5F3WA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Dna binding protein/hydrolase/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 105
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5f3wA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5f3wA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5f3wA01
3IVEA 4G9JA 2AHDA 3GVEA 3C5WC 3P71C 4H2BA 1SU1A 4FBKA 1QHWA 4DSYA 1S3LA 2BDXA 4YKEA 3QFOA 1Z2XA 2P6BA 5F3WA 4V0WA 2NXFA 1USHA 1KBPA 1WARA 5JPFA 3THOB 3QG5C 4NZVA 4I5NC 4MP0A 3IB8A 4ORBA 4MOYA 1HPUA 3E7AA 3EGGA 3H61A 1W24A 1S3NA 4TUIA 2YVTA 4LU9A 3TGHA 1Z2WA 2HYPA 3DSCA 2O8GA 1U32A 2KKNA 2IE3C 3N5UA 1JK7A 4FBWA 1UF3A 2XMOA 4O4KA 4UT3A 4ZX2A 4JA9A 5JJTA 3H68A 1M63A 1OIEA 4JA7A 4H1YP 4DT2A 3PSOA 1IT6A 1XM7A 4F0ZA 1T70A 4Q7FA 1WAO1 2CV9A 1OI8A 3H66A 2Z1AA 2Q8UA 1OIDA 3HVQA 3QFMA 2BCDA 4OR9A 1G5BA 1FJMA 2QFRA 1HO5A 1V73A 4UWQA 2NYMC 3ICFA 5GTUA 1S70A 3ZU0A 3H64A 4ZVZA 3JYFA 1TCOA 2Z72A 2A22A 3E7BA 3RQZA 4O5GA 1XZWA 3EGHA 4H2FA 5IOHA 4DHLA 2WDFA 4KKZA 4V0VA 4IYPC 3DSDA 4H1SA 2HY1A 2NPPC 4WWLA 5HPEA 1HP1A 3H62B 4J6OA 1NNWA 4B2OA 3K7WC 2BQ8X 1QFCA 2WDEA 4O43A 4V0XA 3THNA 4LACC 3RL3A 3AV0A 1AUIA 4TUGA 5JPEA 2ZBMA 2WDDA 3FGAC 3H67A 4O24A 2QJCA 4UT2A 3H63A 5J28A 2WDCA 1T71A 1UTEA 5EQVA 2IE4C 4ORAA 4IL1A 4UT3B 3V4YA 2R17A 2NYLC 2USHA 4XPNA 3PSNA 4MOVA 4H2IA 4H2GA 1S3MA 3KBPA 4HD0A 3AUZA 4FBQA 2O8AA 2DFJA 4FCXA 4M0VA 3IVDA 1S8EA 3QFKA 2IAEC 5INBA 3T1IA 2QFPA 4KBPA 4ORCA 4LTYA 3RL4A 5B8IA 3QFNA 3CK2A 1II7A 1S95A 3H60A 2Z06A 3DW8C 3LL8A 3H69A 2GJUA 2JOGA 3K7VC 3C9FA 5DNYA 5C1VA 3ZTVA 4I5LC 1MF8A 3RL5A 3IB7A 2HYOA
chains in the Genus database with same CATH superfamily
1PJQA 3GVEA 5GKNA 2EPAA 1J5EM 2VE7C 4NXMM 1GLNA 2LVAA 2WBSA 5IZ7D 3HJQA 2D7EA 4I81A 5JPFA 4MP0A 3U60B 3T6PA 1AUAA 1OAIA 4I4LA 5KQ8A 3OMLA 4LRSA 4ZPXA 1TGUA 1R2YA 4UT3A 1XXHE 5LMNE 2QSFX 2CUZA 1HR0E 5FTMA 4IBJA 3EPLA 2J7NA 1PJIA 4OU7A 3U6SA 2CE7A 3ZH9B 2LUPB 2FFJA 2UUCE 2BCDA 4Q35B 2JY7A 4B3RM 4LFCE 4GH9A 1E9RA 4L15A 4HTGA 3MHHC 1DV0A 2BJWA 1A1KA 2VF8A 3K92A 4F54A 2O5RA 2FGGA 4DMIA 2JUJA 3U61A 1A5TA 4JI3M 1NY6A 4DV5M 5IV8B 2ENAA 3U6CA 2F5PA 1T71A 4JI6M 2B7VA 2NYLC 1NNJA 2USHA 1G41A 5FLXC 2K0BX 1XB2B 2XEPA 1JQJC 2EMKA 1SR9A 4I5SA 2KDLA 2UUBE 3A46A 2YTQA 2R18A 3JU0A 3JR5A 3GQ4A 1WRJA 3F6GA 4ZYGA 2JOGA 3K7VC 5DNYA 1BBOA 5KL2A 4PCZA 3VKGA 1QDTA 4G9JA 4NC6A 1BB8A 2ZANA 1RC7A 4WXCA 4B7GA 1J26A 2UU9M 1SXJB 1HPUA 4WP2A 2C99A 3PFIA 4WYQB 2KZUA 2EZ6A 2J5YA 3H61A 2YVTA 4LU9A 3K1JA 3GQ3A 4JI2M 3AJIB 1JK7A 3M6AA 3WHKA 1KFVA 3U6OA 4GRIA 2KONA 4IIWA 4JA7A 2GLIA 4DR4M 4QNMA 3SC3A 4X9JA 4LJ4A 3LQRA 3C4TA 5ITUA 1BBGA 3QAUA 1FJMA 2X49A 2UXBE 4BMJA 2JOBA 3DOAA 8CATA 2QHOB 2R44A 4NSRA 2R45A 2EM3A 3E46A 2C9CA 4DV0M 4NHRA 4JI8E 4GC5A 4AG5A 2A5YB 2WDEA 2EOMA 4DR2M 3VLFB 2FS1A 3H4MA 3RGPA 3T15A 4YHHE 2UXCM 4F9BB 3IWCA 2M5ZA 2EM0A 3PSNA 5AASA 1L8QA 2CHGA 4H2GA 1EE8A 5LLQA 3SAUA 4QHSA 5FTKA 2QFPA 1OQYA 2MKNA 2CRUA 4DUYM 1L1ZA 1HNWM 1TDZA 2NUEA 1Z6TA 1KSFX 3DJWA 4GIPA 2NA2A 3I04M 2L3JA 2V85A 3RL5A 3FIGA 3U6EA 3IWDA 4H2BA 4DSYA 1EKZA 3GLHE 4KO8A 1IY2A 2ZBKB 1WHQA 2CV1A 2H36X 2DAIA 4M9ZA 4DR2E 1TH2A 3FTDA 1HNWE 5A6JA 2V83A 2ZTDA 4QOZC 3K6QA 2Y21A 4FWGA 2EOXA 1NCSA 1IFYA 4F9CB 3Q8GA 2EP3A 2GPIA 4XK8F 3C58A 5DYGA 1CUKA 3H09A 2LJUA 2LHCA 2JP9A 2DAGA 2CV9A 2YTJA 4F6NA 5AC4A 4DV0E 3SFZA 2JOXA 4NXME 4BHCA 2V89A 2BB8A 3UMMA 1L4SA 4B3TE 4WFTA 3AKZA 2JY8A 4QHTA 4CHTB 3I4YA 3CTWB 1PKPA 3THNA 3OTOE 3AV0A 2EMWA 3VHTB 1N36E 4M0WA 2HAKA 4G6ZA 3H67A 2APLA 1IXRC 4DV7M 4BC9A 1LTMA 4UT2A 1GQEA 2NQ8C 2MC6A 4XPNA 2EM7A 3J2PB 4DR5M 1WHCA 2RGOA 4FBQA 4FCXA 1GKIA 4GKKE 2IAEC 4WSPA 1ZMWA 3HY5A 2Z7JA 3HQ1A 4LFAM 4KBPA 4DV7E 1VEKA 1FJGE 4RHBB 1NHWC 3A98B 5EJCA 1Z5BA 3LL8A 2HHHE 2LUQA 4P7DA 4DV2M 3ZTVA 4RNAA 3SMSA 4NRVA 2JVAA 2LCEA 5ITYA 2YU5A 3ADJA 2P6BA 3KOZE 4LF4E 5LMUE 4IJDA 3ZOQB 1PGYA 3D8LA 1P47A 4IBBA 3E7AA 3EGGA 3J81C 4TUIA 2XFTA 1NNUC 5L8RF 2FNAA 1GJTA 1U32A 4LF9M 1NY5A 1A1FA 4REZA 3VKHA 3HGIA 3FRIA 4O4KA 1YPNA 2C9OA 5ITXE 2WCC3 2FTXB 3CGWA 4FCTA 4NL4H 4JI6E 3J7BA 1IN5A 2UUCM 2LBCA 4L16A 3QFMA 4F1IA 4AQYM 2XZUA 2EQ0A 3NBIA 1HO5A 3KOYE 4LJ6A 4JV5M 5A6BA 2DAMA 3GPPA 2VRDA 2CWBA 3J7AG 2WDFA 3THGA 4V0VA 3P1XA 2NPPC 5BR8M 5ITTA 3M0EA 3ZCBB 4ZYHA 2DRPA 2DSYA 4LZJA 2F5OA 4OX9E 1GO5A 4HL4A 2L7IA 1ZBTA 1L1TA 4B3ME 1S3MA 2YSPA 1DO0A 2YQZA 4GITA 4M2ZA 2EPMX 1QZEA 3FUTA 2EJ4A 1NV9A 2LHGA 5EXXA 2DMYA 1Z59A 4M9VC 1IXSA 2YTPA 4JI1M 1R6BX 1Z5AA 2WSEF 3C6MA 2C96A 3BOSA 2L8TA 3V76A 4MGYE 4RF0A 1BVSA 1IBME 1G2DC 4FD2A 4PD2A 4NZVA 5KPZA 2KHXA 2LV2A 4N4RB 2L09A 2EORA 5FTJA 3UK3C 7CATA 3L2AA 2LVNC 3GLIB 4B7FA 2CP8A 2K4VA 3CF6E 4WW0A 4XBOA 4FBWA 2XMOA 2EPXA 1XHBA 3KP1E 4YY3E 4JA9A 5JJTA 3LVWA 2EOYA 3GLFA 1A1IA 2L33A 1M63A 2EOOA 2DHRA 1IT6A 4S12A 1PDAA 1OKSA 2R46A 3IWBA 4GZNC 2XFSA 4DV1E 4DUZE 4ZYDA 1GTKA 3ZU0A 4WURA 1IBKM 1QUSA 2L7HA 3M7GA 3DSDA 2YSOA 4FK5C 3L25A 5FTNA 1N75A 3FUUA 4LGYA 1N3GA 3GLIA 3GRRA 1TN9A 4I8OA 2EMIA 4IL1A 2JZ1A 1DQ3A 5ITRA 1ZV1A 1DGFA 3GO8A 4DR5E 1DI2A 3IVDA 3B7ZA 1PJTA 3LMMA 2G7HA 2DZOB 3UGJA 1OJLA 2L2KB 2Z8YM 4OVZB 2HJJA 4LJ8A 4LFBE 3K8ZA 2R6FA 3UK6A 4I5LC 2P5TA 1V33A 4IBGA 2EPUA 1TF3A 2HCBA 4KWYA 1QHWA 1T38A 1QAQA 2DWNA 2DAEA 2KNVA 4DKKA 4MGZE 4Z8XA 4G3OA 4I5NC 2UXDE 3BBGA 1W5TA 3GLHA 1ZMUA 3QYEA 2M1SA 1DGCA 2F8BA 2YWQA 3VK8A 2KRUA 1MU5A 2LVPC 4WSGA 2ZTCA 2BWEA 3C6KA 5KPTA 3FD9A 2K7IA 1OFIA 1MX0A 1WGLA 1IN7A 2YT4A 4HLQA 2MR9A 2EMBA 2N8XA 1E94E 3C9PA 1PJJA 2CV2A 2QQ8A 5FSWA 1OI8A 2LXEA 4DV4M 2QBYA 1L2BA 2QFRA 4X62M 4UWQA 2WSCF 4P17A 1T3TA 2A22A 2YTFA 2YZTA 5A2QC 4DHLA 4KHPE 3E0JA 1QUTA 4MM3B 4DR1E 3KDSE 3H62B 2K47A 4LF5M 2A25A 2E1MA 2BQ8X 1P3QQ 3MMPA 4AKIA 1QZMA 2EPKX 3IG8A 1T4NA 5EXSA 1IQOA 5IT9C 4JI8M 4UT3B 1PRBA 3L27A 2ODRC 1N32M 2YEQA 4H2IA 4HD0A 3E21A 2FV4B 1KYIA 4R2CA 5INBA 3KWRA 3U5ZB 4EIWA 2HKJA 3LVVA 5EP1A 3C9FA 2DVWB 2KRKA 4WX9A 4M9XA 2AHMA 1K3WA 4PDIA 4FBKA 2DKLA 2LE2A 2MDRA 5JI3E 1X6HA 3QG5C 3B7QA 3AOEA 3IB8A 1GABA 1N34E 1RU3A 3TWMA 2LBSB 2EKKA 2UXDM 2R4EA 1K82A 1YE9A 1X49A 1D2NA 2DWZB 3JR4A 3ADIA 1WGNA 4JV5E 3H68A 1XNRE 1OIEA 3KVWA 2Z3XA 2K9DA 1N33M 2YTIA 1JB0F 3KZYA 2N3GA 3ADGA 3DZDA 1V73A 2ZAMA 2VQEM 3TWKA 1GVNA 1YSAC 2O25A 2EMHA 3J80C 1YYWA 4GHAA 1J7KA 1VDDA 2H1RA 1IQPA 1YLAA 2YTEA 3HTXA 2DXNA 1MGTA 3NWLA 1IBLM 2Y20A 2I7PA 4O43A 2OOAA 3RL3A 3JTZA 2KOUA 2J7JA 1DGHA 2QPAA 2EM5A 2WDDA 1F2IG 1E9SA 3BIDA 1VG5A 3CF2A 5EQVA 1NEIA 1SXJA 1OIPA 2L2MA 4M0VA 1L2DA 3FTCA 1UILA 1ZAEA 1IXZA 2L3CA 1HNZM 2LTUA 1TF6A 1PJSA 2MH8A 3I01M 4FVMA 4L8RC 2EPPA 2LWXA 1IY1A 1Z5CA 1EIJA 1QVRA 3CF0A 4MGHA 2EJSA 3IVEA 2IHR1 4JI4M 1XXHA 1X47A 3BXWA 2F5SA 1Z1BA 2BDXA 1EFUB 5IREB 1XMQE 2NXFA 2Y0TA 4ORBA 1X48A 4L78A 4BB9A 3GRYA 1JR3D 4KODA 4B3TM 2CFOA 2R62A 3T1HM 3GQ5A 2UUAM 2NUFA 3FKEA 3W0FA 4R2EA 1LV7A 4IBKA 1WR1B 1IN4A 1NSFA 2DGCA 2DIXA 2Y0QA 3W67A 1UBDC 2Q8UA 2OPFA 1XNRM 1TTEA 2QENA 3U6MA 3D8BA 1IXSB 3B74A 4BS9A 1YFHA 2GQFA 1SXJC 2EQ3A 3ADLA 5T6JA 3RFWA 2JPAA 1ZMVA 2LH0A 2ODRD 1X3CA 2LT7A 4D82A 2KW0A 2WZOA 5LL6R 3E9SA 4OW0A 1NV8A 4IJFA 3GLGA 4MH0E 1XMQM 4W5WA 2F5NA 1NVMA 3MK6A 1HQYE 1Y8GA 2EPNA 3QYBA 2JWOA 3VDPA 3K9PA 2Z4RA 4II7A 4M9SA 1EH7A 1T39A 2H5XA 2QBYB 4OX9M 3EQ1A 3DA1A 4LFBM 2YRHA 1HJPA 2I9IA 5C1VA 3A42A 2EE8A 2HYOA 3T1HE 2JR1A 1UHZA 3AOGA 4LFCM 4B3RE 2OOBA 4YKEA 2ZM6M 1XNQM 4DUZM 3LQQA 1R2ZA 1WARA 4B3SM 3F92A 2JXPA 5ADZA 3ECRA 1J09A 1FKAE 3I51A 2F4VM 1QNTA 2X8AA 2V1UA 4L8NA 4JI0M 1IQSA 2FE8A 4J8ZA 2PRTA 4Y28F 2EL6A 1VDLA 2JZ0A 1MJGM 4Q28A 4L5NC 3T1YM 4LCBA 2DXIA 3FLOA 4F0ZA 4DV4E 2EM8A 4R03A 4DV2E 1IMUA 4Q7FA 2EOJA 4NRWA 2LTSA 1JK1A 2LJHA 2YNMD 4BC7A 4LF4M 4ZVZA 4X66M 2LMZA 5E26A 1E32A 2EOSA 1YYOA 4DV6M 2W82A 2C98A 4H1SA 2HY1A 2NABA 3IECA 3K7WC 1T43A 4V0XA 2XH9A 3EIHA 3HU1A 1XWIA 4FWHA 1O0WA 5JPEA 2I7NA 1ZU1A 3OTOM 4GMQA 2J7OA 4LY6A 5KL4A 2CTDA 3H63A 2EOIA 2EPOA 1TDHA 3TWLA 3V4YA 2IE4C 5EP2A 1VQ1A 4LF7E 5A6AA 4D81A 1X6FA 5AE1A 2N35A 1T4LB 4HEOA 2O8AA 3QFKA 4R2QA 3T1IA 3F6HA 1R7RA 4LTYA 4X64M 2LO3A 3FTFA 4ITQA 2UU9E 4DV1M 4BCAA 4AZFA 1HQCA 1N33E 2Z06A 2EMGA 1R5LA 2MGWA 3VK6A 2JY9A 3D03A 1N32E 4YY3M 3QFOA 5F3WA 2V88A 4B7HA 3THOB 4R2PA 2R65A 2LRSA 4G4OA 2YTNA 2L92A 4KT0F 1T6OA 4K0KE 4CJ6A 1HNXM 3L26A 2BWBA 3N5UA 4XGIA 5AC5A 3T1YE 3HU3A 2JWSA 3MJ5A 2VQEE 4P78A 2EUCA 2EMLA 4JYAE 2YTGA 4IBDA 4R2RA 2EOHA 5KL5A 4AQYE 2DNAA 3E4RA 2ENHA 3J7Yp 3AL0C 4L4UA 4B3SE 2JP7A 3GRUA 3FE3A 3H64A 4MGIE 4LF8E 4LJAA 4H2FA 1YZ9A 3J27B 2EM4A 2LTRA 3WHLA 2X4AA 1VEGA 3KW6A 2KZSA 3HJSA 1QFCA 2MDGA 3W68A 1AUIA 2KEBA 2DI0A 2WZJA 2YU8A 2EKFA 4KHPM 3BBZA 3SYLA 1FNNA 3M99B 4LF7M 4NSOB 2EQ1A 2JYAA 3HU2A 5IXMB 1S8EA 2DAKA 4CISA 4M30A 3DF6A 5IWAE 2EL4A 4YHHM 4M0DA 2UXBM 1II7A 2HHHM 4NXNE 2YRKA 2EM6A 1W5SA 2D7HA 4MOVA 2LVQD 1A1HA 4KZSA 2RKOA 2EN6A 2EOFA 4GC9A 3U6DA 2EOZA 1KJKA 1Z2XA 4BLCA 1USHA 3PVSA 3FTEA 1EH8A 1G2FC 3MHSC 2VQFE 3LMLA 1H6UA 1Z2WA 3HHXA 2KKNA 3SMPA 2YR0A 4ANRA 3KSJA 2EL5A 2GHFA 5CFFE 2ADRA 1YSYA 2DZLA 2CT1A 1XMOM 4IBFA 2V8QB 3PSOA 1XM7A 4X65E 1T70A 4LG2A 2CHVA 4IJEA 1X6EA 2BJVA 3HVQA 2KNZA 1G5BA 2EA0A 5AE2A 2GNOA 4R3DA 5A69A 2RGHA 1S70A 4IBCA 2ENCA 1NHGC 4LF8M 1SXJE 5A2QS 4RH8A 4LF6M 2VF7A 5IOHA 4AKHA 3BGHA 4OVZA 3A45A 5ITXA 4FW9A 3L28A 1VEJA 1DO2A 5LMUM 3ZC7B 4DV5E 1HNZE 5IT9S 4MLVA 4KLNA 4JYAM 2I13A 3FGAC 1SFEA 1MEYC 1I94E 3TQSA 5C18A 2RRUA 3KZZA 1QDRA 3KOWE 2R76A 2EO2A 3AUZA 4F2JC 4ORCA 4AI6A 4B08A 4JXJA 1NJGA 3H69A 2EMZA 5A6KA 4B3MM 3C5WC 3P71C 4BHBA 2XF3A 3LLHA 4LF6E 2KXEA 4QOSA 2RS6A 3K2LA 2R0IA 2MROB 2BBGA 3AFHA 3FRHA 5EP3A 1N34M 4LJ9A 2HYPA 2G5GX 1D0KA 2EPRA 2RS7A 4JI1E 1G3IA 2V86A 4G4RA 3GPUA 4WPYA 4OOGC 1A1GA 1YUJA 1L2CA 1Q02A 1XXHB 4Q7JA 2B9DA 1PM5A 3KS8A 1C1KA 4TUWA 2V87A 3FUWA 2EM2A 3H66A 4RKUF 1A1LA 1S3SA 2EN1A 3VYXA 1C7YA 1F4IA 1V34A 2L4EA 1QYRA 2LVOC 2NUGA 4JI7M 4AKGA 2RSMA 3RGSA 3L00A 1WXQA 2EPZA 3EPHA 4LJ5A 5AE3A 1YUIA 2XSZA 2EMCA 4MGKE 4GHLA 2HGHA 5A6BD 3UZUA 1IM2A 1I4WA 2HL7A 3TQMA 4LJ7A 2WDCA 3U6PA 2YTOA 4ORAA 3GLFE 2JY5A 2VIIA 4JI7E 1G71A 2B3TA 2QCUA 3RL4A 2EN4A 3FYCA 2QP9X 2JXNA 3HZJA 2ZM6E 2JY6B 2VF1A 1NJFA 2UXCE 4LGMA 1JR3A 2CV0A 3SARA 4LF9E 4X8WA 2D7GA 2E72A 4BBYA 1QANA 5JI2E 1IN6A 3KP0E 4DUYE 3B89A 3J81S 4AG6A 2R4JA 2RPCA 4PDGA 4JI5M 3TGHA 2IE3C 4CIZA 4P16A 4FCWA 1RMDA 2DB2A 1GJSA 2L6OA 4CGYB 5C1BA 4DT2A 4DR3E 2EPLX 3HX3A 3SHGB 3R8FA 4ZYEA 2CHQA 1ORYB 4OR9A 1OIDA 1YYKA 2NYMC 4DR6M 3ICFA 5GTUA 3EPKA 4JN6A 1QQWA 4AW4A 1TCOA 1GZ6A 3U60A 3HWSA 4KKZA 2RSIA 3K9OA 5KL6A 1R4GA 2B3TB 3HXLA 5HPEA 1HP1A 2ZOAA 4B2OA 4G4NA 3U5ZA 5KO3A 3KS4A 3B9PA 2E5LM 4NOOB 2WSFF 3LW5F 2DWMA 4O24A 2ZO9B 5J28A 2ELZA 1UTEA 2D9HA 4X66E 4FCVA 1D0LA 1B69A 2R17A 1K3XA 2N3HA 1IBKE 2EN8A 2MC5A 1G4AE 3GRVA 1J5EE 4R7GA 2WBUA 3SBJA 1AAYA 3KBPA 4IBEA 4DBGB 1STUA 4F2LA 3T38A 1S95A 2C5RA 4IS1C 2GJUA 4X65M 2ELYA 2JNHA 2KNAA 3IB7A 1TH4A 4JI4E 3AOEC 1DGGA 2XSZD 2DLQA 1SU1A 1GL7A 3LCVB 4F9AB 5DFLA 2B7TA 2YTDA 1WHNA 2ERCA 3MHVC 3GLGB 2R1FA 1UN6B 2UUBM 3DSCA 1WXRA 4L6V6 3MSWA 4LFAE 2O8GA 4GKKM 3HHWA 1Q39A 2RQLA 1UFZA 1I94M 4MLQA 1HNXE 2F5QA 4DR6E 3KFUG 3HKPA 3GPYA 5BPVA 3C3DA 5EP4A 4IBIA 2E5LE 1WAO1 2K6BA 2DZNB 3KXEC 4JI3E 4A3VB 3SHFA 1WJ7A 1GL6A 2Z1AA 2DMIA 4MB7A 2RTXA 3L29A 1RQ0A 3RE8A 2Z72A 3W0LB 2FOIC 3E7BA 4DV3M 4O5GA 1IN8A 3EGHA 1DGBA 1IY0A 2DHYA 4WWLA 1TH3A 4J6OA 1NNWA 3SAVA 1X5WA 5BR8E 4NXNM 3IHPA 2G8LA 2EPCA 1HR0M 3JAMC 5IWAM 5TSEA 4GEWA 3B7NA 3ILKA 3HPSA 2EOQA 1T4OA 2MKDA 1OFHA 3QFNA 3DFZA 3DW8C 2G3QA 4DV6E 2EMXA 3HJ8A 1OIZA 1SXJD 1D0MA 2AHDA 3FYDA 3FUXA 1ZAAC 2EN3A 3HPZA 1N77A 2XLJA 4V0WA 2EMFA 3C4BA 1KBPA 1V92A 2M9AA 1AH5A 5KPRA 4R2SA 4RF1A 3RMPA 2EMYA 1S3NA 2CEAA 2JA2A 2DWLA 3U61B 3U6LA 2M7QA 2UUAE 1XC8A 1QAOA 5KL7A 5FLXS 2OQ4A 4K0KM 4WXDA 3ZQJA 2CSHA 1TF0B 2EM9A 5H37D 4LF5E 2DLKA 4DR1M 4DR7E 4X64E 1XMOE 4FWDA 4R2AA 3GPXA 5ITQA 4X62E 1Q3BA 4GKJM 2M60A 3TPZA 1UM8A 3PNYA 2VQFM 1YUBA 1NO1A 2Q2EB 4TUGA 1A1JA 2V1CA 1FJGM 2QJCA 4DR4E 1Q3CA 5EXPA 2EMAA 3GP1A 3EIEA 3QWLA 3VK7A 1EH6A 1OTRA 3I4VA 5KL3A 2DFJA 1SG9A 3GLFB 3PNVA 2L6MA 4HEIA 3UJNA 5B8IA 4JI2E 2XGNA 1N36M 1OAOC 2QNJA 5E6JA 3LCUA 3EPJA 2LNHC 3KSXA 3TE6A 4DR3M 1MN3A 3VFDA 2HWJA 2M4IA 1S3LA 4GEQB 3FUVA 1JK2A 1TR8A 2HC5A 4UN2B 4BBAA 1G59A 3NBXX 4JI5E 1WJPA 1G8PA 1DGHB 4MOYA 2L2NA 1ZQ9A 1N78A 3U6QA 3GLGE 2F4VE 1W24A 2XZFA 3GLIE 3PXGA 3VYYA 3SATA 3C3EA 3TL4X 4QNRA 2CPNA 2Z4SA 2O01F 1XNQE 5EQTA 1UF3A 4ZX2A 2L2DA 2ZAOA 3BF2A 3JAMS 2EN7A 4D80A 3R9XB 1KYQA 4H1YP 5DYIA 4LRTA 2DXLA 2YFQA 5FTLA 2L4FA 2OO9A 1HT1E 3VDUA 4JI0E 4GKJE 1IBLE 5LMNM 3J80S 2KHHA 2YRMA 1QU6A 1ZBQA 3GLHB 3JYFA 3RQZA 1XZWA 2EOEA 5KQDA 4R71A 4DR7M 2V6ZM 4IYPC 1QAMA 4Z6YA 2LVHA 4LACC 2ZBMA 2WBTA 2QZ4A 4R8OA 4F6MA 5EXTA 2YPNA 3H4JA 1JR3E 3SAWA 3J7AS 1WIVA 2EN2A 4LZZA 4DV3E 2KA6B 2VDBB 1LLMC 2BNKA 2EWLA 4G4QA 3KOXE 3HHZA 2FH0A 4R2DA 3HHYA 4PT5A 3CK2A 1AIPC 3H60A 3IG5A 1HT2E 1ZR9A 2MJ5B 2DENA 1IBMM 3SASA 1MF8A 1X37A 3SYKA 3Q8XA
chains in the Genus database with same CATH topology
4JI1M 1R6BX 3T1HE 1NJFA 1Z5AA 1UHZA 2JR1A 3GVEA 5GKNA 3AOGA 1J5EM 2VE7C 4LFCM 4B3RE 2C96A 3BOSA 4LGMA 1JR3A 2CV0A 3SARA 2L8TA 4NXMM 1GLNA 4LF9E 4MGYE 4RF0A 5IZ7D 3HJQA 4X8WA 4YKEA 2ZM6M 2D7GA 4DUZM 1XNQM 3LQQA 2D7EA 4BBYA 4I81A 1R2ZA 4B3SM 1IBME 1WARA 4FD2A 4PD2A 5ADZA 5JPFA 4NZVA 4MP0A 1J09A 1QANA 3U60B 5JI2E 1IN6A 5KPZA 2KHXA 3KP0E 4DUYE 3I51A 3J81S 2L09A 2F4VM 4AG6A 1FKAE 5FTJA 2X8AA 4I4LA 2R4JA 7CATA 3L2AA 2V1UA 4L8NA 4JI0M 3T1YE 3GLIB 5KQ8A 4PDGA 4JI5M 4B7FA 2FE8A 4J8ZA 3TGHA 3OMLA 4LRSA 4ZPXA 2K4VA 3CF6E 2IE3C 4WW0A 4P16A 4XBOA 1TGUA 4FBWA 2XMOA 4FCWA 1R2YA 4UT3A 1XHBA 3KP1E 4YY3E 4Q28A 4JA9A 4L5NC 5JJTA 3T1YM 4LCBA 2DXIA 3LVWA 2DB2A 5LMNE 2CUZA 3GLFA 1HR0E 2L6OA 3FLOA 5FTMA 2L33A 4CGYB 5C1BA 4IBJA 1M63A 2J7NA 4DR3E 4DT2A 2DHRA 1IT6A 1PJIA 4F0ZA 4S12A 4DV4E 4OU7A 4R03A 4DV2E 3SHGB 3U6SA 3R8FA 4Q7FA 2CE7A 2R46A 3ZH9B 4NRWA 2CHQA 3IWBA 2LUPB 2XFSA 1ORYB 2FFJA 2LTSA 2UUCE 4OR9A 1OIDA 2BCDA 4DV1E 1YYKA 4DUZE 2LJHA 2YNMD 4BC7A 4LF4M 2NYMC 4DR6M 3ICFA 5GTUA 4B3RM 4LFCE 3ZU0A 4GH9A 4JN6A 1E9RA 4WURA 4L15A 4ZVZA 1QQWA 4AW4A 1TCOA 1IBKM 2BJWA 4X66M 2LMZA 5E26A 1E32A 1YYOA 4DV6M 1GZ6A 3U60A 3K92A 3HWSA 4F54A 2W82A 2L7HA 2C98A 3M7GA 4KKZA 2O5RA 3DSDA 4H1SA 2HY1A 2B3TB 2FGGA 3HXLA 4DMIA 2LBSB 5HPEA 1HP1A 2ZOAA 3U61A 4B2OA 3K7WC 4JI3M 4G4NA 3U5ZA 2XH9A 5KO3A 4V0XA 1NY6A 4DV5M 3EIHA 3HU1A 1XWIA 4FWHA 3L25A 3KS4A 1O0WA 2I7NA 2R17A 3OTOM 3B9PA 4GMQA 5FTNA 1N75A 3FUUA 4LGYA 2J7OA 4LY6A 4NOOB 2E5LM 2DWMA 3GLIA 4O24A 2ZO9B 3GRRA 3H63A 5J28A 3U6CA 1TDHA 3TWLA 4I8OA 2F5PA 4JI6M 1T71A 1UTEA 4X66E 4FCVA 2B7VA 2IE4C 1DQ3A 5ITRA 5EP2A 1NNJA 1K3XA 2N3HA 1IBKE 2NYLC 2USHA 4LF7E 1G41A 2MC5A 1DGFA 5FLXC 1G4AE 3GRVA 2XEPA 1JQJC 4R7GA 4D81A 3GO8A 4DR5E 3SBJA 5AE1A 1SR9A 3KBPA 4I5SA 4IBEA 1T4LB 1STUA 1DI2A 2O8AA 3IVDA 2UUBE 3QFKA 3A46A 2R18A 3T1IA 3F6HA 3JU0A 1R7RA 3JR5A 3LMMA 2G7HA 4LTYA 4X64M 2DZOB 3GQ4A 4J6OA 3FTFA 4ITQA 3UGJA 3T38A 4DV1M 2UU9E 1S95A 4BCAA 2C5RA 1OJLA 3F6GA 4AZFA 1HQCA 2L2KB 1N33E 2Z06A 4OVZB 2GJUA 4LJ8A 2JOGA 4LFBE 3K8ZA 3K7VC 3UK6A 5DNYA 4X65M 4I5LC 3VK6A 2P5TA 4PCZA 3VKGA 2JY9A 3IB7A 1TH4A 4IBGA 3D03A 4JI4E 3AOEC 4G9JA 2HCBA 1DGGA 2XSZD 1SU1A 1N32E 4YY3M 1QHWA 1GL7A 1QAQA 2DWNA 3QFOA 2ZANA 1RC7A 5F3WA 2V88A 4DKKA 4MGZE 4Z8XA 4B7HA 2B7TA 4F9AB 4B7GA 1J26A 2R65A 2LRSA 4G4OA 1WHNA 2UXDE 4I5NC 3THOB 2UU9M 1SXJB 2ERCA 1HPUA 1W5TA 2C99A 3GLHA 3PFIA 2KZUA 3MHVC 3GLGB 2L92A 4WYQB 2EZ6A 3H61A 2YVTA 4LU9A 2M1SA 3K1JA 3GQ3A 2UUBM 4JI2M 2F8BA 3DSCA 1WXRA 4K0KE 3MSWA 4LFAE 2O8GA 1HNXM 3L26A 2KRUA 3AJIB 1MU5A 3VK8A 4GKKM 1JK7A 3N5UA 4XGIA 3M6AA 3HHWA 5KPTA 3FD9A 1Q39A 3HU3A 3WHKA 1KFVA 1OFIA 1MX0A 3U6OA 1I94M 4GRIA 1HNXE 1IN7A 3MJ5A 2F5QA 4DR6E 2KONA 2VQEE 2YT4A 4HLQA 3KFUG 2EUCA 3HKPA 4IIWA 5BPVA 3GPYA 4P78A 4JYAE 4JA7A 4IBDA 5EP4A 4IBIA 4DR4M 1E94E 4QNMA 3SC3A 1PJJA 2E5LE 1WAO1 3KXEC 2DZNB 4JI3E 2CV2A 4A3VB 4LJ4A 5FSWA 3LQRA 3SHFA 5ITUA 3C4TA 4AQYE 1GL6A 1OI8A 2LXEA 4DV4M 4MB7A 2QBYA 2Z1AA 3QAUA 1L2BA 3E4RA 2X49A 2RTXA 2UXBE 1FJMA 4BMJA 2QFRA 3L29A 4X62M 3J7Yp 1RQ0A 3RE8A 3AL0C 4L4UA 4UWQA 4B3SE 3GRUA 3H64A 1T3TA 2Z72A 2JOBA 3DOAA 4MGIE 3W0LB 4LF8E 8CATA 2FOIC 2A22A 4DV3M 4NSRA 3E7BA 1IN8A 4LJAA 3EGHA 2YZTA 2R45A 5A2QC 1YZ9A 4H2FA 3J27B 4KHPE 4DHLA 3E0JA 2LTRA 1DGBA 1IY0A 3WHLA 2X4AA 2C9CA 4MM3B 4DV0M 3KDSE 3KW6A 2KZSA 3HJSA 4JI8E 4DR1E 4WWLA 1TH3A 3H62B 2K47A 4GC5A 3SAVA 4AG5A 4LF5M 2E1MA 2A5YB 1NNWA 1QFCA 2BQ8X 2WDEA 1AUIA 4AKIA 4DR2M 3VLFB 5BR8E 1QZMA 3IG8A 2KEBA 3H4MA 4NXNM 3RGPA 1T4NA 5EXSA 3T15A 2G8LA 4YHHE 5IT9C 1HR0M 3JAMC 4KHPM 5IWAM 4JI8M 3SYLA 2UXCM 4F9BB 1FNNA 3IWCA 2M5ZA 2DXNA 4UT3B 4LF7M 4NSOB 3L27A 3PSNA 5AASA 2ODRC 1L8QA 2CHGA 1N32M 2YEQA 4H2IA 4H2GA 4HD0A 1EE8A 3SAUA 2FV4B 1KYIA 3HU2A 3ILKA 4QHSA 1S8EA 5INBA 1J5EE 4CISA 3HPSA 5FTKA 3DF6A 4M30A 1T4OA 5IWAE 2QFPA 4YHHM 1OFHA 3KWRA 4M0DA 3QFNA 4DUYM 2UXBM 1L1ZA 3U5ZB 1HNWM 1II7A 2HHHM 4NXNE 4EIWA 1TDZA 2HKJA 2NUEA 3DFZA 3DW8C 3LVVA 1Z6TA 5EP1A 1KSFX 3C9FA 3DJWA 3V4YA 4GIPA 2DVWB 2NA2A 4DV6E 2KRKA 2L3JA 4M9XA 1W5SA 2V85A 3HJ8A 2D7HA 3RL5A 3FIGA 4MOVA 3U6EA 2AHMA 1SXJD 3IWDA 4KZSA 2RKOA 1K3WA 2AHDA 4H2BA 4DSYA 4PDIA 1EKZA 4FBKA 4KO8A 1IY2A 3FYDA 4GC9A 3FUXA 3U6DA 2ZBKB 1WHQA 2LE2A 3HPZA 2CV1A 1N77A 2MDRA 2H36X 4M9ZA 2XLJA 4BLCA 1Z2XA 4V0WA 5JI3E 3C4BA 1USHA 1KBPA 3PVSA 4DR2E 3FTEA 3QG5C 1TH2A 3AOEA 3IB8A 1N34E 3FTDA 1HNWE 5KPRA 2V83A 4RF1A 3RMPA 4QOZC 3TWMA 1S3NA 2CEAA 3K6QA 3LMLA 2JA2A 2Y21A 3U61B 2DWLA 4FWGA 1H6UA 2UXDM 3U6LA 1Z2WA 2M7QA 3HHXA 2R4EA 1K82A 2KKNA 3SMPA 1YE9A 1X49A 2YR0A 3KSJA 2UUAE 1XC8A 1D2NA 2DWZB 3JR4A 3ADIA 5CFFE 4F9CB 1YSYA 4JV5E 3H68A 1QAOA 1XNRE 1XMOM 1OIEA 3KVWA 4IBFA 3C58A 5DYGA 2Z3XA 2V8QB 3PSOA 3H09A 1XM7A 5FLXS 2OQ4A 4K0KM 1N33M 4X65E 4LG2A 2CHVA 4IJEA 1T70A 4IL1A 2CV9A 2BJVA 4LF5E 5H37D 2N3GA 3ADGA 3HVQA 4DR1M 4DV0E 1G5BA 2EA0A 3SFZA 3DZDA 2JOXA 5AE2A 4DR7E 1V73A 2ZAMA 4X64E 2VQEM 4NXME 4R3DA 2RGHA 3TWKA 1S70A 4IBCA 1GVNA 2V89A 1XMOE 4FWDA 1NHGC 4LF8M 3UMMA 1SXJE 5A2QS 3J80C 4B3TE 4LF6M 1YYWA 4GHAA 3GPXA 1J7KA 1VDDA 5IOHA 2H1RA 4AKHA 5ITQA 1IQPA 4WFTA 3AKZA 4X62E 1Q3BA 4OVZA 4QHTA 3HTXA 4GKJM 4O5GA 2M60A 4CHTB 3A45A 3I4YA 3NWLA 5ITXA 3CTWB 2Y20A 3TPZA 2I7PA 1IBLM 4FW9A 1PKPA 3L28A 1UM8A 3PNYA 2VQFM 3OTOE 4O43A 3RL3A 1YUBA 3AV0A 3JTZA 1DO2A 5LMUM 3ZC7B 2KOUA 2Q2EB 4TUGA 4DV5E 1N36E 1DGHA 4M0WA 5IT9S 2QPAA 1HNZE 4KLNA 4G6ZA 4JYAM 2WDDA 2V1CA 1FJGM 3FGAC 4DV7M 1IXRC 4BC9A 1E9SA 1Q3CA 4DR4E 5EXPA 2QJCA 3H67A 4UT2A 3CF2A 1I94E 1GQEA 3GP1A 3TQSA 5EQVA 2NQ8C 3EIEA 3QWLA 3VK7A 5C18A 2MC6A 4XPNA 3J2PB 4DR5M 3KOWE 1SXJA 2RGOA 3I4VA 2L2MA 2EO2A 3AUZA 4FBQA 2DFJA 4FCXA 1GKIA 4M0VA 4GKKE 2IAEC 3GLFB 4WSPA 3PNVA 2L6MA 3UJNA 1L2DA 3FTCA 2Z7JA 3HQ1A 4LFAM 4B08A 4AI6A 4DV7E 1UILA 1FJGE 4KBPA 4ORCA 5B8IA 1ZAEA 1IXZA 2XGNA 4JXJA 4JI2E 1NHWC 3A98B 5EJCA 1N36M 1HNZM 1Z5BA 2L3CA 1NJGA 5E6JA 3LL8A 3H69A 2HHHE 2LUQA 4P7DA 4FVMA 4L8RC 2LNHC 2LWXA 3KSXA 4DV2M 1IY1A 1Z5CA 3TE6A 3ZTVA 4RNAA 1QVRA 4DR3M 3CF0A 4MGHA 3VFDA 3IVEA 2IHR1 4B3MM 3SMSA 4JI4M 1XXHA 3C5WC 4NRVA 2JVAA 2XF3A 1X47A 2M4IA 3P71C 5ITYA 2F5SA 3LLHA 4GEQB 1S3LA 2BDXA 4LF6E 2KXEA 3FUVA 5IREB 1XMQE 3ADJA 2P6BA 4QOSA 2NXFA 3KOZE 2RS6A 2Y0TA 2UXCE 4LF4E 5LMUE 4BBAA 1G59A 3ZOQB 3K2LA 4JI5E 3D8LA 5JPEA 4ORBA 1G8PA 1DGHB 3AFHA 1X48A 2L2NA 4IBBA 3E7AA 1ZQ9A 4MOYA 5EP3A 3U6QA 1N78A 4L78A 2F4VE 1W24A 2XZFA 3J81C 4TUIA 2XFTA 3EGGA 1NNUC 1N34M 4LJ9A 3PXGA 4BB9A 3VYYA 2FNAA 3SATA 2HYPA 1U32A 3TL4X 4LF9M 4QNRA 1NY5A 2G5GX 3GRYA 4REZA 2CPNA 3VKHA 2Z4SA 3HGIA 1XNQE 5EQTA 2RS7A 1UF3A 1JR3D 4KODA 4B3TM 2CFOA 1G3IA 2R62A 3T1HM 4JI1E 4O4KA 4ZX2A 3GQ5A 2V86A 2C9OA 5ITXE 2ZAOA 2FTXB 3JAMS 4G4RA 4FCTA 4D80A 3GPUA 3R9XB 4WPYA 2UUAM 4NL4H 4OOGC 2NUFA 4JI6E 4H1YP 3FKEA 3W0FA 3J7BA 1LV7A 4IBKA 5DYIA 1IN5A 4LRTA 1L2CA 2UUCM 1IN4A 2YFQA 1XXHB 5FTLA 1NSFA 2B9DA 2DXLA 1PM5A 1HT1E 4L16A 3KS8A 2DIXA 2Y0QA 1C1KA 3VDUA 4JI0E 4TUWA 2V87A 3FUWA 3H66A 3QFMA 2Q8UA 4AQYM 2XZUA 4GKJE 3NBIA 2OPFA 1HO5A 1S3SA 3KOYE 4LJ6A 1XNRM 1IBLE 4JV5M 5LMNM 3VYXA 3J80S 1QU6A 1ZBQA 1QYRA 3GLHB 2NUGA 3JYFA 3GPPA 2QENA 3U6MA 3RQZA 3D8BA 4JI7M 1XZWA 1IXSB 4BS9A 4AKGA 2RSMA 3RGSA 3J7AG 1SXJC 5KQDA 4DR7M 3THGA 3ADLA 1WXQA 2WDFA 5T6JA 4V0VA 2V6ZM 4LJ5A 3RFWA 3P1XA 5AE3A 4IYPC 2NPPC 2LH0A 5BR8M 1QAMA 5ITTA 2ODRD 3M0EA 4Z6YA 3ZCBB 2XSZA 4MGKE 2DSYA 4GHLA 4LACC 4LZJA 4D82A 2F5OA 2ZBMA 2KW0A 2WZOA 3UZUA 3E9SA 4OW0A 5LL6R 1IM2A 2QZ4A 4R8OA 4OX9E 1I4WA 2HL7A 4IJFA 5EXTA 4HL4A 2VQFE 2L7IA 3GLGA 4LJ7A 4MH0E 3U6PA 2WDCA 1ZBTA 4ORAA 1XMQM 3SAWA 4W5WA 2F5NA 1NVMA 3J7AS 3MK6A 3THNA 2VIIA 1HQYE 4LZZA 1L1TA 4JI7E 4DV3E 4B3ME 2KA6B 1S3MA 2JWOA 3VDPA 1DO0A 2BNKA 2YQZA 4G4QA 2EWLA 3KOXE 2Z4RA 4GITA 4II7A 4M9SA 3HHZA 4M2ZA 3HHYA 2QCUA 2QBYB 3RL4A 4OX9M 3FUTA 4PT5A 3DA1A 4LFBM 3CK2A 5EXXA 3H60A 3IG5A 1HT2E 2DMYA 3FYCA 2QP9X 2ZM6E 1Z59A 3A42A 5C1VA 1IBMM 2VF1A 3SASA 1MF8A 1X37A 3SYKA 3Q8XA 2HYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVE A;  4G9J A;  2AHD A;  3GVE A;  3C5W C;  3P71 C;  4H2B A;  1SU1 A;  4FBK A;  1QHW A;  4DSY A;  1S3L A;  2BDX A;  4YKE A;  3QFO A;  1Z2X A;  2P6B A;  5F3W A;  4V0W A;  2NXF A;  1USH A;  1KBP A;  1WAR A;  5JPF A;  3THO B;  3QG5 C;  4NZV A;  4I5N C;  4MP0 A;  3IB8 A;  4ORB A;  4MOY A;  1HPU A;  3E7A A;  3EGG A;  3H61 A;  1W24 A;  1S3N A;  4TUI A;  2YVT A;  4LU9 A;  3TGH A;  1Z2W A;  2HYP A;  3DSC A;  2O8G A;  1U32 A;  2KKN A;  2IE3 C;  3N5U A;  1JK7 A;  4FBW A;  1UF3 A;  2XMO A;  4O4K A;  4UT3 A;  4ZX2 A;  4JA9 A;  5JJT A;  3H68 A;  1M63 A;  1OIE A;  4JA7 A;  4H1Y P;  4DT2 A;  3PSO A;  1IT6 A;  1XM7 A;  4F0Z A;  1T70 A;  4Q7F A;  1WAO 1;  2CV9 A;  1OI8 A;  3H66 A;  2Z1A A;  2Q8U A;  1OID A;  3HVQ A;  3QFM A;  2BCD A;  4OR9 A;  1G5B A;  1FJM A;  2QFR A;  1HO5 A;  1V73 A;  4UWQ A;  2NYM C;  3ICF A;  5GTU A;  1S70 A;  3ZU0 A;  3H64 A;  4ZVZ A;  3JYF A;  1TCO A;  2Z72 A;  2A22 A;  3E7B A;  3RQZ A;  4O5G A;  1XZW A;  3EGH A;  4H2F A;  5IOH A;  4DHL A;  2WDF A;  4KKZ A;  4V0V A;  4IYP C;  3DSD A;  4H1S A;  2HY1 A;  2NPP C;  4WWL A;  5HPE A;  1HP1 A;  3H62 B;  4J6O A;  1NNW A;  4B2O A;  3K7W C;  2BQ8 X;  1QFC A;  2WDE A;  4O43 A;  4V0X A;  3THN A;  4LAC C;  3RL3 A;  3AV0 A;  1AUI A;  4TUG A;  5JPE A;  2ZBM A;  2WDD A;  3FGA C;  3H67 A;  4O24 A;  2QJC A;  4UT2 A;  3H63 A;  5J28 A;  2WDC A;  1T71 A;  1UTE A;  5EQV A;  2IE4 C;  4ORA A;  4IL1 A;  4UT3 B;  3V4Y A;  2R17 A;  2NYL C;  2USH A;  4XPN A;  3PSN A;  4MOV A;  4H2I A;  4H2G A;  1S3M A;  3KBP A;  4HD0 A;  3AUZ A;  4FBQ A;  2O8A A;  2DFJ A;  4FCX A;  4M0V A;  3IVD A;  1S8E A;  3QFK A;  2IAE C;  5INB A;  3T1I A;  2QFP A;  4KBP A;  4ORC A;  4LTY A;  3RL4 A;  5B8I A;  3QFN A;  3CK2 A;  1II7 A;  1S95 A;  3H60 A;  2Z06 A;  3DW8 C;  3LL8 A;  3H69 A;  2GJU A;  2JOG A;  3K7V C;  3C9F A;  5DNY A;  5C1V A;  3ZTV A;  4I5L C;  1MF8 A;  3RL5 A;  3IB7 A;  2HYO A; 
#chains in the Genus database with same CATH topology
 1PJQ A;  3GVE A;  5GKN A;  2EPA A;  1J5E M;  2VE7 C;  4NXM M;  1GLN A;  2LVA A;  2WBS A;  5IZ7 D;  3HJQ A;  2D7E A;  4I81 A;  5JPF A;  4MP0 A;  3U60 B;  3T6P A;  1AUA A;  1OAI A;  4I4L A;  5KQ8 A;  3OML A;  4LRS A;  4ZPX A;  1TGU A;  1R2Y A;  4UT3 A;  1XXH E;  5LMN E;  2QSF X;  2CUZ A;  1HR0 E;  5FTM A;  4IBJ A;  3EPL A;  2J7N A;  1PJI A;  4OU7 A;  3U6S A;  2CE7 A;  3ZH9 B;  2LUP B;  2FFJ A;  2UUC E;  2BCD A;  4Q35 B;  2JY7 A;  4B3R M;  4LFC E;  4GH9 A;  1E9R A;  4L15 A;  4HTG A;  3MHH C;  1DV0 A;  2BJW A;  1A1K A;  2VF8 A;  3K92 A;  4F54 A;  2O5R A;  2FGG A;  4DMI A;  2JUJ A;  3U61 A;  1A5T A;  4JI3 M;  1NY6 A;  4DV5 M;  5IV8 B;  2ENA A;  3U6C A;  2F5P A;  1T71 A;  4JI6 M;  2B7V A;  2NYL C;  1NNJ A;  2USH A;  1G41 A;  5FLX C;  2K0B X;  1XB2 B;  2XEP A;  1JQJ C;  2EMK A;  1SR9 A;  4I5S A;  2KDL A;  2UUB E;  3A46 A;  2YTQ A;  2R18 A;  3JU0 A;  3JR5 A;  3GQ4 A;  1WRJ A;  3F6G A;  4ZYG A;  2JOG A;  3K7V C;  5DNY A;  1BBO A;  5KL2 A;  4PCZ A;  3VKG A;  1QDT A;  4G9J A;  4NC6 A;  1BB8 A;  2ZAN A;  1RC7 A;  4WXC A;  4B7G A;  1J26 A;  2UU9 M;  1SXJ B;  1HPU A;  4WP2 A;  2C99 A;  3PFI A;  4WYQ B;  2KZU A;  2EZ6 A;  2J5Y A;  3H61 A;  2YVT A;  4LU9 A;  3K1J A;  3GQ3 A;  4JI2 M;  3AJI B;  1JK7 A;  3M6A A;  3WHK A;  1KFV A;  3U6O A;  4GRI A;  2KON A;  4IIW A;  4JA7 A;  2GLI A;  4DR4 M;  4QNM A;  3SC3 A;  4X9J A;  4LJ4 A;  3LQR A;  3C4T A;  5ITU A;  1BBG A;  3QAU A;  1FJM A;  2X49 A;  2UXB E;  4BMJ A;  2JOB A;  3DOA A;  8CAT A;  2QHO B;  2R44 A;  4NSR A;  2R45 A;  2EM3 A;  3E46 A;  2C9C A;  4DV0 M;  4NHR A;  4JI8 E;  4GC5 A;  4AG5 A;  2A5Y B;  2WDE A;  2EOM A;  4DR2 M;  3VLF B;  2FS1 A;  3H4M A;  3RGP A;  3T15 A;  4YHH E;  2UXC M;  4F9B B;  3IWC A;  2M5Z A;  2EM0 A;  3PSN A;  5AAS A;  1L8Q A;  2CHG A;  4H2G A;  1EE8 A;  5LLQ A;  3SAU A;  4QHS A;  5FTK A;  2QFP A;  1OQY A;  2MKN A;  2CRU A;  4DUY M;  1L1Z A;  1HNW M;  1TDZ A;  2NUE A;  1Z6T A;  1KSF X;  3DJW A;  4GIP A;  2NA2 A;  3I04 M;  2L3J A;  2V85 A;  3RL5 A;  3FIG A;  3U6E A;  3IWD A;  4H2B A;  4DSY A;  1EKZ A;  3GLH E;  4KO8 A;  1IY2 A;  2ZBK B;  1WHQ A;  2CV1 A;  2H36 X;  2DAI A;  4M9Z A;  4DR2 E;  1TH2 A;  3FTD A;  1HNW E;  5A6J A;  2V83 A;  2ZTD A;  4QOZ C;  3K6Q A;  2Y21 A;  4FWG A;  2EOX A;  1NCS A;  1IFY A;  4F9C B;  3Q8G A;  2EP3 A;  2GPI A;  4XK8 F;  3C58 A;  5DYG A;  1CUK A;  3H09 A;  2LJU A;  2LHC A;  2JP9 A;  2DAG A;  2CV9 A;  2YTJ A;  4F6N A;  5AC4 A;  4DV0 E;  3SFZ A;  2JOX A;  4NXM E;  4BHC A;  2V89 A;  2BB8 A;  3UMM A;  1L4S A;  4B3T E;  4WFT A;  3AKZ A;  2JY8 A;  4QHT A;  4CHT B;  3I4Y A;  3CTW B;  1PKP A;  3THN A;  3OTO E;  3AV0 A;  2EMW A;  3VHT B;  1N36 E;  4M0W A;  2HAK A;  4G6Z A;  3H67 A;  2APL A;  1IXR C;  4DV7 M;  4BC9 A;  1LTM A;  4UT2 A;  1GQE A;  2NQ8 C;  2MC6 A;  4XPN A;  2EM7 A;  3J2P B;  4DR5 M;  1WHC A;  2RGO A;  4FBQ A;  4FCX A;  1GKI A;  4GKK E;  2IAE C;  4WSP A;  1ZMW A;  3HY5 A;  2Z7J A;  3HQ1 A;  4LFA M;  4KBP A;  4DV7 E;  1VEK A;  1FJG E;  4RHB B;  1NHW C;  3A98 B;  5EJC A;  1Z5B A;  3LL8 A;  2HHH E;  2LUQ A;  4P7D A;  4DV2 M;  3ZTV A;  4RNA A;  3SMS A;  4NRV A;  2JVA A;  2LCE A;  5ITY A;  2YU5 A;  3ADJ A;  2P6B A;  3KOZ E;  4LF4 E;  5LMU E;  4IJD A;  3ZOQ B;  1PGY A;  3D8L A;  1P47 A;  4IBB A;  3E7A A;  3EGG A;  3J81 C;  4TUI A;  2XFT A;  1NNU C;  5L8R F;  2FNA A;  1GJT A;  1U32 A;  4LF9 M;  1NY5 A;  1A1F A;  4REZ A;  3VKH A;  3HGI A;  3FRI A;  4O4K A;  1YPN A;  2C9O A;  5ITX E;  2WCC 3;  2FTX B;  3CGW A;  4FCT A;  4NL4 H;  4JI6 E;  3J7B A;  1IN5 A;  2UUC M;  2LBC A;  4L16 A;  3QFM A;  4F1I A;  4AQY M;  2XZU A;  2EQ0 A;  3NBI A;  1HO5 A;  3KOY E;  4LJ6 A;  4JV5 M;  5A6B A;  2DAM A;  3GPP A;  2VRD A;  2CWB A;  3J7A G;  2WDF A;  3THG A;  4V0V A;  3P1X A;  2NPP C;  5BR8 M;  5ITT A;  3M0E A;  3ZCB B;  4ZYH A;  2DRP A;  2DSY A;  4LZJ A;  2F5O A;  4OX9 E;  1GO5 A;  4HL4 A;  2L7I A;  1ZBT A;  1L1T A;  4B3M E;  1S3M A;  2YSP A;  1DO0 A;  2YQZ A;  4GIT A;  4M2Z A;  2EPM X;  1QZE A;  3FUT A;  2EJ4 A;  1NV9 A;  2LHG A;  5EXX A;  2DMY A;  1Z59 A;  4M9V C;  1IXS A;  2YTP A;  4JI1 M;  1R6B X;  1Z5A A;  2WSE F;  3C6M A;  2C96 A;  3BOS A;  2L8T A;  3V76 A;  4MGY E;  4RF0 A;  1BVS A;  1IBM E;  1G2D C;  4FD2 A;  4PD2 A;  4NZV A;  5KPZ A;  2KHX A;  2LV2 A;  4N4R B;  2L09 A;  2EOR A;  5FTJ A;  3UK3 C;  7CAT A;  3L2A A;  2LVN C;  3GLI B;  4B7F A;  2CP8 A;  2K4V A;  3CF6 E;  4WW0 A;  4XBO A;  4FBW A;  2XMO A;  2EPX A;  1XHB A;  3KP1 E;  4YY3 E;  4JA9 A;  5JJT A;  3LVW A;  2EOY A;  3GLF A;  1A1I A;  2L33 A;  1M63 A;  2EOO A;  2DHR A;  1IT6 A;  4S12 A;  1PDA A;  1OKS A;  2R46 A;  3IWB A;  4GZN C;  2XFS A;  4DV1 E;  4DUZ E;  4ZYD A;  1GTK A;  3ZU0 A;  4WUR A;  1IBK M;  1QUS A;  2L7H A;  3M7G A;  3DSD A;  2YSO A;  4FK5 C;  3L25 A;  5FTN A;  1N75 A;  3FUU A;  4LGY A;  1N3G A;  3GLI A;  3GRR A;  1TN9 A;  4I8O A;  2EMI A;  4IL1 A;  2JZ1 A;  1DQ3 A;  5ITR A;  1ZV1 A;  1DGF A;  3GO8 A;  4DR5 E;  1DI2 A;  3IVD A;  3B7Z A;  1PJT A;  3LMM A;  2G7H A;  2DZO B;  3UGJ A;  1OJL A;  2L2K B;  2Z8Y M;  4OVZ B;  2HJJ A;  4LJ8 A;  4LFB E;  3K8Z A;  2R6F A;  3UK6 A;  4I5L C;  2P5T A;  1V33 A;  4IBG A;  2EPU A;  1TF3 A;  2HCB A;  4KWY A;  1QHW A;  1T38 A;  1QAQ A;  2DWN A;  2DAE A;  2KNV A;  4DKK A;  4MGZ E;  4Z8X A;  4G3O A;  4I5N C;  2UXD E;  3BBG A;  1W5T A;  3GLH A;  1ZMU A;  3QYE A;  2M1S A;  1DGC A;  2F8B A;  2YWQ A;  3VK8 A;  2KRU A;  1MU5 A;  2LVP C;  4WSG A;  2ZTC A;  2BWE A;  3C6K A;  5KPT A;  3FD9 A;  2K7I A;  1OFI A;  1MX0 A;  1WGL A;  1IN7 A;  2YT4 A;  4HLQ A;  2MR9 A;  2EMB A;  2N8X A;  1E94 E;  3C9P A;  1PJJ A;  2CV2 A;  2QQ8 A;  5FSW A;  1OI8 A;  2LXE A;  4DV4 M;  2QBY A;  1L2B A;  2QFR A;  4X62 M;  4UWQ A;  2WSC F;  4P17 A;  1T3T A;  2A22 A;  2YTF A;  2YZT A;  5A2Q C;  4DHL A;  4KHP E;  3E0J A;  1QUT A;  4MM3 B;  4DR1 E;  3KDS E;  3H62 B;  2K47 A;  4LF5 M;  2A25 A;  2E1M A;  2BQ8 X;  1P3Q Q;  3MMP A;  4AKI A;  1QZM A;  2EPK X;  3IG8 A;  1T4N A;  5EXS A;  1IQO A;  5IT9 C;  4JI8 M;  4UT3 B;  1PRB A;  3L27 A;  2ODR C;  1N32 M;  2YEQ A;  4H2I A;  4HD0 A;  3E21 A;  2FV4 B;  1KYI A;  4R2C A;  5INB A;  3KWR A;  3U5Z B;  4EIW A;  2HKJ A;  3LVV A;  5EP1 A;  3C9F A;  2DVW B;  2KRK A;  4WX9 A;  4M9X A;  2AHM A;  1K3W A;  4PDI A;  4FBK A;  2DKL A;  2LE2 A;  2MDR A;  5JI3 E;  1X6H A;  3QG5 C;  3B7Q A;  3AOE A;  3IB8 A;  1GAB A;  1N34 E;  1RU3 A;  3TWM A;  2LBS B;  2EKK A;  2UXD M;  2R4E A;  1K82 A;  1YE9 A;  1X49 A;  1D2N A;  2DWZ B;  3JR4 A;  3ADI A;  1WGN A;  4JV5 E;  3H68 A;  1XNR E;  1OIE A;  3KVW A;  2Z3X A;  2K9D A;  1N33 M;  2YTI A;  1JB0 F;  3KZY A;  2N3G A;  3ADG A;  3DZD A;  1V73 A;  2ZAM A;  2VQE M;  3TWK A;  1GVN A;  1YSA C;  2O25 A;  2EMH A;  3J80 C;  1YYW A;  4GHA A;  1J7K A;  1VDD A;  2H1R A;  1IQP A;  1YLA A;  2YTE A;  3HTX A;  2DXN A;  1MGT A;  3NWL A;  1IBL M;  2Y20 A;  2I7P A;  4O43 A;  2OOA A;  3RL3 A;  3JTZ A;  2KOU A;  2J7J A;  1DGH A;  2QPA A;  2EM5 A;  2WDD A;  1F2I G;  1E9S A;  3BID A;  1VG5 A;  3CF2 A;  5EQV A;  1NEI A;  1SXJ A;  1OIP A;  2L2M A;  4M0V A;  1L2D A;  3FTC A;  1UIL A;  1ZAE A;  1IXZ A;  2L3C A;  1HNZ M;  2LTU A;  1TF6 A;  1PJS A;  2MH8 A;  3I01 M;  4FVM A;  4L8R C;  2EPP A;  2LWX A;  1IY1 A;  1Z5C A;  1EIJ A;  1QVR A;  3CF0 A;  4MGH A;  2EJS A;  3IVE A;  2IHR 1;  4JI4 M;  1XXH A;  1X47 A;  3BXW A;  2F5S A;  1Z1B A;  2BDX A;  1EFU B;  5IRE B;  1XMQ E;  2NXF A;  2Y0T A;  4ORB A;  1X48 A;  4L78 A;  4BB9 A;  3GRY A;  1JR3 D;  4KOD A;  4B3T M;  2CFO A;  2R62 A;  3T1H M;  3GQ5 A;  2UUA M;  2NUF A;  3FKE A;  3W0F A;  4R2E A;  1LV7 A;  4IBK A;  1WR1 B;  1IN4 A;  1NSF A;  2DGC A;  2DIX A;  2Y0Q A;  3W67 A;  1UBD C;  2Q8U A;  2OPF A;  1XNR M;  1TTE A;  2QEN A;  3U6M A;  3D8B A;  1IXS B;  3B74 A;  4BS9 A;  1YFH A;  2GQF A;  1SXJ C;  2EQ3 A;  3ADL A;  5T6J A;  3RFW A;  2JPA A;  1ZMV A;  2LH0 A;  2ODR D;  1X3C A;  2LT7 A;  4D82 A;  2KW0 A;  2WZO A;  5LL6 R;  3E9S A;  4OW0 A;  1NV8 A;  4IJF A;  3GLG A;  4MH0 E;  1XMQ M;  4W5W A;  2F5N A;  1NVM A;  3MK6 A;  1HQY E;  1Y8G A;  2EPN A;  3QYB A;  2JWO A;  3VDP A;  3K9P A;  2Z4R A;  4II7 A;  4M9S A;  1EH7 A;  1T39 A;  2H5X A;  2QBY B;  4OX9 M;  3EQ1 A;  3DA1 A;  4LFB M;  2YRH A;  1HJP A;  2I9I A;  5C1V A;  3A42 A;  2EE8 A;  2HYO A;  3T1H E;  2JR1 A;  1UHZ A;  3AOG A;  4LFC M;  4B3R E;  2OOB A;  4YKE A;  2ZM6 M;  1XNQ M;  4DUZ M;  3LQQ A;  1R2Z A;  1WAR A;  4B3S M;  3F92 A;  2JXP A;  5ADZ A;  3ECR A;  1J09 A;  1FKA E;  3I51 A;  2F4V M;  1QNT A;  2X8A A;  2V1U A;  4L8N A;  4JI0 M;  1IQS A;  2FE8 A;  4J8Z A;  2PRT A;  4Y28 F;  2EL6 A;  1VDL A;  2JZ0 A;  1MJG M;  4Q28 A;  4L5N C;  3T1Y M;  4LCB A;  2DXI A;  3FLO A;  4F0Z A;  4DV4 E;  2EM8 A;  4R03 A;  4DV2 E;  1IMU A;  4Q7F A;  2EOJ A;  4NRW A;  2LTS A;  1JK1 A;  2LJH A;  2YNM D;  4BC7 A;  4LF4 M;  4ZVZ A;  4X66 M;  2LMZ A;  5E26 A;  1E32 A;  2EOS A;  1YYO A;  4DV6 M;  2W82 A;  2C98 A;  4H1S A;  2HY1 A;  2NAB A;  3IEC A;  3K7W C;  1T43 A;  4V0X A;  2XH9 A;  3EIH A;  3HU1 A;  1XWI A;  4FWH A;  1O0W A;  5JPE A;  2I7N A;  1ZU1 A;  3OTO M;  4GMQ A;  2J7O A;  4LY6 A;  5KL4 A;  2CTD A;  3H63 A;  2EOI A;  2EPO A;  1TDH A;  3TWL A;  3V4Y A;  2IE4 C;  5EP2 A;  1VQ1 A;  4LF7 E;  5A6A A;  4D81 A;  1X6F A;  5AE1 A;  2N35 A;  1T4L B;  4HEO A;  2O8A A;  3QFK A;  4R2Q A;  3T1I A;  3F6H A;  1R7R A;  4LTY A;  4X64 M;  2LO3 A;  3FTF A;  4ITQ A;  2UU9 E;  4DV1 M;  4BCA A;  4AZF A;  1HQC A;  1N33 E;  2Z06 A;  2EMG A;  1R5L A;  2MGW A;  3VK6 A;  2JY9 A;  3D03 A;  1N32 E;  4YY3 M;  3QFO A;  5F3W A;  2V88 A;  4B7H A;  3THO B;  4R2P A;  2R65 A;  2LRS A;  4G4O A;  2YTN A;  2L92 A;  4KT0 F;  1T6O A;  4K0K E;  4CJ6 A;  1HNX M;  3L26 A;  2BWB A;  3N5U A;  4XGI A;  5AC5 A;  3T1Y E;  3HU3 A;  2JWS A;  3MJ5 A;  2VQE E;  4P78 A;  2EUC A;  2EML A;  4JYA E;  2YTG A;  4IBD A;  4R2R A;  2EOH A;  5KL5 A;  4AQY E;  2DNA A;  3E4R A;  2ENH A;  3J7Y p;  3AL0 C;  4L4U A;  4B3S E;  2JP7 A;  3GRU A;  3FE3 A;  3H64 A;  4MGI E;  4LF8 E;  4LJA A;  4H2F A;  1YZ9 A;  3J27 B;  2EM4 A;  2LTR A;  3WHL A;  2X4A A;  1VEG A;  3KW6 A;  2KZS A;  3HJS A;  1QFC A;  2MDG A;  3W68 A;  1AUI A;  2KEB A;  2DI0 A;  2WZJ A;  2YU8 A;  2EKF A;  4KHP M;  3BBZ A;  3SYL A;  1FNN A;  3M99 B;  4LF7 M;  4NSO B;  2EQ1 A;  2JYA A;  3HU2 A;  5IXM B;  1S8E A;  2DAK A;  4CIS A;  4M30 A;  3DF6 A;  5IWA E;  2EL4 A;  4YHH M;  4M0D A;  2UXB M;  1II7 A;  2HHH M;  4NXN E;  2YRK A;  2EM6 A;  1W5S A;  2D7H A;  4MOV A;  2LVQ D;  1A1H A;  4KZS A;  2RKO A;  2EN6 A;  2EOF A;  4GC9 A;  3U6D A;  2EOZ A;  1KJK A;  1Z2X A;  4BLC A;  1USH A;  3PVS A;  3FTE A;  1EH8 A;  1G2F C;  3MHS C;  2VQF E;  3LML A;  1H6U A;  1Z2W A;  3HHX A;  2KKN A;  3SMP A;  2YR0 A;  4ANR A;  3KSJ A;  2EL5 A;  2GHF A;  5CFF E;  2ADR A;  1YSY A;  2DZL A;  2CT1 A;  1XMO M;  4IBF A;  2V8Q B;  3PSO A;  1XM7 A;  4X65 E;  1T70 A;  4LG2 A;  2CHV A;  4IJE A;  1X6E A;  2BJV A;  3HVQ A;  2KNZ A;  1G5B A;  2EA0 A;  5AE2 A;  2GNO A;  4R3D A;  5A69 A;  2RGH A;  1S70 A;  4IBC A;  2ENC A;  1NHG C;  4LF8 M;  1SXJ E;  5A2Q S;  4RH8 A;  4LF6 M;  2VF7 A;  5IOH A;  4AKH A;  3BGH A;  4OVZ A;  3A45 A;  5ITX A;  4FW9 A;  3L28 A;  1VEJ A;  1DO2 A;  5LMU M;  3ZC7 B;  4DV5 E;  1HNZ E;  5IT9 S;  4MLV A;  4KLN A;  4JYA M;  2I13 A;  3FGA C;  1SFE A;  1MEY C;  1I94 E;  3TQS A;  5C18 A;  2RRU A;  3KZZ A;  1QDR A;  3KOW E;  2R76 A;  2EO2 A;  3AUZ A;  4F2J C;  4ORC A;  4AI6 A;  4B08 A;  4JXJ A;  1NJG A;  3H69 A;  2EMZ A;  5A6K A;  4B3M M;  3C5W C;  3P71 C;  4BHB A;  2XF3 A;  3LLH A;  4LF6 E;  2KXE A;  4QOS A;  2RS6 A;  3K2L A;  2R0I A;  2MRO B;  2BBG A;  3AFH A;  3FRH A;  5EP3 A;  1N34 M;  4LJ9 A;  2HYP A;  2G5G X;  1D0K A;  2EPR A;  2RS7 A;  4JI1 E;  1G3I A;  2V86 A;  4G4R A;  3GPU A;  4WPY A;  4OOG C;  1A1G A;  1YUJ A;  1L2C A;  1Q02 A;  1XXH B;  4Q7J A;  2B9D A;  1PM5 A;  3KS8 A;  1C1K A;  4TUW A;  2V87 A;  3FUW A;  2EM2 A;  3H66 A;  4RKU F;  1A1L A;  1S3S A;  2EN1 A;  3VYX A;  1C7Y A;  1F4I A;  1V34 A;  2L4E A;  1QYR A;  2LVO C;  2NUG A;  4JI7 M;  4AKG A;  2RSM A;  3RGS A;  3L00 A;  1WXQ A;  2EPZ A;  3EPH A;  4LJ5 A;  5AE3 A;  1YUI A;  2XSZ A;  2EMC A;  4MGK E;  4GHL A;  2HGH A;  5A6B D;  3UZU A;  1IM2 A;  1I4W A;  2HL7 A;  3TQM A;  4LJ7 A;  2WDC A;  3U6P A;  2YTO A;  4ORA A;  3GLF E;  2JY5 A;  2VII A;  4JI7 E;  1G71 A;  2B3T A;  2QCU A;  3RL4 A;  2EN4 A;  3FYC A;  2QP9 X;  2JXN A;  3HZJ A;  2ZM6 E;  2JY6 B;  2VF1 A;  1NJF A;  2UXC E;  4LGM A;  1JR3 A;  2CV0 A;  3SAR A;  4LF9 E;  4X8W A;  2D7G A;  2E72 A;  4BBY A;  1QAN A;  5JI2 E;  1IN6 A;  3KP0 E;  4DUY E;  3B89 A;  3J81 S;  4AG6 A;  2R4J A;  2RPC A;  4PDG A;  4JI5 M;  3TGH A;  2IE3 C;  4CIZ A;  4P16 A;  4FCW A;  1RMD A;  2DB2 A;  1GJS A;  2L6O A;  4CGY B;  5C1B A;  4DT2 A;  4DR3 E;  2EPL X;  3HX3 A;  3SHG B;  3R8F A;  4ZYE A;  2CHQ A;  1ORY B;  4OR9 A;  1OID A;  1YYK A;  2NYM C;  4DR6 M;  3ICF A;  5GTU A;  3EPK A;  4JN6 A;  1QQW A;  4AW4 A;  1TCO A;  1GZ6 A;  3U60 A;  3HWS A;  4KKZ A;  2RSI A;  3K9O A;  5KL6 A;  1R4G A;  2B3T B;  3HXL A;  5HPE A;  1HP1 A;  2ZOA A;  4B2O A;  4G4N A;  3U5Z A;  5KO3 A;  3KS4 A;  3B9P A;  2E5L M;  4NOO B;  2WSF F;  3LW5 F;  2DWM A;  4O24 A;  2ZO9 B;  5J28 A;  2ELZ A;  1UTE A;  2D9H A;  4X66 E;  4FCV A;  1D0L A;  1B69 A;  2R17 A;  1K3X A;  2N3H A;  1IBK E;  2EN8 A;  2MC5 A;  1G4A E;  3GRV A;  1J5E E;  4R7G A;  2WBU A;  3SBJ A;  1AAY A;  3KBP A;  4IBE A;  4DBG B;  1STU A;  4F2L A;  3T38 A;  1S95 A;  2C5R A;  4IS1 C;  2GJU A;  4X65 M;  2ELY A;  2JNH A;  2KNA A;  3IB7 A;  1TH4 A;  4JI4 E;  3AOE C;  1DGG A;  2XSZ D;  2DLQ A;  1SU1 A;  1GL7 A;  3LCV B;  4F9A B;  5DFL A;  2B7T A;  2YTD A;  1WHN A;  2ERC A;  3MHV C;  3GLG B;  2R1F A;  1UN6 B;  2UUB M;  3DSC A;  1WXR A;  4L6V 6;  3MSW A;  4LFA E;  2O8G A;  4GKK M;  3HHW A;  1Q39 A;  2RQL A;  1UFZ A;  1I94 M;  4MLQ A;  1HNX E;  2F5Q A;  4DR6 E;  3KFU G;  3HKP A;  3GPY A;  5BPV A;  3C3D A;  5EP4 A;  4IBI A;  2E5L E;  1WAO 1;  2K6B A;  2DZN B;  3KXE C;  4JI3 E;  4A3V B;  3SHF A;  1WJ7 A;  1GL6 A;  2Z1A A;  2DMI A;  4MB7 A;  2RTX A;  3L29 A;  1RQ0 A;  3RE8 A;  2Z72 A;  3W0L B;  2FOI C;  3E7B A;  4DV3 M;  4O5G A;  1IN8 A;  3EGH A;  1DGB A;  1IY0 A;  2DHY A;  4WWL A;  1TH3 A;  4J6O A;  1NNW A;  3SAV A;  1X5W A;  5BR8 E;  4NXN M;  3IHP A;  2G8L A;  2EPC A;  1HR0 M;  3JAM C;  5IWA M;  5TSE A;  4GEW A;  3B7N A;  3ILK A;  3HPS A;  2EOQ A;  1T4O A;  2MKD A;  1OFH A;  3QFN A;  3DFZ A;  3DW8 C;  2G3Q A;  4DV6 E;  2EMX A;  3HJ8 A;  1OIZ A;  1SXJ D;  1D0M A;  2AHD A;  3FYD A;  3FUX A;  1ZAA C;  2EN3 A;  3HPZ A;  1N77 A;  2XLJ A;  4V0W A;  2EMF A;  3C4B A;  1KBP A;  1V92 A;  2M9A A;  1AH5 A;  5KPR A;  4R2S A;  4RF1 A;  3RMP A;  2EMY A;  1S3N A;  2CEA A;  2JA2 A;  2DWL A;  3U61 B;  3U6L A;  2M7Q A;  2UUA E;  1XC8 A;  1QAO A;  5KL7 A;  5FLX S;  2OQ4 A;  4K0K M;  4WXD A;  3ZQJ A;  2CSH A;  1TF0 B;  2EM9 A;  5H37 D;  4LF5 E;  2DLK A;  4DR1 M;  4DR7 E;  4X64 E;  1XMO E;  4FWD A;  4R2A A;  3GPX A;  5ITQ A;  4X62 E;  1Q3B A;  4GKJ M;  2M60 A;  3TPZ A;  1UM8 A;  3PNY A;  2VQF M;  1YUB A;  1NO1 A;  2Q2E B;  4TUG A;  1A1J A;  2V1C A;  1FJG M;  2QJC A;  4DR4 E;  1Q3C A;  5EXP A;  2EMA A;  3GP1 A;  3EIE A;  3QWL A;  3VK7 A;  1EH6 A;  1OTR A;  3I4V A;  5KL3 A;  2DFJ A;  1SG9 A;  3GLF B;  3PNV A;  2L6M A;  4HEI A;  3UJN A;  5B8I A;  4JI2 E;  2XGN A;  1N36 M;  1OAO C;  2QNJ A;  5E6J A;  3LCU A;  3EPJ A;  2LNH C;  3KSX A;  3TE6 A;  4DR3 M;  1MN3 A;  3VFD A;  2HWJ A;  2M4I A;  1S3L A;  4GEQ B;  3FUV A;  1JK2 A;  1TR8 A;  2HC5 A;  4UN2 B;  4BBA A;  1G59 A;  3NBX X;  4JI5 E;  1WJP A;  1G8P A;  1DGH B;  4MOY A;  2L2N A;  1ZQ9 A;  1N78 A;  3U6Q A;  3GLG E;  2F4V E;  1W24 A;  2XZF A;  3GLI E;  3PXG A;  3VYY A;  3SAT A;  3C3E A;  3TL4 X;  4QNR A;  2CPN A;  2Z4S A;  2O01 F;  1XNQ E;  5EQT A;  1UF3 A;  4ZX2 A;  2L2D A;  2ZAO A;  3BF2 A;  3JAM S;  2EN7 A;  4D80 A;  3R9X B;  1KYQ A;  4H1Y P;  5DYI A;  4LRT A;  2DXL A;  2YFQ A;  5FTL A;  2L4F A;  2OO9 A;  1HT1 E;  3VDU A;  4JI0 E;  4GKJ E;  1IBL E;  5LMN M;  3J80 S;  2KHH A;  2YRM A;  1QU6 A;  1ZBQ A;  3GLH B;  3JYF A;  3RQZ A;  1XZW A;  2EOE A;  5KQD A;  4R71 A;  4DR7 M;  2V6Z M;  4IYP C;  1QAM A;  4Z6Y A;  2LVH A;  4LAC C;  2ZBM A;  2WBT A;  2QZ4 A;  4R8O A;  4F6M A;  5EXT A;  2YPN A;  3H4J A;  1JR3 E;  3SAW A;  3J7A S;  1WIV A;  2EN2 A;  4LZZ A;  4DV3 E;  2KA6 B;  2VDB B;  1LLM C;  2BNK A;  2EWL A;  4G4Q A;  3KOX E;  3HHZ A;  2FH0 A;  4R2D A;  3HHY A;  4PT5 A;  3CK2 A;  1AIP C;  3H60 A;  3IG5 A;  1HT2 E;  1ZR9 A;  2MJ5 B;  2DEN A;  1IBM M;  3SAS A;  1MF8 A;  1X37 A;  3SYK A;  3Q8X A; 
#chains in the Genus database with same CATH homology
 4JI1 M;  1R6B X;  3T1H E;  1NJF A;  1Z5A A;  1UHZ A;  2JR1 A;  3GVE A;  5GKN A;  3AOG A;  1J5E M;  2VE7 C;  4LFC M;  4B3R E;  2C96 A;  3BOS A;  4LGM A;  1JR3 A;  2CV0 A;  3SAR A;  2L8T A;  4NXM M;  1GLN A;  4LF9 E;  4MGY E;  4RF0 A;  5IZ7 D;  3HJQ A;  4X8W A;  4YKE A;  2ZM6 M;  2D7G A;  4DUZ M;  1XNQ M;  3LQQ A;  2D7E A;  4BBY A;  4I81 A;  1R2Z A;  4B3S M;  1IBM E;  1WAR A;  4FD2 A;  4PD2 A;  5ADZ A;  5JPF A;  4NZV A;  4MP0 A;  1J09 A;  1QAN A;  3U60 B;  5JI2 E;  1IN6 A;  5KPZ A;  2KHX A;  3KP0 E;  4DUY E;  3I51 A;  3J81 S;  2L09 A;  2F4V M;  4AG6 A;  1FKA E;  5FTJ A;  2X8A A;  4I4L A;  2R4J A;  7CAT A;  3L2A A;  2V1U A;  4L8N A;  4JI0 M;  3T1Y E;  3GLI B;  5KQ8 A;  4PDG A;  4JI5 M;  4B7F A;  2FE8 A;  4J8Z A;  3TGH A;  3OML A;  4LRS A;  4ZPX A;  2K4V A;  3CF6 E;  2IE3 C;  4WW0 A;  4P16 A;  4XBO A;  1TGU A;  4FBW A;  2XMO A;  4FCW A;  1R2Y A;  4UT3 A;  1XHB A;  3KP1 E;  4YY3 E;  4Q28 A;  4JA9 A;  4L5N C;  5JJT A;  3T1Y M;  4LCB A;  2DXI A;  3LVW A;  2DB2 A;  5LMN E;  2CUZ A;  3GLF A;  1HR0 E;  2L6O A;  3FLO A;  5FTM A;  2L33 A;  4CGY B;  5C1B A;  4IBJ A;  1M63 A;  2J7N A;  4DR3 E;  4DT2 A;  2DHR A;  1IT6 A;  1PJI A;  4F0Z A;  4S12 A;  4DV4 E;  4OU7 A;  4R03 A;  4DV2 E;  3SHG B;  3U6S A;  3R8F A;  4Q7F A;  2CE7 A;  2R46 A;  3ZH9 B;  4NRW A;  2CHQ A;  3IWB A;  2LUP B;  2XFS A;  1ORY B;  2FFJ A;  2LTS A;  2UUC E;  4OR9 A;  1OID A;  2BCD A;  4DV1 E;  1YYK A;  4DUZ E;  2LJH A;  2YNM D;  4BC7 A;  4LF4 M;  2NYM C;  4DR6 M;  3ICF A;  5GTU A;  4B3R M;  4LFC E;  3ZU0 A;  4GH9 A;  4JN6 A;  1E9R A;  4WUR A;  4L15 A;  4ZVZ A;  1QQW A;  4AW4 A;  1TCO A;  1IBK M;  2BJW A;  4X66 M;  2LMZ A;  5E26 A;  1E32 A;  1YYO A;  4DV6 M;  1GZ6 A;  3U60 A;  3K92 A;  3HWS A;  4F54 A;  2W82 A;  2L7H A;  2C98 A;  3M7G A;  4KKZ A;  2O5R A;  3DSD A;  4H1S A;  2HY1 A;  2B3T B;  2FGG A;  3HXL A;  4DMI A;  2LBS B;  5HPE A;  1HP1 A;  2ZOA A;  3U61 A;  4B2O A;  3K7W C;  4JI3 M;  4G4N A;  3U5Z A;  2XH9 A;  5KO3 A;  4V0X A;  1NY6 A;  4DV5 M;  3EIH A;  3HU1 A;  1XWI A;  4FWH A;  3L25 A;  3KS4 A;  1O0W A;  2I7N A;  2R17 A;  3OTO M;  3B9P A;  4GMQ A;  5FTN A;  1N75 A;  3FUU A;  4LGY A;  2J7O A;  4LY6 A;  4NOO B;  2E5L M;  2DWM A;  3GLI A;  4O24 A;  2ZO9 B;  3GRR A;  3H63 A;  5J28 A;  3U6C A;  1TDH A;  3TWL A;  4I8O A;  2F5P A;  4JI6 M;  1T71 A;  1UTE A;  4X66 E;  4FCV A;  2B7V A;  2IE4 C;  1DQ3 A;  5ITR A;  5EP2 A;  1NNJ A;  1K3X A;  2N3H A;  1IBK E;  2NYL C;  2USH A;  4LF7 E;  1G41 A;  2MC5 A;  1DGF A;  5FLX C;  1G4A E;  3GRV A;  2XEP A;  1JQJ C;  4R7G A;  4D81 A;  3GO8 A;  4DR5 E;  3SBJ A;  5AE1 A;  1SR9 A;  3KBP A;  4I5S A;  4IBE A;  1T4L B;  1STU A;  1DI2 A;  2O8A A;  3IVD A;  2UUB E;  3QFK A;  3A46 A;  2R18 A;  3T1I A;  3F6H A;  3JU0 A;  1R7R A;  3JR5 A;  3LMM A;  2G7H A;  4LTY A;  4X64 M;  2DZO B;  3GQ4 A;  4J6O A;  3FTF A;  4ITQ A;  3UGJ A;  3T38 A;  4DV1 M;  2UU9 E;  1S95 A;  4BCA A;  2C5R A;  1OJL A;  3F6G A;  4AZF A;  1HQC A;  2L2K B;  1N33 E;  2Z06 A;  4OVZ B;  2GJU A;  4LJ8 A;  2JOG A;  4LFB E;  3K8Z A;  3K7V C;  3UK6 A;  5DNY A;  4X65 M;  4I5L C;  3VK6 A;  2P5T A;  4PCZ A;  3VKG A;  2JY9 A;  3IB7 A;  1TH4 A;  4IBG A;  3D03 A;  4JI4 E;  3AOE C;  4G9J A;  2HCB A;  1DGG A;  2XSZ D;  1SU1 A;  1N32 E;  4YY3 M;  1QHW A;  1GL7 A;  1QAQ A;  2DWN A;  3QFO A;  2ZAN A;  1RC7 A;  5F3W A;  2V88 A;  4DKK A;  4MGZ E;  4Z8X A;  4B7H A;  2B7T A;  4F9A B;  4B7G A;  1J26 A;  2R65 A;  2LRS A;  4G4O A;  1WHN A;  2UXD E;  4I5N C;  3THO B;  2UU9 M;  1SXJ B;  2ERC A;  1HPU A;  1W5T A;  2C99 A;  3GLH A;  3PFI A;  2KZU A;  3MHV C;  3GLG B;  2L92 A;  4WYQ B;  2EZ6 A;  3H61 A;  2YVT A;  4LU9 A;  2M1S A;  3K1J A;  3GQ3 A;  2UUB M;  4JI2 M;  2F8B A;  3DSC A;  1WXR A;  4K0K E;  3MSW A;  4LFA E;  2O8G A;  1HNX M;  3L26 A;  2KRU A;  3AJI B;  1MU5 A;  3VK8 A;  4GKK M;  1JK7 A;  3N5U A;  4XGI A;  3M6A A;  3HHW A;  5KPT A;  3FD9 A;  1Q39 A;  3HU3 A;  3WHK A;  1KFV A;  1OFI A;  1MX0 A;  3U6O A;  1I94 M;  4GRI A;  1HNX E;  1IN7 A;  3MJ5 A;  2F5Q A;  4DR6 E;  2KON A;  2VQE E;  2YT4 A;  4HLQ A;  3KFU G;  2EUC A;  3HKP A;  4IIW A;  5BPV A;  3GPY A;  4P78 A;  4JYA E;  4JA7 A;  4IBD A;  5EP4 A;  4IBI A;  4DR4 M;  1E94 E;  4QNM A;  3SC3 A;  1PJJ A;  2E5L E;  1WAO 1;  3KXE C;  2DZN B;  4JI3 E;  2CV2 A;  4A3V B;  4LJ4 A;  5FSW A;  3LQR A;  3SHF A;  5ITU A;  3C4T A;  4AQY E;  1GL6 A;  1OI8 A;  2LXE A;  4DV4 M;  4MB7 A;  2QBY A;  2Z1A A;  3QAU A;  1L2B A;  3E4R A;  2X49 A;  2RTX A;  2UXB E;  1FJM A;  4BMJ A;  2QFR A;  3L29 A;  4X62 M;  3J7Y p;  1RQ0 A;  3RE8 A;  3AL0 C;  4L4U A;  4UWQ A;  4B3S E;  3GRU A;  3H64 A;  1T3T A;  2Z72 A;  2JOB A;  3DOA A;  4MGI E;  3W0L B;  4LF8 E;  8CAT A;  2FOI C;  2A22 A;  4DV3 M;  4NSR A;  3E7B A;  1IN8 A;  4LJA A;  3EGH A;  2YZT A;  2R45 A;  5A2Q C;  1YZ9 A;  4H2F A;  3J27 B;  4KHP E;  4DHL A;  3E0J A;  2LTR A;  1DGB A;  1IY0 A;  3WHL A;  2X4A A;  2C9C A;  4MM3 B;  4DV0 M;  3KDS E;  3KW6 A;  2KZS A;  3HJS A;  4JI8 E;  4DR1 E;  4WWL A;  1TH3 A;  3H62 B;  2K47 A;  4GC5 A;  3SAV A;  4AG5 A;  4LF5 M;  2E1M A;  2A5Y B;  1NNW A;  1QFC A;  2BQ8 X;  2WDE A;  1AUI A;  4AKI A;  4DR2 M;  3VLF B;  5BR8 E;  1QZM A;  3IG8 A;  2KEB A;  3H4M A;  4NXN M;  3RGP A;  1T4N A;  5EXS A;  3T15 A;  2G8L A;  4YHH E;  5IT9 C;  1HR0 M;  3JAM C;  4KHP M;  5IWA M;  4JI8 M;  3SYL A;  2UXC M;  4F9B B;  1FNN A;  3IWC A;  2M5Z A;  2DXN A;  4UT3 B;  4LF7 M;  4NSO B;  3L27 A;  3PSN A;  5AAS A;  2ODR C;  1L8Q A;  2CHG A;  1N32 M;  2YEQ A;  4H2I A;  4H2G A;  4HD0 A;  1EE8 A;  3SAU A;  2FV4 B;  1KYI A;  3HU2 A;  3ILK A;  4QHS A;  1S8E A;  5INB A;  1J5E E;  4CIS A;  3HPS A;  5FTK A;  3DF6 A;  4M30 A;  1T4O A;  5IWA E;  2QFP A;  4YHH M;  1OFH A;  3KWR A;  4M0D A;  3QFN A;  4DUY M;  2UXB M;  1L1Z A;  3U5Z B;  1HNW M;  1II7 A;  2HHH M;  4NXN E;  4EIW A;  1TDZ A;  2HKJ A;  2NUE A;  3DFZ A;  3DW8 C;  3LVV A;  1Z6T A;  5EP1 A;  1KSF X;  3C9F A;  3DJW A;  3V4Y A;  4GIP A;  2DVW B;  2NA2 A;  4DV6 E;  2KRK A;  2L3J A;  4M9X A;  1W5S A;  2V85 A;  3HJ8 A;  2D7H A;  3RL5 A;  3FIG A;  4MOV A;  3U6E A;  2AHM A;  1SXJ D;  3IWD A;  4KZS A;  2RKO A;  1K3W A;  2AHD A;  4H2B A;  4DSY A;  4PDI A;  1EKZ A;  4FBK A;  4KO8 A;  1IY2 A;  3FYD A;  4GC9 A;  3FUX A;  3U6D A;  2ZBK B;  1WHQ A;  2LE2 A;  3HPZ A;  2CV1 A;  1N77 A;  2MDR A;  2H36 X;  4M9Z A;  2XLJ A;  4BLC A;  1Z2X A;  4V0W A;  5JI3 E;  3C4B A;  1USH A;  1KBP A;  3PVS A;  4DR2 E;  3FTE A;  3QG5 C;  1TH2 A;  3AOE A;  3IB8 A;  1N34 E;  3FTD A;  1HNW E;  5KPR A;  2V83 A;  4RF1 A;  3RMP A;  4QOZ C;  3TWM A;  1S3N A;  2CEA A;  3K6Q A;  3LML A;  2JA2 A;  2Y21 A;  3U61 B;  2DWL A;  4FWG A;  1H6U A;  2UXD M;  3U6L A;  1Z2W A;  2M7Q A;  3HHX A;  2R4E A;  1K82 A;  2KKN A;  3SMP A;  1YE9 A;  1X49 A;  2YR0 A;  3KSJ A;  2UUA E;  1XC8 A;  1D2N A;  2DWZ B;  3JR4 A;  3ADI A;  5CFF E;  4F9C B;  1YSY A;  4JV5 E;  3H68 A;  1QAO A;  1XNR E;  1XMO M;  1OIE A;  3KVW A;  4IBF A;  3C58 A;  5DYG A;  2Z3X A;  2V8Q B;  3PSO A;  3H09 A;  1XM7 A;  5FLX S;  2OQ4 A;  4K0K M;  1N33 M;  4X65 E;  4LG2 A;  2CHV A;  4IJE A;  1T70 A;  4IL1 A;  2CV9 A;  2BJV A;  4LF5 E;  5H37 D;  2N3G A;  3ADG A;  3HVQ A;  4DR1 M;  4DV0 E;  1G5B A;  2EA0 A;  3SFZ A;  3DZD A;  2JOX A;  5AE2 A;  4DR7 E;  1V73 A;  2ZAM A;  4X64 E;  2VQE M;  4NXM E;  4R3D A;  2RGH A;  3TWK A;  1S70 A;  4IBC A;  1GVN A;  2V89 A;  1XMO E;  4FWD A;  1NHG C;  4LF8 M;  3UMM A;  1SXJ E;  5A2Q S;  3J80 C;  4B3T E;  4LF6 M;  1YYW A;  4GHA A;  3GPX A;  1J7K A;  1VDD A;  5IOH A;  2H1R A;  4AKH A;  5ITQ A;  1IQP A;  4WFT A;  3AKZ A;  4X62 E;  1Q3B A;  4OVZ A;  4QHT A;  3HTX A;  4GKJ M;  4O5G A;  2M60 A;  4CHT B;  3A45 A;  3I4Y A;  3NWL A;  5ITX A;  3CTW B;  2Y20 A;  3TPZ A;  2I7P A;  1IBL M;  4FW9 A;  1PKP A;  3L28 A;  1UM8 A;  3PNY A;  2VQF M;  3OTO E;  4O43 A;  3RL3 A;  1YUB A;  3AV0 A;  3JTZ A;  1DO2 A;  5LMU M;  3ZC7 B;  2KOU A;  2Q2E B;  4TUG A;  4DV5 E;  1N36 E;  1DGH A;  4M0W A;  5IT9 S;  2QPA A;  1HNZ E;  4KLN A;  4G6Z A;  4JYA M;  2WDD A;  2V1C A;  1FJG M;  3FGA C;  4DV7 M;  1IXR C;  4BC9 A;  1E9S A;  1Q3C A;  4DR4 E;  5EXP A;  2QJC A;  3H67 A;  4UT2 A;  3CF2 A;  1I94 E;  1GQE A;  3GP1 A;  3TQS A;  5EQV A;  2NQ8 C;  3EIE A;  3QWL A;  3VK7 A;  5C18 A;  2MC6 A;  4XPN A;  3J2P B;  4DR5 M;  3KOW E;  1SXJ A;  2RGO A;  3I4V A;  2L2M A;  2EO2 A;  3AUZ A;  4FBQ A;  2DFJ A;  4FCX A;  1GKI A;  4M0V A;  4GKK E;  2IAE C;  3GLF B;  4WSP A;  3PNV A;  2L6M A;  3UJN A;  1L2D A;  3FTC A;  2Z7J A;  3HQ1 A;  4LFA M;  4B08 A;  4AI6 A;  4DV7 E;  1UIL A;  1FJG E;  4KBP A;  4ORC A;  5B8I A;  1ZAE A;  1IXZ A;  2XGN A;  4JXJ A;  4JI2 E;  1NHW C;  3A98 B;  5EJC A;  1N36 M;  1HNZ M;  1Z5B A;  2L3C A;  1NJG A;  5E6J A;  3LL8 A;  3H69 A;  2HHH E;  2LUQ A;  4P7D A;  4FVM A;  4L8R C;  2LNH C;  2LWX A;  3KSX A;  4DV2 M;  1IY1 A;  1Z5C A;  3TE6 A;  3ZTV A;  4RNA A;  1QVR A;  4DR3 M;  3CF0 A;  4MGH A;  3VFD A;  3IVE A;  2IHR 1;  4B3M M;  3SMS A;  4JI4 M;  1XXH A;  3C5W C;  4NRV A;  2JVA A;  2XF3 A;  1X47 A;  2M4I A;  3P71 C;  5ITY A;  2F5S A;  3LLH A;  4GEQ B;  1S3L A;  2BDX A;  4LF6 E;  2KXE A;  3FUV A;  5IRE B;  1XMQ E;  3ADJ A;  2P6B A;  4QOS A;  2NXF A;  3KOZ E;  2RS6 A;  2Y0T A;  2UXC E;  4LF4 E;  5LMU E;  4BBA A;  1G59 A;  3ZOQ B;  3K2L A;  4JI5 E;  3D8L A;  5JPE A;  4ORB A;  1G8P A;  1DGH B;  3AFH A;  1X48 A;  2L2N A;  4IBB A;  3E7A A;  1ZQ9 A;  4MOY A;  5EP3 A;  3U6Q A;  1N78 A;  4L78 A;  2F4V E;  1W24 A;  2XZF A;  3J81 C;  4TUI A;  2XFT A;  3EGG A;  1NNU C;  1N34 M;  4LJ9 A;  3PXG A;  4BB9 A;  3VYY A;  2FNA A;  3SAT A;  2HYP A;  1U32 A;  3TL4 X;  4LF9 M;  4QNR A;  1NY5 A;  2G5G X;  3GRY A;  4REZ A;  2CPN A;  3VKH A;  2Z4S A;  3HGI A;  1XNQ E;  5EQT A;  2RS7 A;  1UF3 A;  1JR3 D;  4KOD A;  4B3T M;  2CFO A;  1G3I A;  2R62 A;  3T1H M;  4JI1 E;  4O4K A;  4ZX2 A;  3GQ5 A;  2V86 A;  2C9O A;  5ITX E;  2ZAO A;  2FTX B;  3JAM S;  4G4R A;  4FCT A;  4D80 A;  3GPU A;  3R9X B;  4WPY A;  2UUA M;  4NL4 H;  4OOG C;  2NUF A;  4JI6 E;  4H1Y P;  3FKE A;  3W0F A;  3J7B A;  1LV7 A;  4IBK A;  5DYI A;  1IN5 A;  4LRT A;  1L2C A;  2UUC M;  1IN4 A;  2YFQ A;  1XXH B;  5FTL A;  1NSF A;  2B9D A;  2DXL A;  1PM5 A;  1HT1 E;  4L16 A;  3KS8 A;  2DIX A;  2Y0Q A;  1C1K A;  3VDU A;  4JI0 E;  4TUW A;  2V87 A;  3FUW A;  3H66 A;  3QFM A;  2Q8U A;  4AQY M;  2XZU A;  4GKJ E;  3NBI A;  2OPF A;  1HO5 A;  1S3S A;  3KOY E;  4LJ6 A;  1XNR M;  1IBL E;  4JV5 M;  5LMN M;  3VYX A;  3J80 S;  1QU6 A;  1ZBQ A;  1QYR A;  3GLH B;  2NUG A;  3JYF A;  3GPP A;  2QEN A;  3U6M A;  3RQZ A;  3D8B A;  4JI7 M;  1XZW A;  1IXS B;  4BS9 A;  4AKG A;  2RSM A;  3RGS A;  3J7A G;  1SXJ C;  5KQD A;  4DR7 M;  3THG A;  3ADL A;  1WXQ A;  2WDF A;  5T6J A;  4V0V A;  2V6Z M;  4LJ5 A;  3RFW A;  3P1X A;  5AE3 A;  4IYP C;  2NPP C;  2LH0 A;  5BR8 M;  1QAM A;  5ITT A;  2ODR D;  3M0E A;  4Z6Y A;  3ZCB B;  2XSZ A;  4MGK E;  2DSY A;  4GHL A;  4LAC C;  4LZJ A;  4D82 A;  2F5O A;  2ZBM A;  2KW0 A;  2WZO A;  3UZU A;  3E9S A;  4OW0 A;  5LL6 R;  1IM2 A;  2QZ4 A;  4R8O A;  4OX9 E;  1I4W A;  2HL7 A;  4IJF A;  5EXT A;  4HL4 A;  2VQF E;  2L7I A;  3GLG A;  4LJ7 A;  4MH0 E;  3U6P A;  2WDC A;  1ZBT A;  4ORA A;  1XMQ M;  3SAW A;  4W5W A;  2F5N A;  1NVM A;  3J7A S;  3MK6 A;  3THN A;  2VII A;  1HQY E;  4LZZ A;  1L1T A;  4JI7 E;  4DV3 E;  4B3M E;  2KA6 B;  1S3M A;  2JWO A;  3VDP A;  1DO0 A;  2BNK A;  2YQZ A;  4G4Q A;  2EWL A;  3KOX E;  2Z4R A;  4GIT A;  4II7 A;  4M9S A;  3HHZ A;  4M2Z A;  3HHY A;  2QCU A;  2QBY B;  3RL4 A;  4OX9 M;  3FUT A;  4PT5 A;  3DA1 A;  4LFB M;  3CK2 A;  5EXX A;  3H60 A;  3IG5 A;  1HT2 E;  2DMY A;  3FYC A;  2QP9 X;  2ZM6 E;  1Z59 A;  3A42 A;  5C1V A;  1IBM M;  2VF1 A;  3SAS A;  1MF8 A;  1X37 A;  3SYK A;  3Q8X A;  2HYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...