5F3WA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
366
structure length
352
Chain Sequence
b'HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Dna binding protein/hydrolase/dna
total genus 105
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5f3wA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5f3wA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5f3wA01
4H1SA 1JK7A 5INBA 4MP0A 3ZTVA 3RL4A 4FBQA 4UT3B 4YKEA 4ORCA 3RL5A 4G9JA 4WWLA 1WAO1 3IB8A 4LU9A 4H2BA 3IVEA 3DSCA 4IL1A 3ZU0A 4B2OA 4H2FA 4JA9A 4ORBA 3AV0A 3PSNA 2USHA 5J28A 4H2IA 1Z2XA 2Q8UA 2NXFA 1S3NA 4HD0A 4I5NC 1II7A 3E7BA 1SU1A 3QFOA 4V0XA 2XMOA 2BQ8X 3AUZA 3C9FA 5HPEA 4IYPC 4LTYA 3H64A 4KBPA 1XZWA 4KKZA 4V0VA 3E7AA 4DSYA 4OR9A 1T70A 2AHDA 3EGHA 1HP1A 4FBWA 3K7WC 1S70A 3FGAC 3DW8C 1M63A 2NYMC 1MF8A 4J6OA 3V4YA 3H69A 1S3MA 1S3LA 3ICFA 4MOVA 4FCXA 2Z1AA 2Z72A 3HVQA 1G5BA 3RL3A 4JA7A 1U32A 4O24A 1HO5A 1S95A 4M0VA 4H1YP 2QFRA 5C1VA 3K7VC 4O43A 3T1IA 4LACC 1WARA 5JPEA 1OIDA 4NZVA 2NPPC 1HPUA 3LL8A 1UF3A 2O8AA 2QFPA 4O4KA 1IT6A 4ZVZA 5B8IA 2WDCA 3H63A 1T71A 1W24A 4ORAA 2NYLC 1V73A 3PSOA 5JJTA 3H61A 1Z2WA 5EQVA 3TGHA 3KBPA 4H2GA 5JPFA 2R17A 3IVDA 4XPNA 2A22A 2IAEC 4UWQA 5DNYA 4UT2A 3QFNA 3THNA 3H68A 3GVEA 3P71C 2GJUA 1USHA 2WDFA 2O8GA 1QHWA 3THOB 3JYFA 3H60A 2JOGA 1OI8A 4MOYA 2ZBMA 3CK2A 2HYPA 5IOHA 2HY1A 1OIEA 1XM7A 5F3WA 1NNWA 2IE3C 3QFMA 5GTUA 4UT3A 2BCDA 2QJCA 4Q7FA 3IB7A 2DFJA 3H62B 4DHLA 4FBKA 3QG5C 2YVTA 2HYOA 4ZX2A 1AUIA 3H66A 3RQZA 1TCOA 2KKNA 2Z06A 3DSDA 2BDXA 4DT2A 2CV9A 3EGGA 2WDEA 2WDDA 4TUIA 1UTEA 3N5UA 4O5GA 4I5LC 3H67A 1FJMA 4V0WA 4TUGA 1S8EA 2P6BA 1QFCA 3C5WC 1KBPA 4F0ZA 2IE4C 3QFKA
chains in the Genus database with same CATH superfamily
4L78A 4G4OA 2ZOAA 4MP0A 4Y28F 2V83A 2EPAA 3I51A 4IBEA 2LJHA 4BHCA 2J7OA 5LLQA 4IL1A 1N32M 1T3TA 4LFBE 4BBAA 5FLXS 3PSNA 4RKUF 2N35A 2EMHA 1A1FA 2C5RA 3VYXA 3SATA 1II7A 2YRMA 4RHBB 5EP4A 2Z7JA 2YTQA 3HU3A 4LFAM 4DV7E 3NBXX 4JI1M 2JZ0A 3JAMS 2R45A 3EPLA 4DV2M 4IBGA 4X62E 4MGHA 1IM2A 2DKLA 2VQEM 1JR3D 2BJVA 2EPRA 4JI8E 2Y20A 2CV2A 4DR3E 1Z2WA 3Q8XA 3U6PA 3VK8A 2JOBA 2YWQA 5FTNA 3MSWA 2X49A 2K4VA 3FKEA 4W5WA 3HHZA 2L2KB 1QHWA 3JYFA 2V8QB 3QYBA 1N77A 2LTSA 3KP0E 2L3CA 5FLXC 1A1HA 2ADRA 1PJTA 2CUZA 3U6DA 4KO8A 2BDXA 4XK8F 4Z8XA 5A6JA 1UTEA 4AZFA 2LHGA 2UXCE 1QFCA 3EPHA 2IE4C 1D2NA 1IXSB 1BVSA 1DO0A 3JAMC 3B7NA 1J09A 1FKAE 1EIJA 5DYIA 1OAIA 3VYYA 3FRIA 4H2BA 1LTMA 1XMQM 2JXNA 2JUJA 4LF9M 1HR0E 1IY0A 2XSZD 4GEWA 2UXDM 1ZBTA 4OOGC 2JP7A 2EOIA 1VEGA 4PCZA 4BCAA 1DGGA 1G41A 4IYPC 2GPIA 3E7AA 3HY5A 1JB0F 2I7PA 4GEQB 1G71A 4L5NC 3GPPA 3K7WC 3IWCA 3DW8C 3V4YA 1MX0A 2EM4A 1GVNA 2YFQA 1NO1A 3AL0C 2B7VA 1HO5A 3PNVA 2RPCA 2ZO9B 2JWSA 4OX9E 4GH9A 3HJSA 2LE2A 3HKPA 4IBCA 5JPEA 3J80S 4O4KA 1HPUA 5EQTA 1UF3A 3Q8GA 5EP2A 1X6HA 4B3TM 1J5EM 2BJWA 2LHCA 5FTKA 3H61A 2EMIA 4MGYE 4NRVA 3TWKA 2H5XA 2QQ8A 2YTEA 4IBBA 2HHHM 2A22A 2R65A 5DNYA 2KXEA 1T38A 3UJNA 1TF3A 2DWMA 2WBUA 5KL6A 3FRHA 2EJ4A 3E4RA 2QPAA 4LJ9A 1OIEA 3OMLA 4IJDA 4L4UA 3GPXA 2LUPB 5ITRA 1AAYA 1K3XA 1DGFA 2LUQA 4M2ZA 1PJJA 2UUCE 2EPCA 4TUGA 1S8EA 1TH4A 2BNKA 1NVMA 1PJIA 2KNZA 5INBA 3ZTVA 4FBQA 2DRPA 4X65E 2YTFA 2LT7A 5LMUE 2KRUA 2HKJA 2VE7C 4HL4A 4IJFA 2KHHA 3J80C 1C7YA 4FK5C 3HWSA 1G4AE 2L92A 4R2CA 1SXJD 1QZMA 1GTKA 2MDRA 3RGSA 2Y21A 4DSYA 1LV7A 2R18A 1UFZA 1DI2A 2FS1A 4FBWA 1L2DA 2WSEF 4DKKA 1MF8A 3KS8A 1XMOE 3WHKA 4JA7A 4JI0E 3SHGB 1IN7A 2MROB 1YSAC 1GO5A 1OIDA 3GLGB 2DHRA 4IJEA 2LRSA 2VDBB 3TPZA 1SG9A 3KVWA 2C98A 3HQ1A 5IWAE 2B7TA 4DR5E 4R71A 3HHXA 2CV1A 4DR6M 1GABA 1F2IG 5EQVA 3L25A 2BB8A 1LLMC 2Z8YM 3CF0A 4B3RE 5C1BA 2EOEA 3IVDA 4Q35B 4LRSA 2JVAA 3HPZA 4B3SE 1GJTA 2DAEA 4LJ5A 1R5LA 4GZNC 2JXPA 1WHCA 3L28A 4DV4E 2EN6A 3GLGE 5IOHA 4L16A 1IXSA 4YY3M 1XM7A 1UHZA 4AKHA 2JPAA 1GJSA 1HNXE 5JI2E 1PM5A 2EOHA 2VF7A 3UGJA 2L3JA 2Z4SA 1XXHB 1JK1A 2Z3XA 3H67A 1IBME 4GKKE 2EPUA 3LMMA 5A2QS 1HT1E 2EE8A 1EFUB 4L6V6 1R7RA 3IHPA 4YKEA 3RL5A 4G9JA 2DZOB 3U6MA 1QU6A 1KJKA 2LVPC 2M5ZA 3GLHE 2A5YB 4PT5A 4YHHM 4H2IA 2DZNB 1A1LA 2RGHA 3KW6A 4G4RA 4IBDA 3AUZA 2EPMX 2EN1A 2KNVA 4NRWA 2NYMC 2L7HA 1N32E 2GQFA 2DAGA 3HVQA 3LVWA 2CT1A 2IHR1 1FJGE 2V86A 2PRTA 2Q2EB 4NZVA 3H09A 2N3HA 4DR4M 3TWMA 3LCVB 1T43A 4MM3B 1NJFA 3SMPA 2YTGA 5JJTA 4LFAE 1FNNA 4JI1E 1IMUA 1HT2E 1N36M 2LVNC 2V6ZM 1NEIA 2XH9A 4BC9A 3GVEA 2EQ3A 4IBIA 3SHFA 4LJ6A 1IY1A 2UUAE 1J26A 2BWBA 4LJ8A 4GMQA 4K0KM 3VFDA 1GLNA 2R62A 1Z5CA 4R2PA 1WR1B 2ZAOA 4DMIA 4F9CB 2D7GA 3N5UA 4O5GA 3WHLA 5AC4A 1IBKM 2MR9A 2LO3A 1ZR9A 1UBDC 3RL4A 4NSRA 4HTGA 3T6PA 1AUAA 3ZU0A 4JI4E 4GKJE 1J7KA 1ZQ9A 1NNUC 2EOMA 3L29A 3KS4A 4LFCE 4IIWA 4I5NC 3GLGA 4V0XA 3J7Yp 2BQ8X 4G4NA 1R2YA 2YSPA 4LY6A 4DV1M 4ANRA 3H4JA 5AASA 1HP1A 2YPNA 3W0FA 3L27A 5IZ7D 4JI7M 3A42A 1XMQE 3HZJA 2E5LM 4AG5A 3T1YM 1N34M 4JV5M 4DR2M 2JY6B 3LMLA 4LF9E 3VK7A 1S95A 4DV3M 5EXXA 1EKZA 2HL7A 4QHTA 1I94M 3E0JA 4RNAA 1KSFX 3KZYA 4R03A 1N78A 3C6KA 3FLOA 2F4VM 1MGTA 1T6OA 3BIDA 1IT6A 3I4VA 3PVSA 5A6AA 1QNTA 5KPRA 3GLIB 3MHVC 2JY5A 3VDPA 4L8RC 4B3MM 1AH5A 5JPFA 3I04M 3B7QA 4XPNA 2QNJA 4DV5M 2IAEC 1XXHA 1Z5BA 2ZANA 3P71C 1HNWM 3H60A 3PFIA 4LRTA 3CK2A 2UU9M 4WPYA 2JY7A 2EMAA 2IE3C 4B3TE 1WGNA 2DAIA 3U6EA 3GLIE 1YZ9A 1XNQE 2ENAA 1IQOA 2Z4RA 2KKNA 2HHHE 2ELYA 5IV8B 2QP9X 3KSXA 5GKNA 2MC5A 2VQFM 2CSHA 3IWDA 1JK7A 1TDHA 3LQRA 4WX9A 3DFZA 2EMXA 2WBSA 4FW9A 4MLVA 4WXCA 1QVRA 3K6QA 1IBLE 1RMDA 4R2EA 3B9PA 4R3DA 4CIZA 3KOYE 2EL5A 4R2DA 5KQDA 2NXFA 4DV6E 3CGWA 2AHMA 3U6QA 2FNAA 3F92A 1S70A 4FD2A 2EN4A 2K0BX 2EM0A 5CFFE 2JR1A 1G5BA 1BBOA 4O43A 1R2ZA 1Z59A 1XHBA 4B7FA 3C6MA 3SMSA 1WGLA 2FOIC 1T71A 1X47A 4NL4H 1V73A 5ITTA 3TGHA 2C9CA 2F5OA 2WSFF 2NUGA 4FWGA 2DVWB 2GJUA 4M9VC 3THOB 1DGHB 5KL4A 5KL7A 2EPPA 1YUJA 1DV0A 4LF4M 2A25A 2C96A 2DZLA 1NCSA 1H6UA 4DR6E 4X64E 2YVTA 3KP1E 4R8OA 1GL7A 3SYLA 1NJGA 4MLQA 2MDGA 3M99B 1A1IA 3THGA 1E9SA 2YNMD 2L4FA 2YTJA 2EOFA 1K3WA 5BR8M 2RGOA 1N75A 2L09A 2CWBA 3HTXA 4RF0A 4UT3B 4EIWA 4WWLA 1R6BX 2CHGA 4LU9A 3T38A 3DOAA 1F4IA 2EORA 1L4SA 3F6HA 3AOEC 3SBJA 3U61B 4M9SA 2EQ0A 4OU7A 4JYAM 2YTIA 3FD9A 1E9RA 3HX3A 2G8LA 1WRJA 3R9XB 2X4AA 4KBPA 1XZWA 4OR9A 2YZTA 4FCTA 1UILA 2J7JA 3GLIA 2JWOA 3U6CA 5C18A 1OIPA 2Z72A 2RSMA 2F5PA 3U5ZB 2QFRA 1UN6B 4YHHE 3ADLA 3B89A 4LZJA 1HQYE 4M9XA 2FV4B 2QFPA 4JI6E 2YQZA 1W24A 3J81S 1XB2B 3PSOA 4JN6A 2DMIA 3SYKA 2C9OA 1DGBA 1YYKA 1VEJA 4LF7E 1E94E 2R4JA 3RE8A 4J8ZA 1DQ3A 1N33M 1NHGC 3KXEC 2WDFA 2O8GA 2XGNA 2UUBE 4IS1C 2EM9A 2L33A 2O5RA 4AI6A 2W82A 1G2DC 1YUBA 1BB8A 4DR7M 4CJ6A 1PDAA 5ITQA 3LW5F 2EPLX 3H62B 1WHNA 3ZQJA 4B08A 2OOAA 1N36E 2ELZA 2EMLA 3DSDA 2O25A 1Z5AA 1RU3A 2YR0A 2J5YA 3JTZA 1TH2A 2YTDA 4B7HA 2ZTDA 3C5WC 2EMBA 1KBPA 5IREB 1TF6A 4H1SA 1QUTA 4K0KE 2EO2A 3C4BA 3QWLA 1HNZM 4WSGA 3EPJA 4DUYM 1TN9A 3DSCA 3W67A 4B2OA 4H2FA 4F54A 3UK3C 2EPNA 1JK2A 3M6AA 2EA0A 3J81C 4HD0A 3HJ8A 1A1KA 4LTYA 5AE3A 4V0VA 5EXTA 3DJWA 1T70A 2RKOA 4L8NA 3K92A 2R46A 2EUCA 4MOVA 4X8WA 3CF6E 3RL3A 3SAVA 1T4OA 2YTNA 1S3SA 3L00A 5AE2A 2QHOB 3BOSA 1QZEA 3VDUA 2G7HA 3DF6A 1SXJC 1DGHA 4WFTA 2HAKA 2LBSB 3CF2A 1T39A 2QZ4A 4XBOA 1O0WA 5E6JA 2RRUA 2QCUA 5EP1A 4IBKA 3E46A 3T1YE 1N34E 1D0LA 5ITXE 1ORYB 3MHHC 4NHRA 4DR2E 4LG2A 4JV5E 2HJJA 3T1HM 3CTWB 3B74A 2K7IA 4DR1M 4UT2A 2JY8A 2V1UA 2KOUA 2B9DA 4X9JA 3GRRA 2EKFA 4GC9A 2MKDA 4ZYHA 4KODA 1TH3A 1NNWA 3BBZA 3J7AG 4UT3A 4DV7M 5EJCA 4DHLA 3FUVA 1AUIA 3J7BA 2EMGA 2EMZA 3U61A 1Y8GA 4HEIA 4PDGA 2N3GA 4DV5E 3JR5A 4X62M 2WDEA 3EGGA 1PKPA 3FTEA 4TUIA 5FTLA 2WZOA 1HNWE 2CHQA 1IXRC 1L8QA 2UU9E 4JI3M 3FIGA 4ORCA 2DXIA 5FTMA 4DR3M 2M7QA 3IB8A 1UM8A 5L8RF 3SC3A 4GC5A 4FVMA 2ZM6M 2ODRD 1KYQA 3U5ZA 3RFWA 2KONA 1MU5A 1QAOA 2LVHA 1MN3A 2VQFE 2KHXA 3A45A 2O01F 2YTPA 4LJ4A 4KKZA 3OTOM 2AHDA 1ZBQA 3ZC7B 2GHFA 2XFSA 1XWIA 2CTDA 3VLFB 2EOQA 1A1JA 2Z1AA 4MH0E 2LV2A 3IG8A 5LMNE 1Z1BA 4AQYM 3FTFA 2Y0QA 4NXME 1XXHE 2XFTA 2CPNA 4NXNE 2NPPC 4X66E 2YSOA 4B7GA 2DSYA 2VIIA 4M0WA 2EM8A 4QNMA 2YU8A 1HR0M 3HXLA 2GLIA 2K9DA 2MGWA 1WIVA 2NA2A 2BBGA 4LCBA 4FCVA 1OKSA 3HHYA 2DWNA 2I9IA 4R2AA 3P1XA 2YU5A 2JYAA 1Q02A 3NWLA 2G5GX 2OPFA 2ZTCA 2JZ1A 3MK6A 5F3WA 1EE8A 4ITQA 2XSZA 3RQZA 2EOYA 3R8FA 2OOBA 4OX9M 5A2QC 4DV2E 2WDDA 3SAWA 4MGKE 4QOSA 5JI3E 5A69A 1Q3CA 4G6ZA 2P6BA 3BBGA 5KPZA 3QFKA 4R7GA 3EIEA 2VQEE 5FTJA 3W0LB 2EOXA 1TR8A 2Y0TA 1PJSA 5ITXA 4JI5M 3KFUG 1CUKA 3IG5A 4P78A 5KL5A 1ZAAC 2USHA 2X8AA 2H36X 2EMFA 1TGUA 5BR8E 1N3GA 3E7BA 2JY9A 5KO3A 5T6JA 3RGPA 1HJPA 1I4WA 2FFJA 3GO8A 4BB9A 1W5SA 1IXZA 2KNAA 3BF2A 3TQSA 2E72A 5IT9S 2L2DA 4M0VA 2UUCM 2KW0A 4LACC 3GLFB 1QANA 1IN6A 1QDRA 4XGIA 1NNJA 4F6MA 4MGIE 4ZVZA 4BBYA 1D0KA 4F2JC 1NV9A 1R4GA 2JA2A 1YYWA 1WJPA 1G3IA 2MKNA 4Z6YA 1X5WA 4I81A 2FTXB 2DAMA 3F6GA 2QENA 2UXDE 1QAQA 4D81A 1X3CA 3HHWA 1IFYA 1X49A 3KOZE 2JOGA 1RC7A 4LGMA 3J2PB 3HPSA 1V92A 4F9AB 2F8BA 3D8BA 4CGYB 2VRDA 4OW0A 4LJ7A 1G2FC 4KZSA 2DIXA 1BBGA 2FE8A 1AIPC 1N33E 2R4EA 4I5LC 2RSIA 2EMKA 2V85A 2R44A 1WXRA 3K8ZA 1DGCA 5IT9C 5EP3A 2N8XA 1ZMWA 2M4IA 1ZMVA 4FWDA 4DR7E 3SFZA 1J5EE 3VKGA 4R2SA 3FUXA 4B3RM 1OFIA 2R6FA 2LCEA 3AV0A 1OAOC 3A46A 4CISA 3HGIA 2LBCA 4M9ZA 1Z2XA 5J28A 4GITA 3L26A 4BS9A 2K47A 4G3OA 3EQ1A 1PRBA 5HPEA 1NHWC 2ENHA 4Q7JA 3FYCA 3M7GA 5ITYA 3UMMA 3TWLA 1HNZE 1GQEA 3GRVA 2EM6A 1ZAEA 2FH0A 2OO9A 5AC5A 2KDLA 4DUZM 1OFHA 1EH6A 2HCBA 3T1IA 2XEPA 4GKKM 2DLKA 3LL8A 3KOXE 4ZPXA 4GRIA 2XZFA 2L6OA 4ORAA 2YRKA 2RTXA 3AFHA 4Q28A 2UXBM 4LZZA 2V89A 3BGHA 3BXWA 1P3QQ 4F2LA 2QBYB 2YT4A 2NABA 1PGYA 1XC8A 8CATA 3QFNA 4QHSA 3ILKA 2L8TA 3VHTB 2ZBMA 4LJAA 3TE6A 1IQSA 4I5SA 2M1SA 2EOZA 3FUUA 4G4QA 4FBKA 3MMPA 2EM7A 2I13A 1KYIA 3T1HE 2H1RA 2CV9A 1FJGM 4DR1E 2L4EA 2HGHA 2G3QA 3H64A 1RQ0A 4WP2A 4LF6M 3HU1A 3FTCA 4OVZB 2L6MA 3LCUA 2LJUA 2NUEA 2EN8A 2RS7A 4RH8A 2DMYA 4GHAA 2D7HA 3E9SA 4JI2M 5A6BA 3GLFA 2UUAM 3W68A 3JU0A 2F5SA 1VDLA 2XF3A 4IBFA 3C9FA 2DWZB 2CV0A 5KPTA 4JI3E 4YY3E 2P5TA 1IY2A 3V76A 2HC5A 3FGAC 2KEBA 3PXGA 1ZV1A 5DFLA 4FCXA 2LVAA 2ZM6E 5C1VA 1D0MA 2EMYA 4N4RB 3C4TA 3C9PA 1WARA 2D7EA 2DLQA 2R1FA 3KDSE 2HWJA 3D8LA 5H37D 2EL4A 4LGYA 5E26A 3ZCBB 4AW4A 2MH8A 2EWLA 3OTOE 2KRKA 3GQ3A 3QYEA 2M9AA 3AJIB 4JI4M 2WBTA 3EIHA 2YRHA 2JP9A 3T15A 4GKJM 2EL6A 4AQYE 1MEYC 3NBIA 4LF8M 4LFCM 4LF5M 2KZSA 2CFOA 2DI0A 3FYDA 1KFVA 1OJLA 2EOJA 3FE3A 7CATA 2QJCA 2EOOA 4KHPM 3IB7A 4PD2A 2LNHC 4BHBA 2DFJA 3QG5C 2DGCA 3A98B 2Z06A 3J27B 4DT2A 3PNYA 4JXJA 5KL3A 2WCC3 1E32A 2OQ4A 1JR3E 4DR4E 1G8PA 3RMPA 1EH7A 2EN3A 1W5TA 1YUIA 2GNOA 4A3VB 4WW0A 3ADJA 2WSCF 3ADIA 3ZH9B 4WYQB 4ORBA 4DV0M 2EM2A 2BWEA 1YSYA 3DZDA 4BLCA 2FGGA 5EXSA 2DWLA 4R2QA 2CE7A 2I7NA 1XNRM 1C1KA 4J6OA 4JI5E 1XNQM 1TTEA 3ICFA 3D03A 3IWBA 5FSWA 5KL2A 2QBYA 3FUTA 3I4YA 2K6BA 1X6EA 4P17A 1WJ7A 4D80A 1IBKE 1YLAA 2XLJA 3GQ4A 1EH8A 5BPVA 3KZZA 4F6NA 3KSJA 1IBLM 1TF0B 3HJQA 1X6FA 1VG5A 4UWQA 1QUSA 2CHVA 2WZJA 4DV6M 1OTRA 1YFHA 2L7IA 3U6SA 1OI8A 4MOYA 4ZYGA 3U6LA 4DV1E 1DO2A 5GTUA 3LQQA 1HQCA 4OVZA 2KZUA 4JI7E 5IXMB 2E5LE 4BMJA 3QAUA 4ZX2A 3H66A 3TQMA 4LFBM 3AKZA 4DV3E 2R76A 3UK6A 4CHTB 1FJMA 1I94E 2KA6B 3AOGA 1Q3BA 4RF1A 2LTUA 2F4VE 1L1ZA 1X37A 3GRUA 1WAO1 3EPKA 3VKHA 4B3ME 2L2MA 4I4LA 3C3EA 3LLHA 4JA9A 1V33A 5A6KA 1A1GA 4HEOA 4KLNA 3J7AS 3E21A 2RQLA 1Q39A 4NSOB 4M0DA 1GKIA 2MC6A 4JI8M 4X64M 1TDZA 1ZMUA 2EOSA 1M63A 1YYOA 3GQ5A 1S3LA 2LVOC 4WXDA 3IECA 2ODRC 3U60B 4O24A 1U32A 2CRUA 4H1YP 3L2AA 4I8OA 2ZAMA 2EPZA 1V34A 1GL6A 1SXJB 1VDDA 2EM5A 4M30A 1JR3A 3K2LA 3TL4X 3FTDA 2O8AA 2EPXA 4P7DA 5B8IA 2LVQD 2F5QA 3ZOQB 1MJGM 1IN4A 3GLHB 4H2GA 2V88A 2E1MA 4F9BB 4DUZE 5DYGA 1USHA 2UXCM 1JQJC 4D82A 1SXJE 1L1TA 2B3TB 2HYPA 3UZUA 4TUWA 2JOXA 2BCDA 2XZUA 3AOEA 2UXBE 2HYOA 2EJSA 4GHLA 4IBJA 2J7NA 4AG6A 2NUFA 1SR9A 2C99A 4L15A 4F1IA 1NSFA 4JI6M 1VQ1A 1VEKA 3GPYA 4NOOB 3IVEA 2EP3A 4HLQA 2EMCA 2CEAA 4LF7M 1QDTA 3ADGA 2CP8A 1K82A 3GRYA 3M0EA 4MGZE 2UUBM 1SU1A 3GPUA 5A6BD 4LF6E 5AE1A 1T4NA 4NC6A 4LF4E 2EPKX 5EXPA 4P16A 1OIZA 2M60A 2VF8A 4GIPA 2EQ1A 1NY6A 3K7VC 4JI2E 2V1CA 3JR4A 2NQ8C 3K9PA 3VK6A 2LH0A 4WSPA 1OQYA 3FUWA 2DXNA 2DHYA 1QQWA 3ECRA 2WDCA 2JNHA 4FCWA 1IN5A 2ERCA 2R17A 1WHQA 3I01M 3U6OA 1Z6TA 2V87A 3THNA 3H68A 2EKKA 4JYAE 4QNRA 4PDIA 1NY5A 3QFMA 2ZBKB 1IN8A 5ITUA 4X65M 4WURA 5TSEA 4DBGB 5LMUM 2EM3A 1P47A 4UN2B 2QSFX 4LF8E 4LF5E 4FWHA 4V0WA 2MJ5B 4R2RA 4S12A 4F0ZA 3GLFE 1NV8A 3DA1A 2EZ6A 1STUA 1QAMA 4KHPE 2EMWA 3H4MA 1XMOM 3KWRA 4ZYEA 1YPNA 4JI0M 3U60A 1GZ6A 1IQPA 2R0IA 2Q8UA 4REZA 1A5TA 3KOWE 1S3NA 1SXJA 3QFOA 1L2CA 1ZU1A 4MB7A 1B69A 4KWYA 2XMOA 2VF1A 2YEQA 2ENCA 5IWAM 3EGHA 4DR5M 1L2BA 1PJQA 3K1JA 3SARA 2LWXA 3H69A 1YE9A 1S3MA 3GLHA 4ZYDA 2LMZA 2EN2A 4DV0E 3K9OA 2DNAA 4B3SM 3SAUA 2DXLA 2DB2A 3SASA 4KT0F 1T4LB 2F5NA 3C58A 4DV4M 4BC7A 2EPOA 2EN7A 2B3TA 5KQ8A 3HU2A 3H63A 1SFEA 1XNRE 2NYLC 1HNXM 4DUYE 3KBPA 2L2NA 1G59A 5ADZA 1WXQA 2LTRA 3MJ5A 1IBMM 3C3DA 3MHSC 4II7A 3GP1A 2HY1A 4AKGA 2APLA 2LXEA 3LVVA 2DAKA 4Q7FA 1X48A 2D9HA 2DENA 2RS6A 1QYRA 5LMNM 4AKIA 1TCOA 2YTOA 4NXMM 5LL6R 3B7ZA 4NXNM 4QOZC 4X66M
chains in the Genus database with same CATH topology
4L78A 4G4OA 2ZOAA 4MP0A 2V83A 3I51A 4IBEA 2LJHA 2J7OA 4IL1A 1N32M 1T3TA 4LFBE 4BBAA 5FLXS 3PSNA 2C5RA 3VYXA 3SATA 1II7A 5EP4A 2Z7JA 3HU3A 4LFAM 4DV7E 4JI1M 3JAMS 2R45A 4DV2M 4IBGA 4X62E 4MGHA 1IM2A 2VQEM 1JR3D 2BJVA 4JI8E 2Y20A 2CV2A 4DR3E 1Z2WA 3Q8XA 3U6PA 3VK8A 2JOBA 5FTNA 3MSWA 2X49A 2K4VA 3FKEA 4W5WA 3HHZA 2L2KB 1QHWA 3JYFA 2V8QB 1N77A 2LTSA 3KP0E 2L3CA 5FLXC 2CUZA 3U6DA 4KO8A 2BDXA 4Z8XA 1UTEA 4AZFA 2UXCE 1QFCA 2IE4C 1D2NA 1IXSB 1DO0A 3JAMC 1J09A 1FKAE 5DYIA 3VYYA 4H2BA 1XMQM 4LF9M 1HR0E 1IY0A 2XSZD 1ZBTA 2UXDM 4OOGC 4PCZA 4BCAA 1DGGA 1G41A 4IYPC 3E7AA 2I7PA 4GEQB 4L5NC 3GPPA 3K7WC 3IWCA 3DW8C 3V4YA 1MX0A 1GVNA 2YFQA 3AL0C 2B7VA 1HO5A 3PNVA 2ZO9B 4OX9E 4GH9A 3HJSA 2LE2A 3HKPA 4IBCA 5JPEA 3J80S 1HPUA 1UF3A 5EQTA 4O4KA 5EP2A 4B3TM 1J5EM 2BJWA 5FTKA 3H61A 4MGYE 4NRVA 3TWKA 4IBBA 2HHHM 2A22A 2R65A 5DNYA 2KXEA 3UJNA 2DWMA 3E4RA 2QPAA 4LJ9A 1OIEA 3OMLA 4L4UA 3GPXA 2LUPB 5ITRA 1K3XA 1DGFA 2LUQA 4M2ZA 1PJJA 2UUCE 4TUGA 1S8EA 1TH4A 2BNKA 1NVMA 1PJIA 5INBA 3ZTVA 4FBQA 4X65E 5LMUE 2KRUA 2HKJA 2VE7C 4HL4A 4IJFA 3J80C 3HWSA 1G4AE 2L92A 1SXJD 1QZMA 2MDRA 3RGSA 2Y21A 4DSYA 1LV7A 2R18A 1DI2A 4FBWA 1L2DA 4DKKA 1MF8A 3KS8A 1XMOE 3WHKA 4JA7A 4JI0E 3SHGB 1IN7A 1OIDA 3GLGB 2DHRA 4IJEA 2LRSA 3TPZA 3KVWA 2C98A 3HQ1A 5IWAE 2B7TA 4DR5E 3HHXA 2CV1A 4DR6M 5EQVA 3L25A 3CF0A 4B3RE 5C1BA 3IVDA 4LRSA 2JVAA 3HPZA 4B3SE 4LJ5A 3L28A 4DV4E 5IOHA 4L16A 4YY3M 1XM7A 1UHZA 4AKHA 1HNXE 5JI2E 1PM5A 2L3JA 3UGJA 2Z4SA 1XXHB 2Z3XA 3H67A 1IBME 4GKKE 3LMMA 5A2QS 1HT1E 1R7RA 4YKEA 3RL5A 4G9JA 2DZOB 3U6MA 1QU6A 2M5ZA 2A5YB 4PT5A 4YHHM 4H2IA 2DZNB 2RGHA 3KW6A 4G4RA 4IBDA 3AUZA 4NRWA 2NYMC 2L7HA 1N32E 3HVQA 3LVWA 2IHR1 1FJGE 2V86A 2Q2EB 4NZVA 3H09A 2N3HA 4DR4M 3TWMA 4MM3B 1NJFA 3SMPA 5JJTA 4LFAE 1FNNA 4JI1E 1HT2E 1N36M 2V6ZM 2XH9A 4BC9A 3GVEA 4IBIA 3SHFA 4LJ6A 1IY1A 2UUAE 1J26A 4LJ8A 4GMQA 4K0KM 3VFDA 1GLNA 2R62A 1Z5CA 2ZAOA 4DMIA 4F9CB 2D7GA 3N5UA 4O5GA 3WHLA 1IBKM 3RL4A 4NSRA 3ZU0A 4JI4E 4GKJE 1J7KA 1ZQ9A 1NNUC 3L29A 3KS4A 4LFCE 4IIWA 4I5NC 3GLGA 4V0XA 3J7Yp 2BQ8X 4G4NA 1R2YA 4LY6A 4DV1M 5AASA 1HP1A 3W0FA 3L27A 5IZ7D 4JI7M 3A42A 1XMQE 2E5LM 4AG5A 3T1YM 1N34M 4JV5M 4DR2M 3LMLA 4LF9E 3VK7A 1S95A 4DV3M 5EXXA 1EKZA 2HL7A 4QHTA 1I94M 3E0JA 4RNAA 1KSFX 4R03A 1N78A 3FLOA 2F4VM 1IT6A 3I4VA 3PVSA 5KPRA 3GLIB 3MHVC 3VDPA 4L8RC 4B3MM 5JPFA 4XPNA 4DV5M 2IAEC 1XXHA 1Z5BA 2ZANA 3P71C 1HNWM 3H60A 3PFIA 4LRTA 3CK2A 2UU9M 4WPYA 2IE3C 4B3TE 3U6EA 1YZ9A 1XNQE 2Z4RA 2KKNA 2HHHE 2QP9X 3KSXA 5GKNA 2MC5A 2VQFM 3IWDA 1JK7A 1TDHA 3LQRA 3DFZA 4FW9A 1QVRA 3K6QA 1IBLE 3B9PA 4R3DA 3KOYE 5KQDA 2NXFA 4DV6E 2AHMA 3U6QA 2FNAA 1S70A 4FD2A 5CFFE 2JR1A 1G5BA 4O43A 1R2ZA 1Z59A 1XHBA 4B7FA 3SMSA 2FOIC 1T71A 1X47A 4NL4H 1V73A 5ITTA 3TGHA 2C9CA 2F5OA 2NUGA 4FWGA 2DVWB 2GJUA 3THOB 1DGHB 4LF4M 2C96A 1H6UA 4DR6E 4X64E 2YVTA 3KP1E 4R8OA 1GL7A 3SYLA 1NJGA 3THGA 1E9SA 2YNMD 1K3WA 5BR8M 2RGOA 1N75A 2L09A 3HTXA 4RF0A 4UT3B 4EIWA 4WWLA 1R6BX 2CHGA 4LU9A 3T38A 3DOAA 3F6HA 3AOEC 3SBJA 3U61B 4M9SA 4OU7A 4JYAM 3FD9A 1E9RA 2G8LA 3R9XB 2X4AA 4KBPA 1XZWA 4OR9A 2YZTA 4FCTA 1UILA 3GLIA 2JWOA 3U6CA 5C18A 2Z72A 2RSMA 2F5PA 3U5ZB 2QFRA 4YHHE 3ADLA 4LZJA 1HQYE 4M9XA 2FV4B 2QFPA 4JI6E 2YQZA 1W24A 3J81S 3PSOA 4JN6A 3SYKA 2C9OA 1DGBA 1YYKA 4LF7E 1E94E 2R4JA 3RE8A 4J8ZA 1DQ3A 1N33M 1NHGC 3KXEC 2WDFA 2O8GA 2XGNA 2UUBE 2L33A 2O5RA 4AI6A 2W82A 1YUBA 4DR7M 5ITQA 3H62B 1WHNA 4B08A 1N36E 3DSDA 1Z5AA 2YR0A 3JTZA 1TH2A 4B7HA 3C5WC 1KBPA 5IREB 4H1SA 4K0KE 2EO2A 3C4BA 3QWLA 1HNZM 4DUYM 3DSCA 4B2OA 4H2FA 4F54A 3M6AA 2EA0A 3J81C 4HD0A 3HJ8A 4LTYA 5AE3A 4V0VA 5EXTA 3DJWA 1T70A 2RKOA 4L8NA 3K92A 2R46A 2EUCA 4MOVA 4X8WA 3CF6E 3RL3A 3SAVA 1T4OA 1S3SA 5AE2A 3BOSA 3VDUA 2G7HA 3DF6A 1SXJC 1DGHA 4WFTA 2LBSB 3CF2A 2QZ4A 4XBOA 1O0WA 5E6JA 2QCUA 5EP1A 4IBKA 3T1YE 1N34E 5ITXE 1ORYB 4JV5E 4DR2E 4LG2A 3T1HM 3CTWB 4DR1M 4UT2A 2V1UA 2KOUA 2B9DA 3GRRA 4GC9A 4KODA 1TH3A 1NNWA 3J7AG 4UT3A 4DV7M 5EJCA 4DHLA 3FUVA 1AUIA 3J7BA 3U61A 4PDGA 2N3GA 3EGGA 2WDEA 3JR5A 4X62M 4DV5E 1PKPA 3FTEA 4TUIA 5FTLA 2WZOA 1HNWE 2CHQA 1IXRC 1L8QA 2UU9E 4JI3M 3FIGA 4ORCA 2DXIA 5FTMA 4DR3M 2M7QA 3IB8A 1UM8A 3SC3A 4GC5A 4FVMA 2ZM6M 2ODRD 3U5ZA 3RFWA 2KONA 1MU5A 1QAOA 2VQFE 2KHXA 3A45A 4LJ4A 4KKZA 3OTOM 2AHDA 1ZBQA 3ZC7B 2XFSA 1XWIA 3VLFB 2Z1AA 4MH0E 3IG8A 5LMNE 4AQYM 3FTFA 2Y0QA 4NXME 2XFTA 2CPNA 4NXNE 2NPPC 4X66E 4B7GA 2DSYA 2VIIA 4M0WA 4QNMA 1HR0M 3HXLA 2NA2A 4LCBA 4FCVA 3HHYA 2DWNA 3P1XA 3NWLA 2G5GX 2OPFA 3MK6A 5F3WA 1EE8A 4ITQA 2XSZA 3RQZA 3R8FA 4OX9M 5A2QC 4DV2E 2WDDA 3SAWA 4MGKE 4QOSA 5JI3E 1Q3CA 4G6ZA 2P6BA 5KPZA 3QFKA 4R7GA 3EIEA 2VQEE 5FTJA 3W0LB 2Y0TA 5ITXA 4JI5M 3KFUG 3IG5A 4P78A 2USHA 2X8AA 2H36X 1TGUA 5BR8E 3E7BA 2JY9A 5KO3A 5T6JA 3RGPA 1I4WA 2FFJA 3GO8A 4BB9A 1W5SA 1IXZA 3TQSA 5IT9S 4M0VA 2UUCM 2KW0A 4LACC 3GLFB 1QANA 1IN6A 4XGIA 1NNJA 4MGIE 4ZVZA 4BBYA 2JA2A 1YYWA 1G3IA 4Z6YA 4I81A 2FTXB 3F6GA 2QENA 2UXDE 1QAQA 4D81A 3HHWA 1X49A 3KOZE 2JOGA 1RC7A 4LGMA 3J2PB 3HPSA 4F9AB 2F8BA 3D8BA 4CGYB 4OW0A 4LJ7A 4KZSA 2DIXA 2FE8A 1N33E 2R4EA 4I5LC 2V85A 1WXRA 3K8ZA 5IT9C 5EP3A 2M4IA 4FWDA 4DR7E 3SFZA 1J5EE 3VKGA 3FUXA 4B3RM 1OFIA 3AV0A 3A46A 4CISA 3HGIA 5J28A 4M9ZA 1Z2XA 4GITA 3L26A 4BS9A 2K47A 5HPEA 1NHWC 3FYCA 3M7GA 5ITYA 3UMMA 3TWLA 1HNZE 1GQEA 3GRVA 1ZAEA 4DUZM 1OFHA 2HCBA 3T1IA 2XEPA 4GKKM 3LL8A 3KOXE 4ZPXA 4GRIA 2XZFA 2L6OA 4ORAA 2RTXA 3AFHA 4Q28A 2UXBM 4LZZA 2V89A 2QBYB 2YT4A 1XC8A 8CATA 3QFNA 4QHSA 3ILKA 2L8TA 2ZBMA 4LJAA 3TE6A 4I5SA 2M1SA 3FUUA 4G4QA 4FBKA 1KYIA 3T1HE 2H1RA 2CV9A 1FJGM 4DR1E 3H64A 1RQ0A 4LF6M 3HU1A 3FTCA 4OVZB 2L6MA 2NUEA 2RS7A 2DMYA 4GHAA 2D7HA 3E9SA 4JI2M 3GLFA 2UUAM 3JU0A 2F5SA 2XF3A 4IBFA 3C9FA 2DWZB 2CV0A 5KPTA 4JI3E 4YY3E 2P5TA 1IY2A 3FGAC 2KEBA 3PXGA 4FCXA 2ZM6E 5C1VA 3C4TA 1WARA 2D7EA 3KDSE 3D8LA 5H37D 4LGYA 5E26A 3ZCBB 4AW4A 2EWLA 3OTOE 2KRKA 3GQ3A 3AJIB 4JI4M 3EIHA 3T15A 4GKJM 4AQYE 3NBIA 4LF8M 4LFCM 4LF5M 2KZSA 2CFOA 1KFVA 3FYDA 1OJLA 7CATA 2QJCA 4KHPM 3IB7A 4PD2A 2LNHC 2DFJA 3QG5C 3A98B 2Z06A 3J27B 4DT2A 3PNYA 4JXJA 1E32A 2OQ4A 4DR4E 1G8PA 3RMPA 1W5TA 4A3VB 4WW0A 3ADJA 3ADIA 3ZH9B 4WYQB 4ORBA 4DV0M 1YSYA 3DZDA 4BLCA 2FGGA 5EXSA 2DWLA 2CE7A 2I7NA 1XNRM 1C1KA 4J6OA 4JI5E 1XNQM 3ICFA 3D03A 3IWBA 5FSWA 2QBYA 3FUTA 3I4YA 4D80A 1IBKE 2XLJA 3GQ4A 5BPVA 3KSJA 1IBLM 3HJQA 4UWQA 2CHVA 4DV6M 2L7IA 3U6SA 1OI8A 4MOYA 3U6LA 4DV1E 1DO2A 5GTUA 3LQQA 1HQCA 4OVZA 2KZUA 4JI7E 2E5LE 4BMJA 3QAUA 4ZX2A 3H66A 4LFBM 3AKZA 4DV3E 3UK6A 4CHTB 1FJMA 1I94E 2KA6B 3AOGA 1Q3BA 4RF1A 2F4VE 1L1ZA 1X37A 3GRUA 1WAO1 3VKHA 4B3ME 2L2MA 4I4LA 3LLHA 4JA9A 4KLNA 3J7AS 1Q39A 4NSOB 4M0DA 1GKIA 2MC6A 4JI8M 4X64M 1TDZA 1M63A 1YYOA 3GQ5A 1S3LA 2ODRC 4O24A 3U60B 1U32A 4H1YP 3L2AA 4I8OA 2ZAMA 1GL6A 1SXJB 1VDDA 4M30A 1JR3A 3K2LA 3TL4X 3FTDA 2O8AA 4P7DA 5B8IA 2F5QA 3ZOQB 1IN4A 3GLHB 4H2GA 2V88A 2E1MA 4F9BB 4DUZE 5DYGA 1USHA 2UXCM 1JQJC 4D82A 1SXJE 1L1TA 2B3TB 2HYPA 3UZUA 4TUWA 2JOXA 2BCDA 2XZUA 3AOEA 2UXBE 2HYOA 4GHLA 4IBJA 2J7NA 4AG6A 2NUFA 1SR9A 2C99A 4L15A 1NSFA 4JI6M 3GPYA 4NOOB 3IVEA 4HLQA 2CEAA 4LF7M 3ADGA 1K82A 3GRYA 3M0EA 4MGZE 2UUBM 1SU1A 3GPUA 4LF6E 5AE1A 1T4NA 4LF4E 5EXPA 4P16A 2M60A 4GIPA 1NY6A 3K7VC 4JI2E 2V1CA 3JR4A 2NQ8C 3VK6A 2LH0A 4WSPA 3FUWA 2DXNA 1QQWA 2WDCA 4FCWA 1IN5A 2ERCA 2R17A 1WHQA 3U6OA 1Z6TA 2V87A 3THNA 3H68A 4JYAE 4QNRA 4PDIA 1NY5A 3QFMA 2ZBKB 1IN8A 5ITUA 4X65M 4WURA 5LMUM 4LF8E 4LF5E 4FWHA 4V0WA 4S12A 4F0ZA 3DA1A 2EZ6A 1STUA 1QAMA 4KHPE 3H4MA 1XMOM 3KWRA 4JI0M 3U60A 1GZ6A 1IQPA 2Q8UA 4REZA 1S3NA 3KOWE 1SXJA 3QFOA 1L2CA 4MB7A 2XMOA 2VF1A 2YEQA 5IWAM 3EGHA 4DR5M 1L2BA 3K1JA 3SARA 2LWXA 3H69A 1YE9A 1S3MA 3GLHA 2LMZA 4DV0E 4B3SM 3SAUA 2DXLA 2DB2A 3SASA 1T4LB 2F5NA 3C58A 4DV4M 4BC7A 5KQ8A 3HU2A 3H63A 1XNRE 2NYLC 1HNXM 4DUYE 3KBPA 2L2NA 1G59A 5ADZA 1WXQA 2LTRA 3MJ5A 1IBMM 4II7A 3GP1A 2HY1A 4AKGA 2LXEA 3LVVA 4Q7FA 1X48A 2RS6A 1QYRA 5LMNM 4AKIA 1TCOA 4NXMM 5LL6R 4NXNM 4QOZC 4X66M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H1S A;  1JK7 A;  5INB A;  4MP0 A;  3ZTV A;  3RL4 A;  4FBQ A;  4UT3 B;  4YKE A;  4ORC A;  3RL5 A;  4G9J A;  4WWL A;  1WAO 1;  3IB8 A;  4LU9 A;  4H2B A;  3IVE A;  3DSC A;  4IL1 A;  3ZU0 A;  4B2O A;  4H2F A;  4JA9 A;  4ORB A;  3AV0 A;  3PSN A;  2USH A;  5J28 A;  4H2I A;  1Z2X A;  2Q8U A;  2NXF A;  1S3N A;  4HD0 A;  4I5N C;  1II7 A;  3E7B A;  1SU1 A;  3QFO A;  4V0X A;  2XMO A;  2BQ8 X;  3AUZ A;  3C9F A;  5HPE A;  4IYP C;  4LTY A;  3H64 A;  4KBP A;  1XZW A;  4KKZ A;  4V0V A;  3E7A A;  4DSY A;  4OR9 A;  1T70 A;  2AHD A;  3EGH A;  1HP1 A;  4FBW A;  3K7W C;  1S70 A;  3FGA C;  3DW8 C;  1M63 A;  2NYM C;  1MF8 A;  4J6O A;  3V4Y A;  3H69 A;  1S3M A;  1S3L A;  3ICF A;  4MOV A;  4FCX A;  2Z1A A;  2Z72 A;  3HVQ A;  1G5B A;  3RL3 A;  4JA7 A;  1U32 A;  4O24 A;  1HO5 A;  1S95 A;  4M0V A;  4H1Y P;  2QFR A;  5C1V A;  3K7V C;  4O43 A;  3T1I A;  4LAC C;  1WAR A;  5JPE A;  1OID A;  4NZV A;  2NPP C;  1HPU A;  3LL8 A;  1UF3 A;  2O8A A;  2QFP A;  4O4K A;  1IT6 A;  4ZVZ A;  5B8I A;  2WDC A;  3H63 A;  1T71 A;  1W24 A;  4ORA A;  2NYL C;  1V73 A;  3PSO A;  5JJT A;  3H61 A;  1Z2W A;  5EQV A;  3TGH A;  3KBP A;  4H2G A;  5JPF A;  2R17 A;  3IVD A;  4XPN A;  2A22 A;  2IAE C;  4UWQ A;  5DNY A;  4UT2 A;  3QFN A;  3THN A;  3H68 A;  3GVE A;  3P71 C;  2GJU A;  1USH A;  2WDF A;  2O8G A;  1QHW A;  3THO B;  3JYF A;  3H60 A;  2JOG A;  1OI8 A;  4MOY A;  2ZBM A;  3CK2 A;  2HYP A;  5IOH A;  2HY1 A;  1OIE A;  1XM7 A;  5F3W A;  1NNW A;  2IE3 C;  3QFM A;  5GTU A;  4UT3 A;  2BCD A;  2QJC A;  4Q7F A;  3IB7 A;  2DFJ A;  3H62 B;  4DHL A;  4FBK A;  3QG5 C;  2YVT A;  2HYO A;  4ZX2 A;  1AUI A;  3H66 A;  3RQZ A;  1TCO A;  2KKN A;  2Z06 A;  3DSD A;  2BDX A;  4DT2 A;  2CV9 A;  3EGG A;  2WDE A;  2WDD A;  4TUI A;  1UTE A;  3N5U A;  4O5G A;  4I5L C;  3H67 A;  1FJM A;  4V0W A;  4TUG A;  1S8E A;  2P6B A;  1QFC A;  3C5W C;  1KBP A;  4F0Z A;  2IE4 C;  3QFK A; 
#chains in the Genus database with same CATH topology
 4L78 A;  4G4O A;  2ZOA A;  4MP0 A;  4Y28 F;  2V83 A;  2EPA A;  3I51 A;  4IBE A;  2LJH A;  4BHC A;  2J7O A;  5LLQ A;  4IL1 A;  1N32 M;  1T3T A;  4LFB E;  4BBA A;  5FLX S;  3PSN A;  4RKU F;  2N35 A;  2EMH A;  1A1F A;  2C5R A;  3VYX A;  3SAT A;  1II7 A;  2YRM A;  4RHB B;  5EP4 A;  2Z7J A;  2YTQ A;  3HU3 A;  4LFA M;  4DV7 E;  3NBX X;  4JI1 M;  2JZ0 A;  3JAM S;  2R45 A;  3EPL A;  4DV2 M;  4IBG A;  4X62 E;  4MGH A;  1IM2 A;  2DKL A;  2VQE M;  1JR3 D;  2BJV A;  2EPR A;  4JI8 E;  2Y20 A;  2CV2 A;  4DR3 E;  1Z2W A;  3Q8X A;  3U6P A;  3VK8 A;  2JOB A;  2YWQ A;  5FTN A;  3MSW A;  2X49 A;  2K4V A;  3FKE A;  4W5W A;  3HHZ A;  2L2K B;  1QHW A;  3JYF A;  2V8Q B;  3QYB A;  1N77 A;  2LTS A;  3KP0 E;  2L3C A;  5FLX C;  1A1H A;  2ADR A;  1PJT A;  2CUZ A;  3U6D A;  4KO8 A;  2BDX A;  4XK8 F;  4Z8X A;  5A6J A;  1UTE A;  4AZF A;  2LHG A;  2UXC E;  1QFC A;  3EPH A;  2IE4 C;  1D2N A;  1IXS B;  1BVS A;  1DO0 A;  3JAM C;  3B7N A;  1J09 A;  1FKA E;  1EIJ A;  5DYI A;  1OAI A;  3VYY A;  3FRI A;  4H2B A;  1LTM A;  1XMQ M;  2JXN A;  2JUJ A;  4LF9 M;  1HR0 E;  1IY0 A;  2XSZ D;  4GEW A;  2UXD M;  1ZBT A;  4OOG C;  2JP7 A;  2EOI A;  1VEG A;  4PCZ A;  4BCA A;  1DGG A;  1G41 A;  4IYP C;  2GPI A;  3E7A A;  3HY5 A;  1JB0 F;  2I7P A;  4GEQ B;  1G71 A;  4L5N C;  3GPP A;  3K7W C;  3IWC A;  3DW8 C;  3V4Y A;  1MX0 A;  2EM4 A;  1GVN A;  2YFQ A;  1NO1 A;  3AL0 C;  2B7V A;  1HO5 A;  3PNV A;  2RPC A;  2ZO9 B;  2JWS A;  4OX9 E;  4GH9 A;  3HJS A;  2LE2 A;  3HKP A;  4IBC A;  5JPE A;  3J80 S;  4O4K A;  1HPU A;  5EQT A;  1UF3 A;  3Q8G A;  5EP2 A;  1X6H A;  4B3T M;  1J5E M;  2BJW A;  2LHC A;  5FTK A;  3H61 A;  2EMI A;  4MGY E;  4NRV A;  3TWK A;  2H5X A;  2QQ8 A;  2YTE A;  4IBB A;  2HHH M;  2A22 A;  2R65 A;  5DNY A;  2KXE A;  1T38 A;  3UJN A;  1TF3 A;  2DWM A;  2WBU A;  5KL6 A;  3FRH A;  2EJ4 A;  3E4R A;  2QPA A;  4LJ9 A;  1OIE A;  3OML A;  4IJD A;  4L4U A;  3GPX A;  2LUP B;  5ITR A;  1AAY A;  1K3X A;  1DGF A;  2LUQ A;  4M2Z A;  1PJJ A;  2UUC E;  2EPC A;  4TUG A;  1S8E A;  1TH4 A;  2BNK A;  1NVM A;  1PJI A;  2KNZ A;  5INB A;  3ZTV A;  4FBQ A;  2DRP A;  4X65 E;  2YTF A;  2LT7 A;  5LMU E;  2KRU A;  2HKJ A;  2VE7 C;  4HL4 A;  4IJF A;  2KHH A;  3J80 C;  1C7Y A;  4FK5 C;  3HWS A;  1G4A E;  2L92 A;  4R2C A;  1SXJ D;  1QZM A;  1GTK A;  2MDR A;  3RGS A;  2Y21 A;  4DSY A;  1LV7 A;  2R18 A;  1UFZ A;  1DI2 A;  2FS1 A;  4FBW A;  1L2D A;  2WSE F;  4DKK A;  1MF8 A;  3KS8 A;  1XMO E;  3WHK A;  4JA7 A;  4JI0 E;  3SHG B;  1IN7 A;  2MRO B;  1YSA C;  1GO5 A;  1OID A;  3GLG B;  2DHR A;  4IJE A;  2LRS A;  2VDB B;  3TPZ A;  1SG9 A;  3KVW A;  2C98 A;  3HQ1 A;  5IWA E;  2B7T A;  4DR5 E;  4R71 A;  3HHX A;  2CV1 A;  4DR6 M;  1GAB A;  1F2I G;  5EQV A;  3L25 A;  2BB8 A;  1LLM C;  2Z8Y M;  3CF0 A;  4B3R E;  5C1B A;  2EOE A;  3IVD A;  4Q35 B;  4LRS A;  2JVA A;  3HPZ A;  4B3S E;  1GJT A;  2DAE A;  4LJ5 A;  1R5L A;  4GZN C;  2JXP A;  1WHC A;  3L28 A;  4DV4 E;  2EN6 A;  3GLG E;  5IOH A;  4L16 A;  1IXS A;  4YY3 M;  1XM7 A;  1UHZ A;  4AKH A;  2JPA A;  1GJS A;  1HNX E;  5JI2 E;  1PM5 A;  2EOH A;  2VF7 A;  3UGJ A;  2L3J A;  2Z4S A;  1XXH B;  1JK1 A;  2Z3X A;  3H67 A;  1IBM E;  4GKK E;  2EPU A;  3LMM A;  5A2Q S;  1HT1 E;  2EE8 A;  1EFU B;  4L6V 6;  1R7R A;  3IHP A;  4YKE A;  3RL5 A;  4G9J A;  2DZO B;  3U6M A;  1QU6 A;  1KJK A;  2LVP C;  2M5Z A;  3GLH E;  2A5Y B;  4PT5 A;  4YHH M;  4H2I A;  2DZN B;  1A1L A;  2RGH A;  3KW6 A;  4G4R A;  4IBD A;  3AUZ A;  2EPM X;  2EN1 A;  2KNV A;  4NRW A;  2NYM C;  2L7H A;  1N32 E;  2GQF A;  2DAG A;  3HVQ A;  3LVW A;  2CT1 A;  2IHR 1;  1FJG E;  2V86 A;  2PRT A;  2Q2E B;  4NZV A;  3H09 A;  2N3H A;  4DR4 M;  3TWM A;  3LCV B;  1T43 A;  4MM3 B;  1NJF A;  3SMP A;  2YTG A;  5JJT A;  4LFA E;  1FNN A;  4JI1 E;  1IMU A;  1HT2 E;  1N36 M;  2LVN C;  2V6Z M;  1NEI A;  2XH9 A;  4BC9 A;  3GVE A;  2EQ3 A;  4IBI A;  3SHF A;  4LJ6 A;  1IY1 A;  2UUA E;  1J26 A;  2BWB A;  4LJ8 A;  4GMQ A;  4K0K M;  3VFD A;  1GLN A;  2R62 A;  1Z5C A;  4R2P A;  1WR1 B;  2ZAO A;  4DMI A;  4F9C B;  2D7G A;  3N5U A;  4O5G A;  3WHL A;  5AC4 A;  1IBK M;  2MR9 A;  2LO3 A;  1ZR9 A;  1UBD C;  3RL4 A;  4NSR A;  4HTG A;  3T6P A;  1AUA A;  3ZU0 A;  4JI4 E;  4GKJ E;  1J7K A;  1ZQ9 A;  1NNU C;  2EOM A;  3L29 A;  3KS4 A;  4LFC E;  4IIW A;  4I5N C;  3GLG A;  4V0X A;  3J7Y p;  2BQ8 X;  4G4N A;  1R2Y A;  2YSP A;  4LY6 A;  4DV1 M;  4ANR A;  3H4J A;  5AAS A;  1HP1 A;  2YPN A;  3W0F A;  3L27 A;  5IZ7 D;  4JI7 M;  3A42 A;  1XMQ E;  3HZJ A;  2E5L M;  4AG5 A;  3T1Y M;  1N34 M;  4JV5 M;  4DR2 M;  2JY6 B;  3LML A;  4LF9 E;  3VK7 A;  1S95 A;  4DV3 M;  5EXX A;  1EKZ A;  2HL7 A;  4QHT A;  1I94 M;  3E0J A;  4RNA A;  1KSF X;  3KZY A;  4R03 A;  1N78 A;  3C6K A;  3FLO A;  2F4V M;  1MGT A;  1T6O A;  3BID A;  1IT6 A;  3I4V A;  3PVS A;  5A6A A;  1QNT A;  5KPR A;  3GLI B;  3MHV C;  2JY5 A;  3VDP A;  4L8R C;  4B3M M;  1AH5 A;  5JPF A;  3I04 M;  3B7Q A;  4XPN A;  2QNJ A;  4DV5 M;  2IAE C;  1XXH A;  1Z5B A;  2ZAN A;  3P71 C;  1HNW M;  3H60 A;  3PFI A;  4LRT A;  3CK2 A;  2UU9 M;  4WPY A;  2JY7 A;  2EMA A;  2IE3 C;  4B3T E;  1WGN A;  2DAI A;  3U6E A;  3GLI E;  1YZ9 A;  1XNQ E;  2ENA A;  1IQO A;  2Z4R A;  2KKN A;  2HHH E;  2ELY A;  5IV8 B;  2QP9 X;  3KSX A;  5GKN A;  2MC5 A;  2VQF M;  2CSH A;  3IWD A;  1JK7 A;  1TDH A;  3LQR A;  4WX9 A;  3DFZ A;  2EMX A;  2WBS A;  4FW9 A;  4MLV A;  4WXC A;  1QVR A;  3K6Q A;  1IBL E;  1RMD A;  4R2E A;  3B9P A;  4R3D A;  4CIZ A;  3KOY E;  2EL5 A;  4R2D A;  5KQD A;  2NXF A;  4DV6 E;  3CGW A;  2AHM A;  3U6Q A;  2FNA A;  3F92 A;  1S70 A;  4FD2 A;  2EN4 A;  2K0B X;  2EM0 A;  5CFF E;  2JR1 A;  1G5B A;  1BBO A;  4O43 A;  1R2Z A;  1Z59 A;  1XHB A;  4B7F A;  3C6M A;  3SMS A;  1WGL A;  2FOI C;  1T71 A;  1X47 A;  4NL4 H;  1V73 A;  5ITT A;  3TGH A;  2C9C A;  2F5O A;  2WSF F;  2NUG A;  4FWG A;  2DVW B;  2GJU A;  4M9V C;  3THO B;  1DGH B;  5KL4 A;  5KL7 A;  2EPP A;  1YUJ A;  1DV0 A;  4LF4 M;  2A25 A;  2C96 A;  2DZL A;  1NCS A;  1H6U A;  4DR6 E;  4X64 E;  2YVT A;  3KP1 E;  4R8O A;  1GL7 A;  3SYL A;  1NJG A;  4MLQ A;  2MDG A;  3M99 B;  1A1I A;  3THG A;  1E9S A;  2YNM D;  2L4F A;  2YTJ A;  2EOF A;  1K3W A;  5BR8 M;  2RGO A;  1N75 A;  2L09 A;  2CWB A;  3HTX A;  4RF0 A;  4UT3 B;  4EIW A;  4WWL A;  1R6B X;  2CHG A;  4LU9 A;  3T38 A;  3DOA A;  1F4I A;  2EOR A;  1L4S A;  3F6H A;  3AOE C;  3SBJ A;  3U61 B;  4M9S A;  2EQ0 A;  4OU7 A;  4JYA M;  2YTI A;  3FD9 A;  1E9R A;  3HX3 A;  2G8L A;  1WRJ A;  3R9X B;  2X4A A;  4KBP A;  1XZW A;  4OR9 A;  2YZT A;  4FCT A;  1UIL A;  2J7J A;  3GLI A;  2JWO A;  3U6C A;  5C18 A;  1OIP A;  2Z72 A;  2RSM A;  2F5P A;  3U5Z B;  2QFR A;  1UN6 B;  4YHH E;  3ADL A;  3B89 A;  4LZJ A;  1HQY E;  4M9X A;  2FV4 B;  2QFP A;  4JI6 E;  2YQZ A;  1W24 A;  3J81 S;  1XB2 B;  3PSO A;  4JN6 A;  2DMI A;  3SYK A;  2C9O A;  1DGB A;  1YYK A;  1VEJ A;  4LF7 E;  1E94 E;  2R4J A;  3RE8 A;  4J8Z A;  1DQ3 A;  1N33 M;  1NHG C;  3KXE C;  2WDF A;  2O8G A;  2XGN A;  2UUB E;  4IS1 C;  2EM9 A;  2L33 A;  2O5R A;  4AI6 A;  2W82 A;  1G2D C;  1YUB A;  1BB8 A;  4DR7 M;  4CJ6 A;  1PDA A;  5ITQ A;  3LW5 F;  2EPL X;  3H62 B;  1WHN A;  3ZQJ A;  4B08 A;  2OOA A;  1N36 E;  2ELZ A;  2EML A;  3DSD A;  2O25 A;  1Z5A A;  1RU3 A;  2YR0 A;  2J5Y A;  3JTZ A;  1TH2 A;  2YTD A;  4B7H A;  2ZTD A;  3C5W C;  2EMB A;  1KBP A;  5IRE B;  1TF6 A;  4H1S A;  1QUT A;  4K0K E;  2EO2 A;  3C4B A;  3QWL A;  1HNZ M;  4WSG A;  3EPJ A;  4DUY M;  1TN9 A;  3DSC A;  3W67 A;  4B2O A;  4H2F A;  4F54 A;  3UK3 C;  2EPN A;  1JK2 A;  3M6A A;  2EA0 A;  3J81 C;  4HD0 A;  3HJ8 A;  1A1K A;  4LTY A;  5AE3 A;  4V0V A;  5EXT A;  3DJW A;  1T70 A;  2RKO A;  4L8N A;  3K92 A;  2R46 A;  2EUC A;  4MOV A;  4X8W A;  3CF6 E;  3RL3 A;  3SAV A;  1T4O A;  2YTN A;  1S3S A;  3L00 A;  5AE2 A;  2QHO B;  3BOS A;  1QZE A;  3VDU A;  2G7H A;  3DF6 A;  1SXJ C;  1DGH A;  4WFT A;  2HAK A;  2LBS B;  3CF2 A;  1T39 A;  2QZ4 A;  4XBO A;  1O0W A;  5E6J A;  2RRU A;  2QCU A;  5EP1 A;  4IBK A;  3E46 A;  3T1Y E;  1N34 E;  1D0L A;  5ITX E;  1ORY B;  3MHH C;  4NHR A;  4DR2 E;  4LG2 A;  4JV5 E;  2HJJ A;  3T1H M;  3CTW B;  3B74 A;  2K7I A;  4DR1 M;  4UT2 A;  2JY8 A;  2V1U A;  2KOU A;  2B9D A;  4X9J A;  3GRR A;  2EKF A;  4GC9 A;  2MKD A;  4ZYH A;  4KOD A;  1TH3 A;  1NNW A;  3BBZ A;  3J7A G;  4UT3 A;  4DV7 M;  5EJC A;  4DHL A;  3FUV A;  1AUI A;  3J7B A;  2EMG A;  2EMZ A;  3U61 A;  1Y8G A;  4HEI A;  4PDG A;  2N3G A;  4DV5 E;  3JR5 A;  4X62 M;  2WDE A;  3EGG A;  1PKP A;  3FTE A;  4TUI A;  5FTL A;  2WZO A;  1HNW E;  2CHQ A;  1IXR C;  1L8Q A;  2UU9 E;  4JI3 M;  3FIG A;  4ORC A;  2DXI A;  5FTM A;  4DR3 M;  2M7Q A;  3IB8 A;  1UM8 A;  5L8R F;  3SC3 A;  4GC5 A;  4FVM A;  2ZM6 M;  2ODR D;  1KYQ A;  3U5Z A;  3RFW A;  2KON A;  1MU5 A;  1QAO A;  2LVH A;  1MN3 A;  2VQF E;  2KHX A;  3A45 A;  2O01 F;  2YTP A;  4LJ4 A;  4KKZ A;  3OTO M;  2AHD A;  1ZBQ A;  3ZC7 B;  2GHF A;  2XFS A;  1XWI A;  2CTD A;  3VLF B;  2EOQ A;  1A1J A;  2Z1A A;  4MH0 E;  2LV2 A;  3IG8 A;  5LMN E;  1Z1B A;  4AQY M;  3FTF A;  2Y0Q A;  4NXM E;  1XXH E;  2XFT A;  2CPN A;  4NXN E;  2NPP C;  4X66 E;  2YSO A;  4B7G A;  2DSY A;  2VII A;  4M0W A;  2EM8 A;  4QNM A;  2YU8 A;  1HR0 M;  3HXL A;  2GLI A;  2K9D A;  2MGW A;  1WIV A;  2NA2 A;  2BBG A;  4LCB A;  4FCV A;  1OKS A;  3HHY A;  2DWN A;  2I9I A;  4R2A A;  3P1X A;  2YU5 A;  2JYA A;  1Q02 A;  3NWL A;  2G5G X;  2OPF A;  2ZTC A;  2JZ1 A;  3MK6 A;  5F3W A;  1EE8 A;  4ITQ A;  2XSZ A;  3RQZ A;  2EOY A;  3R8F A;  2OOB A;  4OX9 M;  5A2Q C;  4DV2 E;  2WDD A;  3SAW A;  4MGK E;  4QOS A;  5JI3 E;  5A69 A;  1Q3C A;  4G6Z A;  2P6B A;  3BBG A;  5KPZ A;  3QFK A;  4R7G A;  3EIE A;  2VQE E;  5FTJ A;  3W0L B;  2EOX A;  1TR8 A;  2Y0T A;  1PJS A;  5ITX A;  4JI5 M;  3KFU G;  1CUK A;  3IG5 A;  4P78 A;  5KL5 A;  1ZAA C;  2USH A;  2X8A A;  2H36 X;  2EMF A;  1TGU A;  5BR8 E;  1N3G A;  3E7B A;  2JY9 A;  5KO3 A;  5T6J A;  3RGP A;  1HJP A;  1I4W A;  2FFJ A;  3GO8 A;  4BB9 A;  1W5S A;  1IXZ A;  2KNA A;  3BF2 A;  3TQS A;  2E72 A;  5IT9 S;  2L2D A;  4M0V A;  2UUC M;  2KW0 A;  4LAC C;  3GLF B;  1QAN A;  1IN6 A;  1QDR A;  4XGI A;  1NNJ A;  4F6M A;  4MGI E;  4ZVZ A;  4BBY A;  1D0K A;  4F2J C;  1NV9 A;  1R4G A;  2JA2 A;  1YYW A;  1WJP A;  1G3I A;  2MKN A;  4Z6Y A;  1X5W A;  4I81 A;  2FTX B;  2DAM A;  3F6G A;  2QEN A;  2UXD E;  1QAQ A;  4D81 A;  1X3C A;  3HHW A;  1IFY A;  1X49 A;  3KOZ E;  2JOG A;  1RC7 A;  4LGM A;  3J2P B;  3HPS A;  1V92 A;  4F9A B;  2F8B A;  3D8B A;  4CGY B;  2VRD A;  4OW0 A;  4LJ7 A;  1G2F C;  4KZS A;  2DIX A;  1BBG A;  2FE8 A;  1AIP C;  1N33 E;  2R4E A;  4I5L C;  2RSI A;  2EMK A;  2V85 A;  2R44 A;  1WXR A;  3K8Z A;  1DGC A;  5IT9 C;  5EP3 A;  2N8X A;  1ZMW A;  2M4I A;  1ZMV A;  4FWD A;  4DR7 E;  3SFZ A;  1J5E E;  3VKG A;  4R2S A;  3FUX A;  4B3R M;  1OFI A;  2R6F A;  2LCE A;  3AV0 A;  1OAO C;  3A46 A;  4CIS A;  3HGI A;  2LBC A;  4M9Z A;  1Z2X A;  5J28 A;  4GIT A;  3L26 A;  4BS9 A;  2K47 A;  4G3O A;  3EQ1 A;  1PRB A;  5HPE A;  1NHW C;  2ENH A;  4Q7J A;  3FYC A;  3M7G A;  5ITY A;  3UMM A;  3TWL A;  1HNZ E;  1GQE A;  3GRV A;  2EM6 A;  1ZAE A;  2FH0 A;  2OO9 A;  5AC5 A;  2KDL A;  4DUZ M;  1OFH A;  1EH6 A;  2HCB A;  3T1I A;  2XEP A;  4GKK M;  2DLK A;  3LL8 A;  3KOX E;  4ZPX A;  4GRI A;  2XZF A;  2L6O A;  4ORA A;  2YRK A;  2RTX A;  3AFH A;  4Q28 A;  2UXB M;  4LZZ A;  2V89 A;  3BGH A;  3BXW A;  1P3Q Q;  4F2L A;  2QBY B;  2YT4 A;  2NAB A;  1PGY A;  1XC8 A;  8CAT A;  3QFN A;  4QHS A;  3ILK A;  2L8T A;  3VHT B;  2ZBM A;  4LJA A;  3TE6 A;  1IQS A;  4I5S A;  2M1S A;  2EOZ A;  3FUU A;  4G4Q A;  4FBK A;  3MMP A;  2EM7 A;  2I13 A;  1KYI A;  3T1H E;  2H1R A;  2CV9 A;  1FJG M;  4DR1 E;  2L4E A;  2HGH A;  2G3Q A;  3H64 A;  1RQ0 A;  4WP2 A;  4LF6 M;  3HU1 A;  3FTC A;  4OVZ B;  2L6M A;  3LCU A;  2LJU A;  2NUE A;  2EN8 A;  2RS7 A;  4RH8 A;  2DMY A;  4GHA A;  2D7H A;  3E9S A;  4JI2 M;  5A6B A;  3GLF A;  2UUA M;  3W68 A;  3JU0 A;  2F5S A;  1VDL A;  2XF3 A;  4IBF A;  3C9F A;  2DWZ B;  2CV0 A;  5KPT A;  4JI3 E;  4YY3 E;  2P5T A;  1IY2 A;  3V76 A;  2HC5 A;  3FGA C;  2KEB A;  3PXG A;  1ZV1 A;  5DFL A;  4FCX A;  2LVA A;  2ZM6 E;  5C1V A;  1D0M A;  2EMY A;  4N4R B;  3C4T A;  3C9P A;  1WAR A;  2D7E A;  2DLQ A;  2R1F A;  3KDS E;  2HWJ A;  3D8L A;  5H37 D;  2EL4 A;  4LGY A;  5E26 A;  3ZCB B;  4AW4 A;  2MH8 A;  2EWL A;  3OTO E;  2KRK A;  3GQ3 A;  3QYE A;  2M9A A;  3AJI B;  4JI4 M;  2WBT A;  3EIH A;  2YRH A;  2JP9 A;  3T15 A;  4GKJ M;  2EL6 A;  4AQY E;  1MEY C;  3NBI A;  4LF8 M;  4LFC M;  4LF5 M;  2KZS A;  2CFO A;  2DI0 A;  3FYD A;  1KFV A;  1OJL A;  2EOJ A;  3FE3 A;  7CAT A;  2QJC A;  2EOO A;  4KHP M;  3IB7 A;  4PD2 A;  2LNH C;  4BHB A;  2DFJ A;  3QG5 C;  2DGC A;  3A98 B;  2Z06 A;  3J27 B;  4DT2 A;  3PNY A;  4JXJ A;  5KL3 A;  2WCC 3;  1E32 A;  2OQ4 A;  1JR3 E;  4DR4 E;  1G8P A;  3RMP A;  1EH7 A;  2EN3 A;  1W5T A;  1YUI A;  2GNO A;  4A3V B;  4WW0 A;  3ADJ A;  2WSC F;  3ADI A;  3ZH9 B;  4WYQ B;  4ORB A;  4DV0 M;  2EM2 A;  2BWE A;  1YSY A;  3DZD A;  4BLC A;  2FGG A;  5EXS A;  2DWL A;  4R2Q A;  2CE7 A;  2I7N A;  1XNR M;  1C1K A;  4J6O A;  4JI5 E;  1XNQ M;  1TTE A;  3ICF A;  3D03 A;  3IWB A;  5FSW A;  5KL2 A;  2QBY A;  3FUT A;  3I4Y A;  2K6B A;  1X6E A;  4P17 A;  1WJ7 A;  4D80 A;  1IBK E;  1YLA A;  2XLJ A;  3GQ4 A;  1EH8 A;  5BPV A;  3KZZ A;  4F6N A;  3KSJ A;  1IBL M;  1TF0 B;  3HJQ A;  1X6F A;  1VG5 A;  4UWQ A;  1QUS A;  2CHV A;  2WZJ A;  4DV6 M;  1OTR A;  1YFH A;  2L7I A;  3U6S A;  1OI8 A;  4MOY A;  4ZYG A;  3U6L A;  4DV1 E;  1DO2 A;  5GTU A;  3LQQ A;  1HQC A;  4OVZ A;  2KZU A;  4JI7 E;  5IXM B;  2E5L E;  4BMJ A;  3QAU A;  4ZX2 A;  3H66 A;  3TQM A;  4LFB M;  3AKZ A;  4DV3 E;  2R76 A;  3UK6 A;  4CHT B;  1FJM A;  1I94 E;  2KA6 B;  3AOG A;  1Q3B A;  4RF1 A;  2LTU A;  2F4V E;  1L1Z A;  1X37 A;  3GRU A;  1WAO 1;  3EPK A;  3VKH A;  4B3M E;  2L2M A;  4I4L A;  3C3E A;  3LLH A;  4JA9 A;  1V33 A;  5A6K A;  1A1G A;  4HEO A;  4KLN A;  3J7A S;  3E21 A;  2RQL A;  1Q39 A;  4NSO B;  4M0D A;  1GKI A;  2MC6 A;  4JI8 M;  4X64 M;  1TDZ A;  1ZMU A;  2EOS A;  1M63 A;  1YYO A;  3GQ5 A;  1S3L A;  2LVO C;  4WXD A;  3IEC A;  2ODR C;  3U60 B;  4O24 A;  1U32 A;  2CRU A;  4H1Y P;  3L2A A;  4I8O A;  2ZAM A;  2EPZ A;  1V34 A;  1GL6 A;  1SXJ B;  1VDD A;  2EM5 A;  4M30 A;  1JR3 A;  3K2L A;  3TL4 X;  3FTD A;  2O8A A;  2EPX A;  4P7D A;  5B8I A;  2LVQ D;  2F5Q A;  3ZOQ B;  1MJG M;  1IN4 A;  3GLH B;  4H2G A;  2V88 A;  2E1M A;  4F9B B;  4DUZ E;  5DYG A;  1USH A;  2UXC M;  1JQJ C;  4D82 A;  1SXJ E;  1L1T A;  2B3T B;  2HYP A;  3UZU A;  4TUW A;  2JOX A;  2BCD A;  2XZU A;  3AOE A;  2UXB E;  2HYO A;  2EJS A;  4GHL A;  4IBJ A;  2J7N A;  4AG6 A;  2NUF A;  1SR9 A;  2C99 A;  4L15 A;  4F1I A;  1NSF A;  4JI6 M;  1VQ1 A;  1VEK A;  3GPY A;  4NOO B;  3IVE A;  2EP3 A;  4HLQ A;  2EMC A;  2CEA A;  4LF7 M;  1QDT A;  3ADG A;  2CP8 A;  1K82 A;  3GRY A;  3M0E A;  4MGZ E;  2UUB M;  1SU1 A;  3GPU A;  5A6B D;  4LF6 E;  5AE1 A;  1T4N A;  4NC6 A;  4LF4 E;  2EPK X;  5EXP A;  4P16 A;  1OIZ A;  2M60 A;  2VF8 A;  4GIP A;  2EQ1 A;  1NY6 A;  3K7V C;  4JI2 E;  2V1C A;  3JR4 A;  2NQ8 C;  3K9P A;  3VK6 A;  2LH0 A;  4WSP A;  1OQY A;  3FUW A;  2DXN A;  2DHY A;  1QQW A;  3ECR A;  2WDC A;  2JNH A;  4FCW A;  1IN5 A;  2ERC A;  2R17 A;  1WHQ A;  3I01 M;  3U6O A;  1Z6T A;  2V87 A;  3THN A;  3H68 A;  2EKK A;  4JYA E;  4QNR A;  4PDI A;  1NY5 A;  3QFM A;  2ZBK B;  1IN8 A;  5ITU A;  4X65 M;  4WUR A;  5TSE A;  4DBG B;  5LMU M;  2EM3 A;  1P47 A;  4UN2 B;  2QSF X;  4LF8 E;  4LF5 E;  4FWH A;  4V0W A;  2MJ5 B;  4R2R A;  4S12 A;  4F0Z A;  3GLF E;  1NV8 A;  3DA1 A;  2EZ6 A;  1STU A;  1QAM A;  4KHP E;  2EMW A;  3H4M A;  1XMO M;  3KWR A;  4ZYE A;  1YPN A;  4JI0 M;  3U60 A;  1GZ6 A;  1IQP A;  2R0I A;  2Q8U A;  4REZ A;  1A5T A;  3KOW E;  1S3N A;  1SXJ A;  3QFO A;  1L2C A;  1ZU1 A;  4MB7 A;  1B69 A;  4KWY A;  2XMO A;  2VF1 A;  2YEQ A;  2ENC A;  5IWA M;  3EGH A;  4DR5 M;  1L2B A;  1PJQ A;  3K1J A;  3SAR A;  2LWX A;  3H69 A;  1YE9 A;  1S3M A;  3GLH A;  4ZYD A;  2LMZ A;  2EN2 A;  4DV0 E;  3K9O A;  2DNA A;  4B3S M;  3SAU A;  2DXL A;  2DB2 A;  3SAS A;  4KT0 F;  1T4L B;  2F5N A;  3C58 A;  4DV4 M;  4BC7 A;  2EPO A;  2EN7 A;  2B3T A;  5KQ8 A;  3HU2 A;  3H63 A;  1SFE A;  1XNR E;  2NYL C;  1HNX M;  4DUY E;  3KBP A;  2L2N A;  1G59 A;  5ADZ A;  1WXQ A;  2LTR A;  3MJ5 A;  1IBM M;  3C3D A;  3MHS C;  4II7 A;  3GP1 A;  2HY1 A;  4AKG A;  2APL A;  2LXE A;  3LVV A;  2DAK A;  4Q7F A;  1X48 A;  2D9H A;  2DEN A;  2RS6 A;  1QYR A;  5LMN M;  4AKI A;  1TCO A;  2YTO A;  4NXM M;  5LL6 R;  3B7Z A;  4NXN M;  4QOZ C;  4X66 M; 
#chains in the Genus database with same CATH homology
 4L78 A;  4G4O A;  2ZOA A;  4MP0 A;  2V83 A;  3I51 A;  4IBE A;  2LJH A;  2J7O A;  4IL1 A;  1N32 M;  1T3T A;  4LFB E;  4BBA A;  5FLX S;  3PSN A;  2C5R A;  3VYX A;  3SAT A;  1II7 A;  5EP4 A;  2Z7J A;  3HU3 A;  4LFA M;  4DV7 E;  4JI1 M;  3JAM S;  2R45 A;  4DV2 M;  4IBG A;  4X62 E;  4MGH A;  1IM2 A;  2VQE M;  1JR3 D;  2BJV A;  4JI8 E;  2Y20 A;  2CV2 A;  4DR3 E;  1Z2W A;  3Q8X A;  3U6P A;  3VK8 A;  2JOB A;  5FTN A;  3MSW A;  2X49 A;  2K4V A;  3FKE A;  4W5W A;  3HHZ A;  2L2K B;  1QHW A;  3JYF A;  2V8Q B;  1N77 A;  2LTS A;  3KP0 E;  2L3C A;  5FLX C;  2CUZ A;  3U6D A;  4KO8 A;  2BDX A;  4Z8X A;  1UTE A;  4AZF A;  2UXC E;  1QFC A;  2IE4 C;  1D2N A;  1IXS B;  1DO0 A;  3JAM C;  1J09 A;  1FKA E;  5DYI A;  3VYY A;  4H2B A;  1XMQ M;  4LF9 M;  1HR0 E;  1IY0 A;  2XSZ D;  1ZBT A;  2UXD M;  4OOG C;  4PCZ A;  4BCA A;  1DGG A;  1G41 A;  4IYP C;  3E7A A;  2I7P A;  4GEQ B;  4L5N C;  3GPP A;  3K7W C;  3IWC A;  3DW8 C;  3V4Y A;  1MX0 A;  1GVN A;  2YFQ A;  3AL0 C;  2B7V A;  1HO5 A;  3PNV A;  2ZO9 B;  4OX9 E;  4GH9 A;  3HJS A;  2LE2 A;  3HKP A;  4IBC A;  5JPE A;  3J80 S;  1HPU A;  1UF3 A;  5EQT A;  4O4K A;  5EP2 A;  4B3T M;  1J5E M;  2BJW A;  5FTK A;  3H61 A;  4MGY E;  4NRV A;  3TWK A;  4IBB A;  2HHH M;  2A22 A;  2R65 A;  5DNY A;  2KXE A;  3UJN A;  2DWM A;  3E4R A;  2QPA A;  4LJ9 A;  1OIE A;  3OML A;  4L4U A;  3GPX A;  2LUP B;  5ITR A;  1K3X A;  1DGF A;  2LUQ A;  4M2Z A;  1PJJ A;  2UUC E;  4TUG A;  1S8E A;  1TH4 A;  2BNK A;  1NVM A;  1PJI A;  5INB A;  3ZTV A;  4FBQ A;  4X65 E;  5LMU E;  2KRU A;  2HKJ A;  2VE7 C;  4HL4 A;  4IJF A;  3J80 C;  3HWS A;  1G4A E;  2L92 A;  1SXJ D;  1QZM A;  2MDR A;  3RGS A;  2Y21 A;  4DSY A;  1LV7 A;  2R18 A;  1DI2 A;  4FBW A;  1L2D A;  4DKK A;  1MF8 A;  3KS8 A;  1XMO E;  3WHK A;  4JA7 A;  4JI0 E;  3SHG B;  1IN7 A;  1OID A;  3GLG B;  2DHR A;  4IJE A;  2LRS A;  3TPZ A;  3KVW A;  2C98 A;  3HQ1 A;  5IWA E;  2B7T A;  4DR5 E;  3HHX A;  2CV1 A;  4DR6 M;  5EQV A;  3L25 A;  3CF0 A;  4B3R E;  5C1B A;  3IVD A;  4LRS A;  2JVA A;  3HPZ A;  4B3S E;  4LJ5 A;  3L28 A;  4DV4 E;  5IOH A;  4L16 A;  4YY3 M;  1XM7 A;  1UHZ A;  4AKH A;  1HNX E;  5JI2 E;  1PM5 A;  2L3J A;  3UGJ A;  2Z4S A;  1XXH B;  2Z3X A;  3H67 A;  1IBM E;  4GKK E;  3LMM A;  5A2Q S;  1HT1 E;  1R7R A;  4YKE A;  3RL5 A;  4G9J A;  2DZO B;  3U6M A;  1QU6 A;  2M5Z A;  2A5Y B;  4PT5 A;  4YHH M;  4H2I A;  2DZN B;  2RGH A;  3KW6 A;  4G4R A;  4IBD A;  3AUZ A;  4NRW A;  2NYM C;  2L7H A;  1N32 E;  3HVQ A;  3LVW A;  2IHR 1;  1FJG E;  2V86 A;  2Q2E B;  4NZV A;  3H09 A;  2N3H A;  4DR4 M;  3TWM A;  4MM3 B;  1NJF A;  3SMP A;  5JJT A;  4LFA E;  1FNN A;  4JI1 E;  1HT2 E;  1N36 M;  2V6Z M;  2XH9 A;  4BC9 A;  3GVE A;  4IBI A;  3SHF A;  4LJ6 A;  1IY1 A;  2UUA E;  1J26 A;  4LJ8 A;  4GMQ A;  4K0K M;  3VFD A;  1GLN A;  2R62 A;  1Z5C A;  2ZAO A;  4DMI A;  4F9C B;  2D7G A;  3N5U A;  4O5G A;  3WHL A;  1IBK M;  3RL4 A;  4NSR A;  3ZU0 A;  4JI4 E;  4GKJ E;  1J7K A;  1ZQ9 A;  1NNU C;  3L29 A;  3KS4 A;  4LFC E;  4IIW A;  4I5N C;  3GLG A;  4V0X A;  3J7Y p;  2BQ8 X;  4G4N A;  1R2Y A;  4LY6 A;  4DV1 M;  5AAS A;  1HP1 A;  3W0F A;  3L27 A;  5IZ7 D;  4JI7 M;  3A42 A;  1XMQ E;  2E5L M;  4AG5 A;  3T1Y M;  1N34 M;  4JV5 M;  4DR2 M;  3LML A;  4LF9 E;  3VK7 A;  1S95 A;  4DV3 M;  5EXX A;  1EKZ A;  2HL7 A;  4QHT A;  1I94 M;  3E0J A;  4RNA A;  1KSF X;  4R03 A;  1N78 A;  3FLO A;  2F4V M;  1IT6 A;  3I4V A;  3PVS A;  5KPR A;  3GLI B;  3MHV C;  3VDP A;  4L8R C;  4B3M M;  5JPF A;  4XPN A;  4DV5 M;  2IAE C;  1XXH A;  1Z5B A;  2ZAN A;  3P71 C;  1HNW M;  3H60 A;  3PFI A;  4LRT A;  3CK2 A;  2UU9 M;  4WPY A;  2IE3 C;  4B3T E;  3U6E A;  1YZ9 A;  1XNQ E;  2Z4R A;  2KKN A;  2HHH E;  2QP9 X;  3KSX A;  5GKN A;  2MC5 A;  2VQF M;  3IWD A;  1JK7 A;  1TDH A;  3LQR A;  3DFZ A;  4FW9 A;  1QVR A;  3K6Q A;  1IBL E;  3B9P A;  4R3D A;  3KOY E;  5KQD A;  2NXF A;  4DV6 E;  2AHM A;  3U6Q A;  2FNA A;  1S70 A;  4FD2 A;  5CFF E;  2JR1 A;  1G5B A;  4O43 A;  1R2Z A;  1Z59 A;  1XHB A;  4B7F A;  3SMS A;  2FOI C;  1T71 A;  1X47 A;  4NL4 H;  1V73 A;  5ITT A;  3TGH A;  2C9C A;  2F5O A;  2NUG A;  4FWG A;  2DVW B;  2GJU A;  3THO B;  1DGH B;  4LF4 M;  2C96 A;  1H6U A;  4DR6 E;  4X64 E;  2YVT A;  3KP1 E;  4R8O A;  1GL7 A;  3SYL A;  1NJG A;  3THG A;  1E9S A;  2YNM D;  1K3W A;  5BR8 M;  2RGO A;  1N75 A;  2L09 A;  3HTX A;  4RF0 A;  4UT3 B;  4EIW A;  4WWL A;  1R6B X;  2CHG A;  4LU9 A;  3T38 A;  3DOA A;  3F6H A;  3AOE C;  3SBJ A;  3U61 B;  4M9S A;  4OU7 A;  4JYA M;  3FD9 A;  1E9R A;  2G8L A;  3R9X B;  2X4A A;  4KBP A;  1XZW A;  4OR9 A;  2YZT A;  4FCT A;  1UIL A;  3GLI A;  2JWO A;  3U6C A;  5C18 A;  2Z72 A;  2RSM A;  2F5P A;  3U5Z B;  2QFR A;  4YHH E;  3ADL A;  4LZJ A;  1HQY E;  4M9X A;  2FV4 B;  2QFP A;  4JI6 E;  2YQZ A;  1W24 A;  3J81 S;  3PSO A;  4JN6 A;  3SYK A;  2C9O A;  1DGB A;  1YYK A;  4LF7 E;  1E94 E;  2R4J A;  3RE8 A;  4J8Z A;  1DQ3 A;  1N33 M;  1NHG C;  3KXE C;  2WDF A;  2O8G A;  2XGN A;  2UUB E;  2L33 A;  2O5R A;  4AI6 A;  2W82 A;  1YUB A;  4DR7 M;  5ITQ A;  3H62 B;  1WHN A;  4B08 A;  1N36 E;  3DSD A;  1Z5A A;  2YR0 A;  3JTZ A;  1TH2 A;  4B7H A;  3C5W C;  1KBP A;  5IRE B;  4H1S A;  4K0K E;  2EO2 A;  3C4B A;  3QWL A;  1HNZ M;  4DUY M;  3DSC A;  4B2O A;  4H2F A;  4F54 A;  3M6A A;  2EA0 A;  3J81 C;  4HD0 A;  3HJ8 A;  4LTY A;  5AE3 A;  4V0V A;  5EXT A;  3DJW A;  1T70 A;  2RKO A;  4L8N A;  3K92 A;  2R46 A;  2EUC A;  4MOV A;  4X8W A;  3CF6 E;  3RL3 A;  3SAV A;  1T4O A;  1S3S A;  5AE2 A;  3BOS A;  3VDU A;  2G7H A;  3DF6 A;  1SXJ C;  1DGH A;  4WFT A;  2LBS B;  3CF2 A;  2QZ4 A;  4XBO A;  1O0W A;  5E6J A;  2QCU A;  5EP1 A;  4IBK A;  3T1Y E;  1N34 E;  5ITX E;  1ORY B;  4JV5 E;  4DR2 E;  4LG2 A;  3T1H M;  3CTW B;  4DR1 M;  4UT2 A;  2V1U A;  2KOU A;  2B9D A;  3GRR A;  4GC9 A;  4KOD A;  1TH3 A;  1NNW A;  3J7A G;  4UT3 A;  4DV7 M;  5EJC A;  4DHL A;  3FUV A;  1AUI A;  3J7B A;  3U61 A;  4PDG A;  2N3G A;  3EGG A;  2WDE A;  3JR5 A;  4X62 M;  4DV5 E;  1PKP A;  3FTE A;  4TUI A;  5FTL A;  2WZO A;  1HNW E;  2CHQ A;  1IXR C;  1L8Q A;  2UU9 E;  4JI3 M;  3FIG A;  4ORC A;  2DXI A;  5FTM A;  4DR3 M;  2M7Q A;  3IB8 A;  1UM8 A;  3SC3 A;  4GC5 A;  4FVM A;  2ZM6 M;  2ODR D;  3U5Z A;  3RFW A;  2KON A;  1MU5 A;  1QAO A;  2VQF E;  2KHX A;  3A45 A;  4LJ4 A;  4KKZ A;  3OTO M;  2AHD A;  1ZBQ A;  3ZC7 B;  2XFS A;  1XWI A;  3VLF B;  2Z1A A;  4MH0 E;  3IG8 A;  5LMN E;  4AQY M;  3FTF A;  2Y0Q A;  4NXM E;  2XFT A;  2CPN A;  4NXN E;  2NPP C;  4X66 E;  4B7G A;  2DSY A;  2VII A;  4M0W A;  4QNM A;  1HR0 M;  3HXL A;  2NA2 A;  4LCB A;  4FCV A;  3HHY A;  2DWN A;  3P1X A;  3NWL A;  2G5G X;  2OPF A;  3MK6 A;  5F3W A;  1EE8 A;  4ITQ A;  2XSZ A;  3RQZ A;  3R8F A;  4OX9 M;  5A2Q C;  4DV2 E;  2WDD A;  3SAW A;  4MGK E;  4QOS A;  5JI3 E;  1Q3C A;  4G6Z A;  2P6B A;  5KPZ A;  3QFK A;  4R7G A;  3EIE A;  2VQE E;  5FTJ A;  3W0L B;  2Y0T A;  5ITX A;  4JI5 M;  3KFU G;  3IG5 A;  4P78 A;  2USH A;  2X8A A;  2H36 X;  1TGU A;  5BR8 E;  3E7B A;  2JY9 A;  5KO3 A;  5T6J A;  3RGP A;  1I4W A;  2FFJ A;  3GO8 A;  4BB9 A;  1W5S A;  1IXZ A;  3TQS A;  5IT9 S;  4M0V A;  2UUC M;  2KW0 A;  4LAC C;  3GLF B;  1QAN A;  1IN6 A;  4XGI A;  1NNJ A;  4MGI E;  4ZVZ A;  4BBY A;  2JA2 A;  1YYW A;  1G3I A;  4Z6Y A;  4I81 A;  2FTX B;  3F6G A;  2QEN A;  2UXD E;  1QAQ A;  4D81 A;  3HHW A;  1X49 A;  3KOZ E;  2JOG A;  1RC7 A;  4LGM A;  3J2P B;  3HPS A;  4F9A B;  2F8B A;  3D8B A;  4CGY B;  4OW0 A;  4LJ7 A;  4KZS A;  2DIX A;  2FE8 A;  1N33 E;  2R4E A;  4I5L C;  2V85 A;  1WXR A;  3K8Z A;  5IT9 C;  5EP3 A;  2M4I A;  4FWD A;  4DR7 E;  3SFZ A;  1J5E E;  3VKG A;  3FUX A;  4B3R M;  1OFI A;  3AV0 A;  3A46 A;  4CIS A;  3HGI A;  5J28 A;  4M9Z A;  1Z2X A;  4GIT A;  3L26 A;  4BS9 A;  2K47 A;  5HPE A;  1NHW C;  3FYC A;  3M7G A;  5ITY A;  3UMM A;  3TWL A;  1HNZ E;  1GQE A;  3GRV A;  1ZAE A;  4DUZ M;  1OFH A;  2HCB A;  3T1I A;  2XEP A;  4GKK M;  3LL8 A;  3KOX E;  4ZPX A;  4GRI A;  2XZF A;  2L6O A;  4ORA A;  2RTX A;  3AFH A;  4Q28 A;  2UXB M;  4LZZ A;  2V89 A;  2QBY B;  2YT4 A;  1XC8 A;  8CAT A;  3QFN A;  4QHS A;  3ILK A;  2L8T A;  2ZBM A;  4LJA A;  3TE6 A;  4I5S A;  2M1S A;  3FUU A;  4G4Q A;  4FBK A;  1KYI A;  3T1H E;  2H1R A;  2CV9 A;  1FJG M;  4DR1 E;  3H64 A;  1RQ0 A;  4LF6 M;  3HU1 A;  3FTC A;  4OVZ B;  2L6M A;  2NUE A;  2RS7 A;  2DMY A;  4GHA A;  2D7H A;  3E9S A;  4JI2 M;  3GLF A;  2UUA M;  3JU0 A;  2F5S A;  2XF3 A;  4IBF A;  3C9F A;  2DWZ B;  2CV0 A;  5KPT A;  4JI3 E;  4YY3 E;  2P5T A;  1IY2 A;  3FGA C;  2KEB A;  3PXG A;  4FCX A;  2ZM6 E;  5C1V A;  3C4T A;  1WAR A;  2D7E A;  3KDS E;  3D8L A;  5H37 D;  4LGY A;  5E26 A;  3ZCB B;  4AW4 A;  2EWL A;  3OTO E;  2KRK A;  3GQ3 A;  3AJI B;  4JI4 M;  3EIH A;  3T15 A;  4GKJ M;  4AQY E;  3NBI A;  4LF8 M;  4LFC M;  4LF5 M;  2KZS A;  2CFO A;  1KFV A;  3FYD A;  1OJL A;  7CAT A;  2QJC A;  4KHP M;  3IB7 A;  4PD2 A;  2LNH C;  2DFJ A;  3QG5 C;  3A98 B;  2Z06 A;  3J27 B;  4DT2 A;  3PNY A;  4JXJ A;  1E32 A;  2OQ4 A;  4DR4 E;  1G8P A;  3RMP A;  1W5T A;  4A3V B;  4WW0 A;  3ADJ A;  3ADI A;  3ZH9 B;  4WYQ B;  4ORB A;  4DV0 M;  1YSY A;  3DZD A;  4BLC A;  2FGG A;  5EXS A;  2DWL A;  2CE7 A;  2I7N A;  1XNR M;  1C1K A;  4J6O A;  4JI5 E;  1XNQ M;  3ICF A;  3D03 A;  3IWB A;  5FSW A;  2QBY A;  3FUT A;  3I4Y A;  4D80 A;  1IBK E;  2XLJ A;  3GQ4 A;  5BPV A;  3KSJ A;  1IBL M;  3HJQ A;  4UWQ A;  2CHV A;  4DV6 M;  2L7I A;  3U6S A;  1OI8 A;  4MOY A;  3U6L A;  4DV1 E;  1DO2 A;  5GTU A;  3LQQ A;  1HQC A;  4OVZ A;  2KZU A;  4JI7 E;  2E5L E;  4BMJ A;  3QAU A;  4ZX2 A;  3H66 A;  4LFB M;  3AKZ A;  4DV3 E;  3UK6 A;  4CHT B;  1FJM A;  1I94 E;  2KA6 B;  3AOG A;  1Q3B A;  4RF1 A;  2F4V E;  1L1Z A;  1X37 A;  3GRU A;  1WAO 1;  3VKH A;  4B3M E;  2L2M A;  4I4L A;  3LLH A;  4JA9 A;  4KLN A;  3J7A S;  1Q39 A;  4NSO B;  4M0D A;  1GKI A;  2MC6 A;  4JI8 M;  4X64 M;  1TDZ A;  1M63 A;  1YYO A;  3GQ5 A;  1S3L A;  2ODR C;  4O24 A;  3U60 B;  1U32 A;  4H1Y P;  3L2A A;  4I8O A;  2ZAM A;  1GL6 A;  1SXJ B;  1VDD A;  4M30 A;  1JR3 A;  3K2L A;  3TL4 X;  3FTD A;  2O8A A;  4P7D A;  5B8I A;  2F5Q A;  3ZOQ B;  1IN4 A;  3GLH B;  4H2G A;  2V88 A;  2E1M A;  4F9B B;  4DUZ E;  5DYG A;  1USH A;  2UXC M;  1JQJ C;  4D82 A;  1SXJ E;  1L1T A;  2B3T B;  2HYP A;  3UZU A;  4TUW A;  2JOX A;  2BCD A;  2XZU A;  3AOE A;  2UXB E;  2HYO A;  4GHL A;  4IBJ A;  2J7N A;  4AG6 A;  2NUF A;  1SR9 A;  2C99 A;  4L15 A;  1NSF A;  4JI6 M;  3GPY A;  4NOO B;  3IVE A;  4HLQ A;  2CEA A;  4LF7 M;  3ADG A;  1K82 A;  3GRY A;  3M0E A;  4MGZ E;  2UUB M;  1SU1 A;  3GPU A;  4LF6 E;  5AE1 A;  1T4N A;  4LF4 E;  5EXP A;  4P16 A;  2M60 A;  4GIP A;  1NY6 A;  3K7V C;  4JI2 E;  2V1C A;  3JR4 A;  2NQ8 C;  3VK6 A;  2LH0 A;  4WSP A;  3FUW A;  2DXN A;  1QQW A;  2WDC A;  4FCW A;  1IN5 A;  2ERC A;  2R17 A;  1WHQ A;  3U6O A;  1Z6T A;  2V87 A;  3THN A;  3H68 A;  4JYA E;  4QNR A;  4PDI A;  1NY5 A;  3QFM A;  2ZBK B;  1IN8 A;  5ITU A;  4X65 M;  4WUR A;  5LMU M;  4LF8 E;  4LF5 E;  4FWH A;  4V0W A;  4S12 A;  4F0Z A;  3DA1 A;  2EZ6 A;  1STU A;  1QAM A;  4KHP E;  3H4M A;  1XMO M;  3KWR A;  4JI0 M;  3U60 A;  1GZ6 A;  1IQP A;  2Q8U A;  4REZ A;  1S3N A;  3KOW E;  1SXJ A;  3QFO A;  1L2C A;  4MB7 A;  2XMO A;  2VF1 A;  2YEQ A;  5IWA M;  3EGH A;  4DR5 M;  1L2B A;  3K1J A;  3SAR A;  2LWX A;  3H69 A;  1YE9 A;  1S3M A;  3GLH A;  2LMZ A;  4DV0 E;  4B3S M;  3SAU A;  2DXL A;  2DB2 A;  3SAS A;  1T4L B;  2F5N A;  3C58 A;  4DV4 M;  4BC7 A;  5KQ8 A;  3HU2 A;  3H63 A;  1XNR E;  2NYL C;  1HNX M;  4DUY E;  3KBP A;  2L2N A;  1G59 A;  5ADZ A;  1WXQ A;  2LTR A;  3MJ5 A;  1IBM M;  4II7 A;  3GP1 A;  2HY1 A;  4AKG A;  2LXE A;  3LVV A;  4Q7F A;  1X48 A;  2RS6 A;  1QYR A;  5LMN M;  4AKI A;  1TCO A;  4NXM M;  5LL6 R;  4NXN M;  4QOZ C;  4X66 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...