5F3WA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Dna binding protein/hydrolase/dna
total genus 105
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5f3wA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5f3wA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5f3wA01
5IOHA 1IT6A 3HVQA 2USHA 3QG5C 3K7VC 4IYPC 1XM7A 4FBQA 4ORCA 2O8AA 4WWLA 3E7AA 3ZTVA 1II7A 4H2FA 3LL8A 1S3MA 4FCXA 4H1YP 4LACC 4UT3A 4H2BA 4V0XA 2DFJA 4ZVZA 3FGAC 2BQ8X 2QJCA 4DT2A 3DSCA 1XZWA 4H1SA 1U32A 1UTEA 3PSOA 4I5LC 2NYLC 5GTUA 3T1IA 1NNWA 1W24A 1WARA 3TGHA 3ICFA 1MF8A 3PSNA 1T70A 2QFRA 3H69A 4UWQA 2O8GA 3DW8C 4XPNA 3GVEA 4KKZA 4KBPA 2WDEA 2QFPA 3RL3A 1JK7A 1WAO1 4M0VA 2IE4C 4ORBA 2BCDA 2IAEC 5JPEA 3QFKA 4FBKA 1AUIA 1S95A 4TUIA 3RL5A 3E7BA 1FJMA 1TCOA 4J6OA 4DSYA 4UT2A 1OIEA 3THNA 3K7WC 1S8EA 3EGGA 4HD0A 4JA7A 2BDXA 3N5UA 3C5WC 4B2OA 1T71A 4FBWA 4LU9A 4ORAA 5C1VA 4O24A 2WDDA 5DNYA 4V0WA 4G9JA 3IVDA 2JOGA 2CV9A 2WDFA 2IE3C 1USHA 2NYMC 3H63A 3H64A 2HY1A 3CK2A 5INBA 5HPEA 4H2GA 3H68A 2KKNA 3QFNA 2YVTA 1KBPA 1S3NA 2Z1AA 1S3LA 2NXFA 2Q8UA 1Z2WA 4MP0A 1QHWA 4IL1A 2A22A 3V4YA 1UF3A 2ZBMA 3QFOA 4I5NC 4H2IA 3IVEA 3RQZA 1OI8A 3C9FA 4O43A 4ZX2A 5JJTA 4TUGA 1SU1A 4O4KA 3AV0A 4JA9A 3JYFA 2HYPA 4UT3B 4DHLA 2AHDA 4V0VA 2Z72A 3RL4A 4MOYA 3H62B 3AUZA 3H60A 3IB7A 2XMOA 3EGHA 1HP1A 2HYOA 3DSDA 2R17A 4NZVA 1S70A 4F0ZA 1HPUA 1G5BA 4YKEA 4LTYA 5B8IA 2Z06A 5J28A 3ZU0A 2P6BA 5EQVA 1M63A 2NPPC 3KBPA 1V73A 5JPFA 3H67A 3P71C 2GJUA 4O5GA 4OR9A 4MOVA 2WDCA 1QFCA 3IB8A 1OIDA 4Q7FA 1Z2XA 3H66A 3QFMA 3THOB 5F3WA 3H61A 1HO5A
chains in the Genus database with same CATH superfamily
2USHA 2JOXA 2X8AA 3FUUA 1DQ3A 1DGCA 4IIWA 1E9SA 2R44A 4R2RA 4G6ZA 4B3SE 4F9BB 4W5WA 1D0LA 4FCXA 2JVAA 1GKIA 5IZ7D 1N36M 4FWHA 1UILA 4DR5E 2XFSA 5GTUA 4NL4H 3JR5A 1GABA 2CTDA 1YUIA 1V34A 1T4NA 4LF4E 2KXEA 5ITYA 3VKHA 1QAOA 2M5ZA 3CF0A 2QFPA 4RH8A 2ENHA 1TN9A 1JB0F 3QFKA 3TQMA 3L00A 4R3DA 3DA1A 4LJ7A 3ZCBB 5IWAE 2ZANA 1XNRM 1MEYC 4DSYA 1OIEA 3THNA 3FTDA 3GRRA 2CP8A 3F92A 3IG8A 2M1SA 2EN2A 1YZ9A 3WHKA 5H37D 2L09A 4DR1M 4J8ZA 2DENA 2LE2A 1G4AE 4K0KM 2QBYB 2NUGA 1N33M 5ITXA 4B3MM 3T15A 4NXME 1X5WA 1G59A 2ZM6M 1VEKA 2DLQA 1DGHB 1Z1BA 2EKFA 2LTSA 1A1KA 2QENA 2CRUA 4N4RB 3H62B 2B7TA 3A98B 3IB7A 4IBFA 2V1CA 2UXBE 3QAUA 2UXDM 3CF6E 2R17A 3IHPA 1G5BA 4JI8M 4YKEA 4F9CB 3KXEC 2VQFM 1QDRA 4L8RC 1AAYA 3H67A 2GJUA 2DLKA 4R2QA 2JPAA 2YRHA 4QOSA 4L4UA 1TF6A 2LH0A 2LJHA 5KL5A 2EN1A 2YZTA 2JA2A 1XC8A 3LCUA 2JNHA 1A5TA 4DV0M 3EPHA 3M7GA 1JR3E 1YSAC 2WSEF 3ADLA 2DFJA 1CUKA 3K1JA 1WGLA 4F6NA 4CJ6A 1A1GA 4NOOB 2NYLC 2XZFA 1NV8A 2CV2A 2M9AA 3PSNA 2MH8A 5A6AA 2EOSA 4FCWA 2JXPA 2EKKA 4AKHA 2IE4C 3GLFB 1NY5A 1IQPA 4LFCE 1XXHB 2QCUA 4PCZA 3EGGA 4PDIA 1L8QA 4GC5A 5DNYA 1N34M 2EMZA 4LCBA 4JI3M 4GHLA 4R2SA 2LVHA 2J5YA 1DV0A 4WURA 3HPSA 1G71A 2V89A 2E5LM 3C3DA 2CWBA 3C9FA 5FTKA 4GITA 4WX9A 2D7HA 4B3SM 3I01M 1STUA 2P5TA 2DIXA 1ZMWA 3BBGA 4DR5M 2HYOA 3SFZA 3TWLA 2WZOA 4R71A 5B8IA 4BHBA 4OW0A 2EMIA 4L8NA 2EMXA 3ZC7B 2LRSA 1ZU1A 1DGGA 3GPUA 2EQ3A 3K7VC 5ITRA 1IM2A 5IWAM 3FTFA 2R76A 4WW0A 4QNRA 1L4SA 2ELYA 2DXNA 3HHXA 4OX9E 2JOBA 3HHYA 5E6JA 3PXGA 4Q7JA 3MMPA 3JR4A 2EL4A 1WHCA 3SYKA 2MDRA 4LF5E 4ZVZA 2OPFA 3DSCA 1NEIA 2K4VA 1J09A 5C1BA 1MF8A 3HJSA 5IV8B 2G8LA 2EM6A 1EKZA 3B7NA 2HGHA 1WAO1 2B7VA 3QYBA 3GRUA 1HQYE 4YY3E 4NXMM 3T38A 1H6UA 1C7YA 3I04M 3U5ZA 4TUIA 3U6EA 2DAGA 4WPYA 1TCOA 3FE3A 3SHFA 2JUJA 3DFZA 5KPRA 1EIJA 4MGZE 2A25A 1UN6B 5ITTA 2EMGA 5LMNE 4LGMA 2CSHA 4Q28A 2EM9A 3D8LA 2RGOA 5HPEA 1IMUA 5BR8M 4GKJE 2YVTA 3HKPA 4QNMA 2NXFA 2EOYA 1Z2WA 2BWBA 1X6FA 1UBDC 3R9XB 4LZZA 2RSMA 1IN4A 5FTMA 2R18A 1VQ1A 5C18A 3L27A 3AKZA 4LJ6A 1BBOA 2UXCM 3U60A 2QSFX 1WHNA 2FTXB 4BC7A 2KOUA 3RE8A 3M0EA 1ZBQA 1TF3A 2LCEA 1SXJC 3A42A 4BB9A 1FNNA 3IB8A 1X6HA 3GLIE 1OKSA 4JXJA 2KNVA 3EIEA 4FBQA 3U61A 4LFCM 4G4RA 3SASA 3P1XA 4Y28F 3VYXA 4DV4M 2EOXA 3K9PA 3TWMA 3PVSA 2CFOA 3VK8A 3PSOA 2C9CA 3T1IA 1WARA 3PNYA 4A3VB 2EMAA 4X64E 1LLMC 1YPNA 2R0IA 1IN8A 1PJIA 3HU3A 2L6MA 2EPOA 1UFZA 1J5EE 4ZYEA 3ZOQB 2RQLA 1G2DC 4Z6YA 4LF8E 2DAEA 3C5WC 4FBWA 2LVPC 4DR6M 1Z5CA 4V0WA 4L78A 3TE6A 2GHFA 2WBUA 2N8XA 2KKNA 1KBPA 1L1TA 2RGHA 2RTXA 4JI0E 1WR1B 2HAKA 3U6MA 4F9AB 3LVWA 4FCVA 4MGHA 1K82A 1EE8A 1TGUA 3T1HE 2Y21A 4M9ZA 2L2KB 2DNAA 4LF5M 4LF7E 2DHYA 2Z4SA 3GP1A 2WCC3 3F6HA 3HX3A 2NPPC 5JPFA 2XH9A 2F5OA 3RFWA 2VF7A 3QYEA 3U6DA 3C4TA 2FNAA 1QZEA 2MJ5B 3H66A 1DGFA 1X37A 4YY3M 4IJDA 3HVQA 2MC5A 1XNRE 4BMJA 2PRTA 2EOOA 1MU5A 4V0XA 2F8BA 1J26A 3C4BA 3TPZA 4D80A 4LG2A 3TGHA 1ZQ9A 1MJGM 4WXCA 2MKNA 1N33E 2K6BA 3MHVC 4ZYHA 1NSFA 4DV6E 4B3ME 2V86A 4OVZA 2WSCF 1WJ7A 4GC9A 2EL5A 5KQ8A 1HQCA 2GPIA 5DYIA 4DR2E 2KDLA 1NNJA 2LMZA 5C1VA 3U6CA 1I94M 2IHR1 3C58A 2MGWA 4F2LA 1BVSA 4G9JA 2V1UA 1PM5A 4R7GA 2CT1A 1BB8A 1T38A 2JY8A 3IECA 4RKUF 4B7GA 2OO9A 3H68A 3FTCA 3I4VA 3J7Yp 4FVMA 2ZAMA 3ECRA 5A69A 2JZ0A 4R2AA 4LJ5A 2HWJA 5LLQA 2MROB 4HEIA 4H2IA 2Z4RA 3CTWB 1OIZA 2CEAA 4AZFA 2NUEA 4O4KA 4JA9A 3JYFA 3U5ZB 1OQYA 4JI7E 3HQ1A 2JZ1A 4KZSA 2M4IA 4PDGA 2DHRA 2EM0A 2C5RA 1S70A 3SAUA 2P6BA 4X64M 5BPVA 2MR9A 2YTEA 1IQSA 3FTEA 4B3TE 1HNXE 1J5EM 3TL4X 3C3EA 2RKOA 3LMMA 4IBGA 5EXSA 5JI3E 1A1LA 5ITQA 3VK7A 2EZ6A 4LF8M 5IREB 3UZUA 3ZQJA 1GJTA 1U32A 2JWSA 1IQOA 1NNWA 1W24A 2BBGA 1IN7A 2B9DA 2E5LE 2O8GA 3HJ8A 4G3OA 4JI0M 3EPKA 1OJLA 1YE9A 1OIPA 3MSWA 5A6JA 3A46A 3JAMC 3LQQA 4DR7E 3H4JA 4KLNA 2R45A 4MLVA 1AUIA 1RU3A 3U61B 5EXPA 2LJUA 2EMYA 3T1HM 4YHHM 1OAOC 4HL4A 4TUWA 2YRKA 4MLQA 2LO3A 4LF7M 3M6AA 1X48A 4NHRA 3E0JA 1ZMUA 1DO0A 3KFUG 1DI2A 5FTLA 2EM8A 2D9HA 5KPTA 3GQ3A 1R4GA 1PJJA 2EM7A 3OTOM 2EMFA 4IL1A 2Y20A 3RQZA 4O43A 2K47A 2Q2EB 4L5NC 3KP1E 3RL4A 3VYYA 4LF6E 4WFTA 3D8BA 1P47A 4II7A 1D0KA 2KONA 4OR9A 3KP0E 3L29A 4DV6M 3C9PA 1NNUC 3V4YA 1IT6A 2XFTA 1XM7A 3BGHA 4WWLA 2CE7A 3SAWA 4JV5E 2N3GA 2H36X 4DR2M 2R62A 3L28A 2YU8A 2QJCA 2DSYA 4I8OA 4R2CA 2R65A 5BR8E 1GL6A 2VDBB 1YYOA 3WHLA 1UHZA 1T70A 4AQYE 4JI2E 2CV0A 2JYAA 2O5RA 4LFBE 4NXNM 2XEPA 3SATA 1NJGA 1T43A 1WJPA 3GLHA 1IBLE 1R2YA 3AOEA 4LF9E 1L2DA 2QP9X 4JI7M 1A1FA 1KJKA 2LUQA 2Y0TA 3K7WC 3EIHA 2UXCE 4JA7A 2MKDA 3L25A 2L7IA 1XNQE 3Q8GA 2VRDA 1NHWC 1HNZE 3RGSA 1XMOE 2RS7A 2IE3C 1USHA 3H63A 4H2GA 2DAKA 2DMIA 2L2MA 1S3LA 4NRVA 2DZOB 4B3TM 1HNXM 3GLGA 4JI4E 4IJEA 2JY5A 4KHPE 4OVZB 5KL7A 4DV4E 4IBEA 2R46A 5KL6A 5KL4A 3VHTB 3LCVB 1N78A 4MH0E 1OFHA 5JI2E 2VF1A 5AC5A 4NZVA 2C99A 2ZTDA 4IBBA 3FRIA 1IY2A 2KNZA 1YLAA 1HNWE 1Q3BA 4WYQB 2WZJA 3IWDA 1QANA 1Z2XA 2F5QA 1W5SA 5IOHA 3I4YA 2QZ4A 4IYPC 4DR7M 2ADRA 3LLHA 2LBSB 3OMLA 1SXJB 2Z3XA 2V83A 3J7AG 2O25A 3GLFE 3SARA 4DR6E 4RF0A 3E21A 2J7NA 1L1ZA 1XXHE 2D7EA 5EJCA 5TSEA 5LMUE 3MJ5A 1AUAA 5KPZA 2KW0A 3MK6A 1E32A 2WBSA 4QHTA 4IBDA 5ITUA 2EORA 1JQJC 3W67A 4M0VA 4JI1M 2DXIA 4F1IA 2A5YB 2LBCA 4IBCA 3HU2A 3DF6A 1NY6A 4MB7A 3I51A 1G8PA 4LF6M 1HJPA 2R4JA 3ZH9B 3FKEA 4DUZE 3HXLA 2CV9A 3KS8A 1FJGE 1PJQA 2L4EA 3FUXA 1SXJE 2YTJA 2HY1A 2EMHA 5FSWA 4NRWA 3IVEA 2E1MA 3BIDA 4R8OA 2VQEM 2KHHA 2LTUA 2L3CA 2EMBA 4JV5M 1WXQA 1X3CA 5IXMB 5FLXC 2R1FA 2JP9A 1HP1A 1X49A 2EMKA 3K2LA 2N35A 2EMCA 4X66E 2Z06A 2Y0QA 2EM4A 1VEGA 2EUCA 3KBPA 4AQYM 2JY6B 4JI2M 2ZTCA 4XGIA 4AG5A 4LFBM 4MGIE 2FH0A 4P17A 2XLJA 3THOB 5F3WA 2EA0A 3THGA 1IBLM 2O8AA 2YU5A 1TDHA 4LF9M 1KFVA 2CHQA 2KA6B 1I94E 4UT3A 3AJIB 2KHXA 1XNQM 3HHZA 3FYDA 4P16A 3FIGA 1HNZM 2ERCA 3FRHA 1XMOM 2APLA 2BJWA 2DAIA 1PRBA 4P78A 5A2QC 4KKZA 4M9XA 2LUPB 1K3WA 4OOGC 5GKNA 4JI4M 4BBYA 4KHPM 3E4RA 4X62M 2EM2A 3BF2A 4Q35B 1TH4A 2DI0A 4UT2A 4D82A 2WBTA 3N5UA 2LV2A 4WXDA 4L6V6 2EE8A 2V6ZM 1GVNA 2WDFA 1IXSA 1HNWM 3H4MA 3UJNA 4ITQA 1Z5BA 3J81S 4MGKE 2EN3A 3GLHB 1YUBA 2Z7JA 2Z72A 5ITXE 2EOIA 3FUTA 4GRIA 4HLQA 2L2NA 3ILKA 3F6GA 1JR3D 3K6QA 5AC4A 3DSDA 2X49A 4R2DA 2EOMA 2YSOA 5LMUM 3DJWA 2BWEA 5EQVA 4G4OA 4BC9A 3VLFB 1OTRA 2DMYA 5FTJA 2EPRA 1TH2A 1JR3A 4RHBB 2ZBKB 4YHHE 1IFYA 2EOFA 1II7A 3LL8A 1S3MA 4LACC 1A1IA 2WSFF 3HZJA 4MGYE 2KZUA 2E72A 4DUZM 4QOZC 4I5LC 1FJGM 3KSJA 3OTOE 3J7BA 4LJAA 2QFRA 3CF2A 3HHWA 4QHSA 2KZSA 1SR9A 4FK5C 4CIZA 1YYKA 3RL3A 2JY7A 2V88A 5AE2A 5AE3A 1HR0E 3IWCA 4GEWA 4FBKA 1S95A 3JU0A 3E7BA 2EN7A 7CATA 3KZYA 2EPUA 2L92A 1S8EA 4F54A 1VDLA 2BDXA 5IT9C 2X4AA 2R4EA 2FV4B 4DV5E 1N3GA 3HPZA 4X66M 1DO2A 3CK2A 4XBOA 2JXNA 2K9DA 3UGJA 5T6JA 1VG5A 4NSOB 4B3RM 4ZX2A 1R6BX 4TUGA 3TWKA 3AV0A 2C98A 2EL6A 2LXEA 3GO8A 4KT0F 3B9PA 2DAMA 1G3IA 2L4FA 1KSFX 2I7PA 4DR3E 3ZU0A 3AOEC 4NXNE 3PFIA 4L16A 4NC6A 1NCSA 4F2JC 3D03A 1S3SA 1MGTA 1IBME 1EH7A 4DHLA 2CUZA 1UM8A 2M60A 3SHGB 1RQ0A 1WIVA 1GO5A 2HKJA 2NA2A 3L26A 4I4LA 4LFAM 4IBIA 1AIPC 4H2FA 1EFUB 4H1YP 2UUBE 4GZNC 4H2BA 3HU1A 1QZMA 3IG5A 3T1YE 3L2AA 2K0BX 1IN5A 1TF0B 3K92A 4I5SA 2XZUA 2F5PA 1T4LB 2EJ4A 1IY1A 1QYRA 3J7AS 4AKGA 2YQZA 1L2CA 1N32E 3J80C 3LVVA 2IAEC 2UUAE 3B7ZA 2LWXA 4DV1E 4J6OA 4LRTA 5AE1A 3VK6A 3FUVA 1GTKA 2F4VE 4DV2M 3U60B 4ORAA 2F5SA 4KO8A 2DWMA 3SMSA 1NO1A 3UMMA 2N3HA 1OFIA 2O01F 4MM3B 2Q8UA 2YPNA 2DZLA 3DZDA 2I9IA 1R2ZA 2JY9A 1RC7A 4NSRA 1QU6A 1OI8A 2AHMA 5DYGA 4IS1C 1ZAAC 4G4NA 3MHSC 2HYPA 3B74A 1XMQE 2JP7A 1WRJA 3SBJA 4LRSA 1GLNA 3PNVA 5AASA 4L15A 4MOYA 3RMPA 3H60A 2YTFA 4Z8XA 1IXRC 3GLIA 1WHQA 4FCTA 3JAMS 1IXSB 1ZR9A 3KZZA 2QQ8A 4JI1E 2YFQA 1ZV1A 2ENAA 4M0WA 1HO5A 1MN3A 3GPYA 1BBGA 1HR0M 1HT1E 2FGGA 2LHCA 3M99B 3W68A 4DV5M 3U6SA 4DT2A 1UTEA 2BB8A 2EPZA 3K9OA 3FD9A 1V92A 3KS4A 1PJTA 2VQEE 2VE7C 2YWQA 2L2DA 5JPEA 1NVMA 1N75A 3C6MA 1QDTA 3KSXA 3SC3A 2YT4A 2FE8A 2ZO9B 2UUCE 4DR3M 4BS9A 2NQ8C 2G7HA 2NYMC 4LJ8A 3H64A 5KL2A 5INBA 2LTRA 1KYIA 3LW5F 5KO3A 1IBMM 3B7QA 4X65E 1P3QQ 2A22A 2RPCA 2ZBMA 1A1HA 3QFOA 1N77A 4PD2A 1Z5AA 8CATA 1IXZA 3GPPA 4JI5E 1O0WA 2F5NA 2QHOB 2UUBM 1L2BA 2ODRC 3HJQA 2R6FA 3CGWA 4DV3E 2XSZD 3T1YM 5KQDA 4KODA 1NJFA 2KRKA 4PT5A 1AH5A 1B69A 5EP2A 2JWOA 1V73A 4MOVA 4R2EA 1R5LA 1ZMVA 3NWLA 4R2PA 4RF1A 4X62E 1OIDA 4Q7FA 2W82A 3QFMA 3KDSE 2LVQD 1N32M 4ZYGA 3KVWA 5E26A 2UUAM 2YTOA 2XSZA 2YTNA 4ORCA 4M9VC 5FTNA 4DV1M 2F4VM 2L6OA 2BQ8X 2ENCA 2DZNB 2M7QA 1XZWA 2YR0A 4H1SA 4HEOA 4HTGA 1PKPA 1VEJA 4AI6A 3ADJA 4GEQB 4UWQA 2XGNA 4FWGA 2EPMX 3T6PA 3EPLA 3JTZA 4ANRA 4EIWA 1QNTA 1SG9A 2MDGA 2FS1A 2CHVA 2HCBA 2CHGA 3J2PB 2DWZB 2EPCA 4S12A 1Y8GA 1XMQM 2K7IA 1W5TA 1X47A 4XK8F 2DXLA 1T71A 3U6QA 1E94E 3GQ4A 1SFEA 5DFLA 1GZ6A 1WGNA 3IVDA 2NABA 3SMPA 2ELZA 1QUSA 3QFNA 4ZYDA 1IY0A 3HTXA 1A1JA 2Z1AA 4LF4M 3ADIA 1QHWA 2GLIA 1UF3A 2EQ0A 2C9OA 4LY6A 2EOHA 3UK3C 4JI6E 2DVWB 2AHDA 2HHHE 2LVAA 4GH9A 3RGPA 3AUZA 4ZPXA 3V76A 1T39A 4FD2A 2EO2A 3GRVA 1E9RA 1TDZA 5J28A 3HGIA 4DKKA 2HJJA 4JN6A 4KWYA 3P71C 4O5GA 1D2NA 2OQ4A 1D0MA 2EQ1A 2DGCA 4X8WA 3H61A 2I13A 3VKGA 1QVRA 3QG5C 2DWLA 4GKKE 5KL3A 2QNJA 2L3JA 2EN4A 2YSPA 5EXXA 3ZTVA 1LTMA 5LL6R 1QAQA 1ORYB 2LT7A 5A6KA 1JK2A 2UUCM 2GNOA 2EN6A 3IWBA 1GL7A 4IBJA 2KRUA 4DUYE 2DB2A 3VDUA 1F2IG 3HWSA 3GLIB 2UXBM 5EQTA 3KOYE 3GPXA 4WSGA 4XPNA 3GVEA 2FOIC 3B89A 4X65M 3MHHC 2WDEA 4GHAA 4B3RE 3UK6A 1JK7A 3KOXE 1IBKE 4AW4A 5FLXS 4ORBA 5EP4A 4B7FA 2V8QB 4JI5M 3ADGA 3LMLA 2ODRD 2LVNC 3W0LB 1G41A 1VDDA 3EPJA 4HD0A 1XWIA 2UU9E 2B3TA 4IJFA 4LJ4A 2I7NA 4B2OA 1Q3CA 4DV3M 4LU9A 3VDPA 3QWLA 4X9JA 2EP3A 4F6MA 1EH8A 1OAIA 2JOGA 4B08A 4DBGB 1T6OA 4BLCA 1YYWA 2EPXA 5A6BD 4MP0A 2EPKX 1TR8A 4LFAE 1PJSA 2ZAOA 2JR1A 2YTPA 5JJTA 3R8FA 1TH3A 4REZA 5A2QS 1G2FC 2D7GA 5A6BA 2YTDA 2KNAA 3KOWE 4LTYA 4M9SA 3J81C 2YTGA 3BXWA 1M63A 4DV7E 2VF8A 1JK1A 2BNKA 3KWRA 1ZAEA 3Q8XA 2YTQA 2WDCA 1LV7A 4I81A 1EH6A 1Q02A 4WSPA 1ZBTA 1NV9A 3K8ZA 3H09A 4D81A 1YUJA 1QUTA 2EM3A 4M30A 2EOZA 4JYAE 4DV2E 2L33A 3E7AA 4RNAA 1FKAE 1C1KA 3TQSA 2EPPA 2FFJA 2EJSA 4DR4E 2Z8YM 3U6LA 1IN6A 3ICFA 2VIIA 4AG6A 4LGYA 3GRYA 2QBYA 3GLGB 4BHCA 4KBPA 1TTEA 2NUFA 3C6KA 2BCDA 3KOZE 1DGHA 3NBXX 4JI6M 2ZOAA 2EOEA 5L8RF 2EWLA 1FJMA 4G4QA 2HHHM 1YFHA 4R03A 3J27B 4IBKA 1N36E 1MX0A 2QPAA 2H5XA 3GLHE 4OX9M 1Z59A 4O24A 3NBIA 2EM5A 1V33A 1Q39A 2DRPA 1HT2E 1RMDA 2CPNA 1S3NA 5EXTA 4FW9A 2HL7A 5EP3A 1GJSA 2J7JA 3BOSA 4I5NC 2XF3A 2GQFA 2KEBA 2J7OA 4M0DA 4GKKM 1PGYA 4GIPA 3GLGE 1J7KA 1QAMA 3U6OA 2EPNA 3EGHA 2LHGA 4DUYM 1HPUA 3HY5A 2DWNA 2EPAA 3E46A 1KYQA 5LMNM 2C96A 4GMQA 3DOAA 2EN8A 4DR1E 2OOBA 4K0KE 1QFCA 1IBKM 2BJVA 3U6PA 1GQEA 3GLFA 4GKJM 5IT9S 3EQ1A 3A45A 2ZM6E 1XXHA 1WXRA 4BBAA 2EPLX 1X6EA 2UU9M 5ADZA 4M2ZA 3LQRA 3FGAC 2LNHC 3SYLA 1XB2B 2YEQA 2UXDE 3BBZA 2EMLA 4JI8E 2OOAA 1K3XA 2HC5A 3VFDA 2VQFE 4LJ9A 3H69A 3DW8C 1SXJD 2L8TA 1T4OA 4UN2B 2RSIA 4FWDA 3AFHA 2L7HA 3RL5A 3W0FA 1QQWA 5CFFE 2CV1A 4DV0E 3FLOA 1SXJA 3FYCA 1DGBA 1R7RA 1I4WA 2DKLA 2WDDA 2EMWA 2LVOC 2EOJA 2H1RA 2YNMD 4DV7M 4WP2A 3AL0C 2RS6A 2YRMA 3AOGA 4CISA 2G3QA 1Z6TA 4P7DA 4BCAA 1YSYA 3FUWA 4JYAM 2EOQA 1XHBA 1SU1A 2V87A 1T3TA 1PDAA 4B7HA 4UT3B 3E9SA 4V0VA 4AKIA 4CHTB 2V85A 4DR4M 2XMOA 2B3TB 2MC6A 4F0ZA 4DMIA 1N34E 4JI3E 1F4IA 3GQ5A 3J80S 1NHGC 2YTIA 2RRUA 4CGYB 5EP1A 4LZJA 3KW6A 3SAVA 4OU7A 2G5GX
chains in the Genus database with same CATH topology
2USHA 2JOXA 2X8AA 3FUUA 1DQ3A 4IIWA 1E9SA 4G6ZA 4B3SE 4F9BB 4W5WA 4FCXA 2JVAA 1GKIA 5IZ7D 1N36M 4FWHA 1UILA 4DR5E 2XFSA 5GTUA 4NL4H 3JR5A 1T4NA 4LF4E 2KXEA 5ITYA 3VKHA 1QAOA 2M5ZA 3CF0A 2QFPA 3QFKA 4R3DA 3DA1A 4LJ7A 3ZCBB 5IWAE 2ZANA 1XNRM 4DSYA 1OIEA 3THNA 3FTDA 3GRRA 3IG8A 2M1SA 1YZ9A 3WHKA 5H37D 2L09A 4DR1M 4J8ZA 2LE2A 1G4AE 4K0KM 2QBYB 2NUGA 1N33M 5ITXA 4B3MM 3T15A 4NXME 1G59A 2ZM6M 1DGHB 2LTSA 2QENA 3H62B 2B7TA 3A98B 3IB7A 4IBFA 2V1CA 2UXBE 3QAUA 2UXDM 3CF6E 2R17A 1G5BA 4JI8M 4YKEA 4F9CB 3KXEC 2VQFM 4L8RC 3H67A 2GJUA 4QOSA 4L4UA 2LH0A 2LJHA 2YZTA 2JA2A 1XC8A 4DV0M 3M7GA 3ADLA 2DFJA 3K1JA 4NOOB 2NYLC 2XZFA 2CV2A 3PSNA 4FCWA 4AKHA 2IE4C 3GLFB 1NY5A 1IQPA 4LFCE 1XXHB 2QCUA 4PCZA 3EGGA 4PDIA 1L8QA 4GC5A 5DNYA 1N34M 4LCBA 4JI3M 4GHLA 4WURA 3HPSA 2V89A 2E5LM 3C9FA 5FTKA 4GITA 2D7HA 4B3SM 1STUA 2P5TA 2DIXA 4DR5M 2HYOA 3SFZA 3TWLA 2WZOA 5B8IA 4OW0A 4L8NA 3ZC7B 2LRSA 1DGGA 3GPUA 3K7VC 5ITRA 1IM2A 5IWAM 3FTFA 4WW0A 4QNRA 2DXNA 3HHXA 4OX9E 2JOBA 3HHYA 5E6JA 3PXGA 3JR4A 2MDRA 4LF5E 4ZVZA 3SYKA 2OPFA 3DSCA 2K4VA 1J09A 5C1BA 1MF8A 3HJSA 2G8LA 1EKZA 1WAO1 2B7VA 3GRUA 1HQYE 4YY3E 4NXMM 3T38A 1H6UA 3U5ZA 4TUIA 3U6EA 4WPYA 1TCOA 3SHFA 3DFZA 5KPRA 4MGZE 5ITTA 5LMNE 4LGMA 4Q28A 3D8LA 2RGOA 5HPEA 5BR8M 4GKJE 2YVTA 3HKPA 4QNMA 2NXFA 1Z2WA 3R9XB 4LZZA 2RSMA 1IN4A 5FTMA 2R18A 5C18A 3L27A 3AKZA 4LJ6A 2UXCM 3U60A 1WHNA 2FTXB 4BC7A 2KOUA 3RE8A 3M0EA 1ZBQA 1SXJC 3A42A 4BB9A 1FNNA 3IB8A 4JXJA 3EIEA 4FBQA 3U61A 4LFCM 4G4RA 3SASA 3P1XA 3VYXA 4DV4M 3TWMA 3PVSA 2CFOA 3VK8A 3PSOA 2C9CA 3T1IA 1WARA 3PNYA 4A3VB 4X64E 1IN8A 1PJIA 3HU3A 2L6MA 1J5EE 3ZOQB 4Z6YA 4LF8E 3C5WC 4FBWA 4DR6M 1Z5CA 4V0WA 4L78A 3TE6A 2KKNA 1KBPA 1L1TA 2RGHA 2RTXA 4JI0E 3U6MA 4F9AB 3LVWA 4FCVA 4MGHA 1K82A 1EE8A 1TGUA 3T1HE 2Y21A 4M9ZA 2L2KB 4LF5M 4LF7E 2Z4SA 3GP1A 3F6HA 2NPPC 5JPFA 2XH9A 2F5OA 3RFWA 3U6DA 3C4TA 2FNAA 3H66A 1DGFA 1X37A 4YY3M 3HVQA 2MC5A 1XNRE 4BMJA 1MU5A 4V0XA 2F8BA 1J26A 3C4BA 3TPZA 4D80A 4LG2A 3TGHA 1ZQ9A 1N33E 3MHVC 1NSFA 4DV6E 4B3ME 2V86A 4OVZA 4GC9A 5KQ8A 1HQCA 4DR2E 5DYIA 1NNJA 2LMZA 5C1VA 3U6CA 1I94M 2IHR1 3C58A 4G9JA 2V1UA 1PM5A 4R7GA 4B7GA 3H68A 3FTCA 3I4VA 3J7Yp 4FVMA 2ZAMA 4LJ5A 4H2IA 2Z4RA 3CTWB 4AZFA 2CEAA 2NUEA 4O4KA 4JA9A 3JYFA 3U5ZB 4JI7E 3HQ1A 4KZSA 2M4IA 4PDGA 2DHRA 2C5RA 1S70A 3SAUA 2P6BA 4X64M 5BPVA 3FTEA 4B3TE 1HNXE 1J5EM 3TL4X 2RKOA 3LMMA 4IBGA 5EXSA 5JI3E 5ITQA 3VK7A 2EZ6A 4LF8M 5IREB 3UZUA 1U32A 1NNWA 1W24A 1IN7A 2B9DA 2E5LE 2O8GA 3HJ8A 4JI0M 1OJLA 1YE9A 3MSWA 3A46A 3JAMC 3LQQA 1AUIA 4KLNA 4DR7E 2R45A 3U61B 5EXPA 3T1HM 4YHHM 4HL4A 4TUWA 4LF7M 3M6AA 1X48A 3E0JA 1DO0A 3KFUG 1DI2A 5FTLA 5KPTA 3GQ3A 1PJJA 3OTOM 4IL1A 2Y20A 3RQZA 4O43A 2K47A 2Q2EB 4L5NC 3KP1E 3RL4A 3VYYA 4LF6E 4WFTA 3D8BA 4II7A 2KONA 4OR9A 3KP0E 3L29A 4DV6M 1NNUC 3V4YA 1IT6A 2XFTA 1XM7A 4WWLA 2CE7A 3SAWA 4JV5E 2N3GA 2H36X 4DR2M 2R62A 3L28A 2QJCA 2DSYA 4I8OA 2R65A 5BR8E 1GL6A 1YYOA 3WHLA 1UHZA 1T70A 4AQYE 4JI2E 2CV0A 2O5RA 4LFBE 4NXNM 2XEPA 3SATA 1NJGA 3GLHA 1IBLE 1R2YA 3AOEA 4LF9E 1L2DA 2QP9X 4JI7M 2LUQA 2Y0TA 3K7WC 3EIHA 2UXCE 4JA7A 3L25A 2L7IA 1XNQE 1NHWC 1HNZE 3RGSA 1XMOE 2RS7A 2IE3C 1USHA 3H63A 4H2GA 2L2MA 1S3LA 4NRVA 2DZOB 4B3TM 1HNXM 3GLGA 4JI4E 4IJEA 4KHPE 4OVZB 4DV4E 4IBEA 2R46A 1N78A 4MH0E 1OFHA 5JI2E 2VF1A 4NZVA 2C99A 4IBBA 1IY2A 1HNWE 1Q3BA 4WYQB 3IWDA 1QANA 1Z2XA 2F5QA 1W5SA 5IOHA 3I4YA 2QZ4A 4IYPC 4DR7M 3LLHA 2LBSB 3OMLA 1SXJB 2Z3XA 2V83A 3J7AG 3SARA 4DR6E 4RF0A 2J7NA 1L1ZA 2D7EA 5EJCA 5LMUE 3MJ5A 5KPZA 2KW0A 3MK6A 1E32A 4QHTA 4IBDA 5ITUA 1JQJC 4M0VA 4JI1M 2DXIA 2A5YB 4IBCA 3HU2A 3DF6A 1NY6A 4MB7A 3I51A 1G8PA 4LF6M 2R4JA 3ZH9B 3FKEA 4DUZE 3HXLA 2CV9A 3KS8A 1FJGE 3FUXA 1SXJE 2HY1A 5FSWA 4NRWA 3IVEA 2E1MA 4R8OA 2VQEM 2L3CA 4JV5M 1WXQA 5FLXC 1HP1A 1X49A 3K2LA 4X66E 2Z06A 2Y0QA 2EUCA 3KBPA 4AQYM 4JI2M 4XGIA 4AG5A 4LFBM 4MGIE 2XLJA 3THOB 5F3WA 2EA0A 3THGA 1IBLM 2O8AA 1TDHA 4LF9M 1KFVA 2CHQA 2KA6B 1I94E 4UT3A 3AJIB 2KHXA 1XNQM 3HHZA 3FYDA 4P16A 3FIGA 1HNZM 2ERCA 1XMOM 2BJWA 4P78A 5A2QC 4KKZA 4M9XA 2LUPB 1K3WA 4OOGC 5GKNA 4JI4M 4BBYA 4KHPM 3E4RA 4X62M 1TH4A 4UT2A 4D82A 3N5UA 2V6ZM 1GVNA 2WDFA 1HNWM 3H4MA 3UJNA 4ITQA 1Z5BA 3J81S 4MGKE 3GLHB 1YUBA 2Z7JA 2Z72A 5ITXE 3FUTA 4GRIA 4HLQA 2L2NA 3ILKA 3F6GA 1JR3D 3K6QA 3DSDA 2X49A 5LMUM 3DJWA 5EQVA 4G4OA 4BC9A 3VLFB 2DMYA 5FTJA 1TH2A 1JR3A 2ZBKB 4YHHE 1II7A 3LL8A 1S3MA 4LACC 4MGYE 2KZUA 4DUZM 4QOZC 4I5LC 1FJGM 3KSJA 3OTOE 3J7BA 4LJAA 2QFRA 3CF2A 3HHWA 4QHSA 2KZSA 1SR9A 1YYKA 3RL3A 2V88A 5AE2A 5AE3A 1HR0E 3IWCA 4FBKA 1S95A 3JU0A 3E7BA 7CATA 2L92A 1S8EA 4F54A 2BDXA 5IT9C 2X4AA 2R4EA 2FV4B 4DV5E 3HPZA 4X66M 1DO2A 3CK2A 4XBOA 3UGJA 5T6JA 4NSOB 4B3RM 4ZX2A 1R6BX 4TUGA 3TWKA 3AV0A 2C98A 2LXEA 3GO8A 3B9PA 1G3IA 1KSFX 2I7PA 4DR3E 3ZU0A 3AOEC 4NXNE 3PFIA 4L16A 3D03A 1S3SA 1IBME 4DHLA 2CUZA 1UM8A 2M60A 3SHGB 1RQ0A 2HKJA 2NA2A 3L26A 4I4LA 4LFAM 4IBIA 4H2FA 4H1YP 2UUBE 4H2BA 3HU1A 1QZMA 3IG5A 3T1YE 3L2AA 1IN5A 3K92A 2F5PA 4I5SA 2XZUA 1T4LB 1IY1A 1QYRA 3J7AS 4AKGA 2YQZA 1L2CA 1N32E 3J80C 3LVVA 2IAEC 2UUAE 2LWXA 4DV1E 4J6OA 4LRTA 5AE1A 3VK6A 3FUVA 2F4VE 4DV2M 3U60B 4ORAA 2F5SA 4KO8A 2DWMA 3SMSA 3UMMA 2N3HA 1OFIA 4MM3B 2Q8UA 3DZDA 1R2ZA 2JY9A 1RC7A 4NSRA 1QU6A 1OI8A 2AHMA 5DYGA 4G4NA 2HYPA 1XMQE 3SBJA 4LRSA 1GLNA 3PNVA 5AASA 4L15A 4MOYA 3RMPA 3H60A 4Z8XA 1IXRC 3GLIA 1WHQA 4FCTA 3JAMS 1IXSB 4JI1E 2YFQA 1HO5A 4M0WA 3GPYA 1HR0M 1HT1E 2FGGA 4DV5M 3U6SA 4DT2A 1UTEA 3FD9A 3KS4A 2VQEE 2VE7C 5JPEA 1NVMA 1N75A 3KSXA 3SC3A 2YT4A 2FE8A 2ZO9B 2UUCE 4DR3M 4BS9A 2NQ8C 2G7HA 2NYMC 4LJ8A 3H64A 5INBA 2LTRA 1KYIA 5KO3A 1IBMM 4X65E 2A22A 2ZBMA 3QFOA 1N77A 4PD2A 1Z5AA 8CATA 1IXZA 3GPPA 4JI5E 1O0WA 2F5NA 2UUBM 1L2BA 2ODRC 3HJQA 4DV3E 2XSZD 3T1YM 5KQDA 4KODA 1NJFA 2KRKA 4PT5A 5EP2A 2JWOA 1V73A 4MOVA 3NWLA 4RF1A 4X62E 1OIDA 4Q7FA 2W82A 3QFMA 3KDSE 1N32M 3KVWA 5E26A 2UUAM 2XSZA 4ORCA 5FTNA 4DV1M 2F4VM 2L6OA 2BQ8X 2DZNB 2M7QA 1XZWA 2YR0A 4H1SA 1PKPA 4AI6A 3ADJA 4GEQB 4UWQA 2XGNA 4FWGA 3JTZA 4EIWA 2CHVA 2HCBA 2CHGA 3J2PB 2DWZB 4S12A 1XMQM 1W5TA 1X47A 2DXLA 1T71A 3U6QA 1E94E 3GQ4A 1GZ6A 3IVDA 3SMPA 3QFNA 1IY0A 3HTXA 2Z1AA 4LF4M 3ADIA 1QHWA 1UF3A 2C9OA 4LY6A 4JI6E 2DVWB 2AHDA 2HHHE 4GH9A 3RGPA 3AUZA 4ZPXA 4FD2A 2EO2A 3GRVA 1E9RA 1TDZA 5J28A 3HGIA 4DKKA 4JN6A 3P71C 4O5GA 1D2NA 2OQ4A 4X8WA 3H61A 3VKGA 1QVRA 3QG5C 2DWLA 4GKKE 2L3JA 5EXXA 3ZTVA 5LL6R 1QAQA 1ORYB 2UUCM 3IWBA 1GL7A 4IBJA 2KRUA 4DUYE 2DB2A 3VDUA 3HWSA 3GLIB 2UXBM 5EQTA 3KOYE 3GPXA 4XPNA 3GVEA 2FOIC 2WDEA 4X65M 4GHAA 4B3RE 3UK6A 1JK7A 3KOXE 1IBKE 4AW4A 5FLXS 4ORBA 5EP4A 4B7FA 2V8QB 4JI5M 3ADGA 3LMLA 2ODRD 3W0LB 1G41A 1VDDA 4HD0A 1XWIA 2UU9E 4IJFA 4LJ4A 2I7NA 4B2OA 1Q3CA 4DV3M 4LU9A 3VDPA 3QWLA 2JOGA 4B08A 4BLCA 1YYWA 4MP0A 4LFAE 2ZAOA 2JR1A 5JJTA 3R8FA 1TH3A 4REZA 5A2QS 2D7GA 3KOWE 4LTYA 4M9SA 3J81C 1M63A 4DV7E 2BNKA 3KWRA 1ZAEA 3Q8XA 2WDCA 1LV7A 4I81A 4WSPA 1ZBTA 3K8ZA 3H09A 4D81A 4M30A 4JYAE 4DV2E 2L33A 3E7AA 4RNAA 1FKAE 1C1KA 3TQSA 2FFJA 4DR4E 3U6LA 1IN6A 3ICFA 2VIIA 4AG6A 4LGYA 3GRYA 2QBYA 3GLGB 4KBPA 2NUFA 2BCDA 3KOZE 1DGHA 4JI6M 2ZOAA 2EWLA 1FJMA 4G4QA 2HHHM 4R03A 3J27B 4IBKA 1N36E 1MX0A 2QPAA 4OX9M 1Z59A 4O24A 3NBIA 1Q39A 1HT2E 2CPNA 1S3NA 5EXTA 4FW9A 2HL7A 5EP3A 3BOSA 4I5NC 2XF3A 2KEBA 2J7OA 4M0DA 4GKKM 4GIPA 1J7KA 1QAMA 3U6OA 3EGHA 4DUYM 1HPUA 2DWNA 5LMNM 2C96A 4GMQA 3DOAA 4DR1E 4K0KE 1QFCA 1IBKM 2BJVA 3U6PA 1GQEA 3GLFA 4GKJM 5IT9S 3A45A 2ZM6E 1XXHA 1WXRA 4BBAA 2UU9M 5ADZA 4M2ZA 3LQRA 3FGAC 2LNHC 3SYLA 2YEQA 2UXDE 4JI8E 1K3XA 3VFDA 2VQFE 4LJ9A 3H69A 3DW8C 1SXJD 2L8TA 1T4OA 4FWDA 3AFHA 2L7HA 3RL5A 3W0FA 1QQWA 5CFFE 2CV1A 4DV0E 3FLOA 1SXJA 3FYCA 1DGBA 1R7RA 1I4WA 2WDDA 2H1RA 2YNMD 4DV7M 2RS6A 3AL0C 3AOGA 4CISA 1Z6TA 4P7DA 4BCAA 1YSYA 3FUWA 4JYAM 1XHBA 1SU1A 2V87A 1T3TA 4B7HA 4UT3B 3E9SA 4V0VA 4AKIA 4CHTB 2V85A 4DR4M 2XMOA 2B3TB 2MC6A 4F0ZA 4DMIA 1N34E 4JI3E 3GQ5A 3J80S 1NHGC 4CGYB 5EP1A 4LZJA 3KW6A 3SAVA 4OU7A 2G5GX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOH A;  1IT6 A;  3HVQ A;  2USH A;  3QG5 C;  3K7V C;  4IYP C;  1XM7 A;  4FBQ A;  4ORC A;  2O8A A;  4WWL A;  3E7A A;  3ZTV A;  1II7 A;  4H2F A;  3LL8 A;  1S3M A;  4FCX A;  4H1Y P;  4LAC C;  4UT3 A;  4H2B A;  4V0X A;  2DFJ A;  4ZVZ A;  3FGA C;  2BQ8 X;  2QJC A;  4DT2 A;  3DSC A;  1XZW A;  4H1S A;  1U32 A;  1UTE A;  3PSO A;  4I5L C;  2NYL C;  5GTU A;  3T1I A;  1NNW A;  1W24 A;  1WAR A;  3TGH A;  3ICF A;  1MF8 A;  3PSN A;  1T70 A;  2QFR A;  3H69 A;  4UWQ A;  2O8G A;  3DW8 C;  4XPN A;  3GVE A;  4KKZ A;  4KBP A;  2WDE A;  2QFP A;  3RL3 A;  1JK7 A;  1WAO 1;  4M0V A;  2IE4 C;  4ORB A;  2BCD A;  2IAE C;  5JPE A;  3QFK A;  4FBK A;  1AUI A;  1S95 A;  4TUI A;  3RL5 A;  3E7B A;  1FJM A;  1TCO A;  4J6O A;  4DSY A;  4UT2 A;  1OIE A;  3THN A;  3K7W C;  1S8E A;  3EGG A;  4HD0 A;  4JA7 A;  2BDX A;  3N5U A;  3C5W C;  4B2O A;  1T71 A;  4FBW A;  4LU9 A;  4ORA A;  5C1V A;  4O24 A;  2WDD A;  5DNY A;  4V0W A;  4G9J A;  3IVD A;  2JOG A;  2CV9 A;  2WDF A;  2IE3 C;  1USH A;  2NYM C;  3H63 A;  3H64 A;  2HY1 A;  3CK2 A;  5INB A;  5HPE A;  4H2G A;  3H68 A;  2KKN A;  3QFN A;  2YVT A;  1KBP A;  1S3N A;  2Z1A A;  1S3L A;  2NXF A;  2Q8U A;  1Z2W A;  4MP0 A;  1QHW A;  4IL1 A;  2A22 A;  3V4Y A;  1UF3 A;  2ZBM A;  3QFO A;  4I5N C;  4H2I A;  3IVE A;  3RQZ A;  1OI8 A;  3C9F A;  4O43 A;  4ZX2 A;  5JJT A;  4TUG A;  1SU1 A;  4O4K A;  3AV0 A;  4JA9 A;  3JYF A;  2HYP A;  4UT3 B;  4DHL A;  2AHD A;  4V0V A;  2Z72 A;  3RL4 A;  4MOY A;  3H62 B;  3AUZ A;  3H60 A;  3IB7 A;  2XMO A;  3EGH A;  1HP1 A;  2HYO A;  3DSD A;  2R17 A;  4NZV A;  1S70 A;  4F0Z A;  1HPU A;  1G5B A;  4YKE A;  4LTY A;  5B8I A;  2Z06 A;  5J28 A;  3ZU0 A;  2P6B A;  5EQV A;  1M63 A;  2NPP C;  3KBP A;  1V73 A;  5JPF A;  3H67 A;  3P71 C;  2GJU A;  4O5G A;  4OR9 A;  4MOV A;  2WDC A;  1QFC A;  3IB8 A;  1OID A;  4Q7F A;  1Z2X A;  3H66 A;  3QFM A;  3THO B;  5F3W A;  3H61 A;  1HO5 A; 
#chains in the Genus database with same CATH topology
 2USH A;  2JOX A;  2X8A A;  3FUU A;  1DQ3 A;  1DGC A;  4IIW A;  1E9S A;  2R44 A;  4R2R A;  4G6Z A;  4B3S E;  4F9B B;  4W5W A;  1D0L A;  4FCX A;  2JVA A;  1GKI A;  5IZ7 D;  1N36 M;  4FWH A;  1UIL A;  4DR5 E;  2XFS A;  5GTU A;  4NL4 H;  3JR5 A;  1GAB A;  2CTD A;  1YUI A;  1V34 A;  1T4N A;  4LF4 E;  2KXE A;  5ITY A;  3VKH A;  1QAO A;  2M5Z A;  3CF0 A;  2QFP A;  4RH8 A;  2ENH A;  1TN9 A;  1JB0 F;  3QFK A;  3TQM A;  3L00 A;  4R3D A;  3DA1 A;  4LJ7 A;  3ZCB B;  5IWA E;  2ZAN A;  1XNR M;  1MEY C;  4DSY A;  1OIE A;  3THN A;  3FTD A;  3GRR A;  2CP8 A;  3F92 A;  3IG8 A;  2M1S A;  2EN2 A;  1YZ9 A;  3WHK A;  5H37 D;  2L09 A;  4DR1 M;  4J8Z A;  2DEN A;  2LE2 A;  1G4A E;  4K0K M;  2QBY B;  2NUG A;  1N33 M;  5ITX A;  4B3M M;  3T15 A;  4NXM E;  1X5W A;  1G59 A;  2ZM6 M;  1VEK A;  2DLQ A;  1DGH B;  1Z1B A;  2EKF A;  2LTS A;  1A1K A;  2QEN A;  2CRU A;  4N4R B;  3H62 B;  2B7T A;  3A98 B;  3IB7 A;  4IBF A;  2V1C A;  2UXB E;  3QAU A;  2UXD M;  3CF6 E;  2R17 A;  3IHP A;  1G5B A;  4JI8 M;  4YKE A;  4F9C B;  3KXE C;  2VQF M;  1QDR A;  4L8R C;  1AAY A;  3H67 A;  2GJU A;  2DLK A;  4R2Q A;  2JPA A;  2YRH A;  4QOS A;  4L4U A;  1TF6 A;  2LH0 A;  2LJH A;  5KL5 A;  2EN1 A;  2YZT A;  2JA2 A;  1XC8 A;  3LCU A;  2JNH A;  1A5T A;  4DV0 M;  3EPH A;  3M7G A;  1JR3 E;  1YSA C;  2WSE F;  3ADL A;  2DFJ A;  1CUK A;  3K1J A;  1WGL A;  4F6N A;  4CJ6 A;  1A1G A;  4NOO B;  2NYL C;  2XZF A;  1NV8 A;  2CV2 A;  2M9A A;  3PSN A;  2MH8 A;  5A6A A;  2EOS A;  4FCW A;  2JXP A;  2EKK A;  4AKH A;  2IE4 C;  3GLF B;  1NY5 A;  1IQP A;  4LFC E;  1XXH B;  2QCU A;  4PCZ A;  3EGG A;  4PDI A;  1L8Q A;  4GC5 A;  5DNY A;  1N34 M;  2EMZ A;  4LCB A;  4JI3 M;  4GHL A;  4R2S A;  2LVH A;  2J5Y A;  1DV0 A;  4WUR A;  3HPS A;  1G71 A;  2V89 A;  2E5L M;  3C3D A;  2CWB A;  3C9F A;  5FTK A;  4GIT A;  4WX9 A;  2D7H A;  4B3S M;  3I01 M;  1STU A;  2P5T A;  2DIX A;  1ZMW A;  3BBG A;  4DR5 M;  2HYO A;  3SFZ A;  3TWL A;  2WZO A;  4R71 A;  5B8I A;  4BHB A;  4OW0 A;  2EMI A;  4L8N A;  2EMX A;  3ZC7 B;  2LRS A;  1ZU1 A;  1DGG A;  3GPU A;  2EQ3 A;  3K7V C;  5ITR A;  1IM2 A;  5IWA M;  3FTF A;  2R76 A;  4WW0 A;  4QNR A;  1L4S A;  2ELY A;  2DXN A;  3HHX A;  4OX9 E;  2JOB A;  3HHY A;  5E6J A;  3PXG A;  4Q7J A;  3MMP A;  3JR4 A;  2EL4 A;  1WHC A;  3SYK A;  2MDR A;  4LF5 E;  4ZVZ A;  2OPF A;  3DSC A;  1NEI A;  2K4V A;  1J09 A;  5C1B A;  1MF8 A;  3HJS A;  5IV8 B;  2G8L A;  2EM6 A;  1EKZ A;  3B7N A;  2HGH A;  1WAO 1;  2B7V A;  3QYB A;  3GRU A;  1HQY E;  4YY3 E;  4NXM M;  3T38 A;  1H6U A;  1C7Y A;  3I04 M;  3U5Z A;  4TUI A;  3U6E A;  2DAG A;  4WPY A;  1TCO A;  3FE3 A;  3SHF A;  2JUJ A;  3DFZ A;  5KPR A;  1EIJ A;  4MGZ E;  2A25 A;  1UN6 B;  5ITT A;  2EMG A;  5LMN E;  4LGM A;  2CSH A;  4Q28 A;  2EM9 A;  3D8L A;  2RGO A;  5HPE A;  1IMU A;  5BR8 M;  4GKJ E;  2YVT A;  3HKP A;  4QNM A;  2NXF A;  2EOY A;  1Z2W A;  2BWB A;  1X6F A;  1UBD C;  3R9X B;  4LZZ A;  2RSM A;  1IN4 A;  5FTM A;  2R18 A;  1VQ1 A;  5C18 A;  3L27 A;  3AKZ A;  4LJ6 A;  1BBO A;  2UXC M;  3U60 A;  2QSF X;  1WHN A;  2FTX B;  4BC7 A;  2KOU A;  3RE8 A;  3M0E A;  1ZBQ A;  1TF3 A;  2LCE A;  1SXJ C;  3A42 A;  4BB9 A;  1FNN A;  3IB8 A;  1X6H A;  3GLI E;  1OKS A;  4JXJ A;  2KNV A;  3EIE A;  4FBQ A;  3U61 A;  4LFC M;  4G4R A;  3SAS A;  3P1X A;  4Y28 F;  3VYX A;  4DV4 M;  2EOX A;  3K9P A;  3TWM A;  3PVS A;  2CFO A;  3VK8 A;  3PSO A;  2C9C A;  3T1I A;  1WAR A;  3PNY A;  4A3V B;  2EMA A;  4X64 E;  1LLM C;  1YPN A;  2R0I A;  1IN8 A;  1PJI A;  3HU3 A;  2L6M A;  2EPO A;  1UFZ A;  1J5E E;  4ZYE A;  3ZOQ B;  2RQL A;  1G2D C;  4Z6Y A;  4LF8 E;  2DAE A;  3C5W C;  4FBW A;  2LVP C;  4DR6 M;  1Z5C A;  4V0W A;  4L78 A;  3TE6 A;  2GHF A;  2WBU A;  2N8X A;  2KKN A;  1KBP A;  1L1T A;  2RGH A;  2RTX A;  4JI0 E;  1WR1 B;  2HAK A;  3U6M A;  4F9A B;  3LVW A;  4FCV A;  4MGH A;  1K82 A;  1EE8 A;  1TGU A;  3T1H E;  2Y21 A;  4M9Z A;  2L2K B;  2DNA A;  4LF5 M;  4LF7 E;  2DHY A;  2Z4S A;  3GP1 A;  2WCC 3;  3F6H A;  3HX3 A;  2NPP C;  5JPF A;  2XH9 A;  2F5O A;  3RFW A;  2VF7 A;  3QYE A;  3U6D A;  3C4T A;  2FNA A;  1QZE A;  2MJ5 B;  3H66 A;  1DGF A;  1X37 A;  4YY3 M;  4IJD A;  3HVQ A;  2MC5 A;  1XNR E;  4BMJ A;  2PRT A;  2EOO A;  1MU5 A;  4V0X A;  2F8B A;  1J26 A;  3C4B A;  3TPZ A;  4D80 A;  4LG2 A;  3TGH A;  1ZQ9 A;  1MJG M;  4WXC A;  2MKN A;  1N33 E;  2K6B A;  3MHV C;  4ZYH A;  1NSF A;  4DV6 E;  4B3M E;  2V86 A;  4OVZ A;  2WSC F;  1WJ7 A;  4GC9 A;  2EL5 A;  5KQ8 A;  1HQC A;  2GPI A;  5DYI A;  4DR2 E;  2KDL A;  1NNJ A;  2LMZ A;  5C1V A;  3U6C A;  1I94 M;  2IHR 1;  3C58 A;  2MGW A;  4F2L A;  1BVS A;  4G9J A;  2V1U A;  1PM5 A;  4R7G A;  2CT1 A;  1BB8 A;  1T38 A;  2JY8 A;  3IEC A;  4RKU F;  4B7G A;  2OO9 A;  3H68 A;  3FTC A;  3I4V A;  3J7Y p;  4FVM A;  2ZAM A;  3ECR A;  5A69 A;  2JZ0 A;  4R2A A;  4LJ5 A;  2HWJ A;  5LLQ A;  2MRO B;  4HEI A;  4H2I A;  2Z4R A;  3CTW B;  1OIZ A;  2CEA A;  4AZF A;  2NUE A;  4O4K A;  4JA9 A;  3JYF A;  3U5Z B;  1OQY A;  4JI7 E;  3HQ1 A;  2JZ1 A;  4KZS A;  2M4I A;  4PDG A;  2DHR A;  2EM0 A;  2C5R A;  1S70 A;  3SAU A;  2P6B A;  4X64 M;  5BPV A;  2MR9 A;  2YTE A;  1IQS A;  3FTE A;  4B3T E;  1HNX E;  1J5E M;  3TL4 X;  3C3E A;  2RKO A;  3LMM A;  4IBG A;  5EXS A;  5JI3 E;  1A1L A;  5ITQ A;  3VK7 A;  2EZ6 A;  4LF8 M;  5IRE B;  3UZU A;  3ZQJ A;  1GJT A;  1U32 A;  2JWS A;  1IQO A;  1NNW A;  1W24 A;  2BBG A;  1IN7 A;  2B9D A;  2E5L E;  2O8G A;  3HJ8 A;  4G3O A;  4JI0 M;  3EPK A;  1OJL A;  1YE9 A;  1OIP A;  3MSW A;  5A6J A;  3A46 A;  3JAM C;  3LQQ A;  4DR7 E;  3H4J A;  4KLN A;  2R45 A;  4MLV A;  1AUI A;  1RU3 A;  3U61 B;  5EXP A;  2LJU A;  2EMY A;  3T1H M;  4YHH M;  1OAO C;  4HL4 A;  4TUW A;  2YRK A;  4MLQ A;  2LO3 A;  4LF7 M;  3M6A A;  1X48 A;  4NHR A;  3E0J A;  1ZMU A;  1DO0 A;  3KFU G;  1DI2 A;  5FTL A;  2EM8 A;  2D9H A;  5KPT A;  3GQ3 A;  1R4G A;  1PJJ A;  2EM7 A;  3OTO M;  2EMF A;  4IL1 A;  2Y20 A;  3RQZ A;  4O43 A;  2K47 A;  2Q2E B;  4L5N C;  3KP1 E;  3RL4 A;  3VYY A;  4LF6 E;  4WFT A;  3D8B A;  1P47 A;  4II7 A;  1D0K A;  2KON A;  4OR9 A;  3KP0 E;  3L29 A;  4DV6 M;  3C9P A;  1NNU C;  3V4Y A;  1IT6 A;  2XFT A;  1XM7 A;  3BGH A;  4WWL A;  2CE7 A;  3SAW A;  4JV5 E;  2N3G A;  2H36 X;  4DR2 M;  2R62 A;  3L28 A;  2YU8 A;  2QJC A;  2DSY A;  4I8O A;  4R2C A;  2R65 A;  5BR8 E;  1GL6 A;  2VDB B;  1YYO A;  3WHL A;  1UHZ A;  1T70 A;  4AQY E;  4JI2 E;  2CV0 A;  2JYA A;  2O5R A;  4LFB E;  4NXN M;  2XEP A;  3SAT A;  1NJG A;  1T43 A;  1WJP A;  3GLH A;  1IBL E;  1R2Y A;  3AOE A;  4LF9 E;  1L2D A;  2QP9 X;  4JI7 M;  1A1F A;  1KJK A;  2LUQ A;  2Y0T A;  3K7W C;  3EIH A;  2UXC E;  4JA7 A;  2MKD A;  3L25 A;  2L7I A;  1XNQ E;  3Q8G A;  2VRD A;  1NHW C;  1HNZ E;  3RGS A;  1XMO E;  2RS7 A;  2IE3 C;  1USH A;  3H63 A;  4H2G A;  2DAK A;  2DMI A;  2L2M A;  1S3L A;  4NRV A;  2DZO B;  4B3T M;  1HNX M;  3GLG A;  4JI4 E;  4IJE A;  2JY5 A;  4KHP E;  4OVZ B;  5KL7 A;  4DV4 E;  4IBE A;  2R46 A;  5KL6 A;  5KL4 A;  3VHT B;  3LCV B;  1N78 A;  4MH0 E;  1OFH A;  5JI2 E;  2VF1 A;  5AC5 A;  4NZV A;  2C99 A;  2ZTD A;  4IBB A;  3FRI A;  1IY2 A;  2KNZ A;  1YLA A;  1HNW E;  1Q3B A;  4WYQ B;  2WZJ A;  3IWD A;  1QAN A;  1Z2X A;  2F5Q A;  1W5S A;  5IOH A;  3I4Y A;  2QZ4 A;  4IYP C;  4DR7 M;  2ADR A;  3LLH A;  2LBS B;  3OML A;  1SXJ B;  2Z3X A;  2V83 A;  3J7A G;  2O25 A;  3GLF E;  3SAR A;  4DR6 E;  4RF0 A;  3E21 A;  2J7N A;  1L1Z A;  1XXH E;  2D7E A;  5EJC A;  5TSE A;  5LMU E;  3MJ5 A;  1AUA A;  5KPZ A;  2KW0 A;  3MK6 A;  1E32 A;  2WBS A;  4QHT A;  4IBD A;  5ITU A;  2EOR A;  1JQJ C;  3W67 A;  4M0V A;  4JI1 M;  2DXI A;  4F1I A;  2A5Y B;  2LBC A;  4IBC A;  3HU2 A;  3DF6 A;  1NY6 A;  4MB7 A;  3I51 A;  1G8P A;  4LF6 M;  1HJP A;  2R4J A;  3ZH9 B;  3FKE A;  4DUZ E;  3HXL A;  2CV9 A;  3KS8 A;  1FJG E;  1PJQ A;  2L4E A;  3FUX A;  1SXJ E;  2YTJ A;  2HY1 A;  2EMH A;  5FSW A;  4NRW A;  3IVE A;  2E1M A;  3BID A;  4R8O A;  2VQE M;  2KHH A;  2LTU A;  2L3C A;  2EMB A;  4JV5 M;  1WXQ A;  1X3C A;  5IXM B;  5FLX C;  2R1F A;  2JP9 A;  1HP1 A;  1X49 A;  2EMK A;  3K2L A;  2N35 A;  2EMC A;  4X66 E;  2Z06 A;  2Y0Q A;  2EM4 A;  1VEG A;  2EUC A;  3KBP A;  4AQY M;  2JY6 B;  4JI2 M;  2ZTC A;  4XGI A;  4AG5 A;  4LFB M;  4MGI E;  2FH0 A;  4P17 A;  2XLJ A;  3THO B;  5F3W A;  2EA0 A;  3THG A;  1IBL M;  2O8A A;  2YU5 A;  1TDH A;  4LF9 M;  1KFV A;  2CHQ A;  2KA6 B;  1I94 E;  4UT3 A;  3AJI B;  2KHX A;  1XNQ M;  3HHZ A;  3FYD A;  4P16 A;  3FIG A;  1HNZ M;  2ERC A;  3FRH A;  1XMO M;  2APL A;  2BJW A;  2DAI A;  1PRB A;  4P78 A;  5A2Q C;  4KKZ A;  4M9X A;  2LUP B;  1K3W A;  4OOG C;  5GKN A;  4JI4 M;  4BBY A;  4KHP M;  3E4R A;  4X62 M;  2EM2 A;  3BF2 A;  4Q35 B;  1TH4 A;  2DI0 A;  4UT2 A;  4D82 A;  2WBT A;  3N5U A;  2LV2 A;  4WXD A;  4L6V 6;  2EE8 A;  2V6Z M;  1GVN A;  2WDF A;  1IXS A;  1HNW M;  3H4M A;  3UJN A;  4ITQ A;  1Z5B A;  3J81 S;  4MGK E;  2EN3 A;  3GLH B;  1YUB A;  2Z7J A;  2Z72 A;  5ITX E;  2EOI A;  3FUT A;  4GRI A;  4HLQ A;  2L2N A;  3ILK A;  3F6G A;  1JR3 D;  3K6Q A;  5AC4 A;  3DSD A;  2X49 A;  4R2D A;  2EOM A;  2YSO A;  5LMU M;  3DJW A;  2BWE A;  5EQV A;  4G4O A;  4BC9 A;  3VLF B;  1OTR A;  2DMY A;  5FTJ A;  2EPR A;  1TH2 A;  1JR3 A;  4RHB B;  2ZBK B;  4YHH E;  1IFY A;  2EOF A;  1II7 A;  3LL8 A;  1S3M A;  4LAC C;  1A1I A;  2WSF F;  3HZJ A;  4MGY E;  2KZU A;  2E72 A;  4DUZ M;  4QOZ C;  4I5L C;  1FJG M;  3KSJ A;  3OTO E;  3J7B A;  4LJA A;  2QFR A;  3CF2 A;  3HHW A;  4QHS A;  2KZS A;  1SR9 A;  4FK5 C;  4CIZ A;  1YYK A;  3RL3 A;  2JY7 A;  2V88 A;  5AE2 A;  5AE3 A;  1HR0 E;  3IWC A;  4GEW A;  4FBK A;  1S95 A;  3JU0 A;  3E7B A;  2EN7 A;  7CAT A;  3KZY A;  2EPU A;  2L92 A;  1S8E A;  4F54 A;  1VDL A;  2BDX A;  5IT9 C;  2X4A A;  2R4E A;  2FV4 B;  4DV5 E;  1N3G A;  3HPZ A;  4X66 M;  1DO2 A;  3CK2 A;  4XBO A;  2JXN A;  2K9D A;  3UGJ A;  5T6J A;  1VG5 A;  4NSO B;  4B3R M;  4ZX2 A;  1R6B X;  4TUG A;  3TWK A;  3AV0 A;  2C98 A;  2EL6 A;  2LXE A;  3GO8 A;  4KT0 F;  3B9P A;  2DAM A;  1G3I A;  2L4F A;  1KSF X;  2I7P A;  4DR3 E;  3ZU0 A;  3AOE C;  4NXN E;  3PFI A;  4L16 A;  4NC6 A;  1NCS A;  4F2J C;  3D03 A;  1S3S A;  1MGT A;  1IBM E;  1EH7 A;  4DHL A;  2CUZ A;  1UM8 A;  2M60 A;  3SHG B;  1RQ0 A;  1WIV A;  1GO5 A;  2HKJ A;  2NA2 A;  3L26 A;  4I4L A;  4LFA M;  4IBI A;  1AIP C;  4H2F A;  1EFU B;  4H1Y P;  2UUB E;  4GZN C;  4H2B A;  3HU1 A;  1QZM A;  3IG5 A;  3T1Y E;  3L2A A;  2K0B X;  1IN5 A;  1TF0 B;  3K92 A;  4I5S A;  2XZU A;  2F5P A;  1T4L B;  2EJ4 A;  1IY1 A;  1QYR A;  3J7A S;  4AKG A;  2YQZ A;  1L2C A;  1N32 E;  3J80 C;  3LVV A;  2IAE C;  2UUA E;  3B7Z A;  2LWX A;  4DV1 E;  4J6O A;  4LRT A;  5AE1 A;  3VK6 A;  3FUV A;  1GTK A;  2F4V E;  4DV2 M;  3U60 B;  4ORA A;  2F5S A;  4KO8 A;  2DWM A;  3SMS A;  1NO1 A;  3UMM A;  2N3H A;  1OFI A;  2O01 F;  4MM3 B;  2Q8U A;  2YPN A;  2DZL A;  3DZD A;  2I9I A;  1R2Z A;  2JY9 A;  1RC7 A;  4NSR A;  1QU6 A;  1OI8 A;  2AHM A;  5DYG A;  4IS1 C;  1ZAA C;  4G4N A;  3MHS C;  2HYP A;  3B74 A;  1XMQ E;  2JP7 A;  1WRJ A;  3SBJ A;  4LRS A;  1GLN A;  3PNV A;  5AAS A;  4L15 A;  4MOY A;  3RMP A;  3H60 A;  2YTF A;  4Z8X A;  1IXR C;  3GLI A;  1WHQ A;  4FCT A;  3JAM S;  1IXS B;  1ZR9 A;  3KZZ A;  2QQ8 A;  4JI1 E;  2YFQ A;  1ZV1 A;  2ENA A;  4M0W A;  1HO5 A;  1MN3 A;  3GPY A;  1BBG A;  1HR0 M;  1HT1 E;  2FGG A;  2LHC A;  3M99 B;  3W68 A;  4DV5 M;  3U6S A;  4DT2 A;  1UTE A;  2BB8 A;  2EPZ A;  3K9O A;  3FD9 A;  1V92 A;  3KS4 A;  1PJT A;  2VQE E;  2VE7 C;  2YWQ A;  2L2D A;  5JPE A;  1NVM A;  1N75 A;  3C6M A;  1QDT A;  3KSX A;  3SC3 A;  2YT4 A;  2FE8 A;  2ZO9 B;  2UUC E;  4DR3 M;  4BS9 A;  2NQ8 C;  2G7H A;  2NYM C;  4LJ8 A;  3H64 A;  5KL2 A;  5INB A;  2LTR A;  1KYI A;  3LW5 F;  5KO3 A;  1IBM M;  3B7Q A;  4X65 E;  1P3Q Q;  2A22 A;  2RPC A;  2ZBM A;  1A1H A;  3QFO A;  1N77 A;  4PD2 A;  1Z5A A;  8CAT A;  1IXZ A;  3GPP A;  4JI5 E;  1O0W A;  2F5N A;  2QHO B;  2UUB M;  1L2B A;  2ODR C;  3HJQ A;  2R6F A;  3CGW A;  4DV3 E;  2XSZ D;  3T1Y M;  5KQD A;  4KOD A;  1NJF A;  2KRK A;  4PT5 A;  1AH5 A;  1B69 A;  5EP2 A;  2JWO A;  1V73 A;  4MOV A;  4R2E A;  1R5L A;  1ZMV A;  3NWL A;  4R2P A;  4RF1 A;  4X62 E;  1OID A;  4Q7F A;  2W82 A;  3QFM A;  3KDS E;  2LVQ D;  1N32 M;  4ZYG A;  3KVW A;  5E26 A;  2UUA M;  2YTO A;  2XSZ A;  2YTN A;  4ORC A;  4M9V C;  5FTN A;  4DV1 M;  2F4V M;  2L6O A;  2BQ8 X;  2ENC A;  2DZN B;  2M7Q A;  1XZW A;  2YR0 A;  4H1S A;  4HEO A;  4HTG A;  1PKP A;  1VEJ A;  4AI6 A;  3ADJ A;  4GEQ B;  4UWQ A;  2XGN A;  4FWG A;  2EPM X;  3T6P A;  3EPL A;  3JTZ A;  4ANR A;  4EIW A;  1QNT A;  1SG9 A;  2MDG A;  2FS1 A;  2CHV A;  2HCB A;  2CHG A;  3J2P B;  2DWZ B;  2EPC A;  4S12 A;  1Y8G A;  1XMQ M;  2K7I A;  1W5T A;  1X47 A;  4XK8 F;  2DXL A;  1T71 A;  3U6Q A;  1E94 E;  3GQ4 A;  1SFE A;  5DFL A;  1GZ6 A;  1WGN A;  3IVD A;  2NAB A;  3SMP A;  2ELZ A;  1QUS A;  3QFN A;  4ZYD A;  1IY0 A;  3HTX A;  1A1J A;  2Z1A A;  4LF4 M;  3ADI A;  1QHW A;  2GLI A;  1UF3 A;  2EQ0 A;  2C9O A;  4LY6 A;  2EOH A;  3UK3 C;  4JI6 E;  2DVW B;  2AHD A;  2HHH E;  2LVA A;  4GH9 A;  3RGP A;  3AUZ A;  4ZPX A;  3V76 A;  1T39 A;  4FD2 A;  2EO2 A;  3GRV A;  1E9R A;  1TDZ A;  5J28 A;  3HGI A;  4DKK A;  2HJJ A;  4JN6 A;  4KWY A;  3P71 C;  4O5G A;  1D2N A;  2OQ4 A;  1D0M A;  2EQ1 A;  2DGC A;  4X8W A;  3H61 A;  2I13 A;  3VKG A;  1QVR A;  3QG5 C;  2DWL A;  4GKK E;  5KL3 A;  2QNJ A;  2L3J A;  2EN4 A;  2YSP A;  5EXX A;  3ZTV A;  1LTM A;  5LL6 R;  1QAQ A;  1ORY B;  2LT7 A;  5A6K A;  1JK2 A;  2UUC M;  2GNO A;  2EN6 A;  3IWB A;  1GL7 A;  4IBJ A;  2KRU A;  4DUY E;  2DB2 A;  3VDU A;  1F2I G;  3HWS A;  3GLI B;  2UXB M;  5EQT A;  3KOY E;  3GPX A;  4WSG A;  4XPN A;  3GVE A;  2FOI C;  3B89 A;  4X65 M;  3MHH C;  2WDE A;  4GHA A;  4B3R E;  3UK6 A;  1JK7 A;  3KOX E;  1IBK E;  4AW4 A;  5FLX S;  4ORB A;  5EP4 A;  4B7F A;  2V8Q B;  4JI5 M;  3ADG A;  3LML A;  2ODR D;  2LVN C;  3W0L B;  1G41 A;  1VDD A;  3EPJ A;  4HD0 A;  1XWI A;  2UU9 E;  2B3T A;  4IJF A;  4LJ4 A;  2I7N A;  4B2O A;  1Q3C A;  4DV3 M;  4LU9 A;  3VDP A;  3QWL A;  4X9J A;  2EP3 A;  4F6M A;  1EH8 A;  1OAI A;  2JOG A;  4B08 A;  4DBG B;  1T6O A;  4BLC A;  1YYW A;  2EPX A;  5A6B D;  4MP0 A;  2EPK X;  1TR8 A;  4LFA E;  1PJS A;  2ZAO A;  2JR1 A;  2YTP A;  5JJT A;  3R8F A;  1TH3 A;  4REZ A;  5A2Q S;  1G2F C;  2D7G A;  5A6B A;  2YTD A;  2KNA A;  3KOW E;  4LTY A;  4M9S A;  3J81 C;  2YTG A;  3BXW A;  1M63 A;  4DV7 E;  2VF8 A;  1JK1 A;  2BNK A;  3KWR A;  1ZAE A;  3Q8X A;  2YTQ A;  2WDC A;  1LV7 A;  4I81 A;  1EH6 A;  1Q02 A;  4WSP A;  1ZBT A;  1NV9 A;  3K8Z A;  3H09 A;  4D81 A;  1YUJ A;  1QUT A;  2EM3 A;  4M30 A;  2EOZ A;  4JYA E;  4DV2 E;  2L33 A;  3E7A A;  4RNA A;  1FKA E;  1C1K A;  3TQS A;  2EPP A;  2FFJ A;  2EJS A;  4DR4 E;  2Z8Y M;  3U6L A;  1IN6 A;  3ICF A;  2VII A;  4AG6 A;  4LGY A;  3GRY A;  2QBY A;  3GLG B;  4BHC A;  4KBP A;  1TTE A;  2NUF A;  3C6K A;  2BCD A;  3KOZ E;  1DGH A;  3NBX X;  4JI6 M;  2ZOA A;  2EOE A;  5L8R F;  2EWL A;  1FJM A;  4G4Q A;  2HHH M;  1YFH A;  4R03 A;  3J27 B;  4IBK A;  1N36 E;  1MX0 A;  2QPA A;  2H5X A;  3GLH E;  4OX9 M;  1Z59 A;  4O24 A;  3NBI A;  2EM5 A;  1V33 A;  1Q39 A;  2DRP A;  1HT2 E;  1RMD A;  2CPN A;  1S3N A;  5EXT A;  4FW9 A;  2HL7 A;  5EP3 A;  1GJS A;  2J7J A;  3BOS A;  4I5N C;  2XF3 A;  2GQF A;  2KEB A;  2J7O A;  4M0D A;  4GKK M;  1PGY A;  4GIP A;  3GLG E;  1J7K A;  1QAM A;  3U6O A;  2EPN A;  3EGH A;  2LHG A;  4DUY M;  1HPU A;  3HY5 A;  2DWN A;  2EPA A;  3E46 A;  1KYQ A;  5LMN M;  2C96 A;  4GMQ A;  3DOA A;  2EN8 A;  4DR1 E;  2OOB A;  4K0K E;  1QFC A;  1IBK M;  2BJV A;  3U6P A;  1GQE A;  3GLF A;  4GKJ M;  5IT9 S;  3EQ1 A;  3A45 A;  2ZM6 E;  1XXH A;  1WXR A;  4BBA A;  2EPL X;  1X6E A;  2UU9 M;  5ADZ A;  4M2Z A;  3LQR A;  3FGA C;  2LNH C;  3SYL A;  1XB2 B;  2YEQ A;  2UXD E;  3BBZ A;  2EML A;  4JI8 E;  2OOA A;  1K3X A;  2HC5 A;  3VFD A;  2VQF E;  4LJ9 A;  3H69 A;  3DW8 C;  1SXJ D;  2L8T A;  1T4O A;  4UN2 B;  2RSI A;  4FWD A;  3AFH A;  2L7H A;  3RL5 A;  3W0F A;  1QQW A;  5CFF E;  2CV1 A;  4DV0 E;  3FLO A;  1SXJ A;  3FYC A;  1DGB A;  1R7R A;  1I4W A;  2DKL A;  2WDD A;  2EMW A;  2LVO C;  2EOJ A;  2H1R A;  2YNM D;  4DV7 M;  4WP2 A;  3AL0 C;  2RS6 A;  2YRM A;  3AOG A;  4CIS A;  2G3Q A;  1Z6T A;  4P7D A;  4BCA A;  1YSY A;  3FUW A;  4JYA M;  2EOQ A;  1XHB A;  1SU1 A;  2V87 A;  1T3T A;  1PDA A;  4B7H A;  4UT3 B;  3E9S A;  4V0V A;  4AKI A;  4CHT B;  2V85 A;  4DR4 M;  2XMO A;  2B3T B;  2MC6 A;  4F0Z A;  4DMI A;  1N34 E;  4JI3 E;  1F4I A;  3GQ5 A;  3J80 S;  1NHG C;  2YTI A;  2RRU A;  4CGY B;  5EP1 A;  4LZJ A;  3KW6 A;  3SAV A;  4OU7 A;  2G5G X; 
#chains in the Genus database with same CATH homology
 2USH A;  2JOX A;  2X8A A;  3FUU A;  1DQ3 A;  4IIW A;  1E9S A;  4G6Z A;  4B3S E;  4F9B B;  4W5W A;  4FCX A;  2JVA A;  1GKI A;  5IZ7 D;  1N36 M;  4FWH A;  1UIL A;  4DR5 E;  2XFS A;  5GTU A;  4NL4 H;  3JR5 A;  1T4N A;  4LF4 E;  2KXE A;  5ITY A;  3VKH A;  1QAO A;  2M5Z A;  3CF0 A;  2QFP A;  3QFK A;  4R3D A;  3DA1 A;  4LJ7 A;  3ZCB B;  5IWA E;  2ZAN A;  1XNR M;  4DSY A;  1OIE A;  3THN A;  3FTD A;  3GRR A;  3IG8 A;  2M1S A;  1YZ9 A;  3WHK A;  5H37 D;  2L09 A;  4DR1 M;  4J8Z A;  2LE2 A;  1G4A E;  4K0K M;  2QBY B;  2NUG A;  1N33 M;  5ITX A;  4B3M M;  3T15 A;  4NXM E;  1G59 A;  2ZM6 M;  1DGH B;  2LTS A;  2QEN A;  3H62 B;  2B7T A;  3A98 B;  3IB7 A;  4IBF A;  2V1C A;  2UXB E;  3QAU A;  2UXD M;  3CF6 E;  2R17 A;  1G5B A;  4JI8 M;  4YKE A;  4F9C B;  3KXE C;  2VQF M;  4L8R C;  3H67 A;  2GJU A;  4QOS A;  4L4U A;  2LH0 A;  2LJH A;  2YZT A;  2JA2 A;  1XC8 A;  4DV0 M;  3M7G A;  3ADL A;  2DFJ A;  3K1J A;  4NOO B;  2NYL C;  2XZF A;  2CV2 A;  3PSN A;  4FCW A;  4AKH A;  2IE4 C;  3GLF B;  1NY5 A;  1IQP A;  4LFC E;  1XXH B;  2QCU A;  4PCZ A;  3EGG A;  4PDI A;  1L8Q A;  4GC5 A;  5DNY A;  1N34 M;  4LCB A;  4JI3 M;  4GHL A;  4WUR A;  3HPS A;  2V89 A;  2E5L M;  3C9F A;  5FTK A;  4GIT A;  2D7H A;  4B3S M;  1STU A;  2P5T A;  2DIX A;  4DR5 M;  2HYO A;  3SFZ A;  3TWL A;  2WZO A;  5B8I A;  4OW0 A;  4L8N A;  3ZC7 B;  2LRS A;  1DGG A;  3GPU A;  3K7V C;  5ITR A;  1IM2 A;  5IWA M;  3FTF A;  4WW0 A;  4QNR A;  2DXN A;  3HHX A;  4OX9 E;  2JOB A;  3HHY A;  5E6J A;  3PXG A;  3JR4 A;  2MDR A;  4LF5 E;  4ZVZ A;  3SYK A;  2OPF A;  3DSC A;  2K4V A;  1J09 A;  5C1B A;  1MF8 A;  3HJS A;  2G8L A;  1EKZ A;  1WAO 1;  2B7V A;  3GRU A;  1HQY E;  4YY3 E;  4NXM M;  3T38 A;  1H6U A;  3U5Z A;  4TUI A;  3U6E A;  4WPY A;  1TCO A;  3SHF A;  3DFZ A;  5KPR A;  4MGZ E;  5ITT A;  5LMN E;  4LGM A;  4Q28 A;  3D8L A;  2RGO A;  5HPE A;  5BR8 M;  4GKJ E;  2YVT A;  3HKP A;  4QNM A;  2NXF A;  1Z2W A;  3R9X B;  4LZZ A;  2RSM A;  1IN4 A;  5FTM A;  2R18 A;  5C18 A;  3L27 A;  3AKZ A;  4LJ6 A;  2UXC M;  3U60 A;  1WHN A;  2FTX B;  4BC7 A;  2KOU A;  3RE8 A;  3M0E A;  1ZBQ A;  1SXJ C;  3A42 A;  4BB9 A;  1FNN A;  3IB8 A;  4JXJ A;  3EIE A;  4FBQ A;  3U61 A;  4LFC M;  4G4R A;  3SAS A;  3P1X A;  3VYX A;  4DV4 M;  3TWM A;  3PVS A;  2CFO A;  3VK8 A;  3PSO A;  2C9C A;  3T1I A;  1WAR A;  3PNY A;  4A3V B;  4X64 E;  1IN8 A;  1PJI A;  3HU3 A;  2L6M A;  1J5E E;  3ZOQ B;  4Z6Y A;  4LF8 E;  3C5W C;  4FBW A;  4DR6 M;  1Z5C A;  4V0W A;  4L78 A;  3TE6 A;  2KKN A;  1KBP A;  1L1T A;  2RGH A;  2RTX A;  4JI0 E;  3U6M A;  4F9A B;  3LVW A;  4FCV A;  4MGH A;  1K82 A;  1EE8 A;  1TGU A;  3T1H E;  2Y21 A;  4M9Z A;  2L2K B;  4LF5 M;  4LF7 E;  2Z4S A;  3GP1 A;  3F6H A;  2NPP C;  5JPF A;  2XH9 A;  2F5O A;  3RFW A;  3U6D A;  3C4T A;  2FNA A;  3H66 A;  1DGF A;  1X37 A;  4YY3 M;  3HVQ A;  2MC5 A;  1XNR E;  4BMJ A;  1MU5 A;  4V0X A;  2F8B A;  1J26 A;  3C4B A;  3TPZ A;  4D80 A;  4LG2 A;  3TGH A;  1ZQ9 A;  1N33 E;  3MHV C;  1NSF A;  4DV6 E;  4B3M E;  2V86 A;  4OVZ A;  4GC9 A;  5KQ8 A;  1HQC A;  4DR2 E;  5DYI A;  1NNJ A;  2LMZ A;  5C1V A;  3U6C A;  1I94 M;  2IHR 1;  3C58 A;  4G9J A;  2V1U A;  1PM5 A;  4R7G A;  4B7G A;  3H68 A;  3FTC A;  3I4V A;  3J7Y p;  4FVM A;  2ZAM A;  4LJ5 A;  4H2I A;  2Z4R A;  3CTW B;  4AZF A;  2CEA A;  2NUE A;  4O4K A;  4JA9 A;  3JYF A;  3U5Z B;  4JI7 E;  3HQ1 A;  4KZS A;  2M4I A;  4PDG A;  2DHR A;  2C5R A;  1S70 A;  3SAU A;  2P6B A;  4X64 M;  5BPV A;  3FTE A;  4B3T E;  1HNX E;  1J5E M;  3TL4 X;  2RKO A;  3LMM A;  4IBG A;  5EXS A;  5JI3 E;  5ITQ A;  3VK7 A;  2EZ6 A;  4LF8 M;  5IRE B;  3UZU A;  1U32 A;  1NNW A;  1W24 A;  1IN7 A;  2B9D A;  2E5L E;  2O8G A;  3HJ8 A;  4JI0 M;  1OJL A;  1YE9 A;  3MSW A;  3A46 A;  3JAM C;  3LQQ A;  1AUI A;  4KLN A;  4DR7 E;  2R45 A;  3U61 B;  5EXP A;  3T1H M;  4YHH M;  4HL4 A;  4TUW A;  4LF7 M;  3M6A A;  1X48 A;  3E0J A;  1DO0 A;  3KFU G;  1DI2 A;  5FTL A;  5KPT A;  3GQ3 A;  1PJJ A;  3OTO M;  4IL1 A;  2Y20 A;  3RQZ A;  4O43 A;  2K47 A;  2Q2E B;  4L5N C;  3KP1 E;  3RL4 A;  3VYY A;  4LF6 E;  4WFT A;  3D8B A;  4II7 A;  2KON A;  4OR9 A;  3KP0 E;  3L29 A;  4DV6 M;  1NNU C;  3V4Y A;  1IT6 A;  2XFT A;  1XM7 A;  4WWL A;  2CE7 A;  3SAW A;  4JV5 E;  2N3G A;  2H36 X;  4DR2 M;  2R62 A;  3L28 A;  2QJC A;  2DSY A;  4I8O A;  2R65 A;  5BR8 E;  1GL6 A;  1YYO A;  3WHL A;  1UHZ A;  1T70 A;  4AQY E;  4JI2 E;  2CV0 A;  2O5R A;  4LFB E;  4NXN M;  2XEP A;  3SAT A;  1NJG A;  3GLH A;  1IBL E;  1R2Y A;  3AOE A;  4LF9 E;  1L2D A;  2QP9 X;  4JI7 M;  2LUQ A;  2Y0T A;  3K7W C;  3EIH A;  2UXC E;  4JA7 A;  3L25 A;  2L7I A;  1XNQ E;  1NHW C;  1HNZ E;  3RGS A;  1XMO E;  2RS7 A;  2IE3 C;  1USH A;  3H63 A;  4H2G A;  2L2M A;  1S3L A;  4NRV A;  2DZO B;  4B3T M;  1HNX M;  3GLG A;  4JI4 E;  4IJE A;  4KHP E;  4OVZ B;  4DV4 E;  4IBE A;  2R46 A;  1N78 A;  4MH0 E;  1OFH A;  5JI2 E;  2VF1 A;  4NZV A;  2C99 A;  4IBB A;  1IY2 A;  1HNW E;  1Q3B A;  4WYQ B;  3IWD A;  1QAN A;  1Z2X A;  2F5Q A;  1W5S A;  5IOH A;  3I4Y A;  2QZ4 A;  4IYP C;  4DR7 M;  3LLH A;  2LBS B;  3OML A;  1SXJ B;  2Z3X A;  2V83 A;  3J7A G;  3SAR A;  4DR6 E;  4RF0 A;  2J7N A;  1L1Z A;  2D7E A;  5EJC A;  5LMU E;  3MJ5 A;  5KPZ A;  2KW0 A;  3MK6 A;  1E32 A;  4QHT A;  4IBD A;  5ITU A;  1JQJ C;  4M0V A;  4JI1 M;  2DXI A;  2A5Y B;  4IBC A;  3HU2 A;  3DF6 A;  1NY6 A;  4MB7 A;  3I51 A;  1G8P A;  4LF6 M;  2R4J A;  3ZH9 B;  3FKE A;  4DUZ E;  3HXL A;  2CV9 A;  3KS8 A;  1FJG E;  3FUX A;  1SXJ E;  2HY1 A;  5FSW A;  4NRW A;  3IVE A;  2E1M A;  4R8O A;  2VQE M;  2L3C A;  4JV5 M;  1WXQ A;  5FLX C;  1HP1 A;  1X49 A;  3K2L A;  4X66 E;  2Z06 A;  2Y0Q A;  2EUC A;  3KBP A;  4AQY M;  4JI2 M;  4XGI A;  4AG5 A;  4LFB M;  4MGI E;  2XLJ A;  3THO B;  5F3W A;  2EA0 A;  3THG A;  1IBL M;  2O8A A;  1TDH A;  4LF9 M;  1KFV A;  2CHQ A;  2KA6 B;  1I94 E;  4UT3 A;  3AJI B;  2KHX A;  1XNQ M;  3HHZ A;  3FYD A;  4P16 A;  3FIG A;  1HNZ M;  2ERC A;  1XMO M;  2BJW A;  4P78 A;  5A2Q C;  4KKZ A;  4M9X A;  2LUP B;  1K3W A;  4OOG C;  5GKN A;  4JI4 M;  4BBY A;  4KHP M;  3E4R A;  4X62 M;  1TH4 A;  4UT2 A;  4D82 A;  3N5U A;  2V6Z M;  1GVN A;  2WDF A;  1HNW M;  3H4M A;  3UJN A;  4ITQ A;  1Z5B A;  3J81 S;  4MGK E;  3GLH B;  1YUB A;  2Z7J A;  2Z72 A;  5ITX E;  3FUT A;  4GRI A;  4HLQ A;  2L2N A;  3ILK A;  3F6G A;  1JR3 D;  3K6Q A;  3DSD A;  2X49 A;  5LMU M;  3DJW A;  5EQV A;  4G4O A;  4BC9 A;  3VLF B;  2DMY A;  5FTJ A;  1TH2 A;  1JR3 A;  2ZBK B;  4YHH E;  1II7 A;  3LL8 A;  1S3M A;  4LAC C;  4MGY E;  2KZU A;  4DUZ M;  4QOZ C;  4I5L C;  1FJG M;  3KSJ A;  3OTO E;  3J7B A;  4LJA A;  2QFR A;  3CF2 A;  3HHW A;  4QHS A;  2KZS A;  1SR9 A;  1YYK A;  3RL3 A;  2V88 A;  5AE2 A;  5AE3 A;  1HR0 E;  3IWC A;  4FBK A;  1S95 A;  3JU0 A;  3E7B A;  7CAT A;  2L92 A;  1S8E A;  4F54 A;  2BDX A;  5IT9 C;  2X4A A;  2R4E A;  2FV4 B;  4DV5 E;  3HPZ A;  4X66 M;  1DO2 A;  3CK2 A;  4XBO A;  3UGJ A;  5T6J A;  4NSO B;  4B3R M;  4ZX2 A;  1R6B X;  4TUG A;  3TWK A;  3AV0 A;  2C98 A;  2LXE A;  3GO8 A;  3B9P A;  1G3I A;  1KSF X;  2I7P A;  4DR3 E;  3ZU0 A;  3AOE C;  4NXN E;  3PFI A;  4L16 A;  3D03 A;  1S3S A;  1IBM E;  4DHL A;  2CUZ A;  1UM8 A;  2M60 A;  3SHG B;  1RQ0 A;  2HKJ A;  2NA2 A;  3L26 A;  4I4L A;  4LFA M;  4IBI A;  4H2F A;  4H1Y P;  2UUB E;  4H2B A;  3HU1 A;  1QZM A;  3IG5 A;  3T1Y E;  3L2A A;  1IN5 A;  3K92 A;  2F5P A;  4I5S A;  2XZU A;  1T4L B;  1IY1 A;  1QYR A;  3J7A S;  4AKG A;  2YQZ A;  1L2C A;  1N32 E;  3J80 C;  3LVV A;  2IAE C;  2UUA E;  2LWX A;  4DV1 E;  4J6O A;  4LRT A;  5AE1 A;  3VK6 A;  3FUV A;  2F4V E;  4DV2 M;  3U60 B;  4ORA A;  2F5S A;  4KO8 A;  2DWM A;  3SMS A;  3UMM A;  2N3H A;  1OFI A;  4MM3 B;  2Q8U A;  3DZD A;  1R2Z A;  2JY9 A;  1RC7 A;  4NSR A;  1QU6 A;  1OI8 A;  2AHM A;  5DYG A;  4G4N A;  2HYP A;  1XMQ E;  3SBJ A;  4LRS A;  1GLN A;  3PNV A;  5AAS A;  4L15 A;  4MOY A;  3RMP A;  3H60 A;  4Z8X A;  1IXR C;  3GLI A;  1WHQ A;  4FCT A;  3JAM S;  1IXS B;  4JI1 E;  2YFQ A;  1HO5 A;  4M0W A;  3GPY A;  1HR0 M;  1HT1 E;  2FGG A;  4DV5 M;  3U6S A;  4DT2 A;  1UTE A;  3FD9 A;  3KS4 A;  2VQE E;  2VE7 C;  5JPE A;  1NVM A;  1N75 A;  3KSX A;  3SC3 A;  2YT4 A;  2FE8 A;  2ZO9 B;  2UUC E;  4DR3 M;  4BS9 A;  2NQ8 C;  2G7H A;  2NYM C;  4LJ8 A;  3H64 A;  5INB A;  2LTR A;  1KYI A;  5KO3 A;  1IBM M;  4X65 E;  2A22 A;  2ZBM A;  3QFO A;  1N77 A;  4PD2 A;  1Z5A A;  8CAT A;  1IXZ A;  3GPP A;  4JI5 E;  1O0W A;  2F5N A;  2UUB M;  1L2B A;  2ODR C;  3HJQ A;  4DV3 E;  2XSZ D;  3T1Y M;  5KQD A;  4KOD A;  1NJF A;  2KRK A;  4PT5 A;  5EP2 A;  2JWO A;  1V73 A;  4MOV A;  3NWL A;  4RF1 A;  4X62 E;  1OID A;  4Q7F A;  2W82 A;  3QFM A;  3KDS E;  1N32 M;  3KVW A;  5E26 A;  2UUA M;  2XSZ A;  4ORC A;  5FTN A;  4DV1 M;  2F4V M;  2L6O A;  2BQ8 X;  2DZN B;  2M7Q A;  1XZW A;  2YR0 A;  4H1S A;  1PKP A;  4AI6 A;  3ADJ A;  4GEQ B;  4UWQ A;  2XGN A;  4FWG A;  3JTZ A;  4EIW A;  2CHV A;  2HCB A;  2CHG A;  3J2P B;  2DWZ B;  4S12 A;  1XMQ M;  1W5T A;  1X47 A;  2DXL A;  1T71 A;  3U6Q A;  1E94 E;  3GQ4 A;  1GZ6 A;  3IVD A;  3SMP A;  3QFN A;  1IY0 A;  3HTX A;  2Z1A A;  4LF4 M;  3ADI A;  1QHW A;  1UF3 A;  2C9O A;  4LY6 A;  4JI6 E;  2DVW B;  2AHD A;  2HHH E;  4GH9 A;  3RGP A;  3AUZ A;  4ZPX A;  4FD2 A;  2EO2 A;  3GRV A;  1E9R A;  1TDZ A;  5J28 A;  3HGI A;  4DKK A;  4JN6 A;  3P71 C;  4O5G A;  1D2N A;  2OQ4 A;  4X8W A;  3H61 A;  3VKG A;  1QVR A;  3QG5 C;  2DWL A;  4GKK E;  2L3J A;  5EXX A;  3ZTV A;  5LL6 R;  1QAQ A;  1ORY B;  2UUC M;  3IWB A;  1GL7 A;  4IBJ A;  2KRU A;  4DUY E;  2DB2 A;  3VDU A;  3HWS A;  3GLI B;  2UXB M;  5EQT A;  3KOY E;  3GPX A;  4XPN A;  3GVE A;  2FOI C;  2WDE A;  4X65 M;  4GHA A;  4B3R E;  3UK6 A;  1JK7 A;  3KOX E;  1IBK E;  4AW4 A;  5FLX S;  4ORB A;  5EP4 A;  4B7F A;  2V8Q B;  4JI5 M;  3ADG A;  3LML A;  2ODR D;  3W0L B;  1G41 A;  1VDD A;  4HD0 A;  1XWI A;  2UU9 E;  4IJF A;  4LJ4 A;  2I7N A;  4B2O A;  1Q3C A;  4DV3 M;  4LU9 A;  3VDP A;  3QWL A;  2JOG A;  4B08 A;  4BLC A;  1YYW A;  4MP0 A;  4LFA E;  2ZAO A;  2JR1 A;  5JJT A;  3R8F A;  1TH3 A;  4REZ A;  5A2Q S;  2D7G A;  3KOW E;  4LTY A;  4M9S A;  3J81 C;  1M63 A;  4DV7 E;  2BNK A;  3KWR A;  1ZAE A;  3Q8X A;  2WDC A;  1LV7 A;  4I81 A;  4WSP A;  1ZBT A;  3K8Z A;  3H09 A;  4D81 A;  4M30 A;  4JYA E;  4DV2 E;  2L33 A;  3E7A A;  4RNA A;  1FKA E;  1C1K A;  3TQS A;  2FFJ A;  4DR4 E;  3U6L A;  1IN6 A;  3ICF A;  2VII A;  4AG6 A;  4LGY A;  3GRY A;  2QBY A;  3GLG B;  4KBP A;  2NUF A;  2BCD A;  3KOZ E;  1DGH A;  4JI6 M;  2ZOA A;  2EWL A;  1FJM A;  4G4Q A;  2HHH M;  4R03 A;  3J27 B;  4IBK A;  1N36 E;  1MX0 A;  2QPA A;  4OX9 M;  1Z59 A;  4O24 A;  3NBI A;  1Q39 A;  1HT2 E;  2CPN A;  1S3N A;  5EXT A;  4FW9 A;  2HL7 A;  5EP3 A;  3BOS A;  4I5N C;  2XF3 A;  2KEB A;  2J7O A;  4M0D A;  4GKK M;  4GIP A;  1J7K A;  1QAM A;  3U6O A;  3EGH A;  4DUY M;  1HPU A;  2DWN A;  5LMN M;  2C96 A;  4GMQ A;  3DOA A;  4DR1 E;  4K0K E;  1QFC A;  1IBK M;  2BJV A;  3U6P A;  1GQE A;  3GLF A;  4GKJ M;  5IT9 S;  3A45 A;  2ZM6 E;  1XXH A;  1WXR A;  4BBA A;  2UU9 M;  5ADZ A;  4M2Z A;  3LQR A;  3FGA C;  2LNH C;  3SYL A;  2YEQ A;  2UXD E;  4JI8 E;  1K3X A;  3VFD A;  2VQF E;  4LJ9 A;  3H69 A;  3DW8 C;  1SXJ D;  2L8T A;  1T4O A;  4FWD A;  3AFH A;  2L7H A;  3RL5 A;  3W0F A;  1QQW A;  5CFF E;  2CV1 A;  4DV0 E;  3FLO A;  1SXJ A;  3FYC A;  1DGB A;  1R7R A;  1I4W A;  2WDD A;  2H1R A;  2YNM D;  4DV7 M;  2RS6 A;  3AL0 C;  3AOG A;  4CIS A;  1Z6T A;  4P7D A;  4BCA A;  1YSY A;  3FUW A;  4JYA M;  1XHB A;  1SU1 A;  2V87 A;  1T3T A;  4B7H A;  4UT3 B;  3E9S A;  4V0V A;  4AKI A;  4CHT B;  2V85 A;  4DR4 M;  2XMO A;  2B3T B;  2MC6 A;  4F0Z A;  4DMI A;  1N34 E;  4JI3 E;  3GQ5 A;  3J80 S;  1NHG C;  4CGY B;  5EP1 A;  4LZJ A;  3KW6 A;  3SAV A;  4OU7 A;  2G5G X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...