3P71C

Crystal structure of the complex of lcmt-1 and pp2a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
303
structure length
303
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPHVTRRTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Tight Control of PP2A Methylation and Function by LCMT-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/hydrolase
molecule keywords Leucine carboxyl methyltransferase 1
total genus 110
structure length 303
sequence length 303
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3p71C00
1WARA 1HP1A 4WWLA 4ZVZA 5IOHA 2CV9A 2BCDA 5EQVA 1S3MA 3THOB 2WDCA 4IL1A 4TUIA 2NXFA 3JYFA 4H2BA 4DHLA 1QHWA 4LACC 1XM7A 1IT6A 3IVEA 2NYMC 3LL8A 5HPEA 5B8IA 1V73A 5GTUA 3GVEA 2GJUA 5JPFA 4Q7FA 2YVTA 1UF3A 3AUZA 2NYLC 4FCXA 4DSYA 3H63A 1USHA 2A22A 4KKZA 3P71C 3FGAC 3H62B 1KBPA 4O5GA 1U32A 4KBPA 4H2GA 4V0XA 3T1IA 3ZU0A 2BDXA 2Z1AA 1MF8A 4MP0A 3PSNA 1FJMA 2O8GA 3ICFA 3V4YA 2IE4C 4NZVA 3THNA 1TCOA 3IB7A 4ORAA 3IVDA 1T70A 4G9JA 4H1YP 1W24A 2Z72A 4V0WA 2QJCA 3EGHA 1NNWA 2BQ8X 2HYOA 4I5NC 4UT2A 3H67A 4MOVA 5J28A 3QG5C 4FBQA 3ZTVA 5DNYA 3EGGA 5JPEA 4LTYA 1II7A 1SU1A 4H2FA 4H1SA 1S3NA 4FBKA 3TGHA 2WDDA 4O24A 4UWQA 2P6BA 2WDEA 1HPUA 4ORCA 3N5UA 4ORBA 3CK2A 3H69A 4M0VA 4OR9A 1G5BA 2ZBMA 3K7VC 1S95A 4UT3A 1UTEA 2HY1A 4XPNA 1S3LA 4YKEA 2IAEC 3QFMA 4H2IA 5F3WA 1S8EA 1HO5A 3E7BA 3H60A 4O43A 2QFRA 1T71A 1M63A 2QFPA 4ZX2A 5INBA 3QFNA 4I5LC 2Z06A 4DT2A 3DSCA 3C9FA 1AUIA 4TUGA 3RQZA 1QFCA 2NPPC 2IE3C 5C1VA 4O4KA 2R17A 4JA7A 1S70A 3AV0A 4IYPC 3QFOA 3KBPA 3H68A 1OIDA 3IB8A 4JA9A 2WDFA 3K7WC 4UT3B 1Z2WA 4F0ZA 2Q8UA 2HYPA 2XMOA 4HD0A 2O8AA 3H66A 1XZWA 1JK7A 4LU9A 4FBWA 3PSOA 4B2OA 2KKNA 1OIEA 3DSDA 4V0VA 2AHDA 2USHA 3DW8C 3RL5A 5JJTA 2JOGA 3RL3A 1Z2XA 3QFKA 3E7AA 3H61A 4J6OA 2DFJA 3H64A 1WAO1 3C5WC 4MOYA 1OI8A 3RL4A 3HVQA
chains in the Genus database with same CATH superfamily
1WARA 1HP1A 4WWLA 4ZVZA 5IOHA 2CV9A 2BCDA 5EQVA 1S3MA 3THOB 2WDCA 4IL1A 4TUIA 2NXFA 3JYFA 4H2BA 4DHLA 3FLOA 1QHWA 4LACC 1XM7A 1IT6A 3IVEA 2NYMC 3LL8A 5HPEA 3D03A 5B8IA 1V73A 5GTUA 2YEQA 3GVEA 2GJUA 5JPFA 4Q7FA 2YVTA 1UF3A 3AUZA 2NYLC 4FCXA 4DSYA 3E0JA 3H63A 1USHA 2A22A 4KKZA 3P71C 3FGAC 3H62B 1KBPA 4O5GA 1U32A 4KBPA 4H2GA 4V0XA 3T1IA 3ZU0A 2BDXA 2Z1AA 1MF8A 4MP0A 3PSNA 1FJMA 2O8GA 3ICFA 3V4YA 2IE4C 4NZVA 3THNA 1TCOA 3IB7A 4ORAA 3IVDA 1T70A 4G9JA 4H1YP 1W24A 2Z72A 4V0WA 2QJCA 3EGHA 1NNWA 2BQ8X 2HYOA 4I5NC 2DXLA 4UT2A 3H67A 4MOVA 5J28A 3QG5C 4FBQA 3ZTVA 5DNYA 3EGGA 5JPEA 4LTYA 1II7A 1SU1A 4H2FA 4H1SA 1S3NA 4FBKA 3TGHA 2WDDA 4O24A 4UWQA 2P6BA 2WDEA 1HPUA 4ORCA 3N5UA 4ORBA 3CK2A 3H69A 4M0VA 4OR9A 1G5BA 2ZBMA 3K7VC 1S95A 4UT3A 1UTEA 2HY1A 4XPNA 1S3LA 4YKEA 2IAEC 3QFMA 4H2IA 5F3WA 1S8EA 1HO5A 3E7BA 3H60A 4O43A 2QFRA 1T71A 1M63A 2QFPA 4ZX2A 5INBA 3QFNA 4I5LC 2Z06A 4DT2A 3DSCA 3C9FA 1AUIA 4TUGA 3RQZA 1QFCA 2DXNA 2IE3C 2NPPC 5C1VA 4O4KA 2R17A 4JA7A 1S70A 3AV0A 4IYPC 2ZOAA 3QFOA 3KBPA 3H68A 1OIDA 3IB8A 4JA9A 2WDFA 3K7WC 4UT3B 1Z2WA 4F0ZA 2Q8UA 2HYPA 2XMOA 4HD0A 2O8AA 3H66A 2ZO9B 1XZWA 1JK7A 4LU9A 4FBWA 3PSOA 4B2OA 2KKNA 1OIEA 3DSDA 4V0VA 2AHDA 2USHA 3DW8C 3RL5A 5JJTA 2JOGA 3RL3A 1Z2XA 3QFKA 3E7AA 3H61A 4J6OA 2DFJA 3H64A 1WAO1 3C5WC 4MOYA 1OI8A 3RL4A 3HVQA
chains in the Genus database with same CATH topology
1WARA 1HP1A 4WWLA 4ZVZA 5IOHA 2CV9A 2BCDA 5EQVA 1S3MA 3THOB 2WDCA 4IL1A 4TUIA 2NXFA 3JYFA 4H2BA 4DHLA 3FLOA 1QHWA 4LACC 1XM7A 1IT6A 3IVEA 2NYMC 3LL8A 5HPEA 3D03A 5B8IA 1V73A 5GTUA 2YEQA 3GVEA 2GJUA 5JPFA 4Q7FA 2YVTA 1UF3A 3AUZA 2NYLC 4FCXA 4DSYA 3E0JA 3H63A 1USHA 2A22A 4KKZA 3P71C 3FGAC 3H62B 1KBPA 4O5GA 1U32A 4KBPA 4H2GA 4V0XA 3T1IA 3ZU0A 2BDXA 2Z1AA 1MF8A 4MP0A 3PSNA 1FJMA 2O8GA 3ICFA 3V4YA 2IE4C 4NZVA 3THNA 1TCOA 3IB7A 4ORAA 3IVDA 1T70A 4G9JA 4H1YP 1W24A 2Z72A 4V0WA 2QJCA 3EGHA 1NNWA 2BQ8X 2HYOA 4I5NC 2DXLA 4UT2A 3H67A 4MOVA 5J28A 3QG5C 4FBQA 3ZTVA 5DNYA 3EGGA 5JPEA 4LTYA 1II7A 1SU1A 4H2FA 4H1SA 1S3NA 4FBKA 3TGHA 2WDDA 4O24A 4UWQA 2P6BA 2WDEA 1HPUA 4ORCA 3N5UA 4ORBA 3CK2A 3H69A 4M0VA 4OR9A 1G5BA 2ZBMA 3K7VC 1S95A 4UT3A 1UTEA 2HY1A 4XPNA 1S3LA 4YKEA 2IAEC 3QFMA 4H2IA 5F3WA 1S8EA 1HO5A 3E7BA 3H60A 4O43A 2QFRA 1T71A 1M63A 2QFPA 4ZX2A 5INBA 3QFNA 4I5LC 2Z06A 4DT2A 3DSCA 3C9FA 1AUIA 4TUGA 3RQZA 1QFCA 2DXNA 2IE3C 2NPPC 5C1VA 4O4KA 2R17A 4JA7A 1S70A 3AV0A 4IYPC 2ZOAA 3QFOA 3KBPA 3H68A 1OIDA 3IB8A 4JA9A 2WDFA 3K7WC 4UT3B 1Z2WA 4F0ZA 2Q8UA 2HYPA 2XMOA 4HD0A 2O8AA 3H66A 2ZO9B 1XZWA 1JK7A 4LU9A 4FBWA 3PSOA 4B2OA 2KKNA 1OIEA 3DSDA 4V0VA 2AHDA 2USHA 3DW8C 3RL5A 5JJTA 2JOGA 3RL3A 1Z2XA 3QFKA 3E7AA 3H61A 4J6OA 2DFJA 3H64A 1WAO1 3C5WC 4MOYA 1OI8A 3RL4A 3HVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAR A;  1HP1 A;  4WWL A;  4ZVZ A;  5IOH A;  2CV9 A;  2BCD A;  5EQV A;  1S3M A;  3THO B;  2WDC A;  4IL1 A;  4TUI A;  2NXF A;  3JYF A;  4H2B A;  4DHL A;  1QHW A;  4LAC C;  1XM7 A;  1IT6 A;  3IVE A;  2NYM C;  3LL8 A;  5HPE A;  5B8I A;  1V73 A;  5GTU A;  3GVE A;  2GJU A;  5JPF A;  4Q7F A;  2YVT A;  1UF3 A;  3AUZ A;  2NYL C;  4FCX A;  4DSY A;  3H63 A;  1USH A;  2A22 A;  4KKZ A;  3P71 C;  3FGA C;  3H62 B;  1KBP A;  4O5G A;  1U32 A;  4KBP A;  4H2G A;  4V0X A;  3T1I A;  3ZU0 A;  2BDX A;  2Z1A A;  1MF8 A;  4MP0 A;  3PSN A;  1FJM A;  2O8G A;  3ICF A;  3V4Y A;  2IE4 C;  4NZV A;  3THN A;  1TCO A;  3IB7 A;  4ORA A;  3IVD A;  1T70 A;  4G9J A;  4H1Y P;  1W24 A;  2Z72 A;  4V0W A;  2QJC A;  3EGH A;  1NNW A;  2BQ8 X;  2HYO A;  4I5N C;  4UT2 A;  3H67 A;  4MOV A;  5J28 A;  3QG5 C;  4FBQ A;  3ZTV A;  5DNY A;  3EGG A;  5JPE A;  4LTY A;  1II7 A;  1SU1 A;  4H2F A;  4H1S A;  1S3N A;  4FBK A;  3TGH A;  2WDD A;  4O24 A;  4UWQ A;  2P6B A;  2WDE A;  1HPU A;  4ORC A;  3N5U A;  4ORB A;  3CK2 A;  3H69 A;  4M0V A;  4OR9 A;  1G5B A;  2ZBM A;  3K7V C;  1S95 A;  4UT3 A;  1UTE A;  2HY1 A;  4XPN A;  1S3L A;  4YKE A;  2IAE C;  3QFM A;  4H2I A;  5F3W A;  1S8E A;  1HO5 A;  3E7B A;  3H60 A;  4O43 A;  2QFR A;  1T71 A;  1M63 A;  2QFP A;  4ZX2 A;  5INB A;  3QFN A;  4I5L C;  2Z06 A;  4DT2 A;  3DSC A;  3C9F A;  1AUI A;  4TUG A;  3RQZ A;  1QFC A;  2NPP C;  2IE3 C;  5C1V A;  4O4K A;  2R17 A;  4JA7 A;  1S70 A;  3AV0 A;  4IYP C;  3QFO A;  3KBP A;  3H68 A;  1OID A;  3IB8 A;  4JA9 A;  2WDF A;  3K7W C;  4UT3 B;  1Z2W A;  4F0Z A;  2Q8U A;  2HYP A;  2XMO A;  4HD0 A;  2O8A A;  3H66 A;  1XZW A;  1JK7 A;  4LU9 A;  4FBW A;  3PSO A;  4B2O A;  2KKN A;  1OIE A;  3DSD A;  4V0V A;  2AHD A;  2USH A;  3DW8 C;  3RL5 A;  5JJT A;  2JOG A;  3RL3 A;  1Z2X A;  3QFK A;  3E7A A;  3H61 A;  4J6O A;  2DFJ A;  3H64 A;  1WAO 1;  3C5W C;  4MOY A;  1OI8 A;  3RL4 A;  3HVQ A; 
#chains in the Genus database with same CATH topology
 1WAR A;  1HP1 A;  4WWL A;  4ZVZ A;  5IOH A;  2CV9 A;  2BCD A;  5EQV A;  1S3M A;  3THO B;  2WDC A;  4IL1 A;  4TUI A;  2NXF A;  3JYF A;  4H2B A;  4DHL A;  3FLO A;  1QHW A;  4LAC C;  1XM7 A;  1IT6 A;  3IVE A;  2NYM C;  3LL8 A;  5HPE A;  3D03 A;  5B8I A;  1V73 A;  5GTU A;  2YEQ A;  3GVE A;  2GJU A;  5JPF A;  4Q7F A;  2YVT A;  1UF3 A;  3AUZ A;  2NYL C;  4FCX A;  4DSY A;  3E0J A;  3H63 A;  1USH A;  2A22 A;  4KKZ A;  3P71 C;  3FGA C;  3H62 B;  1KBP A;  4O5G A;  1U32 A;  4KBP A;  4H2G A;  4V0X A;  3T1I A;  3ZU0 A;  2BDX A;  2Z1A A;  1MF8 A;  4MP0 A;  3PSN A;  1FJM A;  2O8G A;  3ICF A;  3V4Y A;  2IE4 C;  4NZV A;  3THN A;  1TCO A;  3IB7 A;  4ORA A;  3IVD A;  1T70 A;  4G9J A;  4H1Y P;  1W24 A;  2Z72 A;  4V0W A;  2QJC A;  3EGH A;  1NNW A;  2BQ8 X;  2HYO A;  4I5N C;  2DXL A;  4UT2 A;  3H67 A;  4MOV A;  5J28 A;  3QG5 C;  4FBQ A;  3ZTV A;  5DNY A;  3EGG A;  5JPE A;  4LTY A;  1II7 A;  1SU1 A;  4H2F A;  4H1S A;  1S3N A;  4FBK A;  3TGH A;  2WDD A;  4O24 A;  4UWQ A;  2P6B A;  2WDE A;  1HPU A;  4ORC A;  3N5U A;  4ORB A;  3CK2 A;  3H69 A;  4M0V A;  4OR9 A;  1G5B A;  2ZBM A;  3K7V C;  1S95 A;  4UT3 A;  1UTE A;  2HY1 A;  4XPN A;  1S3L A;  4YKE A;  2IAE C;  3QFM A;  4H2I A;  5F3W A;  1S8E A;  1HO5 A;  3E7B A;  3H60 A;  4O43 A;  2QFR A;  1T71 A;  1M63 A;  2QFP A;  4ZX2 A;  5INB A;  3QFN A;  4I5L C;  2Z06 A;  4DT2 A;  3DSC A;  3C9F A;  1AUI A;  4TUG A;  3RQZ A;  1QFC A;  2DXN A;  2IE3 C;  2NPP C;  5C1V A;  4O4K A;  2R17 A;  4JA7 A;  1S70 A;  3AV0 A;  4IYP C;  2ZOA A;  3QFO A;  3KBP A;  3H68 A;  1OID A;  3IB8 A;  4JA9 A;  2WDF A;  3K7W C;  4UT3 B;  1Z2W A;  4F0Z A;  2Q8U A;  2HYP A;  2XMO A;  4HD0 A;  2O8A A;  3H66 A;  2ZO9 B;  1XZW A;  1JK7 A;  4LU9 A;  4FBW A;  3PSO A;  4B2O A;  2KKN A;  1OIE A;  3DSD A;  4V0V A;  2AHD A;  2USH A;  3DW8 C;  3RL5 A;  5JJT A;  2JOG A;  3RL3 A;  1Z2X A;  3QFK A;  3E7A A;  3H61 A;  4J6O A;  2DFJ A;  3H64 A;  1WAO 1;  3C5W C;  4MOY A;  1OI8 A;  3RL4 A;  3HVQ A; 
#chains in the Genus database with same CATH homology
 1WAR A;  1HP1 A;  4WWL A;  4ZVZ A;  5IOH A;  2CV9 A;  2BCD A;  5EQV A;  1S3M A;  3THO B;  2WDC A;  4IL1 A;  4TUI A;  2NXF A;  3JYF A;  4H2B A;  4DHL A;  3FLO A;  1QHW A;  4LAC C;  1XM7 A;  1IT6 A;  3IVE A;  2NYM C;  3LL8 A;  5HPE A;  3D03 A;  5B8I A;  1V73 A;  5GTU A;  2YEQ A;  3GVE A;  2GJU A;  5JPF A;  4Q7F A;  2YVT A;  1UF3 A;  3AUZ A;  2NYL C;  4FCX A;  4DSY A;  3E0J A;  3H63 A;  1USH A;  2A22 A;  4KKZ A;  3P71 C;  3FGA C;  3H62 B;  1KBP A;  4O5G A;  1U32 A;  4KBP A;  4H2G A;  4V0X A;  3T1I A;  3ZU0 A;  2BDX A;  2Z1A A;  1MF8 A;  4MP0 A;  3PSN A;  1FJM A;  2O8G A;  3ICF A;  3V4Y A;  2IE4 C;  4NZV A;  3THN A;  1TCO A;  3IB7 A;  4ORA A;  3IVD A;  1T70 A;  4G9J A;  4H1Y P;  1W24 A;  2Z72 A;  4V0W A;  2QJC A;  3EGH A;  1NNW A;  2BQ8 X;  2HYO A;  4I5N C;  2DXL A;  4UT2 A;  3H67 A;  4MOV A;  5J28 A;  3QG5 C;  4FBQ A;  3ZTV A;  5DNY A;  3EGG A;  5JPE A;  4LTY A;  1II7 A;  1SU1 A;  4H2F A;  4H1S A;  1S3N A;  4FBK A;  3TGH A;  2WDD A;  4O24 A;  4UWQ A;  2P6B A;  2WDE A;  1HPU A;  4ORC A;  3N5U A;  4ORB A;  3CK2 A;  3H69 A;  4M0V A;  4OR9 A;  1G5B A;  2ZBM A;  3K7V C;  1S95 A;  4UT3 A;  1UTE A;  2HY1 A;  4XPN A;  1S3L A;  4YKE A;  2IAE C;  3QFM A;  4H2I A;  5F3W A;  1S8E A;  1HO5 A;  3E7B A;  3H60 A;  4O43 A;  2QFR A;  1T71 A;  1M63 A;  2QFP A;  4ZX2 A;  5INB A;  3QFN A;  4I5L C;  2Z06 A;  4DT2 A;  3DSC A;  3C9F A;  1AUI A;  4TUG A;  3RQZ A;  1QFC A;  2DXN A;  2IE3 C;  2NPP C;  5C1V A;  4O4K A;  2R17 A;  4JA7 A;  1S70 A;  3AV0 A;  4IYP C;  2ZOA A;  3QFO A;  3KBP A;  3H68 A;  1OID A;  3IB8 A;  4JA9 A;  2WDF A;  3K7W C;  4UT3 B;  1Z2W A;  4F0Z A;  2Q8U A;  2HYP A;  2XMO A;  4HD0 A;  2O8A A;  3H66 A;  2ZO9 B;  1XZW A;  1JK7 A;  4LU9 A;  4FBW A;  3PSO A;  4B2O A;  2KKN A;  1OIE A;  3DSD A;  4V0V A;  2AHD A;  2USH A;  3DW8 C;  3RL5 A;  5JJT A;  2JOG A;  3RL3 A;  1Z2X A;  3QFK A;  3E7A A;  3H61 A;  4J6O A;  2DFJ A;  3H64 A;  1WAO 1;  3C5W C;  4MOY A;  1OI8 A;  3RL4 A;  3HVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...