5F3WA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Dna binding protein/hydrolase/dna
total genus 105
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5f3wA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5f3wA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5f3wA01
5C1VA 3DSDA 1W24A 3H62B 4FCXA 4H2BA 4ORCA 3IVDA 4V0VA 1OIDA 3EGGA 4FBQA 4O43A 2WDFA 3QFOA 1QHWA 2USHA 1II7A 2WDEA 4MOVA 4H1YP 4NZVA 2NXFA 1WARA 2HYPA 1XZWA 1WAO1 3H68A 3KBPA 5EQVA 4ORAA 2DFJA 2NYMC 1IT6A 5JPFA 1KBPA 1SU1A 3H66A 4TUGA 4TUIA 2QJCA 3QFNA 3RL4A 4H2FA 4I5NC 4OR9A 3RL5A 3V4YA 1AUIA 3E7AA 2KKNA 4IYPC 1TCOA 1HO5A 1Z2WA 3P71C 2Q8UA 4DSYA 3H60A 4O24A 3ZTVA 3DSCA 1HPUA 3H64A 3RQZA 4XPNA 1S3NA 4I5LC 2HY1A 3K7WC 2Z72A 4UT3A 2ZBMA 3QFKA 3CK2A 3FGAC 2WDCA 4DT2A 1UTEA 3THNA 1S95A 2O8AA 2O8GA 3DW8C 1S3MA 3T1IA 4B2OA 4ZVZA 1Z2XA 4O5GA 1XM7A 5JJTA 1S8EA 2Z1AA 1OI8A 1T70A 5DNYA 1S3LA 4UT3B 1JK7A 1MF8A 2NPPC 2WDDA 4J6OA 5J28A 4DHLA 3N5UA 3EGHA 4LU9A 2CV9A 3HVQA 3H63A 4FBKA 1M63A 4UT2A 4KBPA 2A22A 2JOGA 4Q7FA 4JA7A 2QFRA 1USHA 3IB8A 4M0VA 3IVEA 1NNWA 1UF3A 1U32A 1OIEA 3TGHA 2NYLC 3LL8A 3PSOA 4G9JA 3AV0A 2Z06A 2BCDA 1FJMA 5F3WA 4O4KA 4YKEA 3C9FA 4ORBA 1S70A 3ZU0A 2BQ8X 2IAEC 2IE3C 4V0XA 5IOHA 5JPEA 5HPEA 2P6BA 4V0WA 3ICFA 4WWLA 5INBA 3AUZA 3H69A 3PSNA 4LTYA 2YVTA 3THOB 3RL3A 5B8IA 1T71A 3C5WC 3H61A 3JYFA 3QFMA 3H67A 2HYOA 2GJUA 4H2IA 2AHDA 3GVEA 3E7BA 1V73A 4HD0A 4MOYA 5GTUA 4ZX2A 4H1SA 4F0ZA 4KKZA 4IL1A 2IE4C 1QFCA 4LACC 4H2GA 4JA9A 2BDXA 2R17A 3IB7A 4UWQA 3QG5C 4MP0A 3K7VC 2XMOA 1G5BA 2QFPA 4FBWA 1HP1A
chains in the Genus database with same CATH superfamily
2JVAA 2FH0A 1YZ9A 3GLGA 1AIPC 2ZANA 2LJHA 3KWRA 3L27A 1II7A 2JWOA 2KRKA 1T38A 4DUZM 4IJEA 2UXDE 1KBPA 3QFNA 1WXQA 1N77A 1NEIA 3H60A 4JN6A 4LF9E 4JV5E 4M9SA 4R71A 3RMPA 4JI4M 2JPAA 1WJPA 3KZYA 3B9PA 2V6ZM 1HQYE 5LMUE 4DT2A 2HWJA 2W82A 2XSZD 1OIPA 2LUPB 3U60B 1Z6TA 1OI8A 1T70A 4I8OA 3BBZA 2J7NA 2EJ4A 2EPUA 5IWAE 2QBYB 2CV9A 2EM6A 2R62A 1XB2B 1I4WA 3GRVA 3U5ZA 1R2ZA 4NOOB 4P16A 1IXRC 2EM4A 2VRDA 4JI6E 4GMQA 1R4GA 3CTWB 1U32A 2QENA 2EO2A 3SARA 2Z06A 4ORBA 1VQ1A 2KDLA 2IE3C 3B89A 1DO0A 1WHCA 2UXDM 3C4BA 1JK2A 5ITTA 3BF2A 1IY0A 2LH0A 4MB7A 1A1IA 1E9RA 4LF9M 1G59A 3QWLA 4JV5M 4KKZA 2EL5A 2D7EA 3QG5C 3GLGE 1YYWA 4L8NA 5LMUM 2LRSA 3D03A 2DHYA 4PCZA 2WSCF 1IFYA 2VQEE 2J7JA 3FKEA 4O43A 1UHZA 2EMCA 4DV6E 4MOVA 2LVAA 5ADZA 5IWAM 4ORAA 2NYMC 2ODRD 4JI6M 1TCOA 4LJ5A 2HL7A 3HPSA 5A6AA 4RF1A 5FLXC 3HHZA 5TSEA 3IHPA 1KYIA 5EP2A 3L28A 4K0KM 1X3CA 4I5SA 3NBXX 4LJ4A 4LCBA 3T1IA 2KA6B 1J5EE 2EPOA 3AL0C 3JAMC 5KL6A 1DQ3A 3WHLA 5JI2E 3N5UA 3FYCA 1ZBQA 2H5XA 3OMLA 3QYEA 4YY3E 5EJCA 1FKAE 2VQEM 1IQSA 1MJGM 3JR4A 2F5QA 4QNMA 3M0EA 4DV6M 3AV0A 2XFSA 4JI3M 3GLHB 1QDRA 2P6BA 4WWLA 3KXEC 2WBTA 5INBA 1TR8A 4G6ZA 4JI0E 3PSNA 1TH4A 2K6BA 2KNZA 3ZCBB 4B7HA 2GJUA 4GC5A 8CATA 1G2FC 3FUVA 4HLQA 3GQ3A 3GO8A 3HU3A 3E0JA 1K3XA 5EP4A 1F2IG 1SFEA 2QCUA 4MGYE 1J5EM 2JY9A 1LV7A 2XEPA 4KT0F 4DBGB 2F4VE 2QP9X 1N36E 5E26A 2I7PA 3SYLA 1EFUB 3AOEC 4YY3M 1EKZA 1G41A 4R8OA 2DAIA 4ITQA 2KW0A 1DGHB 4AG6A 1T43A 3MHHC 3IWDA 4L4UA 2PRTA 1QUSA 3IWCA 3K9PA 3F92A 3UZUA 3U61B 1QDTA 1TH2A 3FYDA 2R1FA 2V87A 4JI0M 3LCVB 3FGAC 2LMZA 3THNA 1S95A 1Z59A 1SXJA 2RKOA 3HKPA 1A5TA 2EMYA 1D2NA 2LT7A 2YR0A 2EZ6A 1HJPA 1MF8A 2L2NA 2RRUA 4F6NA 5A6KA 3EIEA 3GLFB 3B74A 2I7NA 4Q7FA 4IS1C 3B7QA 3I01M 1GQEA 4F2JC 3FUWA 3TPZA 2NYLC 1YYOA 2V85A 5KQDA 5IXMB 2F4VM 1S70A 1N36M 3GPUA 3H69A 2V1CA 1F4IA 3VKGA 3I04M 5B8IA 3J80C 5IT9C 2KOUA 1IQPA 1NO1A 1WGNA 3T1YE 1X6FA 4JI8E 4JI7E 4MP0A 1G5BA 4P78A 2EOZA 3J81C 4CISA 1T4NA 5AC4A 4IBIA 3TQMA 3VHTB 2YTPA 1D0LA 3KOZE 2L6OA 3C6KA 1WAO1 3AFHA 4TUIA 4G4QA 1UN6B 3GLIE 3VYYA 5A2QC 2M5ZA 4FCWA 2OO9A 3C3DA 4II7A 3SFZA 2WDCA 4BBAA 2MGWA 2YQZA 2QBYA 1Z5CA 2FE8A 4W5WA 3T1YM 2DZOB 2J7OA 4M2ZA 4EIWA 4IBJA 2NQ8C 4JI8M 2KZSA 4JI7M 1G4AE 2JWSA 1GTKA 2C99A 4GHLA 1P47A 2JZ1A 4WX9A 1RU3A 3VK7A 1IN6A 3B7ZA 1VEGA 1OIZA 1LLMC 5BR8E 4GH9A 4DV2E 3UMMA 2EJSA 4DV1E 1GZ6A 3RFWA 1Z5AA 2ERCA 2RS7A 4BLCA 2R65A 5KQ8A 3SAUA 1MN3A 1NV9A 2VDBB 1T39A 3E7BA 1V33A 4F0ZA 3FIGA 3IB7A 2CE7A 1X6EA 5A6BA 5C18A 2WSEF 2QPAA 2OPFA 3W67A 2DLKA 4DV0M 4QOZC 4NHRA 1VDDA 2KZUA 3H68A 2VF1A 3KSJA 1N33E 3LMLA 3ZOQB 4DV7M 4A3VB 3RL4A 2LVNC 2Y21A 2KKNA 3L2AA 1HO5A 1Z2WA 4LFCE 2K0BX 2L92A 4WURA 5ITYA 2VQFM 1L2BA 3MHSC 5BR8M 4DV2M 4DV1M 3MK6A 3TWMA 3K7WC 3VDUA 2H36X 2Y0TA 2LV2A 1UTEA 3KS4A 2JXPA 4DV4E 4GKJM 1WJ7A 3LMMA 4OVZB 1AH5A 4KZSA 1KSFX 1YYKA 5DNYA 4BB9A 1I94E 3Q8XA 3GLHA 2YNMD 1GJSA 1OFHA 4DR1E 3DZDA 4WYQB 1YSYA 4CGYB 2M4IA 2L7IA 2EP3A 1ORYB 1UBDC 3JU0A 1TH3A 2Y20A 5KL3A 2HKJA 4B7FA 2H1RA 2DXNA 3KFUG 3QFMA 3GVEA 2HCBA 4MOYA 4ZX2A 2C5RA 4H1SA 2C96A 1HQCA 2IE4C 2UUCE 4DV5E 4LGYA 3ADJA 4UWQA 2LXEA 1IBLE 2EOMA 4L78A 2FOIC 4DV4M 3F6GA 3FTEA 3HHYA 1MGTA 3IVDA 1E9SA 2DAMA 4QHTA 1GLNA 3U6SA 2WZOA 3SMPA 4H1YP 3JTZA 1DGHA 4JXJA 4X64E 4ZYEA 2L2KB 1XZWA 1I94M 5JPFA 3ILKA 4F2LA 2YU8A 4R7GA 2L4EA 2VIIA 3ADGA 2EPZA 3U61A 4DR3E 4DSYA 2C9OA 5KPTA 3FTFA 3DOAA 2G3QA 4FW9A 2CV2A 4AI6A 3H64A 4F9CB 1IN4A 2YTGA 4N4RB 4F6MA 5AE2A 2JZ0A 1QYRA 3HX3A 4LJ9A 2JA2A 1QUTA 2ZM6E 2XZUA 1K3WA 3GLFA 2QQ8A 1HR0E 1R5LA 2ZO9B 1X37A 2A5YB 3J2PB 2UUCM 4DV5M 4JYAE 3T1HE 3KVWA 2MH8A 1IBLM 2EUCA 1G8PA 4RKUF 2CTDA 2BWEA 2DAKA 2DXIA 4X65E 1HNWE 4IBFA 3E4RA 5DFLA 3LVVA 4G9JA 4B3SM 4V0XA 4X64M 4DR5E 2FGGA 3FUTA 5A6BD 4LTYA 1T71A 4DR3M 1IXSB 3TE6A 2O25A 4BC7A 3C3EA 4F1IA 2ZAMA 4KHPE 2V89A 5KPRA 1QAMA 3VLFB 3FUXA 3GRRA 2K47A 1W24A 1XXHA 2BJVA 2ZM6M 1QANA 1XC8A 1J09A 3U6DA 4J8ZA 4K0KE 3EPJA 4FBQA 1HR0M 1X49A 3PNVA 1UILA 4WXCA 4R3DA 1PDAA 2QZ4A 3DF6A 4JYAM 3T1HM 4G4OA 2DFJA 4IBDA 2EMBA 3H66A 1ZMUA 4X65M 1HNWM 2Q2EB 2EPAA 4HEIA 5FTJA 2R4JA 4L8RC 3AKZA 4DKKA 3DSCA 3K1JA 5FTKA 2R44A 4DR5M 2EPKX 2CPNA 3U6PA 4M30A 2Z72A 4JI3E 2EN4A 2R76A 2DENA 2L7HA 3GQ5A 1IMUA 3K8ZA 4LF8E 2EM2A 2AHMA 4X62E 3IG5A 2E1MA 2YSPA 4LZZA 1KFVA 4KHPM 3VYXA 3SC3A 1PJSA 2CUZA 1QAQA 2B7TA 2Z7JA 2BWBA 4GHAA 2EOOA 5EXTA 1STUA 2DKLA 3ECRA 2EN3A 4Z8XA 1EH6A 1L2DA 3FTDA 1EH7A 2MKNA 2IAEC 1V92A 2JYAA 2YRKA 4LJ6A 3W0FA 2YTQA 1FJGE 2RS6A 1OKSA 2CWBA 1DGGA 4CHTB 1XHBA 2YRMA 1YPNA 2ODRC 1KJKA 3KOXE 5IV8B 2RQLA 2YTNA 4WFTA 2L4FA 2DAEA 2FNAA 2E72A 1XXHE 1G3IA 2RGHA 5IT9S 2MKDA 1X47A 5C1VA 5KPZA 1B69A 4H2BA 4ORCA 2X49A 1IN5A 4LF8M 1E94E 1OQYA 2EL6A 4X62M 1T4LB 1D0KA 2GQFA 4P17A 1J7KA 1IN7A 3FE3A 3EQ1A 2EPNA 4R2RA 3M6AA 4MM3B 3HU1A 1Q39A 1IT6A 4TUGA 2EN2A 4NC6A 4HL4A 2MDRA 4I5NC 4OR9A 1N32E 2L09A 4LRSA 2EMFA 4TUWA 1RC7A 2NUGA 4HEOA 4F9BB 4AKGA 2CV0A 1QZEA 2LO3A 2HGHA 4CIZA 4XPNA 3FUUA 4OVZA 2EMLA 2ZBMA 3C9PA 1FJGM 3EPKA 1V34A 5A2QS 1WHNA 4BHBA 1DO2A 1A1JA 2K4VA 4LGMA 2B7VA 4Z6YA 1YFHA 3L00A 2Z1AA 2LVOC 3LLHA 4UT3B 2YTIA 2LUQA 3KOWE 2M1SA 1Q3BA 2YU5A 2FFJA 1BVSA 2XF3A 4M0VA 3H4MA 4MGHA 3M99B 1ZQ9A 4S12A 2E5LE 3HQ1A 4NRWA 2M9AA 3C9FA 3H4JA 3U6CA 1A1KA 4B3ME 3J27B 4RHBB 2EMWA 2FV4B 2VF8A 3ZQJA 2EPRA 2YVTA 1N32M 5BPVA 4BBYA 2EKFA 2YT4A 1TTEA 1W5SA 2JR1A 2EA0A 2YTJA 3GLGB 3QYBA 2EMHA 4IJDA 4JA9A 1HT2E 3VKHA 1NHWC 1X5WA 4WXDA 2KONA 3H62B 4FCXA 2LBCA 2EMZA 1OIDA 3EGGA 4M9ZA 4FK5C 2R0IA 3RE8A 5AE1A 4NZVA 1NVMA 2O5RA 2EM0A 3T38A 2EOQA 1IN8A 2HJJA 1JR3A 3SHFA 2CP8A 3MSWA 3E46A 2RSIA 4NSRA 1A1LA 1IBME 3HHWA 2E5LM 5ITRA 1W5TA 3ZTVA 4L15A 4B7GA 4GEQB 2M60A 3JR5A 4B3MM 2JY7A 4D82A 4WSPA 3J7AS 4LJ8A 2N3GA 5AASA 4NSOB 4BC9A 2LBSB 2YFQA 1TN9A 3VK6A 1XMOE 5JI3E 3LCUA 4GEWA 2EE8A 4J6OA 5LMNE 3HTXA 1DV0A 4LF6E 4L5NC 1H6UA 3HVQA 3BIDA 1ZR9A 2A22A 5AC5A 4JI1E 1SXJE 3IB8A 1PRBA 2DHRA 3U60A 4LFAE 2K9DA 4LRTA 4AZFA 2EMIA 2VE7C 3BBGA 4X9JA 4DV0E 1PJIA 2YTEA 4R03A 5KL4A 1NSFA 5ITQA 3RL3A 4I81A 2KHXA 4DV7E 1IBMM 4ZPXA 4FVMA 1ZU1A 1JB0F 4F9AB 1WGLA 2BDXA 2R17A 2VQFE 2EN1A 1QNTA 3OTOM 4M9VC 5JPEA 2L33A 2WBSA 2EMAA 1BB8A 2Y0QA 2XH9A 1XMOM 3MHVC 2IHR1 2R4EA 2YSOA 1YUIA 2UUBE 4GKJE 1JR3E 5LMNM 2B9DA 2V86A 2HYPA 4LF6M 1ZV1A 3KSXA 3L29A 1NCSA 2F5OA 4JI1M 1AUIA 1BBGA 4ZYGA 2Z3XA 4LFAM 4QOSA 1DGBA 3UK3C 3KW6A 2GNOA 4D81A 4LF4E 2ZOAA 1GABA 3NBIA 2DWLA 2GPIA 2EM7A 2CHGA 2ADRA 3PXGA 2JP9A 1S3NA 2DNAA 2LVPC 2CV1A 2R46A 1R6BX 3B7NA 5ITUA 3M7GA 2MDGA 2BJWA 2DMYA 3W68A 2EOEA 3IWBA 3RGPA 1IY1A 1SXJD 1JK7A 2NPPC 5J28A 2ZBKB 1DGCA 1HT1E 2YPNA 1TF6A 2EM3A 5FTLA 2DGCA 4UT2A 4B08A 2NA2A 2YTFA 4L6V6 1MEYC 1Y8GA 1L1TA 1SR9A 2UUBM 1J26A 2BCDA 4MGZE 2L6MA 1YSAC 4QNRA 5HPEA 3EPHA 2L2MA 1NJGA 2EPXA 4BS9A 4DR2E 3DFZA 2XFTA 1XWIA 4IBCA 3FD9A 4H2IA 2EOHA 1NY6A 2DSYA 2LE2A 4LF4M 7CATA 1GKIA 2DZNB 3Q8GA 2EOSA 4IBKA 1SG9A 1QVRA 1JK1A 2LTUA 3A45A 4LZJA 4Q7JA 1NNUC 1JR3D 2JY6B 5FSWA 3I4YA 4V0VA 2DXLA 4DV3E 4P7DA 1XNRE 5DYIA 1RQ0A 2DB2A 2R45A 1GL6A 1G2DC 2EN7A 1VEJA 3KBPA 1IQOA 2HAKA 2JUJA 1WR1B 2BBGA 4ZYHA 3GLIB 3J7Yp 4H2FA 3A42A 1XNQE 2MJ5B 1XMQE 2ELYA 4LJAA 4IBBA 3HU2A 3TQSA 2N8XA 2ZTDA 4GIPA 1ZMVA 4B3SE 4R2EA 4AW4A 4DR2M 2EOIA 3GQ4A 4UT3A 4NL4H 2R18A 3BXWA 4B3TE 5EXPA 3L25A 2WSFF 1XM7A 4LY6A 1S8EA 3C58A 3D8LA 1G71A 1DI2A 4DHLA 2CT1A 2LVQD 4NRVA 4KBPA 4GZNC 1N34E 3PSOA 2RGOA 4DV3M 1XNRM 4D80A 5CFFE 2EQ1A 2UU9E 5FTNA 2L8TA 1FJMA 5F3WA 2EM8A 3ZU0A 2KNAA 3AOEA 2RSMA 3HGIA 5FLXS 3ICFA 3U6EA 4WW0A 4RF0A 3GLHE 2EORA 1IY2A 4GITA 3C5WC 2OOBA 1XNQM 2AHDA 3JAMS 1T6OA 1XMQM 4PDGA 3AOGA 2XLJA 2EQ3A 2EM5A 3U6MA 4DR4E 2RPCA 1GJTA 5ITXA 1K82A 2LHCA 1QAOA 3SATA 4B3TM 1PKPA 2WZJA 2EN8A 1VG5A 4FWGA 1NY5A 2MR9A 2USHA 4PDIA 2UXBE 2MC6A 2LJUA 4AG5A 4AKHA 5EXSA 2DRPA 1QU6A 1OAOC 5KL7A 4JI5E 4M0WA 3LQRA 1N34M 2Q8UA 4KLNA 2UU9M 4M0DA 1UM8A 5LLQA 3FRIA 4FWDA 5FTMA 3T6PA 4OU7A 5GKNA 1S3MA 2DI0A 5LL6R 1NNJA 4YHHE 2X4AA 2FTXB 2CSHA 2EOFA 2D9HA 2JXNA 4DR4M 3PNYA 4Q35B 4NXNE 2C98A 1YUBA 2YTDA 1N75A 2QFRA 2N35A 2LCEA 2NABA 1NJFA 1PJQA 3A46A 1GL7A 3GLFE 3CGWA 5KO3A 3UJNA 2UXBM 1DGFA 3VFDA 1VDLA 1EH8A 3AUZA 4FD2A 4LFBE 2Z4RA 4JI5M 2EOXA 3T15A 4FWHA 2M7QA 4F54A 1IM2A 2F8BA 1V73A 2XZFA 5ITXE 1OFIA 4WP2A 2MC5A 2DMIA 1T3TA 4MLVA 2F5NA 1N3GA 3LQQA 4YHHM 1OAIA 1QHWA 1C7YA 4MGIE 3KZZA 4AQYE 2FS1A 4PT5A 4NXNM 2JOXA 3HJQA 1S3SA 2QJCA 4G4RA 3C4TA 4R2CA 1YUJA 2KXEA 3EPLA 3J80S 4UN2B 3P71C 3MJ5A 2D7HA 1NHGC 2BNKA 1TF0B 1PJJA 2EN6A 1HPUA 4M9XA 1L8QA 1L1ZA 4LF5E 4KO8A 1L2CA 4BHCA 2ZTCA 3J81S 5EP1A 4LFBM 3AJIB 1TGUA 1EIJA 2MROB 4LF7E 2WBUA 1WHQA 2YTOA 4XBOA 1ZBTA 2WDDA 3SAWA 2JY8A 3E21A 2HHHE 1QZMA 4FBKA 5EQTA 2LVHA 1WIVA 2JOGA 4DR6E 4JA7A 2EM9A 2L3JA 1NNWA 1UF3A 3P1XA 4MGKE 2EPCA 4REZA 3HPZA 5IOHA 4AQYM 4V0WA 2DIXA 3J7AG 1VEKA 2EL4A 2LTSA 2JY5A 3THOB 1A1HA 1AUAA 1OJLA 4JI2E 4HTGA 1X6HA 3H67A 4IBGA 4DMIA 1HNXE 3SYKA 2V88A 3MMPA 1Q3CA 4IL1A 4LACC 3E9SA 2OOAA 4LF5M 3K7VC 2B3TB 2QFPA 2R6FA 4X8WA 1ZMWA 4BMJA 5EXXA 3DSDA 4GRIA 4Q28A 3FTCA 2ENAA 4LF7M 2DWMA 4AKIA 3HHXA 3GLIA 3I4VA 1NV8A 3WHKA 1JQJC 2WDEA 2KEBA 2NXFA 5EQVA 3VDPA 2HHHM 2APLA 2I13A 1SU1A 1Q02A 3KOYE 2V1UA 4DR6M 3V4YA 4FCTA 2DVWB 4DR7E 4IYPC 2VF7A 1IXZA 5T6JA 2EQ0A 3LW5F 4NXME 1ZAAC 4B3RE 3NWLA 3HXLA 4QHSA 2Z8YM 3QFKA 2QNJA 4JI2M 3PFIA 3DJWA 2O8GA 3RGSA 4XGIA 3DW8C 3ZH9B 4B2OA 1Z2XA 4O5GA 4IIWA 5JJTA 1HNXM 3GPYA 1YLAA 3I51A 1KYQA 2DAGA 4KWYA 5H37D 2EPPA 1MX0A 2EWLA 1M63A 2LNHC 2F5PA 3OTOE 2KRUA 3GRUA 4WPYA 3TGHA 2CRUA 3LL8A 2GHFA 5IREB 3U5ZB 4O4KA 2UUAE 3ZC7B 4OX9E 1HNZE 3GRYA 4GKKE 3VK8A 1IBKE 3HY5A 4DR7M 5KL5A 3GP1A 3H61A 3J7BA 3GPPA 1XXHB 5E6JA 4HD0A 2ENCA 4MH0E 2LHGA 3K2LA 4NXMM 2EMGA 4B3RM 3UK6A 3DA1A 2I9IA 1HP1A 4R2SA 1E32A 3K92A 1IXSA 3FLOA 2UXCE 2GLIA 3C6MA 3QFOA 1PM5A 3CF6E 2A25A 3R8FA 4G3OA 3K9OA 1OTRA 4ZYDA 4G4NA 1GVNA 2G8LA 2LTRA 3U6LA 2K7IA 2N3HA 3U6OA 3SBJA 1X48A 1ZAEA 3BGHA 2EOYA 2UUAM 1A1FA 1D0MA 1YE9A 4R2DA 3TWLA 3RQZA 4OX9M 1HNZM 2V8QB 1TF3A 1L4SA 4I5LC 4GKKM 2NUFA 1IBKM 3SMSA 1CUKA 3CK2A 3TL4X 2O8AA 4CJ6A 3KP1E 1TDZA 2JNHA 3SHGB 4ZVZA 4IBEA 4R2PA 2X8AA 4WSGA 4ANRA 5C1BA 4LU9A 3EGHA 1WRJA 1TDHA 1GO5A 1R7RA 3HZJA 1USHA 3ADIA 3IVEA 2YRHA 3PVSA 2XSZA 2UXCM 3K6QA 2EMKA 3IECA 4YKEA 2BQ8X 2V83A 1BBOA 1QQWA 2CHVA 2BB8A 4GC9A 4Y28F 1A1GA 3R9XB 2DWZB 2CEAA 3JYFA 1O0WA 2HYOA 3CF2A 5DYGA 3W0LB 5A6JA 2NUEA 4X66E 1QFCA 3SASA 3ADLA 2EMXA 2JOBA 1EE8A 4FBWA 5EP3A 2EKKA 3H09A 2L3CA 3SAVA 3A98B 2G5GX 4I4LA 2EPMX 2YZTA 3KDSE 3V76A 3BOSA 4DUYE 2YWQA 1MU5A 1AAYA 2WDFA 2D7GA 2F5SA 1WARA 4OW0A 1PJTA 1SXJC 2Z4SA 2JP7A 2QSFX 4R2AA 2P5TA 3RL5A 3E7AA 4KODA 2ENHA 2DLQA 4O24A 2ELZA 1N78A 2LWXA 3L26A 1T4OA 3KP0E 2EPLX 1R2YA 2CFOA 2HY1A 5KL2A 4OOGC 2YEQA 4LG2A 1P3QQ 4BCAA 3HWSA 1LTMA 3HJSA 5AE3A 3HJ8A 2QHOB 2EOJA 2DWNA 3KS8A 2L2DA 1S3LA 2XGNA 1N33M 4X66M 1SXJB 1RMDA 4DUZE 2RTXA 2C9CA 4MLQA 4LFCM 2CHQA 2J5YA 3H63A 4XK8F 1UFZA 2OQ4A 1OIEA 1Z5BA 3EIHA 2HC5A 1C1KA 3TWKA 2ZAOA 4DUYM 3GPXA 5L8RF 3QAUA 3UGJA 4JI4E 4RNAA 4PD2A 3D8BA 2O01F 3IG8A 2WCC3 1Z1BA 1PGYA 1FNNA 5A69A 3LVWA 3CF0A 3THGA 2KHHA 4R2QA 3U6QA 2G7HA 4FCVA 3FRHA 2B3TA 1WXRA 3F6HA 5GTUA 2KNVA 4RH8A 4H2GA 4LJ7A 5IZ7D 2XMOA 4IJFA 4L16A 2DZLA 4DR1M
chains in the Genus database with same CATH topology
2JVAA 1YZ9A 3GLGA 2ZANA 2LJHA 3KWRA 3L27A 1II7A 2JWOA 2KRKA 4DUZM 4IJEA 2UXDE 1KBPA 3QFNA 1WXQA 1N77A 3H60A 4JN6A 4LF9E 4JV5E 4M9SA 3RMPA 4JI4M 3B9PA 2V6ZM 1HQYE 5LMUE 4DT2A 2W82A 2XSZD 2LUPB 3U60B 1Z6TA 1OI8A 1T70A 4I8OA 2J7NA 5IWAE 2QBYB 2CV9A 2R62A 1I4WA 3GRVA 3U5ZA 1R2ZA 4NOOB 4P16A 1IXRC 4JI6E 4GMQA 3CTWB 1U32A 2QENA 2EO2A 3SARA 2Z06A 4ORBA 2IE3C 1DO0A 2UXDM 3C4BA 5ITTA 1IY0A 2LH0A 4MB7A 1E9RA 4LF9M 1G59A 3QWLA 4JV5M 4KKZA 2D7EA 3QG5C 1YYWA 4L8NA 5LMUM 2LRSA 3D03A 4PCZA 2VQEE 3FKEA 4O43A 1UHZA 4DV6E 4MOVA 5ADZA 5IWAM 4ORAA 2NYMC 2ODRD 4JI6M 1TCOA 4LJ5A 2HL7A 3HPSA 4RF1A 5FLXC 3HHZA 1KYIA 5EP2A 3L28A 4K0KM 4I5SA 4LJ4A 4LCBA 3T1IA 2KA6B 1J5EE 3AL0C 3JAMC 1DQ3A 3WHLA 5JI2E 3N5UA 3FYCA 1ZBQA 3OMLA 4YY3E 5EJCA 1FKAE 2VQEM 3JR4A 2F5QA 4QNMA 3M0EA 4DV6M 3AV0A 2XFSA 4JI3M 3GLHB 2P6BA 4WWLA 3KXEC 5INBA 4G6ZA 4JI0E 3PSNA 1TH4A 3ZCBB 4B7HA 2GJUA 4GC5A 8CATA 3FUVA 4HLQA 3GQ3A 3GO8A 3HU3A 3E0JA 1K3XA 5EP4A 2QCUA 4MGYE 1J5EM 2JY9A 1LV7A 2XEPA 2F4VE 2QP9X 1N36E 5E26A 2I7PA 3SYLA 3AOEC 4YY3M 1EKZA 1G41A 4R8OA 4ITQA 2KW0A 1DGHB 4AG6A 3IWDA 4L4UA 3IWCA 3UZUA 3U61B 1TH2A 3FYDA 2V87A 4JI0M 3FGAC 2LMZA 3THNA 1S95A 1Z59A 1SXJA 2RKOA 3HKPA 1D2NA 2YR0A 2EZ6A 1MF8A 2L2NA 3EIEA 3GLFB 2I7NA 4Q7FA 1GQEA 3FUWA 3TPZA 2NYLC 1YYOA 2V85A 5KQDA 2F4VM 1S70A 1N36M 3GPUA 3H69A 2V1CA 3VKGA 5B8IA 3J80C 5IT9C 2KOUA 1IQPA 3T1YE 4JI8E 4JI7E 4MP0A 1G5BA 4P78A 3J81C 4CISA 1T4NA 4IBIA 3KOZE 2L6OA 1WAO1 3AFHA 4TUIA 4G4QA 3VYYA 5A2QC 2M5ZA 4FCWA 4II7A 3SFZA 2WDCA 4BBAA 2YQZA 2QBYA 1Z5CA 2FE8A 4W5WA 3T1YM 2DZOB 2J7OA 4M2ZA 4EIWA 4IBJA 2NQ8C 4JI8M 2KZSA 4JI7M 1G4AE 2C99A 4GHLA 3VK7A 1IN6A 5BR8E 4GH9A 4DV2E 3UMMA 4DV1E 1GZ6A 3RFWA 1Z5AA 2ERCA 2RS7A 4BLCA 2R65A 5KQ8A 3SAUA 3E7BA 4F0ZA 3FIGA 3IB7A 2CE7A 5C18A 2QPAA 2OPFA 4DV0M 4QOZC 1VDDA 2KZUA 3H68A 2VF1A 3KSJA 1N33E 3LMLA 3ZOQB 4DV7M 4A3VB 3RL4A 2Y21A 2KKNA 3L2AA 1HO5A 1Z2WA 4LFCE 2L92A 4WURA 5ITYA 2VQFM 1L2BA 5BR8M 4DV2M 4DV1M 3MK6A 3TWMA 3K7WC 3VDUA 2H36X 2Y0TA 1UTEA 3KS4A 4DV4E 4GKJM 3LMMA 4OVZB 4KZSA 1KSFX 1YYKA 5DNYA 4BB9A 1I94E 3Q8XA 3GLHA 2YNMD 1OFHA 4DR1E 3DZDA 4WYQB 1YSYA 4CGYB 2M4IA 2L7IA 1ORYB 3JU0A 1TH3A 2Y20A 2HKJA 4B7FA 2H1RA 2DXNA 3KFUG 3QFMA 3GVEA 2HCBA 4MOYA 4ZX2A 2C5RA 4H1SA 2C96A 1HQCA 2IE4C 2UUCE 4DV5E 4LGYA 3ADJA 4UWQA 2LXEA 1IBLE 4L78A 2FOIC 4DV4M 3F6GA 3FTEA 3HHYA 3IVDA 1E9SA 4QHTA 1GLNA 3U6SA 2WZOA 3SMPA 4H1YP 3JTZA 1DGHA 4JXJA 4X64E 2L2KB 1XZWA 1I94M 5JPFA 3ILKA 4R7GA 2VIIA 3ADGA 3U61A 4DR3E 4DSYA 2C9OA 5KPTA 3FTFA 3DOAA 4FW9A 2CV2A 4AI6A 3H64A 4F9CB 1IN4A 5AE2A 1QYRA 4LJ9A 2JA2A 2ZM6E 2XZUA 1K3WA 3GLFA 1HR0E 2ZO9B 1X37A 2A5YB 3J2PB 2UUCM 4DV5M 4JYAE 3T1HE 3KVWA 1IBLM 2EUCA 1G8PA 2DXIA 4X65E 1HNWE 4IBFA 3E4RA 3LVVA 4G9JA 4B3SM 4V0XA 4X64M 4DR5E 2FGGA 3FUTA 4LTYA 1T71A 4DR3M 1IXSB 3TE6A 4BC7A 2ZAMA 4KHPE 2V89A 5KPRA 1QAMA 3VLFB 3FUXA 3GRRA 2K47A 1W24A 1XXHA 2BJVA 2ZM6M 1QANA 1XC8A 1J09A 3U6DA 4J8ZA 4K0KE 4FBQA 1HR0M 1X49A 3PNVA 1UILA 4R3DA 2QZ4A 3DF6A 4JYAM 3T1HM 4G4OA 2DFJA 4IBDA 3H66A 4X65M 1HNWM 2Q2EB 5FTJA 2R4JA 4L8RC 3AKZA 4DKKA 3DSCA 3K1JA 5FTKA 4DR5M 2CPNA 3U6PA 4M30A 2Z72A 4JI3E 2L7HA 3GQ5A 3K8ZA 4LF8E 2AHMA 4X62E 3IG5A 2E1MA 4LZZA 1KFVA 4KHPM 3VYXA 3SC3A 1QAQA 2CUZA 2B7TA 2Z7JA 4GHAA 5EXTA 1STUA 4Z8XA 1L2DA 3FTDA 2IAEC 4LJ6A 3W0FA 1FJGE 2RS6A 1DGGA 4CHTB 1XHBA 2ODRC 3KOXE 4WFTA 2FNAA 1G3IA 2RGHA 5IT9S 1X47A 5C1VA 5KPZA 4H2BA 4ORCA 2X49A 1IN5A 4LF8M 1E94E 4X62M 1T4LB 1J7KA 1IN7A 3M6AA 4MM3B 3HU1A 1Q39A 1IT6A 4TUGA 4HL4A 2MDRA 4I5NC 4OR9A 1N32E 2L09A 4LRSA 4TUWA 1RC7A 2NUGA 4F9BB 4AKGA 2CV0A 4XPNA 3FUUA 4OVZA 2ZBMA 1FJGM 5A2QS 1WHNA 1DO2A 2K4VA 4LGMA 2B7VA 4Z6YA 2Z1AA 3LLHA 4UT3B 2LUQA 3KOWE 2M1SA 1Q3BA 2FFJA 2XF3A 4M0VA 3H4MA 4MGHA 1ZQ9A 4S12A 2E5LE 3HQ1A 4NRWA 3C9FA 3U6CA 4B3ME 3J27B 2FV4B 2YVTA 1N32M 5BPVA 4BBYA 2YT4A 1W5SA 2JR1A 2EA0A 3GLGB 4JA9A 1HT2E 3VKHA 1NHWC 2KONA 3H62B 4FCXA 1OIDA 3EGGA 4M9ZA 3RE8A 5AE1A 4NZVA 1NVMA 2O5RA 3T38A 1IN8A 1JR3A 3SHFA 3MSWA 4NSRA 1IBME 3HHWA 2E5LM 5ITRA 1W5TA 3ZTVA 4L15A 4B7GA 4GEQB 2M60A 3JR5A 4B3MM 4D82A 4WSPA 3J7AS 4LJ8A 2N3GA 5AASA 4NSOB 4BC9A 2LBSB 2YFQA 3VK6A 1XMOE 5JI3E 4J6OA 5LMNE 3HTXA 4LF6E 4L5NC 1H6UA 3HVQA 2A22A 4JI1E 1SXJE 3IB8A 2DHRA 3U60A 4LFAE 4LRTA 4AZFA 2VE7C 4DV0E 1PJIA 4R03A 1NSFA 5ITQA 3RL3A 4I81A 2KHXA 4DV7E 1IBMM 4ZPXA 4FVMA 4F9AB 2BDXA 2R17A 2VQFE 3OTOM 5JPEA 2L33A 2Y0QA 2XH9A 1XMOM 3MHVC 2IHR1 2R4EA 2UUBE 4GKJE 5LMNM 2B9DA 2V86A 2HYPA 4LF6M 3KSXA 3L29A 2F5OA 4JI1M 1AUIA 2Z3XA 4LFAM 4QOSA 1DGBA 3KW6A 4D81A 4LF4E 2ZOAA 3NBIA 2DWLA 2CHGA 3PXGA 1S3NA 2CV1A 2R46A 1R6BX 5ITUA 3M7GA 2BJWA 2DMYA 3IWBA 3RGPA 1IY1A 1SXJD 1JK7A 2NPPC 5J28A 2ZBKB 1HT1E 5FTLA 4UT2A 4B08A 2NA2A 1L1TA 1SR9A 2UUBM 1J26A 2BCDA 4MGZE 2L6MA 4QNRA 5HPEA 2L2MA 1NJGA 4BS9A 4DR2E 3DFZA 2XFTA 1XWIA 4IBCA 3FD9A 4H2IA 1NY6A 2DSYA 2LE2A 4LF4M 7CATA 1GKIA 2DZNB 4IBKA 1QVRA 3A45A 4LZJA 1NNUC 1JR3D 5FSWA 3I4YA 4V0VA 2DXLA 4DV3E 4P7DA 1XNRE 5DYIA 1RQ0A 2DB2A 2R45A 1GL6A 3KBPA 3GLIB 3J7Yp 4H2FA 3A42A 1XNQE 1XMQE 4LJAA 4IBBA 3HU2A 3TQSA 4GIPA 4B3SE 4AW4A 4DR2M 3GQ4A 4UT3A 4NL4H 2R18A 4B3TE 5EXPA 3L25A 1XM7A 4LY6A 1S8EA 3C58A 3D8LA 1DI2A 4DHLA 4NRVA 4KBPA 1N34E 3PSOA 2RGOA 4DV3M 1XNRM 4D80A 5CFFE 2UU9E 5FTNA 2L8TA 1FJMA 5F3WA 3ZU0A 3AOEA 2RSMA 3HGIA 5FLXS 3ICFA 3U6EA 4WW0A 4RF0A 1IY2A 4GITA 3C5WC 1XNQM 2AHDA 3JAMS 1XMQM 4PDGA 3AOGA 2XLJA 3U6MA 4DR4E 5ITXA 1K82A 1QAOA 3SATA 4B3TM 1PKPA 4FWGA 1NY5A 2USHA 4PDIA 2UXBE 2MC6A 4AKHA 4AG5A 5EXSA 1QU6A 4JI5E 4M0WA 3LQRA 1N34M 2Q8UA 4KLNA 2UU9M 4M0DA 1UM8A 4FWDA 5FTMA 4OU7A 5GKNA 1S3MA 5LL6R 1NNJA 4YHHE 2X4AA 2FTXB 4DR4M 3PNYA 4NXNE 2C98A 1YUBA 1N75A 2QFRA 1NJFA 3A46A 1GL7A 5KO3A 3UJNA 2UXBM 1DGFA 3VFDA 3AUZA 4FD2A 4LFBE 2Z4RA 4JI5M 3T15A 4FWHA 2M7QA 4F54A 1IM2A 2F8BA 1V73A 2XZFA 5ITXE 1OFIA 2MC5A 1T3TA 2F5NA 3LQQA 4YHHM 1QHWA 4MGIE 4AQYE 4PT5A 4NXNM 2JOXA 3HJQA 1S3SA 2QJCA 4G4RA 3C4TA 2KXEA 3J80S 3P71C 3MJ5A 2D7HA 1NHGC 2BNKA 1PJJA 1HPUA 4M9XA 1L8QA 1L1ZA 4LF5E 4KO8A 1L2CA 3J81S 5EP1A 4LFBM 3AJIB 1TGUA 4LF7E 1WHQA 4XBOA 1ZBTA 2WDDA 3SAWA 2HHHE 1QZMA 4FBKA 5EQTA 2JOGA 4DR6E 4JA7A 2L3JA 1NNWA 1UF3A 3P1XA 4MGKE 4REZA 3HPZA 5IOHA 4AQYM 4V0WA 2DIXA 3J7AG 2LTSA 3THOB 1OJLA 4JI2E 3H67A 4IBGA 4DMIA 1HNXE 3SYKA 2V88A 1Q3CA 4IL1A 4LACC 3E9SA 4LF5M 3K7VC 2B3TB 2QFPA 4X8WA 4BMJA 5EXXA 3DSDA 4GRIA 4Q28A 3FTCA 4LF7M 2DWMA 4AKIA 3HHXA 3GLIA 3I4VA 3WHKA 1JQJC 2WDEA 2KEBA 2NXFA 5EQVA 3VDPA 2HHHM 1SU1A 3KOYE 2V1UA 4DR6M 3V4YA 4FCTA 2DVWB 4DR7E 4IYPC 1IXZA 5T6JA 4NXME 4B3RE 3NWLA 3HXLA 4QHSA 3QFKA 4JI2M 3PFIA 3DJWA 2O8GA 3RGSA 4XGIA 3DW8C 3ZH9B 4B2OA 1Z2XA 4O5GA 4IIWA 5JJTA 1HNXM 3GPYA 3I51A 5H37D 1MX0A 2EWLA 1M63A 2LNHC 2F5PA 3OTOE 2KRUA 3GRUA 4WPYA 3TGHA 3LL8A 5IREB 3U5ZB 2UUAE 4O4KA 3ZC7B 4OX9E 1HNZE 3GRYA 4GKKE 3VK8A 1IBKE 4DR7M 3GP1A 3H61A 3J7BA 3GPPA 4HD0A 1XXHB 5E6JA 4MH0E 3K2LA 4NXMM 4B3RM 3UK6A 3DA1A 1HP1A 1E32A 3K92A 3FLOA 2UXCE 3QFOA 1PM5A 3CF6E 3R8FA 4G4NA 1GVNA 2G8LA 2LTRA 3U6LA 2N3HA 3U6OA 3SBJA 1X48A 1ZAEA 2UUAM 1YE9A 3TWLA 3RQZA 4OX9M 1HNZM 2V8QB 4I5LC 4GKKM 2NUFA 1IBKM 3SMSA 3CK2A 3TL4X 2O8AA 3KP1E 1TDZA 3SHGB 4ZVZA 4IBEA 2X8AA 3EGHA 5C1BA 4LU9A 1TDHA 1R7RA 1USHA 3ADIA 3IVEA 3PVSA 2XSZA 2UXCM 3K6QA 4YKEA 2BQ8X 2V83A 1QQWA 2CHVA 4GC9A 3R9XB 2DWZB 2CEAA 3JYFA 1O0WA 2HYOA 3CF2A 5DYGA 3W0LB 2NUEA 4X66E 1QFCA 3SASA 3ADLA 2JOBA 1EE8A 4FBWA 5EP3A 3H09A 2L3CA 3SAVA 3A98B 2G5GX 4I4LA 2YZTA 3KDSE 3BOSA 4DUYE 1MU5A 2WDFA 2D7GA 2F5SA 1WARA 4OW0A 1SXJC 2Z4SA 2P5TA 3RL5A 3E7AA 4KODA 4O24A 1N78A 2LWXA 3L26A 1T4OA 3KP0E 1R2YA 2CFOA 2HY1A 4OOGC 2YEQA 4LG2A 4BCAA 3HWSA 3HJSA 5AE3A 3HJ8A 2DWNA 3KS8A 1S3LA 2XGNA 1N33M 4X66M 1SXJB 4DUZE 2RTXA 2C9CA 3H63A 4LFCM 2CHQA 2OQ4A 1OIEA 1Z5BA 3EIHA 1C1KA 3TWKA 2ZAOA 4DUYM 3GPXA 3QAUA 3UGJA 4JI4E 4RNAA 4PD2A 3D8BA 3IG8A 1FNNA 3LVWA 3CF0A 3THGA 3U6QA 2G7HA 4FCVA 1WXRA 3F6HA 5GTUA 4H2GA 4LJ7A 5IZ7D 2XMOA 4IJFA 4L16A 4DR1M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1V A;  3DSD A;  1W24 A;  3H62 B;  4FCX A;  4H2B A;  4ORC A;  3IVD A;  4V0V A;  1OID A;  3EGG A;  4FBQ A;  4O43 A;  2WDF A;  3QFO A;  1QHW A;  2USH A;  1II7 A;  2WDE A;  4MOV A;  4H1Y P;  4NZV A;  2NXF A;  1WAR A;  2HYP A;  1XZW A;  1WAO 1;  3H68 A;  3KBP A;  5EQV A;  4ORA A;  2DFJ A;  2NYM C;  1IT6 A;  5JPF A;  1KBP A;  1SU1 A;  3H66 A;  4TUG A;  4TUI A;  2QJC A;  3QFN A;  3RL4 A;  4H2F A;  4I5N C;  4OR9 A;  3RL5 A;  3V4Y A;  1AUI A;  3E7A A;  2KKN A;  4IYP C;  1TCO A;  1HO5 A;  1Z2W A;  3P71 C;  2Q8U A;  4DSY A;  3H60 A;  4O24 A;  3ZTV A;  3DSC A;  1HPU A;  3H64 A;  3RQZ A;  4XPN A;  1S3N A;  4I5L C;  2HY1 A;  3K7W C;  2Z72 A;  4UT3 A;  2ZBM A;  3QFK A;  3CK2 A;  3FGA C;  2WDC A;  4DT2 A;  1UTE A;  3THN A;  1S95 A;  2O8A A;  2O8G A;  3DW8 C;  1S3M A;  3T1I A;  4B2O A;  4ZVZ A;  1Z2X A;  4O5G A;  1XM7 A;  5JJT A;  1S8E A;  2Z1A A;  1OI8 A;  1T70 A;  5DNY A;  1S3L A;  4UT3 B;  1JK7 A;  1MF8 A;  2NPP C;  2WDD A;  4J6O A;  5J28 A;  4DHL A;  3N5U A;  3EGH A;  4LU9 A;  2CV9 A;  3HVQ A;  3H63 A;  4FBK A;  1M63 A;  4UT2 A;  4KBP A;  2A22 A;  2JOG A;  4Q7F A;  4JA7 A;  2QFR A;  1USH A;  3IB8 A;  4M0V A;  3IVE A;  1NNW A;  1UF3 A;  1U32 A;  1OIE A;  3TGH A;  2NYL C;  3LL8 A;  3PSO A;  4G9J A;  3AV0 A;  2Z06 A;  2BCD A;  1FJM A;  5F3W A;  4O4K A;  4YKE A;  3C9F A;  4ORB A;  1S70 A;  3ZU0 A;  2BQ8 X;  2IAE C;  2IE3 C;  4V0X A;  5IOH A;  5JPE A;  5HPE A;  2P6B A;  4V0W A;  3ICF A;  4WWL A;  5INB A;  3AUZ A;  3H69 A;  3PSN A;  4LTY A;  2YVT A;  3THO B;  3RL3 A;  5B8I A;  1T71 A;  3C5W C;  3H61 A;  3JYF A;  3QFM A;  3H67 A;  2HYO A;  2GJU A;  4H2I A;  2AHD A;  3GVE A;  3E7B A;  1V73 A;  4HD0 A;  4MOY A;  5GTU A;  4ZX2 A;  4H1S A;  4F0Z A;  4KKZ A;  4IL1 A;  2IE4 C;  1QFC A;  4LAC C;  4H2G A;  4JA9 A;  2BDX A;  2R17 A;  3IB7 A;  4UWQ A;  3QG5 C;  4MP0 A;  3K7V C;  2XMO A;  1G5B A;  2QFP A;  4FBW A;  1HP1 A; 
#chains in the Genus database with same CATH topology
 2JVA A;  2FH0 A;  1YZ9 A;  3GLG A;  1AIP C;  2ZAN A;  2LJH A;  3KWR A;  3L27 A;  1II7 A;  2JWO A;  2KRK A;  1T38 A;  4DUZ M;  4IJE A;  2UXD E;  1KBP A;  3QFN A;  1WXQ A;  1N77 A;  1NEI A;  3H60 A;  4JN6 A;  4LF9 E;  4JV5 E;  4M9S A;  4R71 A;  3RMP A;  4JI4 M;  2JPA A;  1WJP A;  3KZY A;  3B9P A;  2V6Z M;  1HQY E;  5LMU E;  4DT2 A;  2HWJ A;  2W82 A;  2XSZ D;  1OIP A;  2LUP B;  3U60 B;  1Z6T A;  1OI8 A;  1T70 A;  4I8O A;  3BBZ A;  2J7N A;  2EJ4 A;  2EPU A;  5IWA E;  2QBY B;  2CV9 A;  2EM6 A;  2R62 A;  1XB2 B;  1I4W A;  3GRV A;  3U5Z A;  1R2Z A;  4NOO B;  4P16 A;  1IXR C;  2EM4 A;  2VRD A;  4JI6 E;  4GMQ A;  1R4G A;  3CTW B;  1U32 A;  2QEN A;  2EO2 A;  3SAR A;  2Z06 A;  4ORB A;  1VQ1 A;  2KDL A;  2IE3 C;  3B89 A;  1DO0 A;  1WHC A;  2UXD M;  3C4B A;  1JK2 A;  5ITT A;  3BF2 A;  1IY0 A;  2LH0 A;  4MB7 A;  1A1I A;  1E9R A;  4LF9 M;  1G59 A;  3QWL A;  4JV5 M;  4KKZ A;  2EL5 A;  2D7E A;  3QG5 C;  3GLG E;  1YYW A;  4L8N A;  5LMU M;  2LRS A;  3D03 A;  2DHY A;  4PCZ A;  2WSC F;  1IFY A;  2VQE E;  2J7J A;  3FKE A;  4O43 A;  1UHZ A;  2EMC A;  4DV6 E;  4MOV A;  2LVA A;  5ADZ A;  5IWA M;  4ORA A;  2NYM C;  2ODR D;  4JI6 M;  1TCO A;  4LJ5 A;  2HL7 A;  3HPS A;  5A6A A;  4RF1 A;  5FLX C;  3HHZ A;  5TSE A;  3IHP A;  1KYI A;  5EP2 A;  3L28 A;  4K0K M;  1X3C A;  4I5S A;  3NBX X;  4LJ4 A;  4LCB A;  3T1I A;  2KA6 B;  1J5E E;  2EPO A;  3AL0 C;  3JAM C;  5KL6 A;  1DQ3 A;  3WHL A;  5JI2 E;  3N5U A;  3FYC A;  1ZBQ A;  2H5X A;  3OML A;  3QYE A;  4YY3 E;  5EJC A;  1FKA E;  2VQE M;  1IQS A;  1MJG M;  3JR4 A;  2F5Q A;  4QNM A;  3M0E A;  4DV6 M;  3AV0 A;  2XFS A;  4JI3 M;  3GLH B;  1QDR A;  2P6B A;  4WWL A;  3KXE C;  2WBT A;  5INB A;  1TR8 A;  4G6Z A;  4JI0 E;  3PSN A;  1TH4 A;  2K6B A;  2KNZ A;  3ZCB B;  4B7H A;  2GJU A;  4GC5 A;  8CAT A;  1G2F C;  3FUV A;  4HLQ A;  3GQ3 A;  3GO8 A;  3HU3 A;  3E0J A;  1K3X A;  5EP4 A;  1F2I G;  1SFE A;  2QCU A;  4MGY E;  1J5E M;  2JY9 A;  1LV7 A;  2XEP A;  4KT0 F;  4DBG B;  2F4V E;  2QP9 X;  1N36 E;  5E26 A;  2I7P A;  3SYL A;  1EFU B;  3AOE C;  4YY3 M;  1EKZ A;  1G41 A;  4R8O A;  2DAI A;  4ITQ A;  2KW0 A;  1DGH B;  4AG6 A;  1T43 A;  3MHH C;  3IWD A;  4L4U A;  2PRT A;  1QUS A;  3IWC A;  3K9P A;  3F92 A;  3UZU A;  3U61 B;  1QDT A;  1TH2 A;  3FYD A;  2R1F A;  2V87 A;  4JI0 M;  3LCV B;  3FGA C;  2LMZ A;  3THN A;  1S95 A;  1Z59 A;  1SXJ A;  2RKO A;  3HKP A;  1A5T A;  2EMY A;  1D2N A;  2LT7 A;  2YR0 A;  2EZ6 A;  1HJP A;  1MF8 A;  2L2N A;  2RRU A;  4F6N A;  5A6K A;  3EIE A;  3GLF B;  3B74 A;  2I7N A;  4Q7F A;  4IS1 C;  3B7Q A;  3I01 M;  1GQE A;  4F2J C;  3FUW A;  3TPZ A;  2NYL C;  1YYO A;  2V85 A;  5KQD A;  5IXM B;  2F4V M;  1S70 A;  1N36 M;  3GPU A;  3H69 A;  2V1C A;  1F4I A;  3VKG A;  3I04 M;  5B8I A;  3J80 C;  5IT9 C;  2KOU A;  1IQP A;  1NO1 A;  1WGN A;  3T1Y E;  1X6F A;  4JI8 E;  4JI7 E;  4MP0 A;  1G5B A;  4P78 A;  2EOZ A;  3J81 C;  4CIS A;  1T4N A;  5AC4 A;  4IBI A;  3TQM A;  3VHT B;  2YTP A;  1D0L A;  3KOZ E;  2L6O A;  3C6K A;  1WAO 1;  3AFH A;  4TUI A;  4G4Q A;  1UN6 B;  3GLI E;  3VYY A;  5A2Q C;  2M5Z A;  4FCW A;  2OO9 A;  3C3D A;  4II7 A;  3SFZ A;  2WDC A;  4BBA A;  2MGW A;  2YQZ A;  2QBY A;  1Z5C A;  2FE8 A;  4W5W A;  3T1Y M;  2DZO B;  2J7O A;  4M2Z A;  4EIW A;  4IBJ A;  2NQ8 C;  4JI8 M;  2KZS A;  4JI7 M;  1G4A E;  2JWS A;  1GTK A;  2C99 A;  4GHL A;  1P47 A;  2JZ1 A;  4WX9 A;  1RU3 A;  3VK7 A;  1IN6 A;  3B7Z A;  1VEG A;  1OIZ A;  1LLM C;  5BR8 E;  4GH9 A;  4DV2 E;  3UMM A;  2EJS A;  4DV1 E;  1GZ6 A;  3RFW A;  1Z5A A;  2ERC A;  2RS7 A;  4BLC A;  2R65 A;  5KQ8 A;  3SAU A;  1MN3 A;  1NV9 A;  2VDB B;  1T39 A;  3E7B A;  1V33 A;  4F0Z A;  3FIG A;  3IB7 A;  2CE7 A;  1X6E A;  5A6B A;  5C18 A;  2WSE F;  2QPA A;  2OPF A;  3W67 A;  2DLK A;  4DV0 M;  4QOZ C;  4NHR A;  1VDD A;  2KZU A;  3H68 A;  2VF1 A;  3KSJ A;  1N33 E;  3LML A;  3ZOQ B;  4DV7 M;  4A3V B;  3RL4 A;  2LVN C;  2Y21 A;  2KKN A;  3L2A A;  1HO5 A;  1Z2W A;  4LFC E;  2K0B X;  2L92 A;  4WUR A;  5ITY A;  2VQF M;  1L2B A;  3MHS C;  5BR8 M;  4DV2 M;  4DV1 M;  3MK6 A;  3TWM A;  3K7W C;  3VDU A;  2H36 X;  2Y0T A;  2LV2 A;  1UTE A;  3KS4 A;  2JXP A;  4DV4 E;  4GKJ M;  1WJ7 A;  3LMM A;  4OVZ B;  1AH5 A;  4KZS A;  1KSF X;  1YYK A;  5DNY A;  4BB9 A;  1I94 E;  3Q8X A;  3GLH A;  2YNM D;  1GJS A;  1OFH A;  4DR1 E;  3DZD A;  4WYQ B;  1YSY A;  4CGY B;  2M4I A;  2L7I A;  2EP3 A;  1ORY B;  1UBD C;  3JU0 A;  1TH3 A;  2Y20 A;  5KL3 A;  2HKJ A;  4B7F A;  2H1R A;  2DXN A;  3KFU G;  3QFM A;  3GVE A;  2HCB A;  4MOY A;  4ZX2 A;  2C5R A;  4H1S A;  2C96 A;  1HQC A;  2IE4 C;  2UUC E;  4DV5 E;  4LGY A;  3ADJ A;  4UWQ A;  2LXE A;  1IBL E;  2EOM A;  4L78 A;  2FOI C;  4DV4 M;  3F6G A;  3FTE A;  3HHY A;  1MGT A;  3IVD A;  1E9S A;  2DAM A;  4QHT A;  1GLN A;  3U6S A;  2WZO A;  3SMP A;  4H1Y P;  3JTZ A;  1DGH A;  4JXJ A;  4X64 E;  4ZYE A;  2L2K B;  1XZW A;  1I94 M;  5JPF A;  3ILK A;  4F2L A;  2YU8 A;  4R7G A;  2L4E A;  2VII A;  3ADG A;  2EPZ A;  3U61 A;  4DR3 E;  4DSY A;  2C9O A;  5KPT A;  3FTF A;  3DOA A;  2G3Q A;  4FW9 A;  2CV2 A;  4AI6 A;  3H64 A;  4F9C B;  1IN4 A;  2YTG A;  4N4R B;  4F6M A;  5AE2 A;  2JZ0 A;  1QYR A;  3HX3 A;  4LJ9 A;  2JA2 A;  1QUT A;  2ZM6 E;  2XZU A;  1K3W A;  3GLF A;  2QQ8 A;  1HR0 E;  1R5L A;  2ZO9 B;  1X37 A;  2A5Y B;  3J2P B;  2UUC M;  4DV5 M;  4JYA E;  3T1H E;  3KVW A;  2MH8 A;  1IBL M;  2EUC A;  1G8P A;  4RKU F;  2CTD A;  2BWE A;  2DAK A;  2DXI A;  4X65 E;  1HNW E;  4IBF A;  3E4R A;  5DFL A;  3LVV A;  4G9J A;  4B3S M;  4V0X A;  4X64 M;  4DR5 E;  2FGG A;  3FUT A;  5A6B D;  4LTY A;  1T71 A;  4DR3 M;  1IXS B;  3TE6 A;  2O25 A;  4BC7 A;  3C3E A;  4F1I A;  2ZAM A;  4KHP E;  2V89 A;  5KPR A;  1QAM A;  3VLF B;  3FUX A;  3GRR A;  2K47 A;  1W24 A;  1XXH A;  2BJV A;  2ZM6 M;  1QAN A;  1XC8 A;  1J09 A;  3U6D A;  4J8Z A;  4K0K E;  3EPJ A;  4FBQ A;  1HR0 M;  1X49 A;  3PNV A;  1UIL A;  4WXC A;  4R3D A;  1PDA A;  2QZ4 A;  3DF6 A;  4JYA M;  3T1H M;  4G4O A;  2DFJ A;  4IBD A;  2EMB A;  3H66 A;  1ZMU A;  4X65 M;  1HNW M;  2Q2E B;  2EPA A;  4HEI A;  5FTJ A;  2R4J A;  4L8R C;  3AKZ A;  4DKK A;  3DSC A;  3K1J A;  5FTK A;  2R44 A;  4DR5 M;  2EPK X;  2CPN A;  3U6P A;  4M30 A;  2Z72 A;  4JI3 E;  2EN4 A;  2R76 A;  2DEN A;  2L7H A;  3GQ5 A;  1IMU A;  3K8Z A;  4LF8 E;  2EM2 A;  2AHM A;  4X62 E;  3IG5 A;  2E1M A;  2YSP A;  4LZZ A;  1KFV A;  4KHP M;  3VYX A;  3SC3 A;  1PJS A;  2CUZ A;  1QAQ A;  2B7T A;  2Z7J A;  2BWB A;  4GHA A;  2EOO A;  5EXT A;  1STU A;  2DKL A;  3ECR A;  2EN3 A;  4Z8X A;  1EH6 A;  1L2D A;  3FTD A;  1EH7 A;  2MKN A;  2IAE C;  1V92 A;  2JYA A;  2YRK A;  4LJ6 A;  3W0F A;  2YTQ A;  1FJG E;  2RS6 A;  1OKS A;  2CWB A;  1DGG A;  4CHT B;  1XHB A;  2YRM A;  1YPN A;  2ODR C;  1KJK A;  3KOX E;  5IV8 B;  2RQL A;  2YTN A;  4WFT A;  2L4F A;  2DAE A;  2FNA A;  2E72 A;  1XXH E;  1G3I A;  2RGH A;  5IT9 S;  2MKD A;  1X47 A;  5C1V A;  5KPZ A;  1B69 A;  4H2B A;  4ORC A;  2X49 A;  1IN5 A;  4LF8 M;  1E94 E;  1OQY A;  2EL6 A;  4X62 M;  1T4L B;  1D0K A;  2GQF A;  4P17 A;  1J7K A;  1IN7 A;  3FE3 A;  3EQ1 A;  2EPN A;  4R2R A;  3M6A A;  4MM3 B;  3HU1 A;  1Q39 A;  1IT6 A;  4TUG A;  2EN2 A;  4NC6 A;  4HL4 A;  2MDR A;  4I5N C;  4OR9 A;  1N32 E;  2L09 A;  4LRS A;  2EMF A;  4TUW A;  1RC7 A;  2NUG A;  4HEO A;  4F9B B;  4AKG A;  2CV0 A;  1QZE A;  2LO3 A;  2HGH A;  4CIZ A;  4XPN A;  3FUU A;  4OVZ A;  2EML A;  2ZBM A;  3C9P A;  1FJG M;  3EPK A;  1V34 A;  5A2Q S;  1WHN A;  4BHB A;  1DO2 A;  1A1J A;  2K4V A;  4LGM A;  2B7V A;  4Z6Y A;  1YFH A;  3L00 A;  2Z1A A;  2LVO C;  3LLH A;  4UT3 B;  2YTI A;  2LUQ A;  3KOW E;  2M1S A;  1Q3B A;  2YU5 A;  2FFJ A;  1BVS A;  2XF3 A;  4M0V A;  3H4M A;  4MGH A;  3M99 B;  1ZQ9 A;  4S12 A;  2E5L E;  3HQ1 A;  4NRW A;  2M9A A;  3C9F A;  3H4J A;  3U6C A;  1A1K A;  4B3M E;  3J27 B;  4RHB B;  2EMW A;  2FV4 B;  2VF8 A;  3ZQJ A;  2EPR A;  2YVT A;  1N32 M;  5BPV A;  4BBY A;  2EKF A;  2YT4 A;  1TTE A;  1W5S A;  2JR1 A;  2EA0 A;  2YTJ A;  3GLG B;  3QYB A;  2EMH A;  4IJD A;  4JA9 A;  1HT2 E;  3VKH A;  1NHW C;  1X5W A;  4WXD A;  2KON A;  3H62 B;  4FCX A;  2LBC A;  2EMZ A;  1OID A;  3EGG A;  4M9Z A;  4FK5 C;  2R0I A;  3RE8 A;  5AE1 A;  4NZV A;  1NVM A;  2O5R A;  2EM0 A;  3T38 A;  2EOQ A;  1IN8 A;  2HJJ A;  1JR3 A;  3SHF A;  2CP8 A;  3MSW A;  3E46 A;  2RSI A;  4NSR A;  1A1L A;  1IBM E;  3HHW A;  2E5L M;  5ITR A;  1W5T A;  3ZTV A;  4L15 A;  4B7G A;  4GEQ B;  2M60 A;  3JR5 A;  4B3M M;  2JY7 A;  4D82 A;  4WSP A;  3J7A S;  4LJ8 A;  2N3G A;  5AAS A;  4NSO B;  4BC9 A;  2LBS B;  2YFQ A;  1TN9 A;  3VK6 A;  1XMO E;  5JI3 E;  3LCU A;  4GEW A;  2EE8 A;  4J6O A;  5LMN E;  3HTX A;  1DV0 A;  4LF6 E;  4L5N C;  1H6U A;  3HVQ A;  3BID A;  1ZR9 A;  2A22 A;  5AC5 A;  4JI1 E;  1SXJ E;  3IB8 A;  1PRB A;  2DHR A;  3U60 A;  4LFA E;  2K9D A;  4LRT A;  4AZF A;  2EMI A;  2VE7 C;  3BBG A;  4X9J A;  4DV0 E;  1PJI A;  2YTE A;  4R03 A;  5KL4 A;  1NSF A;  5ITQ A;  3RL3 A;  4I81 A;  2KHX A;  4DV7 E;  1IBM M;  4ZPX A;  4FVM A;  1ZU1 A;  1JB0 F;  4F9A B;  1WGL A;  2BDX A;  2R17 A;  2VQF E;  2EN1 A;  1QNT A;  3OTO M;  4M9V C;  5JPE A;  2L33 A;  2WBS A;  2EMA A;  1BB8 A;  2Y0Q A;  2XH9 A;  1XMO M;  3MHV C;  2IHR 1;  2R4E A;  2YSO A;  1YUI A;  2UUB E;  4GKJ E;  1JR3 E;  5LMN M;  2B9D A;  2V86 A;  2HYP A;  4LF6 M;  1ZV1 A;  3KSX A;  3L29 A;  1NCS A;  2F5O A;  4JI1 M;  1AUI A;  1BBG A;  4ZYG A;  2Z3X A;  4LFA M;  4QOS A;  1DGB A;  3UK3 C;  3KW6 A;  2GNO A;  4D81 A;  4LF4 E;  2ZOA A;  1GAB A;  3NBI A;  2DWL A;  2GPI A;  2EM7 A;  2CHG A;  2ADR A;  3PXG A;  2JP9 A;  1S3N A;  2DNA A;  2LVP C;  2CV1 A;  2R46 A;  1R6B X;  3B7N A;  5ITU A;  3M7G A;  2MDG A;  2BJW A;  2DMY A;  3W68 A;  2EOE A;  3IWB A;  3RGP A;  1IY1 A;  1SXJ D;  1JK7 A;  2NPP C;  5J28 A;  2ZBK B;  1DGC A;  1HT1 E;  2YPN A;  1TF6 A;  2EM3 A;  5FTL A;  2DGC A;  4UT2 A;  4B08 A;  2NA2 A;  2YTF A;  4L6V 6;  1MEY C;  1Y8G A;  1L1T A;  1SR9 A;  2UUB M;  1J26 A;  2BCD A;  4MGZ E;  2L6M A;  1YSA C;  4QNR A;  5HPE A;  3EPH A;  2L2M A;  1NJG A;  2EPX A;  4BS9 A;  4DR2 E;  3DFZ A;  2XFT A;  1XWI A;  4IBC A;  3FD9 A;  4H2I A;  2EOH A;  1NY6 A;  2DSY A;  2LE2 A;  4LF4 M;  7CAT A;  1GKI A;  2DZN B;  3Q8G A;  2EOS A;  4IBK A;  1SG9 A;  1QVR A;  1JK1 A;  2LTU A;  3A45 A;  4LZJ A;  4Q7J A;  1NNU C;  1JR3 D;  2JY6 B;  5FSW A;  3I4Y A;  4V0V A;  2DXL A;  4DV3 E;  4P7D A;  1XNR E;  5DYI A;  1RQ0 A;  2DB2 A;  2R45 A;  1GL6 A;  1G2D C;  2EN7 A;  1VEJ A;  3KBP A;  1IQO A;  2HAK A;  2JUJ A;  1WR1 B;  2BBG A;  4ZYH A;  3GLI B;  3J7Y p;  4H2F A;  3A42 A;  1XNQ E;  2MJ5 B;  1XMQ E;  2ELY A;  4LJA A;  4IBB A;  3HU2 A;  3TQS A;  2N8X A;  2ZTD A;  4GIP A;  1ZMV A;  4B3S E;  4R2E A;  4AW4 A;  4DR2 M;  2EOI A;  3GQ4 A;  4UT3 A;  4NL4 H;  2R18 A;  3BXW A;  4B3T E;  5EXP A;  3L25 A;  2WSF F;  1XM7 A;  4LY6 A;  1S8E A;  3C58 A;  3D8L A;  1G71 A;  1DI2 A;  4DHL A;  2CT1 A;  2LVQ D;  4NRV A;  4KBP A;  4GZN C;  1N34 E;  3PSO A;  2RGO A;  4DV3 M;  1XNR M;  4D80 A;  5CFF E;  2EQ1 A;  2UU9 E;  5FTN A;  2L8T A;  1FJM A;  5F3W A;  2EM8 A;  3ZU0 A;  2KNA A;  3AOE A;  2RSM A;  3HGI A;  5FLX S;  3ICF A;  3U6E A;  4WW0 A;  4RF0 A;  3GLH E;  2EOR A;  1IY2 A;  4GIT A;  3C5W C;  2OOB A;  1XNQ M;  2AHD A;  3JAM S;  1T6O A;  1XMQ M;  4PDG A;  3AOG A;  2XLJ A;  2EQ3 A;  2EM5 A;  3U6M A;  4DR4 E;  2RPC A;  1GJT A;  5ITX A;  1K82 A;  2LHC A;  1QAO A;  3SAT A;  4B3T M;  1PKP A;  2WZJ A;  2EN8 A;  1VG5 A;  4FWG A;  1NY5 A;  2MR9 A;  2USH A;  4PDI A;  2UXB E;  2MC6 A;  2LJU A;  4AG5 A;  4AKH A;  5EXS A;  2DRP A;  1QU6 A;  1OAO C;  5KL7 A;  4JI5 E;  4M0W A;  3LQR A;  1N34 M;  2Q8U A;  4KLN A;  2UU9 M;  4M0D A;  1UM8 A;  5LLQ A;  3FRI A;  4FWD A;  5FTM A;  3T6P A;  4OU7 A;  5GKN A;  1S3M A;  2DI0 A;  5LL6 R;  1NNJ A;  4YHH E;  2X4A A;  2FTX B;  2CSH A;  2EOF A;  2D9H A;  2JXN A;  4DR4 M;  3PNY A;  4Q35 B;  4NXN E;  2C98 A;  1YUB A;  2YTD A;  1N75 A;  2QFR A;  2N35 A;  2LCE A;  2NAB A;  1NJF A;  1PJQ A;  3A46 A;  1GL7 A;  3GLF E;  3CGW A;  5KO3 A;  3UJN A;  2UXB M;  1DGF A;  3VFD A;  1VDL A;  1EH8 A;  3AUZ A;  4FD2 A;  4LFB E;  2Z4R A;  4JI5 M;  2EOX A;  3T15 A;  4FWH A;  2M7Q A;  4F54 A;  1IM2 A;  2F8B A;  1V73 A;  2XZF A;  5ITX E;  1OFI A;  4WP2 A;  2MC5 A;  2DMI A;  1T3T A;  4MLV A;  2F5N A;  1N3G A;  3LQQ A;  4YHH M;  1OAI A;  1QHW A;  1C7Y A;  4MGI E;  3KZZ A;  4AQY E;  2FS1 A;  4PT5 A;  4NXN M;  2JOX A;  3HJQ A;  1S3S A;  2QJC A;  4G4R A;  3C4T A;  4R2C A;  1YUJ A;  2KXE A;  3EPL A;  3J80 S;  4UN2 B;  3P71 C;  3MJ5 A;  2D7H A;  1NHG C;  2BNK A;  1TF0 B;  1PJJ A;  2EN6 A;  1HPU A;  4M9X A;  1L8Q A;  1L1Z A;  4LF5 E;  4KO8 A;  1L2C A;  4BHC A;  2ZTC A;  3J81 S;  5EP1 A;  4LFB M;  3AJI B;  1TGU A;  1EIJ A;  2MRO B;  4LF7 E;  2WBU A;  1WHQ A;  2YTO A;  4XBO A;  1ZBT A;  2WDD A;  3SAW A;  2JY8 A;  3E21 A;  2HHH E;  1QZM A;  4FBK A;  5EQT A;  2LVH A;  1WIV A;  2JOG A;  4DR6 E;  4JA7 A;  2EM9 A;  2L3J A;  1NNW A;  1UF3 A;  3P1X A;  4MGK E;  2EPC A;  4REZ A;  3HPZ A;  5IOH A;  4AQY M;  4V0W A;  2DIX A;  3J7A G;  1VEK A;  2EL4 A;  2LTS A;  2JY5 A;  3THO B;  1A1H A;  1AUA A;  1OJL A;  4JI2 E;  4HTG A;  1X6H A;  3H67 A;  4IBG A;  4DMI A;  1HNX E;  3SYK A;  2V88 A;  3MMP A;  1Q3C A;  4IL1 A;  4LAC C;  3E9S A;  2OOA A;  4LF5 M;  3K7V C;  2B3T B;  2QFP A;  2R6F A;  4X8W A;  1ZMW A;  4BMJ A;  5EXX A;  3DSD A;  4GRI A;  4Q28 A;  3FTC A;  2ENA A;  4LF7 M;  2DWM A;  4AKI A;  3HHX A;  3GLI A;  3I4V A;  1NV8 A;  3WHK A;  1JQJ C;  2WDE A;  2KEB A;  2NXF A;  5EQV A;  3VDP A;  2HHH M;  2APL A;  2I13 A;  1SU1 A;  1Q02 A;  3KOY E;  2V1U A;  4DR6 M;  3V4Y A;  4FCT A;  2DVW B;  4DR7 E;  4IYP C;  2VF7 A;  1IXZ A;  5T6J A;  2EQ0 A;  3LW5 F;  4NXM E;  1ZAA C;  4B3R E;  3NWL A;  3HXL A;  4QHS A;  2Z8Y M;  3QFK A;  2QNJ A;  4JI2 M;  3PFI A;  3DJW A;  2O8G A;  3RGS A;  4XGI A;  3DW8 C;  3ZH9 B;  4B2O A;  1Z2X A;  4O5G A;  4IIW A;  5JJT A;  1HNX M;  3GPY A;  1YLA A;  3I51 A;  1KYQ A;  2DAG A;  4KWY A;  5H37 D;  2EPP A;  1MX0 A;  2EWL A;  1M63 A;  2LNH C;  2F5P A;  3OTO E;  2KRU A;  3GRU A;  4WPY A;  3TGH A;  2CRU A;  3LL8 A;  2GHF A;  5IRE B;  3U5Z B;  4O4K A;  2UUA E;  3ZC7 B;  4OX9 E;  1HNZ E;  3GRY A;  4GKK E;  3VK8 A;  1IBK E;  3HY5 A;  4DR7 M;  5KL5 A;  3GP1 A;  3H61 A;  3J7B A;  3GPP A;  1XXH B;  5E6J A;  4HD0 A;  2ENC A;  4MH0 E;  2LHG A;  3K2L A;  4NXM M;  2EMG A;  4B3R M;  3UK6 A;  3DA1 A;  2I9I A;  1HP1 A;  4R2S A;  1E32 A;  3K92 A;  1IXS A;  3FLO A;  2UXC E;  2GLI A;  3C6M A;  3QFO A;  1PM5 A;  3CF6 E;  2A25 A;  3R8F A;  4G3O A;  3K9O A;  1OTR A;  4ZYD A;  4G4N A;  1GVN A;  2G8L A;  2LTR A;  3U6L A;  2K7I A;  2N3H A;  3U6O A;  3SBJ A;  1X48 A;  1ZAE A;  3BGH A;  2EOY A;  2UUA M;  1A1F A;  1D0M A;  1YE9 A;  4R2D A;  3TWL A;  3RQZ A;  4OX9 M;  1HNZ M;  2V8Q B;  1TF3 A;  1L4S A;  4I5L C;  4GKK M;  2NUF A;  1IBK M;  3SMS A;  1CUK A;  3CK2 A;  3TL4 X;  2O8A A;  4CJ6 A;  3KP1 E;  1TDZ A;  2JNH A;  3SHG B;  4ZVZ A;  4IBE A;  4R2P A;  2X8A A;  4WSG A;  4ANR A;  5C1B A;  4LU9 A;  3EGH A;  1WRJ A;  1TDH A;  1GO5 A;  1R7R A;  3HZJ A;  1USH A;  3ADI A;  3IVE A;  2YRH A;  3PVS A;  2XSZ A;  2UXC M;  3K6Q A;  2EMK A;  3IEC A;  4YKE A;  2BQ8 X;  2V83 A;  1BBO A;  1QQW A;  2CHV A;  2BB8 A;  4GC9 A;  4Y28 F;  1A1G A;  3R9X B;  2DWZ B;  2CEA A;  3JYF A;  1O0W A;  2HYO A;  3CF2 A;  5DYG A;  3W0L B;  5A6J A;  2NUE A;  4X66 E;  1QFC A;  3SAS A;  3ADL A;  2EMX A;  2JOB A;  1EE8 A;  4FBW A;  5EP3 A;  2EKK A;  3H09 A;  2L3C A;  3SAV A;  3A98 B;  2G5G X;  4I4L A;  2EPM X;  2YZT A;  3KDS E;  3V76 A;  3BOS A;  4DUY E;  2YWQ A;  1MU5 A;  1AAY A;  2WDF A;  2D7G A;  2F5S A;  1WAR A;  4OW0 A;  1PJT A;  1SXJ C;  2Z4S A;  2JP7 A;  2QSF X;  4R2A A;  2P5T A;  3RL5 A;  3E7A A;  4KOD A;  2ENH A;  2DLQ A;  4O24 A;  2ELZ A;  1N78 A;  2LWX A;  3L26 A;  1T4O A;  3KP0 E;  2EPL X;  1R2Y A;  2CFO A;  2HY1 A;  5KL2 A;  4OOG C;  2YEQ A;  4LG2 A;  1P3Q Q;  4BCA A;  3HWS A;  1LTM A;  3HJS A;  5AE3 A;  3HJ8 A;  2QHO B;  2EOJ A;  2DWN A;  3KS8 A;  2L2D A;  1S3L A;  2XGN A;  1N33 M;  4X66 M;  1SXJ B;  1RMD A;  4DUZ E;  2RTX A;  2C9C A;  4MLQ A;  4LFC M;  2CHQ A;  2J5Y A;  3H63 A;  4XK8 F;  1UFZ A;  2OQ4 A;  1OIE A;  1Z5B A;  3EIH A;  2HC5 A;  1C1K A;  3TWK A;  2ZAO A;  4DUY M;  3GPX A;  5L8R F;  3QAU A;  3UGJ A;  4JI4 E;  4RNA A;  4PD2 A;  3D8B A;  2O01 F;  3IG8 A;  2WCC 3;  1Z1B A;  1PGY A;  1FNN A;  5A69 A;  3LVW A;  3CF0 A;  3THG A;  2KHH A;  4R2Q A;  3U6Q A;  2G7H A;  4FCV A;  3FRH A;  2B3T A;  1WXR A;  3F6H A;  5GTU A;  2KNV A;  4RH8 A;  4H2G A;  4LJ7 A;  5IZ7 D;  2XMO A;  4IJF A;  4L16 A;  2DZL A;  4DR1 M; 
#chains in the Genus database with same CATH homology
 2JVA A;  1YZ9 A;  3GLG A;  2ZAN A;  2LJH A;  3KWR A;  3L27 A;  1II7 A;  2JWO A;  2KRK A;  4DUZ M;  4IJE A;  2UXD E;  1KBP A;  3QFN A;  1WXQ A;  1N77 A;  3H60 A;  4JN6 A;  4LF9 E;  4JV5 E;  4M9S A;  3RMP A;  4JI4 M;  3B9P A;  2V6Z M;  1HQY E;  5LMU E;  4DT2 A;  2W82 A;  2XSZ D;  2LUP B;  3U60 B;  1Z6T A;  1OI8 A;  1T70 A;  4I8O A;  2J7N A;  5IWA E;  2QBY B;  2CV9 A;  2R62 A;  1I4W A;  3GRV A;  3U5Z A;  1R2Z A;  4NOO B;  4P16 A;  1IXR C;  4JI6 E;  4GMQ A;  3CTW B;  1U32 A;  2QEN A;  2EO2 A;  3SAR A;  2Z06 A;  4ORB A;  2IE3 C;  1DO0 A;  2UXD M;  3C4B A;  5ITT A;  1IY0 A;  2LH0 A;  4MB7 A;  1E9R A;  4LF9 M;  1G59 A;  3QWL A;  4JV5 M;  4KKZ A;  2D7E A;  3QG5 C;  1YYW A;  4L8N A;  5LMU M;  2LRS A;  3D03 A;  4PCZ A;  2VQE E;  3FKE A;  4O43 A;  1UHZ A;  4DV6 E;  4MOV A;  5ADZ A;  5IWA M;  4ORA A;  2NYM C;  2ODR D;  4JI6 M;  1TCO A;  4LJ5 A;  2HL7 A;  3HPS A;  4RF1 A;  5FLX C;  3HHZ A;  1KYI A;  5EP2 A;  3L28 A;  4K0K M;  4I5S A;  4LJ4 A;  4LCB A;  3T1I A;  2KA6 B;  1J5E E;  3AL0 C;  3JAM C;  1DQ3 A;  3WHL A;  5JI2 E;  3N5U A;  3FYC A;  1ZBQ A;  3OML A;  4YY3 E;  5EJC A;  1FKA E;  2VQE M;  3JR4 A;  2F5Q A;  4QNM A;  3M0E A;  4DV6 M;  3AV0 A;  2XFS A;  4JI3 M;  3GLH B;  2P6B A;  4WWL A;  3KXE C;  5INB A;  4G6Z A;  4JI0 E;  3PSN A;  1TH4 A;  3ZCB B;  4B7H A;  2GJU A;  4GC5 A;  8CAT A;  3FUV A;  4HLQ A;  3GQ3 A;  3GO8 A;  3HU3 A;  3E0J A;  1K3X A;  5EP4 A;  2QCU A;  4MGY E;  1J5E M;  2JY9 A;  1LV7 A;  2XEP A;  2F4V E;  2QP9 X;  1N36 E;  5E26 A;  2I7P A;  3SYL A;  3AOE C;  4YY3 M;  1EKZ A;  1G41 A;  4R8O A;  4ITQ A;  2KW0 A;  1DGH B;  4AG6 A;  3IWD A;  4L4U A;  3IWC A;  3UZU A;  3U61 B;  1TH2 A;  3FYD A;  2V87 A;  4JI0 M;  3FGA C;  2LMZ A;  3THN A;  1S95 A;  1Z59 A;  1SXJ A;  2RKO A;  3HKP A;  1D2N A;  2YR0 A;  2EZ6 A;  1MF8 A;  2L2N A;  3EIE A;  3GLF B;  2I7N A;  4Q7F A;  1GQE A;  3FUW A;  3TPZ A;  2NYL C;  1YYO A;  2V85 A;  5KQD A;  2F4V M;  1S70 A;  1N36 M;  3GPU A;  3H69 A;  2V1C A;  3VKG A;  5B8I A;  3J80 C;  5IT9 C;  2KOU A;  1IQP A;  3T1Y E;  4JI8 E;  4JI7 E;  4MP0 A;  1G5B A;  4P78 A;  3J81 C;  4CIS A;  1T4N A;  4IBI A;  3KOZ E;  2L6O A;  1WAO 1;  3AFH A;  4TUI A;  4G4Q A;  3VYY A;  5A2Q C;  2M5Z A;  4FCW A;  4II7 A;  3SFZ A;  2WDC A;  4BBA A;  2YQZ A;  2QBY A;  1Z5C A;  2FE8 A;  4W5W A;  3T1Y M;  2DZO B;  2J7O A;  4M2Z A;  4EIW A;  4IBJ A;  2NQ8 C;  4JI8 M;  2KZS A;  4JI7 M;  1G4A E;  2C99 A;  4GHL A;  3VK7 A;  1IN6 A;  5BR8 E;  4GH9 A;  4DV2 E;  3UMM A;  4DV1 E;  1GZ6 A;  3RFW A;  1Z5A A;  2ERC A;  2RS7 A;  4BLC A;  2R65 A;  5KQ8 A;  3SAU A;  3E7B A;  4F0Z A;  3FIG A;  3IB7 A;  2CE7 A;  5C18 A;  2QPA A;  2OPF A;  4DV0 M;  4QOZ C;  1VDD A;  2KZU A;  3H68 A;  2VF1 A;  3KSJ A;  1N33 E;  3LML A;  3ZOQ B;  4DV7 M;  4A3V B;  3RL4 A;  2Y21 A;  2KKN A;  3L2A A;  1HO5 A;  1Z2W A;  4LFC E;  2L92 A;  4WUR A;  5ITY A;  2VQF M;  1L2B A;  5BR8 M;  4DV2 M;  4DV1 M;  3MK6 A;  3TWM A;  3K7W C;  3VDU A;  2H36 X;  2Y0T A;  1UTE A;  3KS4 A;  4DV4 E;  4GKJ M;  3LMM A;  4OVZ B;  4KZS A;  1KSF X;  1YYK A;  5DNY A;  4BB9 A;  1I94 E;  3Q8X A;  3GLH A;  2YNM D;  1OFH A;  4DR1 E;  3DZD A;  4WYQ B;  1YSY A;  4CGY B;  2M4I A;  2L7I A;  1ORY B;  3JU0 A;  1TH3 A;  2Y20 A;  2HKJ A;  4B7F A;  2H1R A;  2DXN A;  3KFU G;  3QFM A;  3GVE A;  2HCB A;  4MOY A;  4ZX2 A;  2C5R A;  4H1S A;  2C96 A;  1HQC A;  2IE4 C;  2UUC E;  4DV5 E;  4LGY A;  3ADJ A;  4UWQ A;  2LXE A;  1IBL E;  4L78 A;  2FOI C;  4DV4 M;  3F6G A;  3FTE A;  3HHY A;  3IVD A;  1E9S A;  4QHT A;  1GLN A;  3U6S A;  2WZO A;  3SMP A;  4H1Y P;  3JTZ A;  1DGH A;  4JXJ A;  4X64 E;  2L2K B;  1XZW A;  1I94 M;  5JPF A;  3ILK A;  4R7G A;  2VII A;  3ADG A;  3U61 A;  4DR3 E;  4DSY A;  2C9O A;  5KPT A;  3FTF A;  3DOA A;  4FW9 A;  2CV2 A;  4AI6 A;  3H64 A;  4F9C B;  1IN4 A;  5AE2 A;  1QYR A;  4LJ9 A;  2JA2 A;  2ZM6 E;  2XZU A;  1K3W A;  3GLF A;  1HR0 E;  2ZO9 B;  1X37 A;  2A5Y B;  3J2P B;  2UUC M;  4DV5 M;  4JYA E;  3T1H E;  3KVW A;  1IBL M;  2EUC A;  1G8P A;  2DXI A;  4X65 E;  1HNW E;  4IBF A;  3E4R A;  3LVV A;  4G9J A;  4B3S M;  4V0X A;  4X64 M;  4DR5 E;  2FGG A;  3FUT A;  4LTY A;  1T71 A;  4DR3 M;  1IXS B;  3TE6 A;  4BC7 A;  2ZAM A;  4KHP E;  2V89 A;  5KPR A;  1QAM A;  3VLF B;  3FUX A;  3GRR A;  2K47 A;  1W24 A;  1XXH A;  2BJV A;  2ZM6 M;  1QAN A;  1XC8 A;  1J09 A;  3U6D A;  4J8Z A;  4K0K E;  4FBQ A;  1HR0 M;  1X49 A;  3PNV A;  1UIL A;  4R3D A;  2QZ4 A;  3DF6 A;  4JYA M;  3T1H M;  4G4O A;  2DFJ A;  4IBD A;  3H66 A;  4X65 M;  1HNW M;  2Q2E B;  5FTJ A;  2R4J A;  4L8R C;  3AKZ A;  4DKK A;  3DSC A;  3K1J A;  5FTK A;  4DR5 M;  2CPN A;  3U6P A;  4M30 A;  2Z72 A;  4JI3 E;  2L7H A;  3GQ5 A;  3K8Z A;  4LF8 E;  2AHM A;  4X62 E;  3IG5 A;  2E1M A;  4LZZ A;  1KFV A;  4KHP M;  3VYX A;  3SC3 A;  1QAQ A;  2CUZ A;  2B7T A;  2Z7J A;  4GHA A;  5EXT A;  1STU A;  4Z8X A;  1L2D A;  3FTD A;  2IAE C;  4LJ6 A;  3W0F A;  1FJG E;  2RS6 A;  1DGG A;  4CHT B;  1XHB A;  2ODR C;  3KOX E;  4WFT A;  2FNA A;  1G3I A;  2RGH A;  5IT9 S;  1X47 A;  5C1V A;  5KPZ A;  4H2B A;  4ORC A;  2X49 A;  1IN5 A;  4LF8 M;  1E94 E;  4X62 M;  1T4L B;  1J7K A;  1IN7 A;  3M6A A;  4MM3 B;  3HU1 A;  1Q39 A;  1IT6 A;  4TUG A;  4HL4 A;  2MDR A;  4I5N C;  4OR9 A;  1N32 E;  2L09 A;  4LRS A;  4TUW A;  1RC7 A;  2NUG A;  4F9B B;  4AKG A;  2CV0 A;  4XPN A;  3FUU A;  4OVZ A;  2ZBM A;  1FJG M;  5A2Q S;  1WHN A;  1DO2 A;  2K4V A;  4LGM A;  2B7V A;  4Z6Y A;  2Z1A A;  3LLH A;  4UT3 B;  2LUQ A;  3KOW E;  2M1S A;  1Q3B A;  2FFJ A;  2XF3 A;  4M0V A;  3H4M A;  4MGH A;  1ZQ9 A;  4S12 A;  2E5L E;  3HQ1 A;  4NRW A;  3C9F A;  3U6C A;  4B3M E;  3J27 B;  2FV4 B;  2YVT A;  1N32 M;  5BPV A;  4BBY A;  2YT4 A;  1W5S A;  2JR1 A;  2EA0 A;  3GLG B;  4JA9 A;  1HT2 E;  3VKH A;  1NHW C;  2KON A;  3H62 B;  4FCX A;  1OID A;  3EGG A;  4M9Z A;  3RE8 A;  5AE1 A;  4NZV A;  1NVM A;  2O5R A;  3T38 A;  1IN8 A;  1JR3 A;  3SHF A;  3MSW A;  4NSR A;  1IBM E;  3HHW A;  2E5L M;  5ITR A;  1W5T A;  3ZTV A;  4L15 A;  4B7G A;  4GEQ B;  2M60 A;  3JR5 A;  4B3M M;  4D82 A;  4WSP A;  3J7A S;  4LJ8 A;  2N3G A;  5AAS A;  4NSO B;  4BC9 A;  2LBS B;  2YFQ A;  3VK6 A;  1XMO E;  5JI3 E;  4J6O A;  5LMN E;  3HTX A;  4LF6 E;  4L5N C;  1H6U A;  3HVQ A;  2A22 A;  4JI1 E;  1SXJ E;  3IB8 A;  2DHR A;  3U60 A;  4LFA E;  4LRT A;  4AZF A;  2VE7 C;  4DV0 E;  1PJI A;  4R03 A;  1NSF A;  5ITQ A;  3RL3 A;  4I81 A;  2KHX A;  4DV7 E;  1IBM M;  4ZPX A;  4FVM A;  4F9A B;  2BDX A;  2R17 A;  2VQF E;  3OTO M;  5JPE A;  2L33 A;  2Y0Q A;  2XH9 A;  1XMO M;  3MHV C;  2IHR 1;  2R4E A;  2UUB E;  4GKJ E;  5LMN M;  2B9D A;  2V86 A;  2HYP A;  4LF6 M;  3KSX A;  3L29 A;  2F5O A;  4JI1 M;  1AUI A;  2Z3X A;  4LFA M;  4QOS A;  1DGB A;  3KW6 A;  4D81 A;  4LF4 E;  2ZOA A;  3NBI A;  2DWL A;  2CHG A;  3PXG A;  1S3N A;  2CV1 A;  2R46 A;  1R6B X;  5ITU A;  3M7G A;  2BJW A;  2DMY A;  3IWB A;  3RGP A;  1IY1 A;  1SXJ D;  1JK7 A;  2NPP C;  5J28 A;  2ZBK B;  1HT1 E;  5FTL A;  4UT2 A;  4B08 A;  2NA2 A;  1L1T A;  1SR9 A;  2UUB M;  1J26 A;  2BCD A;  4MGZ E;  2L6M A;  4QNR A;  5HPE A;  2L2M A;  1NJG A;  4BS9 A;  4DR2 E;  3DFZ A;  2XFT A;  1XWI A;  4IBC A;  3FD9 A;  4H2I A;  1NY6 A;  2DSY A;  2LE2 A;  4LF4 M;  7CAT A;  1GKI A;  2DZN B;  4IBK A;  1QVR A;  3A45 A;  4LZJ A;  1NNU C;  1JR3 D;  5FSW A;  3I4Y A;  4V0V A;  2DXL A;  4DV3 E;  4P7D A;  1XNR E;  5DYI A;  1RQ0 A;  2DB2 A;  2R45 A;  1GL6 A;  3KBP A;  3GLI B;  3J7Y p;  4H2F A;  3A42 A;  1XNQ E;  1XMQ E;  4LJA A;  4IBB A;  3HU2 A;  3TQS A;  4GIP A;  4B3S E;  4AW4 A;  4DR2 M;  3GQ4 A;  4UT3 A;  4NL4 H;  2R18 A;  4B3T E;  5EXP A;  3L25 A;  1XM7 A;  4LY6 A;  1S8E A;  3C58 A;  3D8L A;  1DI2 A;  4DHL A;  4NRV A;  4KBP A;  1N34 E;  3PSO A;  2RGO A;  4DV3 M;  1XNR M;  4D80 A;  5CFF E;  2UU9 E;  5FTN A;  2L8T A;  1FJM A;  5F3W A;  3ZU0 A;  3AOE A;  2RSM A;  3HGI A;  5FLX S;  3ICF A;  3U6E A;  4WW0 A;  4RF0 A;  1IY2 A;  4GIT A;  3C5W C;  1XNQ M;  2AHD A;  3JAM S;  1XMQ M;  4PDG A;  3AOG A;  2XLJ A;  3U6M A;  4DR4 E;  5ITX A;  1K82 A;  1QAO A;  3SAT A;  4B3T M;  1PKP A;  4FWG A;  1NY5 A;  2USH A;  4PDI A;  2UXB E;  2MC6 A;  4AKH A;  4AG5 A;  5EXS A;  1QU6 A;  4JI5 E;  4M0W A;  3LQR A;  1N34 M;  2Q8U A;  4KLN A;  2UU9 M;  4M0D A;  1UM8 A;  4FWD A;  5FTM A;  4OU7 A;  5GKN A;  1S3M A;  5LL6 R;  1NNJ A;  4YHH E;  2X4A A;  2FTX B;  4DR4 M;  3PNY A;  4NXN E;  2C98 A;  1YUB A;  1N75 A;  2QFR A;  1NJF A;  3A46 A;  1GL7 A;  5KO3 A;  3UJN A;  2UXB M;  1DGF A;  3VFD A;  3AUZ A;  4FD2 A;  4LFB E;  2Z4R A;  4JI5 M;  3T15 A;  4FWH A;  2M7Q A;  4F54 A;  1IM2 A;  2F8B A;  1V73 A;  2XZF A;  5ITX E;  1OFI A;  2MC5 A;  1T3T A;  2F5N A;  3LQQ A;  4YHH M;  1QHW A;  4MGI E;  4AQY E;  4PT5 A;  4NXN M;  2JOX A;  3HJQ A;  1S3S A;  2QJC A;  4G4R A;  3C4T A;  2KXE A;  3J80 S;  3P71 C;  3MJ5 A;  2D7H A;  1NHG C;  2BNK A;  1PJJ A;  1HPU A;  4M9X A;  1L8Q A;  1L1Z A;  4LF5 E;  4KO8 A;  1L2C A;  3J81 S;  5EP1 A;  4LFB M;  3AJI B;  1TGU A;  4LF7 E;  1WHQ A;  4XBO A;  1ZBT A;  2WDD A;  3SAW A;  2HHH E;  1QZM A;  4FBK A;  5EQT A;  2JOG A;  4DR6 E;  4JA7 A;  2L3J A;  1NNW A;  1UF3 A;  3P1X A;  4MGK E;  4REZ A;  3HPZ A;  5IOH A;  4AQY M;  4V0W A;  2DIX A;  3J7A G;  2LTS A;  3THO B;  1OJL A;  4JI2 E;  3H67 A;  4IBG A;  4DMI A;  1HNX E;  3SYK A;  2V88 A;  1Q3C A;  4IL1 A;  4LAC C;  3E9S A;  4LF5 M;  3K7V C;  2B3T B;  2QFP A;  4X8W A;  4BMJ A;  5EXX A;  3DSD A;  4GRI A;  4Q28 A;  3FTC A;  4LF7 M;  2DWM A;  4AKI A;  3HHX A;  3GLI A;  3I4V A;  3WHK A;  1JQJ C;  2WDE A;  2KEB A;  2NXF A;  5EQV A;  3VDP A;  2HHH M;  1SU1 A;  3KOY E;  2V1U A;  4DR6 M;  3V4Y A;  4FCT A;  2DVW B;  4DR7 E;  4IYP C;  1IXZ A;  5T6J A;  4NXM E;  4B3R E;  3NWL A;  3HXL A;  4QHS A;  3QFK A;  4JI2 M;  3PFI A;  3DJW A;  2O8G A;  3RGS A;  4XGI A;  3DW8 C;  3ZH9 B;  4B2O A;  1Z2X A;  4O5G A;  4IIW A;  5JJT A;  1HNX M;  3GPY A;  3I51 A;  5H37 D;  1MX0 A;  2EWL A;  1M63 A;  2LNH C;  2F5P A;  3OTO E;  2KRU A;  3GRU A;  4WPY A;  3TGH A;  3LL8 A;  5IRE B;  3U5Z B;  2UUA E;  4O4K A;  3ZC7 B;  4OX9 E;  1HNZ E;  3GRY A;  4GKK E;  3VK8 A;  1IBK E;  4DR7 M;  3GP1 A;  3H61 A;  3J7B A;  3GPP A;  4HD0 A;  1XXH B;  5E6J A;  4MH0 E;  3K2L A;  4NXM M;  4B3R M;  3UK6 A;  3DA1 A;  1HP1 A;  1E32 A;  3K92 A;  3FLO A;  2UXC E;  3QFO A;  1PM5 A;  3CF6 E;  3R8F A;  4G4N A;  1GVN A;  2G8L A;  2LTR A;  3U6L A;  2N3H A;  3U6O A;  3SBJ A;  1X48 A;  1ZAE A;  2UUA M;  1YE9 A;  3TWL A;  3RQZ A;  4OX9 M;  1HNZ M;  2V8Q B;  4I5L C;  4GKK M;  2NUF A;  1IBK M;  3SMS A;  3CK2 A;  3TL4 X;  2O8A A;  3KP1 E;  1TDZ A;  3SHG B;  4ZVZ A;  4IBE A;  2X8A A;  3EGH A;  5C1B A;  4LU9 A;  1TDH A;  1R7R A;  1USH A;  3ADI A;  3IVE A;  3PVS A;  2XSZ A;  2UXC M;  3K6Q A;  4YKE A;  2BQ8 X;  2V83 A;  1QQW A;  2CHV A;  4GC9 A;  3R9X B;  2DWZ B;  2CEA A;  3JYF A;  1O0W A;  2HYO A;  3CF2 A;  5DYG A;  3W0L B;  2NUE A;  4X66 E;  1QFC A;  3SAS A;  3ADL A;  2JOB A;  1EE8 A;  4FBW A;  5EP3 A;  3H09 A;  2L3C A;  3SAV A;  3A98 B;  2G5G X;  4I4L A;  2YZT A;  3KDS E;  3BOS A;  4DUY E;  1MU5 A;  2WDF A;  2D7G A;  2F5S A;  1WAR A;  4OW0 A;  1SXJ C;  2Z4S A;  2P5T A;  3RL5 A;  3E7A A;  4KOD A;  4O24 A;  1N78 A;  2LWX A;  3L26 A;  1T4O A;  3KP0 E;  1R2Y A;  2CFO A;  2HY1 A;  4OOG C;  2YEQ A;  4LG2 A;  4BCA A;  3HWS A;  3HJS A;  5AE3 A;  3HJ8 A;  2DWN A;  3KS8 A;  1S3L A;  2XGN A;  1N33 M;  4X66 M;  1SXJ B;  4DUZ E;  2RTX A;  2C9C A;  3H63 A;  4LFC M;  2CHQ A;  2OQ4 A;  1OIE A;  1Z5B A;  3EIH A;  1C1K A;  3TWK A;  2ZAO A;  4DUY M;  3GPX A;  3QAU A;  3UGJ A;  4JI4 E;  4RNA A;  4PD2 A;  3D8B A;  3IG8 A;  1FNN A;  3LVW A;  3CF0 A;  3THG A;  3U6Q A;  2G7H A;  4FCV A;  1WXR A;  3F6H A;  5GTU A;  4H2G A;  4LJ7 A;  5IZ7 D;  2XMO A;  4IJF A;  4L16 A;  4DR1 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...