2O8GA

Rat pp1c gamma complexed with mouse inhibitor-2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
publication title Structural basis for regulation of protein phosphatase 1 by inhibitor-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
total genus 111
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2o8gA00
4IYPC 3IVDA 5F3WA 1IT6A 4FBKA 4B2OA 3IB7A 3GVEA 3EGGA 3V4YA 1Z2WA 2XMOA 4XPNA 1UF3A 5IOHA 4WWLA 2YVTA 2JOGA 2WDDA 4OR9A 1S3NA 1T71A 2ZBMA 4DHLA 4V0XA 2QFRA 3H68A 4ORAA 2DFJA 1T70A 5DNYA 2NPPC 3THOB 3E7BA 1TCOA 4KBPA 4DSYA 1G5BA 1S70A 4H1YP 3H63A 4MOYA 4UT3A 4M0VA 5EQVA 2WDEA 3ICFA 3P71C 5JJTA 4O5GA 3TGHA 2Z72A 1JK7A 1OIDA 3PSNA 4H2IA 2QJCA 4O43A 3IB8A 3JYFA 4JA7A 3LL8A 1II7A 2BDXA 2QFPA 2IE4C 4ORCA 3QFKA 4H2BA 1XM7A 4J6OA 4ZX2A 4UWQA 3H64A 4TUIA 3ZU0A 1OI8A 3EGHA 2HYPA 4O24A 4H1SA 2Z06A 1NNWA 3H61A 4I5LC 2USHA 2WDCA 4O4KA 5GTUA 3H66A 2P6BA 1S3LA 1QHWA 1QFCA 1WARA 4IL1A 1S3MA 3IVEA 1UTEA 3HVQA 4I5NC 2A22A 2KKNA 1HPUA 1USHA 3K7WC 4F0ZA 1Z2XA 4LACC 2NYMC 2BCDA 4Q7FA 1V73A 3DSDA 2NYLC 3CK2A 1S95A 4H2FA 4UT2A 4TUGA 1W24A 1SU1A 1U32A 1XZWA 2NXFA 3C5WC 5INBA 3DW8C 4FBWA 3E7AA 3PSOA 3K7VC 1MF8A 5B8IA 2GJUA 4LTYA 4H2GA 4LU9A 1M63A 2O8AA 3H62B 5J28A 4KKZA 2R17A 4G9JA 3H67A 1KBPA 2Q8UA 5C1VA 1OIEA 3H60A 2AHDA 1FJMA 3FGAC 3RL5A 3QG5C 1S8EA 4ORBA 5HPEA 2WDFA 3THNA 2CV9A 4V0VA 4UT3B 3AUZA 5JPEA 4MOVA 3KBPA 4YKEA 1WAO1 4JA9A 4DT2A 5JPFA 3RQZA 3DSCA 2BQ8X 2Z1AA 3H69A 3ZTVA 3RL3A 4MP0A 3QFNA 3QFOA 3N5UA 3RL4A 3T1IA 2IE3C 2HYOA 3AV0A 4ZVZA 4FCXA 2O8GA 1AUIA 4V0WA 1HP1A 4FBQA 4NZVA 3C9FA 2HY1A 4HD0A 2IAEC 1HO5A 3QFMA
chains in the Genus database with same CATH superfamily
4IYPC 3IVDA 2ZO9B 5F3WA 1IT6A 4FBKA 4B2OA 3IB7A 3GVEA 3EGGA 3V4YA 1Z2WA 2XMOA 4XPNA 1UF3A 5IOHA 4WWLA 2YVTA 2DXNA 2JOGA 2WDDA 4OR9A 1S3NA 1T71A 2ZBMA 4DHLA 4V0XA 2QFRA 3H68A 4ORAA 2DFJA 1T70A 5DNYA 2NPPC 3THOB 3E7BA 1TCOA 4KBPA 4DSYA 1G5BA 1S70A 4H1YP 3H63A 3FLOA 4MOYA 4UT3A 4M0VA 5EQVA 2WDEA 3ICFA 3P71C 5JJTA 4O5GA 3TGHA 2DXLA 1JK7A 1OIDA 2Z72A 3PSNA 4H2IA 2QJCA 4O43A 3IB8A 3JYFA 4JA7A 3E0JA 3LL8A 1II7A 2BDXA 2QFPA 2IE4C 4ORCA 3QFKA 4H2BA 1XM7A 4J6OA 4ZX2A 4UWQA 3H64A 4TUIA 3ZU0A 1OI8A 3EGHA 2HYPA 4O24A 4H1SA 2Z06A 1NNWA 3H61A 4I5LC 2USHA 2WDCA 4O4KA 5GTUA 3H66A 2P6BA 1S3LA 1QHWA 1QFCA 1WARA 4IL1A 1S3MA 3IVEA 1UTEA 3HVQA 4I5NC 2A22A 2KKNA 1HPUA 1USHA 3K7WC 4F0ZA 1Z2XA 4LACC 2NYMC 2BCDA 4Q7FA 1V73A 3DSDA 2NYLC 3CK2A 1S95A 4H2FA 4UT2A 4TUGA 1W24A 1SU1A 1U32A 1XZWA 2NXFA 3C5WC 5INBA 3DW8C 4FBWA 3E7AA 3PSOA 3K7VC 1MF8A 5B8IA 2GJUA 4LTYA 4H2GA 4LU9A 1M63A 2O8AA 3H62B 5J28A 2YEQA 4KKZA 2R17A 4G9JA 3H67A 1KBPA 2Q8UA 5C1VA 1OIEA 3H60A 2AHDA 1FJMA 3FGAC 3RL5A 3QG5C 1S8EA 4ORBA 5HPEA 2WDFA 3THNA 2CV9A 4V0VA 4UT3B 3AUZA 5JPEA 4MOVA 3KBPA 4YKEA 1WAO1 4JA9A 4DT2A 5JPFA 3RQZA 3DSCA 2BQ8X 2Z1AA 3H69A 3ZTVA 3D03A 3RL3A 4MP0A 3QFNA 3QFOA 3N5UA 3RL4A 3T1IA 2IE3C 2HYOA 3AV0A 4ZVZA 4FCXA 2O8GA 1AUIA 2ZOAA 4V0WA 1HP1A 4FBQA 4NZVA 3C9FA 2HY1A 4HD0A 2IAEC 1HO5A 3QFMA
chains in the Genus database with same CATH topology
4IYPC 3IVDA 2ZO9B 5F3WA 1IT6A 4FBKA 4B2OA 3IB7A 3GVEA 3EGGA 3V4YA 1Z2WA 2XMOA 4XPNA 1UF3A 5IOHA 4WWLA 2YVTA 2DXNA 2JOGA 2WDDA 4OR9A 1S3NA 1T71A 2ZBMA 4DHLA 4V0XA 2QFRA 3H68A 4ORAA 2DFJA 1T70A 5DNYA 2NPPC 3THOB 3E7BA 1TCOA 4KBPA 4DSYA 1G5BA 1S70A 4H1YP 3H63A 3FLOA 4MOYA 4UT3A 4M0VA 5EQVA 2WDEA 3ICFA 3P71C 5JJTA 4O5GA 3TGHA 2DXLA 1JK7A 1OIDA 2Z72A 3PSNA 4H2IA 2QJCA 4O43A 3IB8A 3JYFA 4JA7A 3E0JA 3LL8A 1II7A 2BDXA 2QFPA 2IE4C 4ORCA 3QFKA 4H2BA 1XM7A 4J6OA 4ZX2A 4UWQA 3H64A 4TUIA 3ZU0A 1OI8A 3EGHA 2HYPA 4O24A 4H1SA 2Z06A 1NNWA 3H61A 4I5LC 2USHA 2WDCA 4O4KA 5GTUA 3H66A 2P6BA 1S3LA 1QHWA 1QFCA 1WARA 4IL1A 1S3MA 3IVEA 1UTEA 3HVQA 4I5NC 2A22A 2KKNA 1HPUA 1USHA 3K7WC 4F0ZA 1Z2XA 4LACC 2NYMC 2BCDA 4Q7FA 1V73A 3DSDA 2NYLC 3CK2A 1S95A 4H2FA 4UT2A 4TUGA 1W24A 1SU1A 1U32A 1XZWA 2NXFA 3C5WC 5INBA 3DW8C 4FBWA 3E7AA 3PSOA 3K7VC 1MF8A 5B8IA 2GJUA 4LTYA 4H2GA 4LU9A 1M63A 2O8AA 3H62B 5J28A 2YEQA 4KKZA 2R17A 4G9JA 3H67A 1KBPA 2Q8UA 5C1VA 1OIEA 3H60A 2AHDA 1FJMA 3FGAC 3RL5A 3QG5C 1S8EA 4ORBA 5HPEA 2WDFA 3THNA 2CV9A 4V0VA 4UT3B 3AUZA 5JPEA 4MOVA 3KBPA 4YKEA 1WAO1 4JA9A 4DT2A 5JPFA 3RQZA 3DSCA 2BQ8X 2Z1AA 3H69A 3ZTVA 3D03A 3RL3A 4MP0A 3QFNA 3QFOA 3N5UA 3RL4A 3T1IA 2IE3C 2HYOA 3AV0A 4ZVZA 4FCXA 2O8GA 1AUIA 2ZOAA 4V0WA 1HP1A 4FBQA 4NZVA 3C9FA 2HY1A 4HD0A 2IAEC 1HO5A 3QFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYP C;  3IVD A;  5F3W A;  1IT6 A;  4FBK A;  4B2O A;  3IB7 A;  3GVE A;  3EGG A;  3V4Y A;  1Z2W A;  2XMO A;  4XPN A;  1UF3 A;  5IOH A;  4WWL A;  2YVT A;  2JOG A;  2WDD A;  4OR9 A;  1S3N A;  1T71 A;  2ZBM A;  4DHL A;  4V0X A;  2QFR A;  3H68 A;  4ORA A;  2DFJ A;  1T70 A;  5DNY A;  2NPP C;  3THO B;  3E7B A;  1TCO A;  4KBP A;  4DSY A;  1G5B A;  1S70 A;  4H1Y P;  3H63 A;  4MOY A;  4UT3 A;  4M0V A;  5EQV A;  2WDE A;  3ICF A;  3P71 C;  5JJT A;  4O5G A;  3TGH A;  2Z72 A;  1JK7 A;  1OID A;  3PSN A;  4H2I A;  2QJC A;  4O43 A;  3IB8 A;  3JYF A;  4JA7 A;  3LL8 A;  1II7 A;  2BDX A;  2QFP A;  2IE4 C;  4ORC A;  3QFK A;  4H2B A;  1XM7 A;  4J6O A;  4ZX2 A;  4UWQ A;  3H64 A;  4TUI A;  3ZU0 A;  1OI8 A;  3EGH A;  2HYP A;  4O24 A;  4H1S A;  2Z06 A;  1NNW A;  3H61 A;  4I5L C;  2USH A;  2WDC A;  4O4K A;  5GTU A;  3H66 A;  2P6B A;  1S3L A;  1QHW A;  1QFC A;  1WAR A;  4IL1 A;  1S3M A;  3IVE A;  1UTE A;  3HVQ A;  4I5N C;  2A22 A;  2KKN A;  1HPU A;  1USH A;  3K7W C;  4F0Z A;  1Z2X A;  4LAC C;  2NYM C;  2BCD A;  4Q7F A;  1V73 A;  3DSD A;  2NYL C;  3CK2 A;  1S95 A;  4H2F A;  4UT2 A;  4TUG A;  1W24 A;  1SU1 A;  1U32 A;  1XZW A;  2NXF A;  3C5W C;  5INB A;  3DW8 C;  4FBW A;  3E7A A;  3PSO A;  3K7V C;  1MF8 A;  5B8I A;  2GJU A;  4LTY A;  4H2G A;  4LU9 A;  1M63 A;  2O8A A;  3H62 B;  5J28 A;  4KKZ A;  2R17 A;  4G9J A;  3H67 A;  1KBP A;  2Q8U A;  5C1V A;  1OIE A;  3H60 A;  2AHD A;  1FJM A;  3FGA C;  3RL5 A;  3QG5 C;  1S8E A;  4ORB A;  5HPE A;  2WDF A;  3THN A;  2CV9 A;  4V0V A;  4UT3 B;  3AUZ A;  5JPE A;  4MOV A;  3KBP A;  4YKE A;  1WAO 1;  4JA9 A;  4DT2 A;  5JPF A;  3RQZ A;  3DSC A;  2BQ8 X;  2Z1A A;  3H69 A;  3ZTV A;  3RL3 A;  4MP0 A;  3QFN A;  3QFO A;  3N5U A;  3RL4 A;  3T1I A;  2IE3 C;  2HYO A;  3AV0 A;  4ZVZ A;  4FCX A;  2O8G A;  1AUI A;  4V0W A;  1HP1 A;  4FBQ A;  4NZV A;  3C9F A;  2HY1 A;  4HD0 A;  2IAE C;  1HO5 A;  3QFM A; 
#chains in the Genus database with same CATH topology
 4IYP C;  3IVD A;  2ZO9 B;  5F3W A;  1IT6 A;  4FBK A;  4B2O A;  3IB7 A;  3GVE A;  3EGG A;  3V4Y A;  1Z2W A;  2XMO A;  4XPN A;  1UF3 A;  5IOH A;  4WWL A;  2YVT A;  2DXN A;  2JOG A;  2WDD A;  4OR9 A;  1S3N A;  1T71 A;  2ZBM A;  4DHL A;  4V0X A;  2QFR A;  3H68 A;  4ORA A;  2DFJ A;  1T70 A;  5DNY A;  2NPP C;  3THO B;  3E7B A;  1TCO A;  4KBP A;  4DSY A;  1G5B A;  1S70 A;  4H1Y P;  3H63 A;  3FLO A;  4MOY A;  4UT3 A;  4M0V A;  5EQV A;  2WDE A;  3ICF A;  3P71 C;  5JJT A;  4O5G A;  3TGH A;  2DXL A;  1JK7 A;  1OID A;  2Z72 A;  3PSN A;  4H2I A;  2QJC A;  4O43 A;  3IB8 A;  3JYF A;  4JA7 A;  3E0J A;  3LL8 A;  1II7 A;  2BDX A;  2QFP A;  2IE4 C;  4ORC A;  3QFK A;  4H2B A;  1XM7 A;  4J6O A;  4ZX2 A;  4UWQ A;  3H64 A;  4TUI A;  3ZU0 A;  1OI8 A;  3EGH A;  2HYP A;  4O24 A;  4H1S A;  2Z06 A;  1NNW A;  3H61 A;  4I5L C;  2USH A;  2WDC A;  4O4K A;  5GTU A;  3H66 A;  2P6B A;  1S3L A;  1QHW A;  1QFC A;  1WAR A;  4IL1 A;  1S3M A;  3IVE A;  1UTE A;  3HVQ A;  4I5N C;  2A22 A;  2KKN A;  1HPU A;  1USH A;  3K7W C;  4F0Z A;  1Z2X A;  4LAC C;  2NYM C;  2BCD A;  4Q7F A;  1V73 A;  3DSD A;  2NYL C;  3CK2 A;  1S95 A;  4H2F A;  4UT2 A;  4TUG A;  1W24 A;  1SU1 A;  1U32 A;  1XZW A;  2NXF A;  3C5W C;  5INB A;  3DW8 C;  4FBW A;  3E7A A;  3PSO A;  3K7V C;  1MF8 A;  5B8I A;  2GJU A;  4LTY A;  4H2G A;  4LU9 A;  1M63 A;  2O8A A;  3H62 B;  5J28 A;  2YEQ A;  4KKZ A;  2R17 A;  4G9J A;  3H67 A;  1KBP A;  2Q8U A;  5C1V A;  1OIE A;  3H60 A;  2AHD A;  1FJM A;  3FGA C;  3RL5 A;  3QG5 C;  1S8E A;  4ORB A;  5HPE A;  2WDF A;  3THN A;  2CV9 A;  4V0V A;  4UT3 B;  3AUZ A;  5JPE A;  4MOV A;  3KBP A;  4YKE A;  1WAO 1;  4JA9 A;  4DT2 A;  5JPF A;  3RQZ A;  3DSC A;  2BQ8 X;  2Z1A A;  3H69 A;  3ZTV A;  3D03 A;  3RL3 A;  4MP0 A;  3QFN A;  3QFO A;  3N5U A;  3RL4 A;  3T1I A;  2IE3 C;  2HYO A;  3AV0 A;  4ZVZ A;  4FCX A;  2O8G A;  1AUI A;  2ZOA A;  4V0W A;  1HP1 A;  4FBQ A;  4NZV A;  3C9F A;  2HY1 A;  4HD0 A;  2IAE C;  1HO5 A;  3QFM A; 
#chains in the Genus database with same CATH homology
 4IYP C;  3IVD A;  2ZO9 B;  5F3W A;  1IT6 A;  4FBK A;  4B2O A;  3IB7 A;  3GVE A;  3EGG A;  3V4Y A;  1Z2W A;  2XMO A;  4XPN A;  1UF3 A;  5IOH A;  4WWL A;  2YVT A;  2DXN A;  2JOG A;  2WDD A;  4OR9 A;  1S3N A;  1T71 A;  2ZBM A;  4DHL A;  4V0X A;  2QFR A;  3H68 A;  4ORA A;  2DFJ A;  1T70 A;  5DNY A;  2NPP C;  3THO B;  3E7B A;  1TCO A;  4KBP A;  4DSY A;  1G5B A;  1S70 A;  4H1Y P;  3H63 A;  3FLO A;  4MOY A;  4UT3 A;  4M0V A;  5EQV A;  2WDE A;  3ICF A;  3P71 C;  5JJT A;  4O5G A;  3TGH A;  2DXL A;  1JK7 A;  1OID A;  2Z72 A;  3PSN A;  4H2I A;  2QJC A;  4O43 A;  3IB8 A;  3JYF A;  4JA7 A;  3E0J A;  3LL8 A;  1II7 A;  2BDX A;  2QFP A;  2IE4 C;  4ORC A;  3QFK A;  4H2B A;  1XM7 A;  4J6O A;  4ZX2 A;  4UWQ A;  3H64 A;  4TUI A;  3ZU0 A;  1OI8 A;  3EGH A;  2HYP A;  4O24 A;  4H1S A;  2Z06 A;  1NNW A;  3H61 A;  4I5L C;  2USH A;  2WDC A;  4O4K A;  5GTU A;  3H66 A;  2P6B A;  1S3L A;  1QHW A;  1QFC A;  1WAR A;  4IL1 A;  1S3M A;  3IVE A;  1UTE A;  3HVQ A;  4I5N C;  2A22 A;  2KKN A;  1HPU A;  1USH A;  3K7W C;  4F0Z A;  1Z2X A;  4LAC C;  2NYM C;  2BCD A;  4Q7F A;  1V73 A;  3DSD A;  2NYL C;  3CK2 A;  1S95 A;  4H2F A;  4UT2 A;  4TUG A;  1W24 A;  1SU1 A;  1U32 A;  1XZW A;  2NXF A;  3C5W C;  5INB A;  3DW8 C;  4FBW A;  3E7A A;  3PSO A;  3K7V C;  1MF8 A;  5B8I A;  2GJU A;  4LTY A;  4H2G A;  4LU9 A;  1M63 A;  2O8A A;  3H62 B;  5J28 A;  2YEQ A;  4KKZ A;  2R17 A;  4G9J A;  3H67 A;  1KBP A;  2Q8U A;  5C1V A;  1OIE A;  3H60 A;  2AHD A;  1FJM A;  3FGA C;  3RL5 A;  3QG5 C;  1S8E A;  4ORB A;  5HPE A;  2WDF A;  3THN A;  2CV9 A;  4V0V A;  4UT3 B;  3AUZ A;  5JPE A;  4MOV A;  3KBP A;  4YKE A;  1WAO 1;  4JA9 A;  4DT2 A;  5JPF A;  3RQZ A;  3DSC A;  2BQ8 X;  2Z1A A;  3H69 A;  3ZTV A;  3D03 A;  3RL3 A;  4MP0 A;  3QFN A;  3QFO A;  3N5U A;  3RL4 A;  3T1I A;  2IE3 C;  2HYO A;  3AV0 A;  4ZVZ A;  4FCX A;  2O8G A;  1AUI A;  2ZOA A;  4V0W A;  1HP1 A;  4FBQ A;  4NZV A;  3C9F A;  2HY1 A;  4HD0 A;  2IAE C;  1HO5 A;  3QFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...