3H69A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c) with two zn2+ atoms complexed with endothall
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h69A00
2CV9A 1S3LA 3PSOA 3QFNA 2NXFA 4JA9A 3HVQA 4ZVZA 2P6BA 3RL5A 1OIDA 2HY1A 1II7A 4O5GA 2HYPA 3GVEA 1Z2XA 4XPNA 4UT3B 1USHA 3H63A 3RL4A 2O8GA 4V0VA 3THNA 3K7WC 1XM7A 4MOVA 1OIEA 4JA7A 4O4KA 1UF3A 5HPEA 2USHA 2BQ8X 3EGHA 3H61A 1AUIA 2Q8UA 5INBA 3P71C 2IE3C 3H68A 2QJCA 5JPEA 4IYPC 1W24A 1S8EA 3TGHA 1NNWA 3QFKA 5DNYA 4YKEA 3EGGA 3V4YA 3AUZA 3DSCA 2NYLC 2WDCA 2DFJA 1KBPA 3H66A 4I5NC 5EQVA 3DSDA 1MF8A 4TUGA 4KBPA 3QFMA 1HPUA 3QFOA 4V0WA 4TUIA 4UT2A 2Z06A 3LL8A 3ZU0A 1HP1A 3H69A 1S95A 2QFRA 4LTYA 1FJMA 5B8IA 4H1YP 1V73A 4G9JA 2KKNA 4KKZA 1HO5A 3IVEA 4UT3A 4ZX2A 4H2GA 3C9FA 4H2FA 1Z2WA 3PSNA 2GJUA 2BCDA 4J6OA 1JK7A 4Q7FA 3THOB 5J28A 4FBQA 2IAEC 1S3NA 2AHDA 4WWLA 3IVDA 1TCOA 5C1VA 4OR9A 1UTEA 3AV0A 5JJTA 4FBWA 1QFCA 2Z72A 3H64A 2WDDA 3QG5C 2IE4C 4H2IA 4IL1A 5IOHA 4H1SA 3ZTVA 3DW8C 2A22A 4FBKA 4I5LC 4O43A 4F0ZA 1SU1A 3H62B 5F3WA 1IT6A 3IB7A 1T70A 4B2OA 3E7BA 4H2BA 1T71A 3K7VC 3T1IA 1OI8A 2NPPC 4FCXA 3KBPA 2R17A 4ORCA 4NZVA 5JPFA 1G5BA 3FGAC 4ORBA 3JYFA 3E7AA 1S3MA 1WARA 2ZBMA 2YVTA 4DSYA 3C5WC 3RL3A 3RQZA 4LU9A 1WAO1 4M0VA 5GTUA 3CK2A 1M63A 2HYOA 2WDEA 4V0XA 2WDFA 2Z1AA 4HD0A 4MP0A 4UWQA 4DT2A 2XMOA 2JOGA 3H67A 3IB8A 2O8AA 2QFPA 1S70A 4DHLA 1U32A 1XZWA 3H60A 2NYMC 4LACC 4MOYA 4O24A 2BDXA 3ICFA 3N5UA 4ORAA 1QHWA
chains in the Genus database with same CATH superfamily
2CV9A 1S3LA 3PSOA 3QFNA 2NXFA 4JA9A 3HVQA 4ZVZA 2P6BA 3RL5A 1OIDA 2HY1A 1II7A 4O5GA 2HYPA 3GVEA 1Z2XA 4XPNA 4UT3B 1USHA 3H63A 3RL4A 2O8GA 4V0VA 3THNA 3K7WC 1XM7A 4MOVA 1OIEA 4JA7A 4O4KA 1UF3A 5HPEA 2USHA 2BQ8X 3EGHA 3H61A 3D03A 1AUIA 2Q8UA 5INBA 3P71C 2IE3C 3H68A 2QJCA 5JPEA 4IYPC 1W24A 1S8EA 3TGHA 1NNWA 3QFKA 5DNYA 4YKEA 3EGGA 3V4YA 3AUZA 3DSCA 2NYLC 2WDCA 2DFJA 1KBPA 3H66A 4I5NC 5EQVA 3DSDA 1MF8A 2DXNA 4TUGA 4KBPA 3QFMA 1HPUA 3QFOA 4V0WA 4TUIA 4UT2A 2Z06A 3LL8A 3ZU0A 1HP1A 3H69A 2ZO9B 1S95A 2QFRA 4LTYA 1FJMA 5B8IA 4H1YP 1V73A 4G9JA 2KKNA 4KKZA 1HO5A 3IVEA 4UT3A 4ZX2A 4H2GA 2ZOAA 3C9FA 4H2FA 1Z2WA 3PSNA 2GJUA 2BCDA 4J6OA 1JK7A 4Q7FA 3THOB 5J28A 4FBQA 2IAEC 2YEQA 1S3NA 2AHDA 4WWLA 3IVDA 1TCOA 5C1VA 4OR9A 1UTEA 3AV0A 5JJTA 4FBWA 1QFCA 2Z72A 3H64A 2WDDA 3QG5C 2IE4C 4H2IA 4IL1A 5IOHA 4H1SA 3FLOA 3DW8C 3ZTVA 2A22A 4FBKA 4I5LC 4O43A 4F0ZA 1SU1A 3H62B 5F3WA 1IT6A 3IB7A 1T70A 4B2OA 3E7BA 4H2BA 1T71A 3K7VC 3T1IA 1OI8A 2NPPC 4FCXA 3KBPA 2R17A 4ORCA 4NZVA 5JPFA 1G5BA 3FGAC 4ORBA 3JYFA 3E7AA 1S3MA 1WARA 2ZBMA 2YVTA 4DSYA 3C5WC 3RL3A 3RQZA 4LU9A 1WAO1 4M0VA 5GTUA 3CK2A 1M63A 2HYOA 2WDEA 4V0XA 2WDFA 2Z1AA 4HD0A 4MP0A 4UWQA 4DT2A 2XMOA 2JOGA 3E0JA 3H67A 3IB8A 2DXLA 2O8AA 2QFPA 1S70A 4DHLA 1U32A 1XZWA 3H60A 2NYMC 4LACC 4MOYA 4O24A 2BDXA 3ICFA 3N5UA 4ORAA 1QHWA
chains in the Genus database with same CATH topology
2CV9A 1S3LA 3PSOA 3QFNA 2NXFA 4JA9A 3HVQA 4ZVZA 2P6BA 3RL5A 1OIDA 2HY1A 1II7A 4O5GA 2HYPA 3GVEA 1Z2XA 4XPNA 4UT3B 1USHA 3H63A 3RL4A 2O8GA 4V0VA 3THNA 3K7WC 1XM7A 4MOVA 1OIEA 4JA7A 4O4KA 1UF3A 5HPEA 2USHA 2BQ8X 3EGHA 3H61A 3D03A 1AUIA 2Q8UA 5INBA 3P71C 2IE3C 3H68A 2QJCA 5JPEA 4IYPC 1W24A 1S8EA 3TGHA 1NNWA 3QFKA 5DNYA 4YKEA 3EGGA 3V4YA 3AUZA 3DSCA 2NYLC 2WDCA 2DFJA 1KBPA 3H66A 4I5NC 5EQVA 3DSDA 1MF8A 2DXNA 4TUGA 4KBPA 3QFMA 1HPUA 3QFOA 4V0WA 4TUIA 4UT2A 2Z06A 3LL8A 3ZU0A 1HP1A 3H69A 2ZO9B 1S95A 2QFRA 4LTYA 1FJMA 5B8IA 4H1YP 1V73A 4G9JA 2KKNA 4KKZA 1HO5A 3IVEA 4UT3A 4ZX2A 4H2GA 2ZOAA 3C9FA 4H2FA 1Z2WA 3PSNA 2GJUA 2BCDA 4J6OA 1JK7A 4Q7FA 3THOB 5J28A 4FBQA 2IAEC 2YEQA 1S3NA 2AHDA 4WWLA 3IVDA 1TCOA 5C1VA 4OR9A 1UTEA 3AV0A 5JJTA 4FBWA 1QFCA 2Z72A 3H64A 2WDDA 3QG5C 2IE4C 4H2IA 4IL1A 5IOHA 4H1SA 3FLOA 3DW8C 3ZTVA 2A22A 4FBKA 4I5LC 4O43A 4F0ZA 1SU1A 3H62B 5F3WA 1IT6A 3IB7A 1T70A 4B2OA 3E7BA 4H2BA 1T71A 3K7VC 3T1IA 1OI8A 2NPPC 4FCXA 3KBPA 2R17A 4ORCA 4NZVA 5JPFA 1G5BA 3FGAC 4ORBA 3JYFA 3E7AA 1S3MA 1WARA 2ZBMA 2YVTA 4DSYA 3C5WC 3RL3A 3RQZA 4LU9A 1WAO1 4M0VA 5GTUA 3CK2A 1M63A 2HYOA 2WDEA 4V0XA 2WDFA 2Z1AA 4HD0A 4MP0A 4UWQA 4DT2A 2XMOA 2JOGA 3E0JA 3H67A 3IB8A 2DXLA 2O8AA 2QFPA 1S70A 4DHLA 1U32A 1XZWA 3H60A 2NYMC 4LACC 4MOYA 4O24A 2BDXA 3ICFA 3N5UA 4ORAA 1QHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV9 A;  1S3L A;  3PSO A;  3QFN A;  2NXF A;  4JA9 A;  3HVQ A;  4ZVZ A;  2P6B A;  3RL5 A;  1OID A;  2HY1 A;  1II7 A;  4O5G A;  2HYP A;  3GVE A;  1Z2X A;  4XPN A;  4UT3 B;  1USH A;  3H63 A;  3RL4 A;  2O8G A;  4V0V A;  3THN A;  3K7W C;  1XM7 A;  4MOV A;  1OIE A;  4JA7 A;  4O4K A;  1UF3 A;  5HPE A;  2USH A;  2BQ8 X;  3EGH A;  3H61 A;  1AUI A;  2Q8U A;  5INB A;  3P71 C;  2IE3 C;  3H68 A;  2QJC A;  5JPE A;  4IYP C;  1W24 A;  1S8E A;  3TGH A;  1NNW A;  3QFK A;  5DNY A;  4YKE A;  3EGG A;  3V4Y A;  3AUZ A;  3DSC A;  2NYL C;  2WDC A;  2DFJ A;  1KBP A;  3H66 A;  4I5N C;  5EQV A;  3DSD A;  1MF8 A;  4TUG A;  4KBP A;  3QFM A;  1HPU A;  3QFO A;  4V0W A;  4TUI A;  4UT2 A;  2Z06 A;  3LL8 A;  3ZU0 A;  1HP1 A;  3H69 A;  1S95 A;  2QFR A;  4LTY A;  1FJM A;  5B8I A;  4H1Y P;  1V73 A;  4G9J A;  2KKN A;  4KKZ A;  1HO5 A;  3IVE A;  4UT3 A;  4ZX2 A;  4H2G A;  3C9F A;  4H2F A;  1Z2W A;  3PSN A;  2GJU A;  2BCD A;  4J6O A;  1JK7 A;  4Q7F A;  3THO B;  5J28 A;  4FBQ A;  2IAE C;  1S3N A;  2AHD A;  4WWL A;  3IVD A;  1TCO A;  5C1V A;  4OR9 A;  1UTE A;  3AV0 A;  5JJT A;  4FBW A;  1QFC A;  2Z72 A;  3H64 A;  2WDD A;  3QG5 C;  2IE4 C;  4H2I A;  4IL1 A;  5IOH A;  4H1S A;  3ZTV A;  3DW8 C;  2A22 A;  4FBK A;  4I5L C;  4O43 A;  4F0Z A;  1SU1 A;  3H62 B;  5F3W A;  1IT6 A;  3IB7 A;  1T70 A;  4B2O A;  3E7B A;  4H2B A;  1T71 A;  3K7V C;  3T1I A;  1OI8 A;  2NPP C;  4FCX A;  3KBP A;  2R17 A;  4ORC A;  4NZV A;  5JPF A;  1G5B A;  3FGA C;  4ORB A;  3JYF A;  3E7A A;  1S3M A;  1WAR A;  2ZBM A;  2YVT A;  4DSY A;  3C5W C;  3RL3 A;  3RQZ A;  4LU9 A;  1WAO 1;  4M0V A;  5GTU A;  3CK2 A;  1M63 A;  2HYO A;  2WDE A;  4V0X A;  2WDF A;  2Z1A A;  4HD0 A;  4MP0 A;  4UWQ A;  4DT2 A;  2XMO A;  2JOG A;  3H67 A;  3IB8 A;  2O8A A;  2QFP A;  1S70 A;  4DHL A;  1U32 A;  1XZW A;  3H60 A;  2NYM C;  4LAC C;  4MOY A;  4O24 A;  2BDX A;  3ICF A;  3N5U A;  4ORA A;  1QHW A; 
#chains in the Genus database with same CATH topology
 2CV9 A;  1S3L A;  3PSO A;  3QFN A;  2NXF A;  4JA9 A;  3HVQ A;  4ZVZ A;  2P6B A;  3RL5 A;  1OID A;  2HY1 A;  1II7 A;  4O5G A;  2HYP A;  3GVE A;  1Z2X A;  4XPN A;  4UT3 B;  1USH A;  3H63 A;  3RL4 A;  2O8G A;  4V0V A;  3THN A;  3K7W C;  1XM7 A;  4MOV A;  1OIE A;  4JA7 A;  4O4K A;  1UF3 A;  5HPE A;  2USH A;  2BQ8 X;  3EGH A;  3H61 A;  3D03 A;  1AUI A;  2Q8U A;  5INB A;  3P71 C;  2IE3 C;  3H68 A;  2QJC A;  5JPE A;  4IYP C;  1W24 A;  1S8E A;  3TGH A;  1NNW A;  3QFK A;  5DNY A;  4YKE A;  3EGG A;  3V4Y A;  3AUZ A;  3DSC A;  2NYL C;  2WDC A;  2DFJ A;  1KBP A;  3H66 A;  4I5N C;  5EQV A;  3DSD A;  1MF8 A;  2DXN A;  4TUG A;  4KBP A;  3QFM A;  1HPU A;  3QFO A;  4V0W A;  4TUI A;  4UT2 A;  2Z06 A;  3LL8 A;  3ZU0 A;  1HP1 A;  3H69 A;  2ZO9 B;  1S95 A;  2QFR A;  4LTY A;  1FJM A;  5B8I A;  4H1Y P;  1V73 A;  4G9J A;  2KKN A;  4KKZ A;  1HO5 A;  3IVE A;  4UT3 A;  4ZX2 A;  4H2G A;  2ZOA A;  3C9F A;  4H2F A;  1Z2W A;  3PSN A;  2GJU A;  2BCD A;  4J6O A;  1JK7 A;  4Q7F A;  3THO B;  5J28 A;  4FBQ A;  2IAE C;  2YEQ A;  1S3N A;  2AHD A;  4WWL A;  3IVD A;  1TCO A;  5C1V A;  4OR9 A;  1UTE A;  3AV0 A;  5JJT A;  4FBW A;  1QFC A;  2Z72 A;  3H64 A;  2WDD A;  3QG5 C;  2IE4 C;  4H2I A;  4IL1 A;  5IOH A;  4H1S A;  3FLO A;  3DW8 C;  3ZTV A;  2A22 A;  4FBK A;  4I5L C;  4O43 A;  4F0Z A;  1SU1 A;  3H62 B;  5F3W A;  1IT6 A;  3IB7 A;  1T70 A;  4B2O A;  3E7B A;  4H2B A;  1T71 A;  3K7V C;  3T1I A;  1OI8 A;  2NPP C;  4FCX A;  3KBP A;  2R17 A;  4ORC A;  4NZV A;  5JPF A;  1G5B A;  3FGA C;  4ORB A;  3JYF A;  3E7A A;  1S3M A;  1WAR A;  2ZBM A;  2YVT A;  4DSY A;  3C5W C;  3RL3 A;  3RQZ A;  4LU9 A;  1WAO 1;  4M0V A;  5GTU A;  3CK2 A;  1M63 A;  2HYO A;  2WDE A;  4V0X A;  2WDF A;  2Z1A A;  4HD0 A;  4MP0 A;  4UWQ A;  4DT2 A;  2XMO A;  2JOG A;  3E0J A;  3H67 A;  3IB8 A;  2DXL A;  2O8A A;  2QFP A;  1S70 A;  4DHL A;  1U32 A;  1XZW A;  3H60 A;  2NYM C;  4LAC C;  4MOY A;  4O24 A;  2BDX A;  3ICF A;  3N5U A;  4ORA A;  1QHW A; 
#chains in the Genus database with same CATH homology
 2CV9 A;  1S3L A;  3PSO A;  3QFN A;  2NXF A;  4JA9 A;  3HVQ A;  4ZVZ A;  2P6B A;  3RL5 A;  1OID A;  2HY1 A;  1II7 A;  4O5G A;  2HYP A;  3GVE A;  1Z2X A;  4XPN A;  4UT3 B;  1USH A;  3H63 A;  3RL4 A;  2O8G A;  4V0V A;  3THN A;  3K7W C;  1XM7 A;  4MOV A;  1OIE A;  4JA7 A;  4O4K A;  1UF3 A;  5HPE A;  2USH A;  2BQ8 X;  3EGH A;  3H61 A;  3D03 A;  1AUI A;  2Q8U A;  5INB A;  3P71 C;  2IE3 C;  3H68 A;  2QJC A;  5JPE A;  4IYP C;  1W24 A;  1S8E A;  3TGH A;  1NNW A;  3QFK A;  5DNY A;  4YKE A;  3EGG A;  3V4Y A;  3AUZ A;  3DSC A;  2NYL C;  2WDC A;  2DFJ A;  1KBP A;  3H66 A;  4I5N C;  5EQV A;  3DSD A;  1MF8 A;  2DXN A;  4TUG A;  4KBP A;  3QFM A;  1HPU A;  3QFO A;  4V0W A;  4TUI A;  4UT2 A;  2Z06 A;  3LL8 A;  3ZU0 A;  1HP1 A;  3H69 A;  2ZO9 B;  1S95 A;  2QFR A;  4LTY A;  1FJM A;  5B8I A;  4H1Y P;  1V73 A;  4G9J A;  2KKN A;  4KKZ A;  1HO5 A;  3IVE A;  4UT3 A;  4ZX2 A;  4H2G A;  2ZOA A;  3C9F A;  4H2F A;  1Z2W A;  3PSN A;  2GJU A;  2BCD A;  4J6O A;  1JK7 A;  4Q7F A;  3THO B;  5J28 A;  4FBQ A;  2IAE C;  2YEQ A;  1S3N A;  2AHD A;  4WWL A;  3IVD A;  1TCO A;  5C1V A;  4OR9 A;  1UTE A;  3AV0 A;  5JJT A;  4FBW A;  1QFC A;  2Z72 A;  3H64 A;  2WDD A;  3QG5 C;  2IE4 C;  4H2I A;  4IL1 A;  5IOH A;  4H1S A;  3FLO A;  3DW8 C;  3ZTV A;  2A22 A;  4FBK A;  4I5L C;  4O43 A;  4F0Z A;  1SU1 A;  3H62 B;  5F3W A;  1IT6 A;  3IB7 A;  1T70 A;  4B2O A;  3E7B A;  4H2B A;  1T71 A;  3K7V C;  3T1I A;  1OI8 A;  2NPP C;  4FCX A;  3KBP A;  2R17 A;  4ORC A;  4NZV A;  5JPF A;  1G5B A;  3FGA C;  4ORB A;  3JYF A;  3E7A A;  1S3M A;  1WAR A;  2ZBM A;  2YVT A;  4DSY A;  3C5W C;  3RL3 A;  3RQZ A;  4LU9 A;  1WAO 1;  4M0V A;  5GTU A;  3CK2 A;  1M63 A;  2HYO A;  2WDE A;  4V0X A;  2WDF A;  2Z1A A;  4HD0 A;  4MP0 A;  4UWQ A;  4DT2 A;  2XMO A;  2JOG A;  3E0J A;  3H67 A;  3IB8 A;  2DXL A;  2O8A A;  2QFP A;  1S70 A;  4DHL A;  1U32 A;  1XZW A;  3H60 A;  2NYM C;  4LAC C;  4MOY A;  4O24 A;  2BDX A;  3ICF A;  3N5U A;  4ORA A;  1QHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...