2O8GA

Rat pp1c gamma complexed with mouse inhibitor-2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of protein phosphatase 1 by inhibitor-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 111
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2o8gA00
4O4KA 4H1SA 1NNWA 4UWQA 3ZU0A 4KKZA 4ZX2A 4ORBA 1SU1A 3P71C 4H2IA 4IL1A 4TUGA 2O8AA 3QFNA 4UT2A 3AUZA 3AV0A 4FCXA 5HPEA 4ORCA 4JA9A 3RL5A 1OI8A 2BQ8X 4UT3A 1S70A 4O5GA 3ZTVA 3H68A 3LL8A 4MOVA 1XZWA 3ICFA 4FBWA 5C1VA 3QG5C 1U32A 3C9FA 3EGGA 5GTUA 3H64A 4H2FA 2IE3C 3QFOA 3IB8A 1OIDA 1XM7A 4DHLA 5IOHA 2Z1AA 4B2OA 3H63A 2JOGA 3DW8C 2NXFA 3RL4A 3RQZA 4MP0A 4KBPA 4NZVA 2BCDA 5EQVA 1FJMA 1USHA 1T71A 4V0VA 3C5WC 3TGHA 2DFJA 1OIEA 2NYLC 3T1IA 5JPEA 2GJUA 2BDXA 1Z2XA 2HYOA 2NPPC 5F3WA 4J6OA 3JYFA 5B8IA 3RL3A 2WDEA 5JPFA 1WAO1 2Z72A 2YVTA 3HVQA 3N5UA 2WDCA 4ZVZA 3PSNA 4LTYA 2P6BA 1Z2WA 2WDDA 4Q7FA 4HD0A 3THNA 4LU9A 4H2GA 3THOB 1UF3A 3EGHA 1KBPA 1TCOA 4G9JA 1T70A 2A22A 1S95A 3PSOA 3QFKA 1UTEA 3IVDA 1MF8A 2QFRA 2HYPA 3H69A 5JJTA 1S3NA 3DSCA 4H2BA 3E7BA 4I5NC 3V4YA 2O8GA 4FBQA 2USHA 1WARA 2Z06A 4M0VA 4IYPC 5J28A 4I5LC 1II7A 4LACC 2QJCA 3H62B 1HPUA 2AHDA 4O43A 1IT6A 5DNYA 4FBKA 4YKEA 3K7WC 1JK7A 2HY1A 4ORAA 1AUIA 1M63A 2WDFA 4XPNA 1S8EA 1W24A 3FGAC 3IB7A 5INBA 2KKNA 4V0XA 4H1YP 3GVEA 4F0ZA 3H61A 3H66A 1QFCA 4WWLA 3DSDA 1S3LA 4DT2A 2Q8UA 1S3MA 3E7AA 1HP1A 1HO5A 1V73A 1QHWA 2XMOA 4O24A 2IAEC 2R17A 4V0WA 3H60A 2QFPA 4JA7A 2ZBMA 1G5BA 3H67A 4UT3B 2IE4C 3IVEA 3CK2A 3KBPA 4OR9A 3K7VC 4DSYA 2NYMC 4MOYA 3QFMA 2CV9A 4TUIA
chains in the Genus database with same CATH superfamily
4O4KA 4H1SA 1NNWA 4UWQA 3ZU0A 4KKZA 4ZX2A 4ORBA 1SU1A 3P71C 4H2IA 4IL1A 4TUGA 2O8AA 3QFNA 4UT2A 3AUZA 3AV0A 4FCXA 5HPEA 4ORCA 2ZOAA 4JA9A 1OI8A 3RL5A 2BQ8X 4UT3A 1S70A 4O5GA 3ZTVA 3H68A 3LL8A 4MOVA 1XZWA 3ICFA 4FBWA 5C1VA 3QG5C 1U32A 3C9FA 3EGGA 5GTUA 3H64A 4H2FA 2IE3C 3E0JA 3IB8A 1OIDA 1XM7A 3QFOA 4DHLA 2Z1AA 5IOHA 4B2OA 3H63A 2JOGA 3DW8C 2NXFA 3RL4A 3RQZA 4MP0A 4KBPA 4NZVA 2BCDA 5EQVA 1FJMA 1USHA 1T71A 4V0VA 3C5WC 3TGHA 2DFJA 1OIEA 2NYLC 3T1IA 5JPEA 2GJUA 2BDXA 1Z2XA 2HYOA 2NPPC 5F3WA 4J6OA 3JYFA 5B8IA 3RL3A 2WDEA 5JPFA 1WAO1 2Z72A 2YVTA 3HVQA 3N5UA 3D03A 2WDCA 4ZVZA 3PSNA 4LTYA 2P6BA 1Z2WA 2WDDA 4Q7FA 4HD0A 3FLOA 3THNA 4LU9A 4H2GA 3THOB 1UF3A 3EGHA 1KBPA 1TCOA 4G9JA 2DXNA 1T70A 2A22A 1S95A 3PSOA 3QFKA 1UTEA 3IVDA 1MF8A 2QFRA 2HYPA 3H69A 5JJTA 1S3NA 3DSCA 4H2BA 3E7BA 4I5NC 3V4YA 2O8GA 4FBQA 2USHA 1WARA 2Z06A 4M0VA 4IYPC 5J28A 4I5LC 1II7A 4LACC 2QJCA 3H62B 1HPUA 2AHDA 4O43A 1IT6A 2ZO9B 5DNYA 4FBKA 4YKEA 3K7WC 1JK7A 2HY1A 4ORAA 1AUIA 1M63A 2WDFA 4XPNA 1S8EA 1W24A 3FGAC 3IB7A 5INBA 2KKNA 4V0XA 4H1YP 3GVEA 4F0ZA 3H61A 3H66A 1QFCA 4WWLA 3DSDA 1S3LA 2DXLA 4DT2A 2Q8UA 1S3MA 3E7AA 1HP1A 1HO5A 1V73A 1QHWA 2XMOA 2YEQA 2IAEC 4O24A 2R17A 4V0WA 3H60A 2QFPA 4JA7A 2ZBMA 1G5BA 3H67A 4UT3B 2IE4C 3IVEA 3CK2A 3KBPA 4OR9A 3K7VC 4DSYA 2NYMC 4MOYA 3QFMA 2CV9A 4TUIA
chains in the Genus database with same CATH topology
4O4KA 4H1SA 1NNWA 4UWQA 3ZU0A 4KKZA 4ZX2A 4ORBA 1SU1A 3P71C 4H2IA 4IL1A 4TUGA 2O8AA 3QFNA 4UT2A 3AUZA 3AV0A 4FCXA 5HPEA 4ORCA 2ZOAA 4JA9A 1OI8A 3RL5A 2BQ8X 4UT3A 1S70A 4O5GA 3ZTVA 3H68A 3LL8A 4MOVA 1XZWA 3ICFA 4FBWA 5C1VA 3QG5C 1U32A 3C9FA 3EGGA 5GTUA 3H64A 4H2FA 2IE3C 3E0JA 3IB8A 1OIDA 1XM7A 3QFOA 4DHLA 2Z1AA 5IOHA 4B2OA 3H63A 2JOGA 3DW8C 2NXFA 3RL4A 3RQZA 4MP0A 4KBPA 4NZVA 2BCDA 5EQVA 1FJMA 1USHA 1T71A 4V0VA 3C5WC 3TGHA 2DFJA 1OIEA 2NYLC 3T1IA 5JPEA 2GJUA 2BDXA 1Z2XA 2HYOA 2NPPC 5F3WA 4J6OA 3JYFA 5B8IA 3RL3A 2WDEA 5JPFA 1WAO1 2Z72A 2YVTA 3HVQA 3N5UA 3D03A 2WDCA 4ZVZA 3PSNA 4LTYA 2P6BA 1Z2WA 2WDDA 4Q7FA 4HD0A 3FLOA 3THNA 4LU9A 4H2GA 3THOB 1UF3A 3EGHA 1KBPA 1TCOA 4G9JA 2DXNA 1T70A 2A22A 1S95A 3PSOA 3QFKA 1UTEA 3IVDA 1MF8A 2QFRA 2HYPA 3H69A 5JJTA 1S3NA 3DSCA 4H2BA 3E7BA 4I5NC 3V4YA 2O8GA 4FBQA 2USHA 1WARA 2Z06A 4M0VA 4IYPC 5J28A 4I5LC 1II7A 4LACC 2QJCA 3H62B 1HPUA 2AHDA 4O43A 1IT6A 2ZO9B 5DNYA 4FBKA 4YKEA 3K7WC 1JK7A 2HY1A 4ORAA 1AUIA 1M63A 2WDFA 4XPNA 1S8EA 1W24A 3FGAC 3IB7A 5INBA 2KKNA 4V0XA 4H1YP 3GVEA 4F0ZA 3H61A 3H66A 1QFCA 4WWLA 3DSDA 1S3LA 2DXLA 4DT2A 2Q8UA 1S3MA 3E7AA 1HP1A 1HO5A 1V73A 1QHWA 2XMOA 2YEQA 2IAEC 4O24A 2R17A 4V0WA 3H60A 2QFPA 4JA7A 2ZBMA 1G5BA 3H67A 4UT3B 2IE4C 3IVEA 3CK2A 3KBPA 4OR9A 3K7VC 4DSYA 2NYMC 4MOYA 3QFMA 2CV9A 4TUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O4K A;  4H1S A;  1NNW A;  4UWQ A;  3ZU0 A;  4KKZ A;  4ZX2 A;  4ORB A;  1SU1 A;  3P71 C;  4H2I A;  4IL1 A;  4TUG A;  2O8A A;  3QFN A;  4UT2 A;  3AUZ A;  3AV0 A;  4FCX A;  5HPE A;  4ORC A;  4JA9 A;  3RL5 A;  1OI8 A;  2BQ8 X;  4UT3 A;  1S70 A;  4O5G A;  3ZTV A;  3H68 A;  3LL8 A;  4MOV A;  1XZW A;  3ICF A;  4FBW A;  5C1V A;  3QG5 C;  1U32 A;  3C9F A;  3EGG A;  5GTU A;  3H64 A;  4H2F A;  2IE3 C;  3QFO A;  3IB8 A;  1OID A;  1XM7 A;  4DHL A;  5IOH A;  2Z1A A;  4B2O A;  3H63 A;  2JOG A;  3DW8 C;  2NXF A;  3RL4 A;  3RQZ A;  4MP0 A;  4KBP A;  4NZV A;  2BCD A;  5EQV A;  1FJM A;  1USH A;  1T71 A;  4V0V A;  3C5W C;  3TGH A;  2DFJ A;  1OIE A;  2NYL C;  3T1I A;  5JPE A;  2GJU A;  2BDX A;  1Z2X A;  2HYO A;  2NPP C;  5F3W A;  4J6O A;  3JYF A;  5B8I A;  3RL3 A;  2WDE A;  5JPF A;  1WAO 1;  2Z72 A;  2YVT A;  3HVQ A;  3N5U A;  2WDC A;  4ZVZ A;  3PSN A;  4LTY A;  2P6B A;  1Z2W A;  2WDD A;  4Q7F A;  4HD0 A;  3THN A;  4LU9 A;  4H2G A;  3THO B;  1UF3 A;  3EGH A;  1KBP A;  1TCO A;  4G9J A;  1T70 A;  2A22 A;  1S95 A;  3PSO A;  3QFK A;  1UTE A;  3IVD A;  1MF8 A;  2QFR A;  2HYP A;  3H69 A;  5JJT A;  1S3N A;  3DSC A;  4H2B A;  3E7B A;  4I5N C;  3V4Y A;  2O8G A;  4FBQ A;  2USH A;  1WAR A;  2Z06 A;  4M0V A;  4IYP C;  5J28 A;  4I5L C;  1II7 A;  4LAC C;  2QJC A;  3H62 B;  1HPU A;  2AHD A;  4O43 A;  1IT6 A;  5DNY A;  4FBK A;  4YKE A;  3K7W C;  1JK7 A;  2HY1 A;  4ORA A;  1AUI A;  1M63 A;  2WDF A;  4XPN A;  1S8E A;  1W24 A;  3FGA C;  3IB7 A;  5INB A;  2KKN A;  4V0X A;  4H1Y P;  3GVE A;  4F0Z A;  3H61 A;  3H66 A;  1QFC A;  4WWL A;  3DSD A;  1S3L A;  4DT2 A;  2Q8U A;  1S3M A;  3E7A A;  1HP1 A;  1HO5 A;  1V73 A;  1QHW A;  2XMO A;  4O24 A;  2IAE C;  2R17 A;  4V0W A;  3H60 A;  2QFP A;  4JA7 A;  2ZBM A;  1G5B A;  3H67 A;  4UT3 B;  2IE4 C;  3IVE A;  3CK2 A;  3KBP A;  4OR9 A;  3K7V C;  4DSY A;  2NYM C;  4MOY A;  3QFM A;  2CV9 A;  4TUI A; 
#chains in the Genus database with same CATH topology
 4O4K A;  4H1S A;  1NNW A;  4UWQ A;  3ZU0 A;  4KKZ A;  4ZX2 A;  4ORB A;  1SU1 A;  3P71 C;  4H2I A;  4IL1 A;  4TUG A;  2O8A A;  3QFN A;  4UT2 A;  3AUZ A;  3AV0 A;  4FCX A;  5HPE A;  4ORC A;  2ZOA A;  4JA9 A;  1OI8 A;  3RL5 A;  2BQ8 X;  4UT3 A;  1S70 A;  4O5G A;  3ZTV A;  3H68 A;  3LL8 A;  4MOV A;  1XZW A;  3ICF A;  4FBW A;  5C1V A;  3QG5 C;  1U32 A;  3C9F A;  3EGG A;  5GTU A;  3H64 A;  4H2F A;  2IE3 C;  3E0J A;  3IB8 A;  1OID A;  1XM7 A;  3QFO A;  4DHL A;  2Z1A A;  5IOH A;  4B2O A;  3H63 A;  2JOG A;  3DW8 C;  2NXF A;  3RL4 A;  3RQZ A;  4MP0 A;  4KBP A;  4NZV A;  2BCD A;  5EQV A;  1FJM A;  1USH A;  1T71 A;  4V0V A;  3C5W C;  3TGH A;  2DFJ A;  1OIE A;  2NYL C;  3T1I A;  5JPE A;  2GJU A;  2BDX A;  1Z2X A;  2HYO A;  2NPP C;  5F3W A;  4J6O A;  3JYF A;  5B8I A;  3RL3 A;  2WDE A;  5JPF A;  1WAO 1;  2Z72 A;  2YVT A;  3HVQ A;  3N5U A;  3D03 A;  2WDC A;  4ZVZ A;  3PSN A;  4LTY A;  2P6B A;  1Z2W A;  2WDD A;  4Q7F A;  4HD0 A;  3FLO A;  3THN A;  4LU9 A;  4H2G A;  3THO B;  1UF3 A;  3EGH A;  1KBP A;  1TCO A;  4G9J A;  2DXN A;  1T70 A;  2A22 A;  1S95 A;  3PSO A;  3QFK A;  1UTE A;  3IVD A;  1MF8 A;  2QFR A;  2HYP A;  3H69 A;  5JJT A;  1S3N A;  3DSC A;  4H2B A;  3E7B A;  4I5N C;  3V4Y A;  2O8G A;  4FBQ A;  2USH A;  1WAR A;  2Z06 A;  4M0V A;  4IYP C;  5J28 A;  4I5L C;  1II7 A;  4LAC C;  2QJC A;  3H62 B;  1HPU A;  2AHD A;  4O43 A;  1IT6 A;  2ZO9 B;  5DNY A;  4FBK A;  4YKE A;  3K7W C;  1JK7 A;  2HY1 A;  4ORA A;  1AUI A;  1M63 A;  2WDF A;  4XPN A;  1S8E A;  1W24 A;  3FGA C;  3IB7 A;  5INB A;  2KKN A;  4V0X A;  4H1Y P;  3GVE A;  4F0Z A;  3H61 A;  3H66 A;  1QFC A;  4WWL A;  3DSD A;  1S3L A;  2DXL A;  4DT2 A;  2Q8U A;  1S3M A;  3E7A A;  1HP1 A;  1HO5 A;  1V73 A;  1QHW A;  2XMO A;  2YEQ A;  2IAE C;  4O24 A;  2R17 A;  4V0W A;  3H60 A;  2QFP A;  4JA7 A;  2ZBM A;  1G5B A;  3H67 A;  4UT3 B;  2IE4 C;  3IVE A;  3CK2 A;  3KBP A;  4OR9 A;  3K7V C;  4DSY A;  2NYM C;  4MOY A;  3QFM A;  2CV9 A;  4TUI A; 
#chains in the Genus database with same CATH homology
 4O4K A;  4H1S A;  1NNW A;  4UWQ A;  3ZU0 A;  4KKZ A;  4ZX2 A;  4ORB A;  1SU1 A;  3P71 C;  4H2I A;  4IL1 A;  4TUG A;  2O8A A;  3QFN A;  4UT2 A;  3AUZ A;  3AV0 A;  4FCX A;  5HPE A;  4ORC A;  2ZOA A;  4JA9 A;  1OI8 A;  3RL5 A;  2BQ8 X;  4UT3 A;  1S70 A;  4O5G A;  3ZTV A;  3H68 A;  3LL8 A;  4MOV A;  1XZW A;  3ICF A;  4FBW A;  5C1V A;  3QG5 C;  1U32 A;  3C9F A;  3EGG A;  5GTU A;  3H64 A;  4H2F A;  2IE3 C;  3E0J A;  3IB8 A;  1OID A;  1XM7 A;  3QFO A;  4DHL A;  2Z1A A;  5IOH A;  4B2O A;  3H63 A;  2JOG A;  3DW8 C;  2NXF A;  3RL4 A;  3RQZ A;  4MP0 A;  4KBP A;  4NZV A;  2BCD A;  5EQV A;  1FJM A;  1USH A;  1T71 A;  4V0V A;  3C5W C;  3TGH A;  2DFJ A;  1OIE A;  2NYL C;  3T1I A;  5JPE A;  2GJU A;  2BDX A;  1Z2X A;  2HYO A;  2NPP C;  5F3W A;  4J6O A;  3JYF A;  5B8I A;  3RL3 A;  2WDE A;  5JPF A;  1WAO 1;  2Z72 A;  2YVT A;  3HVQ A;  3N5U A;  3D03 A;  2WDC A;  4ZVZ A;  3PSN A;  4LTY A;  2P6B A;  1Z2W A;  2WDD A;  4Q7F A;  4HD0 A;  3FLO A;  3THN A;  4LU9 A;  4H2G A;  3THO B;  1UF3 A;  3EGH A;  1KBP A;  1TCO A;  4G9J A;  2DXN A;  1T70 A;  2A22 A;  1S95 A;  3PSO A;  3QFK A;  1UTE A;  3IVD A;  1MF8 A;  2QFR A;  2HYP A;  3H69 A;  5JJT A;  1S3N A;  3DSC A;  4H2B A;  3E7B A;  4I5N C;  3V4Y A;  2O8G A;  4FBQ A;  2USH A;  1WAR A;  2Z06 A;  4M0V A;  4IYP C;  5J28 A;  4I5L C;  1II7 A;  4LAC C;  2QJC A;  3H62 B;  1HPU A;  2AHD A;  4O43 A;  1IT6 A;  2ZO9 B;  5DNY A;  4FBK A;  4YKE A;  3K7W C;  1JK7 A;  2HY1 A;  4ORA A;  1AUI A;  1M63 A;  2WDF A;  4XPN A;  1S8E A;  1W24 A;  3FGA C;  3IB7 A;  5INB A;  2KKN A;  4V0X A;  4H1Y P;  3GVE A;  4F0Z A;  3H61 A;  3H66 A;  1QFC A;  4WWL A;  3DSD A;  1S3L A;  2DXL A;  4DT2 A;  2Q8U A;  1S3M A;  3E7A A;  1HP1 A;  1HO5 A;  1V73 A;  1QHW A;  2XMO A;  2YEQ A;  2IAE C;  4O24 A;  2R17 A;  4V0W A;  3H60 A;  2QFP A;  4JA7 A;  2ZBM A;  1G5B A;  3H67 A;  4UT3 B;  2IE4 C;  3IVE A;  3CK2 A;  3KBP A;  4OR9 A;  3K7V C;  4DSY A;  2NYM C;  4MOY A;  3QFM A;  2CV9 A;  4TUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...