 4JI0E 1PJQA 2EMIA 2EQ1A 2HC5A 4Q35B 4H2FA 2EPPA 2B9DA 2E5LE 1G5BA 2BCDA 4M2ZA 4F0ZA 3HPZA 3H66A 2YPNA 5A69A 1XM7A 4LTYA 1XMQE 3HPSA 1JK2A 2KHXA 3IB8A 2EMZA 4DV2E 1S3LA 1T71A 1A1FA 2EOHA 1EH8A 1O0WA 1MGTA 3IVEA 2EWLA 3IWBA 2DSYA 3VYYA 2YZTA 4Q28A 4WPYA 4O4KA 5LL6R 5LMUE 3GVEA 2DGCA 4DUYE 3M99B 1IQSA 2JOBA 1RMDA 4B3RE 5AC5A 3LL8A 5KL6A 2EP3A 1HNXE 3MHSC 1X49A 4P78A 3K7WC 4YHHE 4DV7E 4FBQA 2LV2A 1M63A 4B3SE 2EMYA 4F54A
chains in the Genus database with same CATH topology
2BQ8X 1HO5A 4V0WA 3ZU0A 3E7AA 3IVDA 3PSNA 2O8GA 3AV0A 3IB7A 4YKEA 2HYPA 3H64A 3EGGA 3T1IA 4LU9A 4DHLA 2YEQA 1W24A 2KKNA 4FCXA 4MOYA 4ORBA 3HVQA 3H63A 1OIEA 3H60A 3H62B 5GTUA 1S3MA 1WAO1 1XZWA 2IE3C 4M0VA 1S95A 1QFCA 1SU1A 3QFOA 1KBPA 3C5WC 2NYMC 4ORAA 4XPNA 2CV9A 1IT6A 2R17A 2QFRA 3CK2A 3PSOA 2ZO9B 4H2IA 4DT2A 2DXLA 1OIDA 2YVTA 2QFPA 4JA9A 3FLOA 1II7A 4JA7A 1S3NA 4Q7FA 3P71C 4B2OA 4ORCA 2XMOA 3DSDA 2WDCA 2ZOAA 3N5UA 2IAEC 1HPUA 4LACC 3QFMA 5DNYA 5INBA 1Z2WA 4UT3B 4V0VA 3RL3A 2GJUA 2P6BA 5JPEA 4O24A 3H61A 4DSYA 4MP0A 2Q8UA 3RL5A 4KKZA 3H68A 5JJTA 4ZX2A 1UF3A 5F3WA 4UT2A 1TCOA 3E0JA 2WDEA 4I5NC 3RL4A 2NPPC 3H67A 2IE4C 2O8AA 2Z06A 4H2BA 4O5GA 4V0XA 4H1YP 4UWQA 3V4YA 2WDFA 2Z72A 3DW8C 3E7BA 4ZVZA 3ZTVA 1S8EA 5J28A 1FJMA 1WARA 3AUZA 3RQZA 1OI8A 1T70A 1HP1A 3JYFA 4I5LC 4KBPA 3C9FA 4TUIA 2HYOA 3K7VC 5IOHA 1JK7A 3H69A 4J6OA 2NXFA 5B8IA 3THNA 1UTEA 2NYLC 1MF8A 3KBPA 5JPFA 4MOVA 4OR9A 1AUIA 4NZVA 4H2FA 1U32A 3DSCA 4F0ZA 1G5BA 2BCDA 3QG5C 3H66A 1QHWA 3ICFA 1XM7A 4LTYA 4HD0A 1USHA 4FBWA 3IB8A 1S3LA 1T71A 1Z2XA 3EGHA 2USHA 4TUGA 4IYPC 3IVEA 3THOB 3QFNA 3QFKA 1S70A 4IL1A 3D03A 2ZBMA 4O4KA 2BDXA 3GVEA 4FBKA 2JOGA 4O43A 4H2GA 4G9JA 3FGAC 4H1SA 2DFJA 4UT3A 2DXNA 2A22A 3LL8A 1V73A 2HY1A 1NNWA 3TGHA 2QJCA 2AHDA 3K7WC 4FBQA 5EQVA 4WWLA 1M63A 5C1VA 5HPEA 2WDDA 2Z1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQ8 X;  1HO5 A;  4V0W A;  3ZU0 A;  3E7A A;  3IVD A;  3PSN A;  2O8G A;  3AV0 A;  3IB7 A;  4YKE A;  2HYP A;  3H64 A;  3EGG A;  3T1I A;  4LU9 A;  4DHL A;  1W24 A;  2KKN A;  4FCX A;  4MOY A;  4ORB A;  3HVQ A;  3H63 A;  1OIE A;  3H60 A;  3H62 B;  5GTU A;  1S3M A;  1WAO 1;  1XZW A;  2IE3 C;  4M0V A;  1S95 A;  1QFC A;  1SU1 A;  3QFO A;  1KBP A;  3C5W C;  2NYM C;  4ORA A;  4XPN A;  2CV9 A;  1IT6 A;  2R17 A;  2QFR A;  3CK2 A;  3PSO A;  4H2I A;  4DT2 A;  4JA9 A;  1OID A;  2YVT A;  2QFP A;  1II7 A;  4JA7 A;  1S3N A;  4Q7F A;  3P71 C;  4B2O A;  4ORC A;  2XMO A;  3DSD A;  2WDC A;  3N5U A;  2IAE C;  1HPU A;  4LAC C;  3QFM A;  5DNY A;  5INB A;  1Z2W A;  4UT3 B;  4V0V A;  3RL3 A;  2GJU A;  2P6B A;  5JPE A;  4O24 A;  3H61 A;  4DSY A;  4MP0 A;  2Q8U A;  3RL5 A;  4KKZ A;  3H68 A;  5JJT A;  4ZX2 A;  1UF3 A;  5F3W A;  4UT2 A;  1TCO A;  2WDE A;  4I5N C;  3RL4 A;  2NPP C;  3H67 A;  2IE4 C;  2O8A A;  2Z06 A;  4H2B A;  4O5G A;  4V0X A;  4H1Y P;  4UWQ A;  3V4Y A;  2WDF A;  2Z72 A;  3DW8 C;  3E7B A;  4ZVZ A;  3ZTV A;  1S8E A;  5J28 A;  1FJM A;  1WAR A;  3AUZ A;  3RQZ A;  1OI8 A;  1T70 A;  1HP1 A;  3JYF A;  4I5L C;  4KBP A;  3C9F A;  4TUI A;  2HYO A;  3K7V C;  5IOH A;  1JK7 A;  3H69 A;  4J6O A;  2NXF A;  5B8I A;  3THN A;  1UTE A;  2NYL C;  1MF8 A;  3KBP A;  5JPF A;  4MOV A;  4OR9 A;  1AUI A;  4NZV A;  4H2F A;  1U32 A;  4F0Z A;  3DSC A;  1G5B A;  2BCD A;  3QG5 C;  3H66 A;  1QHW A;  3ICF A;  1XM7 A;  4LTY A;  4HD0 A;  1USH A;  4FBW A;  3IB8 A;  1S3L A;  1T71 A;  1Z2X A;  3EGH A;  2USH A;  4TUG A;  4IYP C;  3IVE A;  3THO B;  3QFN A;  3QFK A;  1S70 A;  4IL1 A;  2ZBM A;  4O4K A;  2BDX A;  3GVE A;  4FBK A;  2JOG A;  4O43 A;  4H2G A;  4G9J A;  3FGA C;  4H1S A;  2DFJ A;  4UT3 A;  2A22 A;  3LL8 A;  1V73 A;  2HY1 A;  1NNW A;  3TGH A;  2QJC A;  2AHD A;  3K7W C;  4FBQ A;  5EQV A;  4WWL A;  1M63 A;  5C1V A;  5HPE A;  2WDD A;  2Z1A A; 
#chains in the Genus database with same CATH topology
 1Z1B A;  3ZU0 A;  3C4T A;  4JI4 E;  3PSN A;  1GQE A;  5KL4 A;  3J7Y p;  1J5E E;  4DUZ E;  3IB7 A;  2F4V E;  3F6H A;  2HYP A;  5LLQ A;  3H64 A;  4DHL A;  2KKN A;  1IBL E;  4MOY A;  3HVQ A;  4OX9 E;  4X8W A;  3H60 A;  1ZBT A;  2H36 X;  2EPK X;  4M0V A;  5AE3 A;  1QFC A;  2BB8 A;  1SU1 A;  1WHN A;  3P1X A;  3C5W C;  2NYM C;  2DIX A;  2LCE A;  3C4B A;  1ZU1 A;  4DR6 E;  3CK2 A;  4DR2 E;  3PSO A;  2V89 A;  1X3C A;  4DT2 A;  1WXR A;  2QFP A;  2JY9 A;  1II7 A;  2YTE A;  1S3N A;  3FLO A;  1SR9 A;  2EL4 A;  2G7H A;  2CSH A;  2JOX A;  2WCC 3;  4DV5 E;  5DNY A;  2EOF A;  5A6B A;  2MDR A;  4LF4 E;  1Z2W A;  2MKN A;  4JYA E;  4R2S A;  5IXM B;  4NXM E;  4O24 A;  5AAS A;  4DSY A;  4MP0 A;  2IHR 1;  1YUI A;  2Q8U A;  3RL5 A;  2WZO A;  1YZ9 A;  3KZZ A;  1PJS A;  5F3W A;  1DGC A;  2EPL X;  3E0J A;  2L8T A;  2YRK A;  1L4S A;  1N34 E;  2RS7 A;  5KL5 A;  1GZ6 A;  4DV3 E;  4IJD A;  4UWQ A;  2B7T A;  1UHZ A;  4JI5 E;  3DJW A;  1TF6 A;  2NUE A;  2EL6 A;  3HXL A;  2J7J A;  3E7B A;  2EOQ A;  2NA2 A;  2L3J A;  5J28 A;  1XNR E;  1FJM A;  1WAR A;  2JP9 A;  1UN6 B;  1T70 A;  1HP1 A;  4I5L C;  4KZS A;  2JXP A;  5IOH A;  5AE1 A;  2HJJ A;  2GLI A;  4JI2 E;  3H69 A;  4J6O A;  5KL7 A;  5B8I A;  2EPM X;  3OTO E;  2VRD A;  3KBP A;  3ZOQ B;  2WBU A;  4OR9 A;  4JI3 E;  2LE2 A;  2DLK A;  3DSC A;  3QG5 C;  3C6K A;  1I94 E;  4P7D A;  3ICF A;  2EN8 A;  3VK6 A;  4HD0 A;  1YYW A;  2YTG A;  2E1M A;  3BID A;  2YTN A;  2EM2 A;  1Z2X A;  3EGH A;  3QFN A;  2YTJ A;  2EOE A;  2E72 A;  3HQ1 A;  2ADR A;  2YU8 A;  2R1F A;  2V86 A;  4F2J C;  1AAY A;  1HR0 E;  1PJT A;  4RHB B;  2A22 A;  5A2Q C;  1V73 A;  1YYO A;  4KHP E;  2QJC A;  4ZYH A;  1BBG A;  2RSI A;  2N8X A;  2UU9 E;  1YSA C;  5C1V A;  1NEI A;  5AE2 A;  1HO5 A;  3EPK A;  2EMC A;  1PKP A;  2RQL A;  4J8Z A;  1X6H A;  4DKK A;  1BB8 A;  2O8G A;  3OML A;  4DV4 E;  2EOY A;  4F9B B;  3TQM A;  4FK5 C;  4K0K E;  3T1I A;  2YEQ A;  2L3C A;  4FCX A;  5A6J A;  4ORB A;  3ECR A;  3H63 A;  2DMI A;  1OIE A;  3H62 B;  5AC4 A;  2RPC A;  3MHH C;  5LMN E;  4DR1 E;  4LF9 E;  1YUJ A;  1LLM C;  2L2K B;  4R2D A;  1S95 A;  2IE3 C;  2EPN A;  2EN7 A;  4GKK E;  4M9V C;  3QFO A;  1KBP A;  4F9C B;  4DR3 E;  3JU0 A;  2UXD E;  1IT6 A;  1T4O A;  1XNQ E;  4H2I A;  2FV4 B;  1JK1 A;  2DXL A;  1OID A;  4JA9 A;  2LVH A;  4JA7 A;  4KWY A;  2LTR A;  2PRT A;  2V88 A;  3K6Q A;  1EKZ A;  2ZOA A;  1N3G A;  2LRS A;  3C6M A;  3VYX A;  1HPU A;  4LAC C;  1KYQ A;  2JR1 A;  1BBO A;  1YPN A;  2L6M A;  5ADZ A;  4UT3 B;  3RL3 A;  3KZY A;  3H61 A;  2EPO A;  2JPA A;  3H68 A;  4ZX2 A;  1WHQ A;  2FTX B;  2UUC E;  2EM0 A;  2EPU A;  4RH8 A;  2ZM6 E;  1X6F A;  2EM7 A;  4MLQ A;  1X6E A;  2EPC A;  2O8A A;  4O5G A;  1A1K A;  4H1Y P;  2B7V A;  3ADG A;  2WDF A;  1T39 A;  4OOG C;  4ZYD A;  2Z72 A;  2MC6 A;  1EH6 A;  3DW8 C;  1ZBQ A;  2N3H A;  3LML A;  4ZVZ A;  2CPN A;  2D9H A;  3J7A G;  3ZTV A;  5BR8 E;  1G2F C;  4WX9 A;  4AQY E;  1X47 A;  2EOJ A;  3RMP A;  2WBT A;  3C9F A;  4TUI A;  2EPX A;  2YTQ A;  4R2A A;  2NXF A;  4BHB A;  4R8O A;  3THN A;  1X48 A;  4ZYG A;  5KL3 A;  1UTE A;  4MOV A;  3ADL A;  4R2E A;  2NAB A;  2YRH A;  2YSO A;  1U32 A;  4L5N C;  4HTG A;  2UUB E;  2EMW A;  4BCA A;  2LBS B;  1IMU A;  4JI7 E;  2M1S A;  4B3M E;  2YRM A;  1USH A;  4FBW A;  1A1L A;  4LF7 E;  2LMZ A;  2ENH A;  2DMY A;  3EPJ A;  2EOR A;  4BS9 A;  4GKJ E;  4X62 E;  4DR7 E;  1IBK E;  4IYP C;  3QFK A;  4WFT A;  2V87 A;  4IL1 A;  3D03 A;  2L92 A;  1A1J A;  2YTO A;  2ZBM A;  1P47 A;  4FBK A;  2EML A;  3T1Y E;  4H2G A;  4BMJ A;  2EN1 A;  4G9J A;  1YFH A;  4H1S A;  2M7Q A;  2EM8 A;  4UT3 A;  2DXN A;  2I9I A;  2KOU A;  3KWR A;  1HNW E;  1DI2 A;  2HY1 A;  1NNW A;  1T4L B;  2EN3 A;  2VE7 C;  2MC5 A;  4ZYE A;  2WBS A;  1MEY C;  1QNT A;  4BC9 A;  2EN6 A;  2LT7 A;  2L33 A;  5GTU A;  2Z1A A;  4DR5 E;  4V0W A;  2EOX A;  4N4R B;  4WXC A;  2EOO A;  3E7A A;  5IWA E;  5FLX C;  3AV0 A;  1T38 A;  3EPH A;  4YKE A;  2EM9 A;  1RC7 A;  2EOZ A;  5A6A A;  1N32 E;  4LU9 A;  1T4N A;  1ZAA C;  1W24 A;  4NXN E;  1RQ0 A;  2HHH E;  2EMA A;  1FJG E;  1S3M A;  1XZW A;  2I13 A;  4X65 E;  4B3T E;  2WDD A;  5A6B D;  3HTX A;  2UXB E;  4BBY A;  2QFR A;  3JTZ A;  1X5W A;  4F9A B;  4B2O A;  4Q7F A;  1WRJ A;  2YWQ A;  2XMO A;  2WDC A;  2EN2 A;  2LUQ A;  1WJP A;  4V0V A;  1DQ3 A;  1FKA E;  2EPA A;  2P6B A;  5JPE A;  4NHR A;  4KKZ A;  4WSP A;  4L8N A;  5JJT A;  1J26 A;  5TSE A;  3H09 A;  2UUA E;  1TCO A;  3ADJ A;  2WDE A;  4I5N C;  3RL4 A;  2NPP C;  3H67 A;  2IE4 C;  1UIL A;  4V0X A;  2YTF A;  3V4Y A;  2EPZ A;  2YSP A;  1N33 E;  4GZN C;  2ODR C;  2N3G A;  1EH7 A;  1A1I A;  1A1G A;  4DV1 E;  5KL2 A;  4R03 A;  3AUZ A;  1N36 E;  2BBG A;  1IQO A;  3RQZ A;  2MDG A;  1JK7 A;  1TF3 A;  3J80 C;  2EM4 A;  1G2D C;  2VF1 A;  2M4I A;  4BC7 A;  2EZ6 A;  5JPF A;  4R2R A;  3FIG A;  1TN9 A;  4NZV A;  1ZR9 A;  1HNZ E;  2K4V A;  1NCS A;  2EM5 A;  2EN4 A;  2YTD A;  1QHW A;  1STU A;  4GEQ B;  2RS6 A;  2EMB A;  4R2C A;  2JYA A;  2VQE E;  3T1H E;  2YTI A;  2DB2 A;  2LO3 A;  4M30 A;  2MKD A;  4DMI A;  2USH A;  4TUG A;  4JI6 E;  3THO B;  3J81 C;  2B3T B;  1S70 A;  2JWO A;  2YU5 A;  2BDX A;  2JOG A;  4O43 A;  2CT1 A;  1IBM E;  2V83 A;  2NUF A;  3FGA C;  3VHT B;  2DFJ A;  2DRP A;  2EMG A;  4DV0 E;  2EPR A;  3TGH A;  2EQ3 A;  3IWC A;  4JV5 E;  2EOI A;  3EQ1 A;  2CTD A;  2AHD A;  2LTS A;  2KON A;  2EL5 A;  2EOM A;  1PDA A;  5EQV A;  4WWL A;  5HPE A;  2BQ8 X;  2GHF A;  5IV8 B;  3IVD A;  2ENA A;  3DF6 A;  2K7I A;  2YT4 A;  2V8Q B;  4F6M A;  2DLQ A;  3EGG A;  4X9J A;  2UXC E;  1GTK A;  2FGG A;  4LF6 E;  4LFB E;  1WAO 1;  2ELY A;  3L00 A;  2EJ4 A;  4LFC E;  4IS1 C;  4I8O A;  2EOS A;  1YYK A;  4ORA A;  4XPN A;  1XMO E;  2CV9 A;  1B69 A;  2A25 A;  4WXD A;  2EMH A;  4WYQ B;  3JAM C;  2ELZ A;  3UK3 C;  1UBD C;  4DV6 E;  4DR4 E;  2R17 A;  2ZO9 B;  4X64 E;  2ENC A;  2YVT A;  2GPI A;  2F8B A;  2M9A A;  3P71 C;  2HGH A;  2YTP A;  4ORC A;  2ODR D;  2R76 A;  3DSD A;  3N5U A;  3MSW A;  2IAE C;  2RSM A;  3QFM A;  5A6K A;  4F6N A;  5INB A;  4YY3 E;  2GJU A;  2EM6 A;  4JI8 E;  2V85 A;  4R2Q A;  1SFE A;  2LUP B;  1UF3 A;  4LF5 E;  4WSG A;  1QU6 A;  4UT2 A;  2EE8 A;  3LLH A;  2LJH A;  4LFA E;  3BGH A;  2Z06 A;  4H2B A;  3IWD A;  1F2I G;  4JI1 E;  2EMX A;  3ADI A;  3BF2 A;  2EMF A;  1KJK A;  1AH5 A;  2JVA A;  2EMK A;  4LF8 E;  4MLV A;  1S8E A;  5T6J A;  2VQF E;  1A1H A;  1OI8 A;  3JYF A;  3F6G A;  4KBP A;  2NUG A;  4HEI A;  2LJU A;  2HYO A;  3K7V C;  2EM3 A;  2RTX A;  3EPL A;  5IT9 C;  2EQ0 A;  2L2M A;  2NYL C;  3BBG A;  4R2P A;  1MF8 A;  5CFF E;  4X66 E;  2L2N A;  4BHC A;  1AUI A;  4JI0 E;  1PJQ A;  2EMI A;  2EQ1 A;  2HC5 A;  4Q35 B;  4H2F A;  2EPP A;  2B9D A;  2E5L E;  1G5B A;  2BCD A;  4M2Z A;  4F0Z A;  3HPZ A;  3H66 A;  2YPN A;  5A69 A;  1XM7 A;  4LTY A;  1XMQ E;  3HPS A;  1JK2 A;  2KHX A;  3IB8 A;  2EMZ A;  4DV2 E;  1S3L A;  1T71 A;  1A1F A;  2EOH A;  1EH8 A;  1O0W A;  1MGT A;  3IVE A;  2EWL A;  3IWB A;  2DSY A;  3VYY A;  2YZT A;  4Q28 A;  4WPY A;  4O4K A;  5LL6 R;  5LMU E;  3GVE A;  2DGC A;  4DUY E;  3M99 B;  1IQS A;  2JOB A;  1RMD A;  4B3R E;  5AC5 A;  3LL8 A;  5KL6 A;  2EP3 A;  1HNX E;  3MHS C;  1X49 A;  4P78 A;  3K7W C;  4YHH E;  4DV7 E;  4FBQ A;  2LV2 A;  1M63 A;  4B3S E;  2EMY A;  4F54 A; 
#chains in the Genus database with same CATH homology
 2BQ8 X;  1HO5 A;  4V0W A;  3ZU0 A;  3E7A A;  3IVD A;  3PSN A;  2O8G A;  3AV0 A;  3IB7 A;  4YKE A;  2HYP A;  3H64 A;  3EGG A;  3T1I A;  4LU9 A;  4DHL A;  2YEQ A;  1W24 A;  2KKN A;  4FCX A;  4MOY A;  4ORB A;  3HVQ A;  3H63 A;  1OIE A;  3H60 A;  3H62 B;  5GTU A;  1S3M A;  1WAO 1;  1XZW A;  2IE3 C;  4M0V A;  1S95 A;  1QFC A;  1SU1 A;  3QFO A;  1KBP A;  3C5W C;  2NYM C;  4ORA A;  4XPN A;  2CV9 A;  1IT6 A;  2R17 A;  2QFR A;  3CK2 A;  3PSO A;  2ZO9 B;  4H2I A;  4DT2 A;  2DXL A;  1OID A;  2YVT A;  2QFP A;  4JA9 A;  3FLO A;  1II7 A;  4JA7 A;  1S3N A;  4Q7F A;  3P71 C;  4B2O A;  4ORC A;  2XMO A;  3DSD A;  2WDC A;  2ZOA A;  3N5U A;  2IAE C;  1HPU A;  4LAC C;  3QFM A;  5DNY A;  5INB A;  1Z2W A;  4UT3 B;  4V0V A;  3RL3 A;  2GJU A;  2P6B A;  5JPE A;  4O24 A;  3H61 A;  4DSY A;  4MP0 A;  2Q8U A;  3RL5 A;  4KKZ A;  3H68 A;  5JJT A;  4ZX2 A;  1UF3 A;  5F3W A;  4UT2 A;  1TCO A;  3E0J A;  2WDE A;  4I5N C;  3RL4 A;  2NPP C;  3H67 A;  2IE4 C;  2O8A A;  2Z06 A;  4H2B A;  4O5G A;  4V0X A;  4H1Y P;  4UWQ A;  3V4Y A;  2WDF A;  2Z72 A;  3DW8 C;  3E7B A;  4ZVZ A;  3ZTV A;  1S8E A;  5J28 A;  1FJM A;  1WAR A;  3AUZ A;  3RQZ A;  1OI8 A;  1T70 A;  1HP1 A;  3JYF A;  4I5L C;  4KBP A;  3C9F A;  4TUI A;  2HYO A;  3K7V C;  5IOH A;  1JK7 A;  3H69 A;  4J6O A;  2NXF A;  5B8I A;  3THN A;  1UTE A;  2NYL C;  1MF8 A;  3KBP A;  5JPF A;  4MOV A;  4OR9 A;  1AUI A;  4NZV A;  4H2F A;  1U32 A;  3DSC A;  4F0Z A;  1G5B A;  2BCD A;  3QG5 C;  3H66 A;  1QHW A;  3ICF A;  1XM7 A;  4LTY A;  4HD0 A;  1USH A;  4FBW A;  3IB8 A;  1S3L A;  1T71 A;  1Z2X A;  3EGH A;  2USH A;  4TUG A;  4IYP C;  3IVE A;  3THO B;  3QFN A;  3QFK A;  1S70 A;  4IL1 A;  3D03 A;  2ZBM A;  4O4K A;  2BDX A;  3GVE A;  4FBK A;  2JOG A;  4O43 A;  4H2G A;  4G9J A;  3FGA C;  4H1S A;  2DFJ A;  4UT3 A;  2DXN A;  2A22 A;  3LL8 A;  1V73 A;  2HY1 A;  1NNW A;  3TGH A;  2QJC A;  2AHD A;  3K7W C;  4FBQ A;  5EQV A;  4WWL A;  1M63 A;  5C1V A;  5HPE A;  2WDD A;  2Z1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...