2O8GA

Rat pp1c gamma complexed with mouse inhibitor-2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of protein phosphatase 1 by inhibitor-2.
pubmed doi rcsb
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
total genus 111
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2o8gA00
4FBWA 4O43A 4OR9A 5IOHA 1S3MA 4H1SA 1QFCA 1MF8A 1U32A 3DW8C 1T71A 2NYLC 2QJCA 4MP0A 4M0VA 3CK2A 2Z06A 4H2IA 4DHLA 2IE4C 3H68A 2AHDA 2KKNA 2IE3C 4V0XA 1W24A 2QFRA 1OIEA 2ZBMA 3QFMA 4UWQA 2QFPA 2YVTA 1NNWA 3P71C 1JK7A 1HP1A 3HVQA 5JPFA 5DNYA 4UT3A 2BQ8X 4B2OA 4H2BA 4O24A 4IYPC 3H69A 4NZVA 2USHA 1OIDA 1IT6A 3PSNA 4ZX2A 3DSCA 4G9JA 4FBKA 5JJTA 3K7WC 1M63A 3QG5C 4UT3B 4V0VA 4J6OA 3QFOA 4JA7A 3C9FA 1AUIA 3RL4A 4DT2A 3AUZA 3E7AA 1S3LA 4TUIA 1S95A 5C1VA 3THOB 3H61A 3ZTVA 1Z2XA 3H64A 4ORCA 2BDXA 2HYPA 3EGGA 3RQZA 1Z2WA 2HY1A 5F3WA 3KBPA 3JYFA 4HD0A 2P6BA 4I5NC 4O4KA 1V73A 1T70A 1FJMA 4LU9A 1WAO1 4UT2A 1TCOA 1S8EA 4H1YP 5EQVA 1USHA 5B8IA 3V4YA 2NPPC 5INBA 2WDFA 3FGAC 4DSYA 4F0ZA 4XPNA 1UF3A 2CV9A 3T1IA 3TGHA 1S70A 4KKZA 5JPEA 2JOGA 2GJUA 3RL5A 2Q8UA 3H66A 1OI8A 3ZU0A 3GVEA 4KBPA 2DFJA 5J28A 3DSDA 4FBQA 3AV0A 3IVDA 2NXFA 4H2GA 2WDDA 4H2FA 4TUGA 3THNA 4Q7FA 2A22A 3H67A 2WDEA 2BCDA 3ICFA 4V0WA 4ZVZA 3RL3A 2NYMC 2HYOA 1HO5A 4IL1A 1XZWA 2XMOA 2O8AA 4ORAA 3E7BA 4WWLA 1QHWA 1G5BA 1UTEA 2Z1AA 4LACC 2R17A 4JA9A 2IAEC 2WDCA 3H62B 3H60A 1SU1A 1WARA 3IB8A 3N5UA 4MOYA 4ORBA 4MOVA 3QFNA 5HPEA 5GTUA 1KBPA 4I5LC 2Z72A 3LL8A 3EGHA 3QFKA 1S3NA 4FCXA 3PSOA 4LTYA 4YKEA 3C5WC 1II7A 1XM7A 3IB7A 1HPUA 3H63A 3K7VC 2O8GA 4O5GA 3IVEA
chains in the Genus database with same CATH superfamily
4FBWA 4O43A 4OR9A 5IOHA 1S3MA 4H1SA 1QFCA 1MF8A 1U32A 3DW8C 1T71A 2NYLC 2QJCA 4MP0A 4M0VA 3CK2A 2Z06A 4H2IA 4DHLA 2IE4C 3H68A 2AHDA 2KKNA 2IE3C 4V0XA 1W24A 2QFRA 1OIEA 2ZBMA 3QFMA 4UWQA 2QFPA 2YVTA 1NNWA 3P71C 1JK7A 1HP1A 3HVQA 5JPFA 5DNYA 4UT3A 2BQ8X 4B2OA 4H2BA 4O24A 4IYPC 3H69A 4NZVA 2USHA 1OIDA 1IT6A 3PSNA 4ZX2A 3DSCA 4G9JA 4FBKA 5JJTA 3K7WC 1M63A 3QG5C 4UT3B 4V0VA 4J6OA 3QFOA 4JA7A 3C9FA 1AUIA 3RL4A 4DT2A 3AUZA 3E7AA 1S3LA 4TUIA 1S95A 5C1VA 3THOB 3H61A 3ZTVA 1Z2XA 3H64A 4ORCA 2BDXA 2HYPA 3EGGA 3RQZA 1Z2WA 2HY1A 5F3WA 2ZOAA 3KBPA 3JYFA 4HD0A 2P6BA 4I5NC 4O4KA 1V73A 1T70A 1FJMA 4LU9A 1WAO1 4UT2A 1TCOA 2DXLA 1S8EA 4H1YP 2YEQA 5EQVA 1USHA 5B8IA 3V4YA 2NPPC 5INBA 2WDFA 3FGAC 4DSYA 4F0ZA 3FLOA 4XPNA 1UF3A 2CV9A 3T1IA 3TGHA 1S70A 4KKZA 5JPEA 2JOGA 2GJUA 3RL5A 3E0JA 2Q8UA 3H66A 1OI8A 3ZU0A 3GVEA 2DXNA 4KBPA 2DFJA 5J28A 3DSDA 4FBQA 3AV0A 3IVDA 2NXFA 4H2GA 2WDDA 4H2FA 3D03A 4TUGA 3THNA 4Q7FA 2A22A 3H67A 2WDEA 2BCDA 3ICFA 4V0WA 4ZVZA 3RL3A 2NYMC 2HYOA 1HO5A 4IL1A 1XZWA 2XMOA 2O8AA 4ORAA 3E7BA 4WWLA 1QHWA 1G5BA 1UTEA 2Z1AA 4LACC 2R17A 4JA9A 2IAEC 2WDCA 3H62B 3H60A 1SU1A 1WARA 3IB8A 3N5UA 4MOYA 4ORBA 4MOVA 3QFNA 5HPEA 5GTUA 1KBPA 4I5LC 2Z72A 3LL8A 3EGHA 3QFKA 1S3NA 4FCXA 3PSOA 4LTYA 4YKEA 3C5WC 1II7A 1XM7A 3IB7A 1HPUA 2ZO9B 3H63A 3K7VC 2O8GA 4O5GA 3IVEA
chains in the Genus database with same CATH topology
4FBWA 4O43A 4OR9A 5IOHA 1S3MA 4H1SA 1QFCA 1MF8A 1U32A 3DW8C 1T71A 2NYLC 2QJCA 4MP0A 4M0VA 3CK2A 2Z06A 4H2IA 4DHLA 2IE4C 3H68A 2AHDA 2KKNA 2IE3C 4V0XA 1W24A 2QFRA 1OIEA 2ZBMA 3QFMA 4UWQA 2QFPA 2YVTA 1NNWA 3P71C 1JK7A 1HP1A 3HVQA 5JPFA 5DNYA 4UT3A 2BQ8X 4B2OA 4H2BA 4O24A 4IYPC 3H69A 4NZVA 2USHA 1OIDA 1IT6A 3PSNA 4ZX2A 3DSCA 4G9JA 4FBKA 5JJTA 3K7WC 1M63A 3QG5C 4UT3B 4V0VA 4J6OA 3QFOA 4JA7A 3C9FA 1AUIA 3RL4A 4DT2A 3AUZA 3E7AA 1S3LA 4TUIA 1S95A 5C1VA 3THOB 3H61A 3ZTVA 1Z2XA 3H64A 4ORCA 2BDXA 2HYPA 3EGGA 3RQZA 1Z2WA 2HY1A 5F3WA 2ZOAA 3KBPA 3JYFA 4HD0A 2P6BA 4I5NC 4O4KA 1V73A 1T70A 1FJMA 4LU9A 1WAO1 4UT2A 1TCOA 2DXLA 1S8EA 4H1YP 2YEQA 5EQVA 1USHA 5B8IA 3V4YA 2NPPC 5INBA 2WDFA 3FGAC 4DSYA 4F0ZA 3FLOA 4XPNA 1UF3A 2CV9A 3T1IA 3TGHA 1S70A 4KKZA 5JPEA 2JOGA 2GJUA 3RL5A 3E0JA 2Q8UA 3H66A 1OI8A 3ZU0A 3GVEA 2DXNA 4KBPA 2DFJA 5J28A 3DSDA 4FBQA 3AV0A 3IVDA 2NXFA 4H2GA 2WDDA 4H2FA 3D03A 4TUGA 3THNA 4Q7FA 2A22A 3H67A 2WDEA 2BCDA 3ICFA 4V0WA 4ZVZA 3RL3A 2NYMC 2HYOA 1HO5A 4IL1A 1XZWA 2XMOA 2O8AA 4ORAA 3E7BA 4WWLA 1QHWA 1G5BA 1UTEA 2Z1AA 4LACC 2R17A 4JA9A 2IAEC 2WDCA 3H62B 3H60A 1SU1A 1WARA 3IB8A 3N5UA 4MOYA 4ORBA 4MOVA 3QFNA 5HPEA 5GTUA 1KBPA 4I5LC 2Z72A 3LL8A 3EGHA 3QFKA 1S3NA 4FCXA 3PSOA 4LTYA 4YKEA 3C5WC 1II7A 1XM7A 3IB7A 1HPUA 2ZO9B 3H63A 3K7VC 2O8GA 4O5GA 3IVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBW A;  4O43 A;  4OR9 A;  5IOH A;  1S3M A;  4H1S A;  1QFC A;  1MF8 A;  1U32 A;  3DW8 C;  1T71 A;  2NYL C;  2QJC A;  4MP0 A;  4M0V A;  3CK2 A;  2Z06 A;  4H2I A;  4DHL A;  2IE4 C;  3H68 A;  2AHD A;  2KKN A;  2IE3 C;  4V0X A;  1W24 A;  2QFR A;  1OIE A;  2ZBM A;  3QFM A;  4UWQ A;  2QFP A;  2YVT A;  1NNW A;  3P71 C;  1JK7 A;  1HP1 A;  3HVQ A;  5JPF A;  5DNY A;  4UT3 A;  2BQ8 X;  4B2O A;  4H2B A;  4O24 A;  4IYP C;  3H69 A;  4NZV A;  2USH A;  1OID A;  1IT6 A;  3PSN A;  4ZX2 A;  3DSC A;  4G9J A;  4FBK A;  5JJT A;  3K7W C;  1M63 A;  3QG5 C;  4UT3 B;  4V0V A;  4J6O A;  3QFO A;  4JA7 A;  3C9F A;  1AUI A;  3RL4 A;  4DT2 A;  3AUZ A;  3E7A A;  1S3L A;  4TUI A;  1S95 A;  5C1V A;  3THO B;  3H61 A;  3ZTV A;  1Z2X A;  3H64 A;  4ORC A;  2BDX A;  2HYP A;  3EGG A;  3RQZ A;  1Z2W A;  2HY1 A;  5F3W A;  3KBP A;  3JYF A;  4HD0 A;  2P6B A;  4I5N C;  4O4K A;  1V73 A;  1T70 A;  1FJM A;  4LU9 A;  1WAO 1;  4UT2 A;  1TCO A;  1S8E A;  4H1Y P;  5EQV A;  1USH A;  5B8I A;  3V4Y A;  2NPP C;  5INB A;  2WDF A;  3FGA C;  4DSY A;  4F0Z A;  4XPN A;  1UF3 A;  2CV9 A;  3T1I A;  3TGH A;  1S70 A;  4KKZ A;  5JPE A;  2JOG A;  2GJU A;  3RL5 A;  2Q8U A;  3H66 A;  1OI8 A;  3ZU0 A;  3GVE A;  4KBP A;  2DFJ A;  5J28 A;  3DSD A;  4FBQ A;  3AV0 A;  3IVD A;  2NXF A;  4H2G A;  2WDD A;  4H2F A;  4TUG A;  3THN A;  4Q7F A;  2A22 A;  3H67 A;  2WDE A;  2BCD A;  3ICF A;  4V0W A;  4ZVZ A;  3RL3 A;  2NYM C;  2HYO A;  1HO5 A;  4IL1 A;  1XZW A;  2XMO A;  2O8A A;  4ORA A;  3E7B A;  4WWL A;  1QHW A;  1G5B A;  1UTE A;  2Z1A A;  4LAC C;  2R17 A;  4JA9 A;  2IAE C;  2WDC A;  3H62 B;  3H60 A;  1SU1 A;  1WAR A;  3IB8 A;  3N5U A;  4MOY A;  4ORB A;  4MOV A;  3QFN A;  5HPE A;  5GTU A;  1KBP A;  4I5L C;  2Z72 A;  3LL8 A;  3EGH A;  3QFK A;  1S3N A;  4FCX A;  3PSO A;  4LTY A;  4YKE A;  3C5W C;  1II7 A;  1XM7 A;  3IB7 A;  1HPU A;  3H63 A;  3K7V C;  2O8G A;  4O5G A;  3IVE A; 
#chains in the Genus database with same CATH topology
 4FBW A;  4O43 A;  4OR9 A;  5IOH A;  1S3M A;  4H1S A;  1QFC A;  1MF8 A;  1U32 A;  3DW8 C;  1T71 A;  2NYL C;  2QJC A;  4MP0 A;  4M0V A;  3CK2 A;  2Z06 A;  4H2I A;  4DHL A;  2IE4 C;  3H68 A;  2AHD A;  2KKN A;  2IE3 C;  4V0X A;  1W24 A;  2QFR A;  1OIE A;  2ZBM A;  3QFM A;  4UWQ A;  2QFP A;  2YVT A;  1NNW A;  3P71 C;  1JK7 A;  1HP1 A;  3HVQ A;  5JPF A;  5DNY A;  4UT3 A;  2BQ8 X;  4B2O A;  4H2B A;  4O24 A;  4IYP C;  3H69 A;  4NZV A;  2USH A;  1OID A;  1IT6 A;  3PSN A;  4ZX2 A;  3DSC A;  4G9J A;  4FBK A;  5JJT A;  3K7W C;  1M63 A;  3QG5 C;  4UT3 B;  4V0V A;  4J6O A;  3QFO A;  4JA7 A;  3C9F A;  1AUI A;  3RL4 A;  4DT2 A;  3AUZ A;  3E7A A;  1S3L A;  4TUI A;  1S95 A;  5C1V A;  3THO B;  3H61 A;  3ZTV A;  1Z2X A;  3H64 A;  4ORC A;  2BDX A;  2HYP A;  3EGG A;  3RQZ A;  1Z2W A;  2HY1 A;  5F3W A;  2ZOA A;  3KBP A;  3JYF A;  4HD0 A;  2P6B A;  4I5N C;  4O4K A;  1V73 A;  1T70 A;  1FJM A;  4LU9 A;  1WAO 1;  4UT2 A;  1TCO A;  2DXL A;  1S8E A;  4H1Y P;  2YEQ A;  5EQV A;  1USH A;  5B8I A;  3V4Y A;  2NPP C;  5INB A;  2WDF A;  3FGA C;  4DSY A;  4F0Z A;  3FLO A;  4XPN A;  1UF3 A;  2CV9 A;  3T1I A;  3TGH A;  1S70 A;  4KKZ A;  5JPE A;  2JOG A;  2GJU A;  3RL5 A;  3E0J A;  2Q8U A;  3H66 A;  1OI8 A;  3ZU0 A;  3GVE A;  2DXN A;  4KBP A;  2DFJ A;  5J28 A;  3DSD A;  4FBQ A;  3AV0 A;  3IVD A;  2NXF A;  4H2G A;  2WDD A;  4H2F A;  3D03 A;  4TUG A;  3THN A;  4Q7F A;  2A22 A;  3H67 A;  2WDE A;  2BCD A;  3ICF A;  4V0W A;  4ZVZ A;  3RL3 A;  2NYM C;  2HYO A;  1HO5 A;  4IL1 A;  1XZW A;  2XMO A;  2O8A A;  4ORA A;  3E7B A;  4WWL A;  1QHW A;  1G5B A;  1UTE A;  2Z1A A;  4LAC C;  2R17 A;  4JA9 A;  2IAE C;  2WDC A;  3H62 B;  3H60 A;  1SU1 A;  1WAR A;  3IB8 A;  3N5U A;  4MOY A;  4ORB A;  4MOV A;  3QFN A;  5HPE A;  5GTU A;  1KBP A;  4I5L C;  2Z72 A;  3LL8 A;  3EGH A;  3QFK A;  1S3N A;  4FCX A;  3PSO A;  4LTY A;  4YKE A;  3C5W C;  1II7 A;  1XM7 A;  3IB7 A;  1HPU A;  2ZO9 B;  3H63 A;  3K7V C;  2O8G A;  4O5G A;  3IVE A; 
#chains in the Genus database with same CATH homology
 4FBW A;  4O43 A;  4OR9 A;  5IOH A;  1S3M A;  4H1S A;  1QFC A;  1MF8 A;  1U32 A;  3DW8 C;  1T71 A;  2NYL C;  2QJC A;  4MP0 A;  4M0V A;  3CK2 A;  2Z06 A;  4H2I A;  4DHL A;  2IE4 C;  3H68 A;  2AHD A;  2KKN A;  2IE3 C;  4V0X A;  1W24 A;  2QFR A;  1OIE A;  2ZBM A;  3QFM A;  4UWQ A;  2QFP A;  2YVT A;  1NNW A;  3P71 C;  1JK7 A;  1HP1 A;  3HVQ A;  5JPF A;  5DNY A;  4UT3 A;  2BQ8 X;  4B2O A;  4H2B A;  4O24 A;  4IYP C;  3H69 A;  4NZV A;  2USH A;  1OID A;  1IT6 A;  3PSN A;  4ZX2 A;  3DSC A;  4G9J A;  4FBK A;  5JJT A;  3K7W C;  1M63 A;  3QG5 C;  4UT3 B;  4V0V A;  4J6O A;  3QFO A;  4JA7 A;  3C9F A;  1AUI A;  3RL4 A;  4DT2 A;  3AUZ A;  3E7A A;  1S3L A;  4TUI A;  1S95 A;  5C1V A;  3THO B;  3H61 A;  3ZTV A;  1Z2X A;  3H64 A;  4ORC A;  2BDX A;  2HYP A;  3EGG A;  3RQZ A;  1Z2W A;  2HY1 A;  5F3W A;  2ZOA A;  3KBP A;  3JYF A;  4HD0 A;  2P6B A;  4I5N C;  4O4K A;  1V73 A;  1T70 A;  1FJM A;  4LU9 A;  1WAO 1;  4UT2 A;  1TCO A;  2DXL A;  1S8E A;  4H1Y P;  2YEQ A;  5EQV A;  1USH A;  5B8I A;  3V4Y A;  2NPP C;  5INB A;  2WDF A;  3FGA C;  4DSY A;  4F0Z A;  3FLO A;  4XPN A;  1UF3 A;  2CV9 A;  3T1I A;  3TGH A;  1S70 A;  4KKZ A;  5JPE A;  2JOG A;  2GJU A;  3RL5 A;  3E0J A;  2Q8U A;  3H66 A;  1OI8 A;  3ZU0 A;  3GVE A;  2DXN A;  4KBP A;  2DFJ A;  5J28 A;  3DSD A;  4FBQ A;  3AV0 A;  3IVD A;  2NXF A;  4H2G A;  2WDD A;  4H2F A;  3D03 A;  4TUG A;  3THN A;  4Q7F A;  2A22 A;  3H67 A;  2WDE A;  2BCD A;  3ICF A;  4V0W A;  4ZVZ A;  3RL3 A;  2NYM C;  2HYO A;  1HO5 A;  4IL1 A;  1XZW A;  2XMO A;  2O8A A;  4ORA A;  3E7B A;  4WWL A;  1QHW A;  1G5B A;  1UTE A;  2Z1A A;  4LAC C;  2R17 A;  4JA9 A;  2IAE C;  2WDC A;  3H62 B;  3H60 A;  1SU1 A;  1WAR A;  3IB8 A;  3N5U A;  4MOY A;  4ORB A;  4MOV A;  3QFN A;  5HPE A;  5GTU A;  1KBP A;  4I5L C;  2Z72 A;  3LL8 A;  3EGH A;  3QFK A;  1S3N A;  4FCX A;  3PSO A;  4LTY A;  4YKE A;  3C5W C;  1II7 A;  1XM7 A;  3IB7 A;  1HPU A;  2ZO9 B;  3H63 A;  3K7V C;  2O8G A;  4O5G A;  3IVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...