5F3WA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/hydrolase/dna
molecule keywords DNA double-strand break repair protein Mre11
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 105
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5f3wA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5f3wA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5f3wA01
2QFRA 1M63A 2IE3C 3QG5C 1W24A 2Q8UA 3EGHA 4NZVA 4IL1A 5F3WA 3DSDA 1HP1A 1Z2WA 3H68A 2WDEA 2Z1AA 2R17A 4FCXA 4FBWA 1JK7A 2AHDA 4M0VA 4V0WA 1IT6A 2IAEC 4O43A 1XZWA 4UT2A 3CK2A 3C5WC 2NYMC 3ICFA 4O4KA 1NNWA 2HYPA 1MF8A 3IVEA 2GJUA 4ZVZA 3RL4A 3RQZA 3ZU0A 4DSYA 5J28A 3AUZA 2QJCA 1USHA 1AUIA 3H69A 4ORCA 5B8IA 3QFKA 1V73A 2USHA 5IOHA 4DHLA 1II7A 1G5BA 4OR9A 2Z06A 1WARA 3AV0A 3K7WC 3QFMA 4ORAA 4TUGA 3ZTVA 2IE4C 2P6BA 2BQ8X 1OI8A 1QFCA 5INBA 4J6OA 4F0ZA 3T1IA 2DFJA 2KKNA 4O5GA 4YKEA 3FGAC 3PSNA 3H63A 5EQVA 3P71C 1S95A 4I5NC 2BCDA 3H66A 2WDCA 5JPEA 4LU9A 3JYFA 4UT3B 3RL5A 4H1YP 3N5UA 4TUIA 2XMOA 3QFOA 3DSCA 1S3LA 4ZX2A 1S3MA 2HYOA 3V4YA 1UTEA 1OIDA 4FBQA 1FJMA 1S70A 3IB7A 2O8GA 4JA9A 4MOYA 4V0XA 2CV9A 1SU1A 4ORBA 4H2GA 5GTUA 2HY1A 3GVEA 4XPNA 4MP0A 1KBPA 4H2IA 4LACC 1QHWA 3H67A 2YVTA 1HPUA 4V0VA 4FBKA 3H64A 3RL3A 4B2OA 2NXFA 4UT3A 1HO5A 4H2BA 3E7AA 3IB8A 4MOVA 2WDDA 4O24A 4H1SA 3H62B 1S3NA 2QFPA 2NYLC 3EGGA 4I5LC 5C1VA 3LL8A 3E7BA 3THOB 1T70A 3H61A 2WDFA 4Q7FA 1XM7A 3PSOA 4IYPC 1WAO1 1S8EA 4HD0A 4DT2A 2NPPC 1U32A 5JJTA 4KKZA 3TGHA 1Z2XA 2A22A 3HVQA 3K7VC 1TCOA 3THNA 5DNYA 2O8AA 4WWLA 3DW8C 5JPFA 2Z72A 4UWQA 3QFNA 4LTYA 1UF3A 2JOGA 2ZBMA 3C9FA 3IVDA 4JA7A 4KBPA 2BDXA 3KBPA 3H60A 1OIEA 4H2FA 5HPEA 4G9JA 1T71A
chains in the Genus database with same CATH superfamily
1A1FA 1AUAA 2EN2A 1WXRA 2YEQA 1V34A 4B3TM 2EA0A 1F4IA 4LCBA 1LV7A 3L26A 5A2QC 1NNWA 2XSZD 2K9DA 4F2LA 3HU1A 1A1JA 1PJTA 1ZMUA 5H37D 3PFIA 2DWNA 5GKNA 2L6MA 3C6KA 4DR5M 2LHGA 4JI3M 1N36E 4J6OA 4LF8E 5BPVA 2ZM6E 4DV5M 2F4VE 4LFCE 1DO0A 2HWJA 3NBXX 4F9BB 4X64E 1OAIA 5ITXA 1ZBTA 5DYIA 4G4OA 3BGHA 4FVMA 2CE7A 4JA9A 2R45A 2DWZB 1YSYA 1DGFA 2EMCA 1OIPA 4AKIA 3KOWE 3SYLA 1KBPA 2EN3A 2J7OA 4UN2B 1WGNA 4V0VA 3RL3A 3KZZA 5FLXS 1VG5A 1HO5A 4MOVA 4KHPM 1EIJA 4LF9M 2YTNA 2CWBA 2HAKA 1Q3CA 2APLA 1VQ1A 2D7GA 2RTXA 3PSOA 5EXPA 4B7FA 2KRKA 3IWBA 4JV5E 4II7A 3T1HM 3KS8A 1TTEA 4WWLA 2YU8A 2Y21A 2F5SA 4X62E 4LFAM 4L4UA 1ZAEA 5KQDA 3SHFA 3HTXA 3QG5C 2JZ1A 4DUZE 4GC9A 2R62A 3K92A 1GZ6A 2GHFA 2Z1AA 2EPXA 2L09A 1NHWC 3GRUA 4LJ8A 2HKJA 4NL4H 4IJDA 3GLGA 3ADLA 1G5BA 2EJSA 3IWDA 1DGHA 3C9PA 3HY5A 2DNAA 1N36M 1GJTA 2EPNA 5LMUM 1EH6A 4LF8M 2EMYA 2BQ8X 2ZM6M 2F4VM 3NBIA 3U6OA 1SFEA 4LFCM 4B3SM 4M9SA 3PNVA 4DV0M 3SC3A 2RGHA 4ZYDA 4FW9A 4X64M 2L33A 3H66A 1WJPA 2J7NA 5KL7A 3DOAA 3K9OA 5IWAE 3N5UA 4WXCA 1K3XA 3DSCA 4LJ4A 3F6HA 2J7JA 1NY5A 3M0EA 4F9AB 4BHBA 4OVZA 4IBGA 4QOZC 1NV8A 4WSPA 3EQ1A 3MHHC 2XFSA 1BBOA 3HPSA 2L4EA 1Z5BA 2FH0A 2BWEA 1T70A 2O25A 2WDFA 3SARA 2KW0A 3QYBA 1TH3A 1LLMC 2EOXA 4JV5M 4AKGA 3GPPA 4DT2A 5FTJA 1P3QQ 3KZYA 1A1HA 5KPZA 4X62M 3BBGA 2RS6A 2B3TB 2CFOA 3IVDA 4BCAA 1N78A 3HXLA 3U6CA 2DIXA 1OIEA 3JR5A 2VF8A 2EJ4A 1OFIA 3A98B 2EM9A 1I4WA 2FOIC 3C3EA 2JY8A 3A45A 3H09A 3KP0E 2JPAA 4UT2A 4O4KA 3T38A 3PVSA 1NJGA 3DFZA 1Z5CA 1FJGE 3EPLA 4F9CB 2JP7A 2N35A 3F92A 3LMMA 4FCTA 3BOSA 4KO8A 2L2DA 2EQ3A 2YRHA 2QSFX 2EO2A 4DR4E 1G41A 2NUFA 3L28A 2KNZA 3FTCA 2LV2A 5AE3A 4DV4E 2NUEA 2L4FA 3BIDA 2ZBKB 4LZZA 2JY9A 5IWAM 1QAOA 4M0DA 1XXHE 1VDLA 3MK6A 4CHTB 4IBDA 2JA2A 2CP8A 5A69A 2CEAA 2WSCF 3V4YA 1ZMVA 1GO5A 1PRBA 1IXSB 1S70A 4PT5A 5AC5A 4BHCA 3C4BA 2V89A 4DR2E 4HTGA 1KYQA 4AI6A 3VKGA 3K1JA 4WSGA 2Y0TA 3IG8A 5KPTA 1XMQE 5AC4A 2Z4SA 2FFJA 3GLIE 4R2SA 2EUCA 2XFTA 3E21A 4PDIA 2B7TA 2DB2A 2MJ5B 2DLQA 2EN4A 4MGIE 1UBDC 3FRHA 2EPZA 4UWQA 1WGLA 5A6JA 2JOGA 4L8NA 2H36X 3JTZA 2QHOB 2K7IA 1OAOC 4MLQA 1HR0E 5HPEA 4G9JA 3SYKA 2OPFA 4LRTA 1OTRA 4JI0E 3ADIA 4IBFA 3H4JA 2R18A 3J27B 3W68A 3A42A 4LF5E 1STUA 1FJGM 3DZDA 2HYPA 4ZYEA 3CF6E 5LMNE 1A1IA 1L8QA 4LFBE 1X37A 2DZOB 2JOXA 1T43A 4DV4M 4X66M 2IE4C 4B3RE 2KZUA 2YTDA 3Q8XA 2IHR1 4REZA 5FTKA 2BWBA 2KA6B 2X8AA 1NY6A 4TUIA 3QFOA 2OO9A 3AJIB 1P47A 3KWRA 3HX3A 3C4TA 4V0XA 4YHHE 2QNJA 2WSEF 3JU0A 4DR2M 1X5WA 4DR6E 5A6AA 2BNKA 3HHZA 1E9SA 3HHXA 2YTPA 1QNTA 4H1SA 1OQYA 1R2ZA 1XMQM 1HQCA 5C1VA 4IS1C 4QNMA 2LE2A 1MU5A 3M6AA 2YWQA 4HD0A 2CUZA 3IWCA 1EE8A 3A46A 4R71A 2V6ZM 2CV1A 1XXHA 3RMPA 2L7HA 1HR0M 3ZCBB 4KT0F 2Z8YM 1R2YA 4JI0M 4FWGA 2ZAOA 2QFRA 2IE3C 3VK6A 1UHZA 1L2DA 1VEGA 2C9OA 1TH4A 2EM0A 1TF0B 2DVWB 4M0VA 2IAEC 3U5ZA 5AASA 4DR1E 1PDAA 4QOSA 1O0WA 3C5WC 3GLHA 2W82A 3I4VA 3SBJA 4L15A 1NJFA 5LMNM 3KVWA 2K4VA 2JUJA 4LGMA 3HJSA 4R2CA 1X49A 3GLIA 2L92A 3QAUA 4LFBM 3K7WC 4ORAA 2LVNC 4NRVA 3TPZA 1GLNA 4L78A 5EP1A 4B3RM 4LGYA 1QFCA 2EOEA 3TE6A 4B3TE 4OX9E 4JXJA 1X3CA 4G4NA 4WXDA 4RH8A 1TDHA 2LTRA 5JPEA 3U61B 4N4RB 3LCUA 3E4RA 2HYOA 3GP1A 2KHXA 4YHHM 3L2AA 1Q39A 2YTFA 3VFDA 4DR6M 2R1FA 2EOFA 2G8LA 2EN7A 3FD9A 2YSOA 5LLQA 4MGZE 2ADRA 1IN5A 4DV1E 3E7AA 3UZUA 1MJGM 1ORYB 3AKZA 2EM2A 4I4LA 1NCSA 3TL4X 2MC5A 2D7EA 2Y0QA 1RC7A 4IBJA 1NV9A 3VHTB 1DGHB 4G4RA 7CATA 4FCVA 1U32A 4M9ZA 1T38A 1QYRA 4X8WA 2KNVA 1TCOA 2EKKA 2DZNB 2YR0A 1YPNA 3ZH9B 2GLIA 1LTMA 1IQPA 3BF2A 2HL7A 3K8ZA 2HGHA 3B89A 3K2LA 2RS7A 3CF2A 3THGA 3FUUA 2D7HA 1JK2A 5C1BA 3H68A 5A2QS 3ZQJA 4DR1M 4FBWA 1EKZA 1Y8GA 1QZMA 4XBOA 2QBYA 2EPRA 4V0WA 4OVZB 1TF6A 1VEJA 4AZFA 4OU7A 1WJ7A 1XWIA 1AH5A 1PJJA 2YTIA 1AUIA 5IOHA 2CSHA 4LFAE 2EMIA 4LF7M 3U6SA 3BXWA 2E5LM 4JI1E 2EPMX 5C18A 1GL6A 3U6PA 4OX9M 2L8TA 1WIVA 2PRTA 5AE1A 1S95A 2BCDA 4F6NA 4UT3B 1JR3D 3LVVA 1S3LA 1YLAA 1K3WA 4TUWA 4QNRA 4MM3B 4MOYA 5TSEA 3QWLA 4H2GA 4PD2A 2LVPC 2YSPA 2Q2EB 5LMUE 1B69A 4XK8F 4DV1M 1IN4A 2KHHA 1WHQA 1ZU1A 2LMZA 3LQQA 4GITA 2EMXA 4B3SE 3EPHA 2EMAA 2X4AA 3WHKA 1X6HA 4DV0E 2QFPA 3H4MA 4I5LC 2EMBA 4LG2A 4G3OA 3HJ8A 2DXIA 4KZSA 4CGYB 1JB0F 5KL3A 2M7QA 5ITYA 2WSFF 2GPIA 1D0LA 3THNA 1IBKE 2KOUA 3IG5A 4W5WA 2CRUA 4R2PA 3TWKA 5E26A 1KSFX 1MN3A 3AOGA 3EIEA 1IY0A 5KQ8A 3JR4A 3MHVC 4L8RC 5EP3A 3UGJA 2ENHA 4MGYE 1HP1A 2EM5A 3GPUA 4F1IA 5ITQA 1XZWA 3P1XA 4ZVZA 2YTOA 3K6QA 5J28A 3HQ1A 2RGOA 3CTWB 2XZUA 4ORCA 2N8XA 2DWMA 2DLKA 4IJEA 3QFMA 1C1KA 3VKHA 3GRRA 2F5QA 4ITQA 4JI1M 1PJIA 1JK1A 3ADJA 3I01M 4IBEA 2EM6A 3U6DA 1W5TA 2DZLA 2F5PA 2LH0A 4LU9A 3RL5A 5EQTA 1QU6A 1SXJE 2ENAA 1FJMA 1GQEA 3M7GA 3IECA 1SU1A 2BJWA 2WBSA 3GVEA 2NUGA 2RQLA 4LACC 1HNZE 3MSWA 2LUPB 2I9IA 3R9XB 1XB2B 3THOB 2LBSB 4KWYA 3MMPA 2EOYA 2V1CA 1IBKM 2E72A 1WHCA 1NHGC 2JWSA 2Z72A 3PXGA 4L16A 1NVMA 1AAYA 1UF3A 1XMOE 5A6BA 5IXMB 3U60B 2EPOA 2OOAA 1DO2A 4DSYA 2Q8UA 2MR9A 1EH8A 2ELZA 2KZSA 2R17A 3HPZA 3KW6A 2Z7JA 1JK7A 2C96A 4LJ9A 3LCVB 1KFVA 2C5RA 1NSFA 2VQFE 1BVSA 1T4LB 2USHA 4OR9A 1V33A 4DV3E 3QYEA 2LNHC 5IV8B 1WR1B 1F2IG 3R8FA 5INBA 4L5NC 4Q7JA 2M9AA 2I7NA 2YTEA 1EH7A 1OKSA 3E0JA 2EMGA 3D8LA 3SMSA 2EOIA 4RNAA 2WBTA 1SG9A 1J26A 3T15A 1S3MA 1Q02A 1YSAC 4GH9A 2G5GX 2CV9A 2HY1A 3TQSA 2M4IA 1E94E 5JI3E 4J8ZA 4X66E 1HNZM 1Z6TA 1QHWA 2K6BA 2XF3A 1HPUA 2AHMA 4B2OA 3SFZA 2NXFA 3UJNA 3U5ZB 3GLFB 5FTLA 4WFTA 1VDDA 4WURA 4Q28A 2LJHA 1IXRC 2WZOA 3AL0C 5FSWA 1TGUA 3C58A 5ITRA 1XMOM 3QFNA 3J7Yp 4LTYA 2FTXB 4AQYE 1SXJA 3GLHE 2H5XA 5A6KA 1SXJC 4WW0A 3ECRA 1G71A 2UUCE 3WHLA 2YU5A 2NABA 4F6MA 4R03A 4CISA 2VRDA 1G2FC 4Z6YA 4R7GA 2VQFM 2LO3A 4DUYM 1IN8A 3U6LA 1X47A 1USHA 2YRKA 4DV3M 2EM8A 1WXQA 3E46A 3CF0A 2KNAA 5KPRA 3KFUG 2R4JA 1FKAE 3ZTVA 1E32A 1R5LA 2HCBA 2MC6A 1OI8A 2EWLA 4P7DA 1J7KA 3T1IA 1OFHA 2YNMD 4AG6A 3P71C 2RKOA 3J7BA 3NWLA 3JYFA 1TF3A 2YZTA 2G7HA 1UTEA 1IFYA 2FE8A 1RMDA 2EPUA 4LF6E 1RU3A 2F5OA 2YTJA 3AOEA 1DV0A 1NNUC 4PDGA 3H67A 3AOEC 2YVTA 2DKLA 2ZTDA 2QBYB 2Z4RA 3KOZE 3GO8A 4GHLA 3H64A 5EXXA 2EM7A 3LVWA 1IBLM 2JXPA 4NRWA 4GMQA 1DQ3A 2LT7A 4K0KE 2UXDE 2ZANA 2B7VA 4IYPC 3RFWA 1S8EA 1VEKA 3SAUA 2CPNA 1YUBA 3L27A 4CJ6A 3TGHA 3KDSE 2GNOA 4D81A 1G2DC 5KL5A 3J2PB 2K47A 4AQYM 3B7ZA 3VYXA 4RF0A 2LBCA 2KRUA 2A25A 4WPYA 2UUCM 3HZJA 2M5ZA 2LVAA 1GTKA 2C9CA 2MH8A 1NNJA 2I13A 3W0FA 1DI2A 3FE3A 3CK2A 1JR3E 4NC6A 2GJUA 2YTGA 3ZU0A 1ZMWA 3H69A 2VDBB 4HL4A 1QDRA 3KS4A 1II7A 1IQOA 5IREB 1QAQA 1HT1E 3KOXE 2BBGA 4BC9A 4MGKE 1XHBA 3CGWA 1HNWM 3SHGB 3T1YE 2UXBE 3FLOA 1X48A 4LRSA 5IZ7D 5IT9C 2M60A 2KDLA 1MEYC 4O5GA 3FGAC 4JI5E 4FWDA 4Q35B 1R6BX 1IXZA 2EPAA 4M9XA 2RRUA 1A5TA 3DA1A 1EFUB 4NXNE 2ZTCA 2BB8A 4LF6M 4LF7E 4WYQB 1MX0A 2MROB 1QANA 3F6GA 1D0KA 2A5YB 2LVQD 1L1ZA 2E5LE 4M9VC 3GQ5A 3VK8A 2JZ0A 1TDZA 1T4OA 3M99B 2ODRC 4H2BA 1GJSA 2WDDA 3H62B 2EZ6A 1IXSA 4K0KM 3MHSC 5FTMA 2UXDM 5L8RF 1QDTA 3HU2A 5KL6A 2EMWA 1N33E 2M1SA 4F54A 1IY2A 5DFLA 2OQ4A 3DW8C 2V86A 3VLFB 4B7HA 1J09A 2ZBMA 1A1KA 1A1LA 4JA7A 2DXNA 2EKFA 1HNXE 4RKUF 2DMIA 4D80A 3GLGB 2C98A 1M63A 2R6FA 4GKKM 3OTOE 4IL1A 4LF4E 3JAMC 2JY5A 2DAGA 2EMHA 3TWLA 4BLCA 3GPYA 4O43A 3BBZA 2VQEM 1IY1A 1ZBQA 3IVEA 1MF8A 1L2CA 4JI2E 3AUZA 2QJCA 4B3MM 2EOOA 1Q3BA 4DHLA 4JN6A 1D0MA 2L3JA 4FWHA 4R3DA 1YYKA 3V76A 1TN9A 2N3HA 1J5EE 3T1YM 2UXBM 4YY3E 2XLJA 2RSMA 2E1MA 2VE7C 4JI5M 2EORA 4CIZA 4F0ZA 4AW4A 3ZOQB 2CV0A 4I5NC 3GPXA 3HGIA 1X6FA 4NXNM 3FYDA 4JI6M 2EPCA 2RSIA 2UUBM 2L2MA 2F8BA 2XSZA 4ZPXA 1JR3A 1Z5AA 2L7IA 2LHCA 4KODA 5ITUA 2FNAA 5T6JA 2JNHA 2CHQA 1PJSA 4O24A 3C3DA 2DAKA 1TR8A 2EE8A 3B7NA 4DBGB 1N33M 3J80C 2LTSA 4NXME 1XM7A 3T6PA 2EM4A 2R0IA 2DAEA 5LL6R 1WAO1 3HHWA 4G4QA 4KKZA 3DJWA 2H1RA 3K7VC 4LZJA 4RF1A 1X6EA 4DR7M 2VF1A 3RE8A 2QPAA 1V92A 1HNXM 1SR9A 2DI0A 3OTOM 4LF4M 4WP2A 2UU9E 2HJJA 2V1UA 3J81S 2V85A 1IQSA 2JXNA 4OOGC 4XGIA 4IBBA 4JI2M 3FTEA 1QQWA 1J5EM 4YY3M 4WX9A 1WHNA 2G3QA 3KSXA 2EN8A 3KXEC 2HHHE 5EXTA 2UUAE 2KKNA 1DGBA 3J81C 4YKEA 3B9PA 4I8OA 2WDCA 4KLNA 2EPLX 2DWLA 4BBAA 2DENA 4Z8XA 3GQ4A 1A1GA 2EMFA 1SXJB 3UK6A 4IBCA 3B7QA 1N34E 4ORBA 4M2ZA 2I7PA 3PNYA 3U61A 4R2RA 1QZEA 1QAMA 2CT1A 3HU3A 4GHAA 1NEIA 2DAMA 3TWMA 3MJ5A 3AFHA 5FLXC 4FCWA 3U6EA 1DGGA 4JI4E 4NXMM 4M0WA 4D82A 2YPNA 4Q7FA 4MH0E 1T39A 2JWOA 1IN7A 1KYIA 3HVQA 3FUTA 4OW0A 5BR8E 1D2NA 4NOOB 2MDRA 4JYAE 1T71A 4ZYHA 2UU9M 2NA2A 1W24A 4A3VB 3D03A 3ZC7B 2Y20A 2ZAMA 2EL5A 2LJUA 1L4SA 3RGSA 4FCXA 1I94E 2QCUA 3I04M 5EP4A 2V88A 2RPCA 1IT6A 4DMIA 1N3GA 2NYMC 1QUTA 2LWXA 3L25A 1G4AE 3KOYE 4LJAA 2Z06A 3KSJA 4QHSA 3FUXA 3J7AG 1WARA 2KONA 2JOBA 3AV0A 1ZR9A 2HHHM 1AIPC 4BBYA 4TUGA 3UMMA 2EPPA 8CATA 2UUAM 4P16A 2DFJA 5KL2A 3H63A 4P78A 2R76A 1HJPA 2L3CA 4DUYE 4H1YP 4QHTA 1DGCA 1Z59A 2R44A 2X49A 2LUQA 2LRSA 1R4GA 1YYOA 1GL7A 3FYCA 1N34M 4JI7E 1G59A 5A6BD 4DV2E 2O8GA 2EMZA 4S12A 4XPNA 3FUWA 1L2BA 2UXCE 2ZOAA 3ILKA 4F2JC 4UT3A 2EOZA 3FRIA 1XXHB 4JI8E 2NYLC 2CHGA 4DUZM 4JI4M 3EGGA 4R2EA 2DHRA 4DV7E 1N32E 4LY6A 1E9RA 1MGTA 2WBUA 2DMYA 2NPPC 2N3GA 4IBKA 2VIIA 1HT2E 3GRYA 1PJQA 1UN6B 4B08A 5DNYA 4NHRA 1Z1BA 5CFFE 2LXEA 5BR8M 2EN6A 4MLVA 3GLHB 4JYAM 2FS1A 3SMPA 4PCZA 1ZAAC 1IBLE 4NZVA 3EGHA 2R46A 4X65E 5F3WA 3GLIB 3SAVA 5EJCA 1I94M 4Y28F 2OOBA 2JYAA 2CTDA 1R7RA 3RQZA 2O01F 2EOQA 3GRVA 1V73A 5ADZA 2MKNA 2ERCA 3L00A 1GKIA 2JP9A 1IM2A 4MB7A 1TH2A 2MDGA 1BB8A 1PGYA 3Q8GA 4GIPA 3UK3C 4I5SA 3VDUA 3GLFE 1YYWA 5AE2A 3FUVA 2XMOA 4JI7M 4ZX2A 4GEQB 1OIDA 4DV2M 5ITTA 1SXJD 1PKPA 2EQ0A 1CUKA 2YTQA 2V8QB 2UXCM 5JI2E 2L6OA 1H6UA 3D8BA 4R2AA 4GZNC 4MP0A 1T3TA 2EM3A 1HNWE 1RQ0A 3VYYA 4HLQA 2EOMA 1G8PA 1FNNA 5EXSA 4FD2A 2GQFA 2ENCA 2EOSA 3I4YA 4JI8M 4R2DA 4DR3E 3IB8A 2R65A 2EPKX 4DV7M 1N32M 3E7BA 3LMLA 3TQMA 5E6JA 2LTUA 1XNQE 4EIWA 1XNRE 1UM8A 1Z2XA 4G6ZA 3IHPA 3L29A 1WRJA 3LW5F 3H60A 1YUJA 2BJVA 4H2FA 3RGPA 4DR4M 2QP9X 4X65M 2Z3XA 2JY7A 2WCC3 3I51A 2KXEA 2WDEA 1HQYE 4NSRA 1N75A 3U60A 4HEOA 3VK7A 4DKKA 1IBME 5B8IA 3QFKA 2CV2A 2DXLA 2QZ4A 4BMJA 3B74A 5KL4A 5IT9S 3U6MA 4GKKE 2P6BA 3C6MA 2XH9A 5EP2A 4GKJE 3OMLA 2DGCA 2V87A 4X9JA 2B3TA 3FIGA 3PSNA 1IMUA 5EQVA 2EQ1A 4DV6E 2VQEE 2YFQA 3LQRA 3LLHA 2MKDA 4B3ME 2LVOC 4M30A 4BS9A 1KJKA 1PM5A 1C7YA 3IB7A 1ZQ9A 4IJFA 4L6V6 2D9HA 5GTUA 3K9PA 4DR3M 4FBKA 2LCEA 2FGGA 1S3NA 4BC7A 1YZ9A 2QENA 2YT4A 1T4NA 2EOJA 4FK5C 2P5TA 1QUSA 1XNQM 2LVHA 1GABA 2V83A 4JI6E 1S3SA 1YFHA 2HC5A 1XNRM 2UUBE 4LF5M 4MGHA 2A22A 4B7GA 3GLFA 2O8AA 2ZO9B 2JR1A 5JPFA 4AKHA 2BDXA 1UILA 3KBPA 2EN1A 2MGWA 1OJLA 2NQ8C 3HKPA 3JAMS 4AG5A 5ITXE 2DHYA 4GRIA 1QVRA 4LJ7A 3DSDA 2JY6B 1Z2WA 1NO1A 2XZFA 2J5YA 1YE9A 2EL6A 2AHDA 2EL4A 4LJ5A 3VDPA 2KEBA 3ICFA 1ZV1A 3FKEA 1IBMM 3RL4A 3FTFA 4I81A 2EMKA 5FTNA 4DR7E 2EMLA 1OIZA 1YUIA 2ODRD 2F5NA 4R8OA 3W67A 2ELYA 4R2QA 1IN6A 2B9DA 2R4EA 2CHVA 1BBGA 2QQ8A 5DYGA 2EP3A 1GVNA 4GKJM 5KO3A 4GEWA 4DR5E 4JI3E 4IBIA 4GC5A 3GQ3A 4DV6M 4DV5E 1UFZA 2C99A 3SATA 1W5SA 3ADGA 3HWSA 4HEIA 4LJ6A 2O5RA 3SAWA 1T6OA 4FBQA 2DRPA 3HHYA 2XGNA 3SASA 4BB9A 2L2NA 2DAIA 1N77A 4H2IA 2K0BX 3EPKA 1XC8A 1G3IA 4ZYGA 2L2KB 2VF7A 3J80S 2EOHA 3FTDA 3GLGE 3EIHA 4KHPE 1L1TA 3E9SA 4IIWA 2XEPA 4LF9E 3LL8A 4NSOB 3W0LB 4P17A 1K82A 3H61A 3KP1E 2WZJA 2JVAA 5JJTA 3DF6A 1JQJC 4RHBB 2YRMA 3T1HE 3HJQA 3C9FA 3J7AS 4KBPA 2YQZA 2FV4B 3EPJA 2DSYA 3U6QA 4ANRA
chains in the Genus database with same CATH topology
1WXRA 2YEQA 4B3TM 2EA0A 4LCBA 1LV7A 3L26A 5A2QC 1NNWA 2XSZD 3HU1A 5H37D 3PFIA 2DWNA 5GKNA 2L6MA 4DR5M 4JI3M 1N36E 4J6OA 4LF8E 5BPVA 2ZM6E 4DV5M 2F4VE 4LFCE 1DO0A 4F9BB 4X64E 5ITXA 1ZBTA 5DYIA 4G4OA 4FVMA 2CE7A 4JA9A 2R45A 2DWZB 1YSYA 1DGFA 4AKIA 3KOWE 3SYLA 1KBPA 2J7OA 4V0VA 3RL3A 5FLXS 1HO5A 4MOVA 4KHPM 4LF9M 1Q3CA 2D7GA 2RTXA 3PSOA 5EXPA 4B7FA 2KRKA 3IWBA 4JV5E 4II7A 3T1HM 3KS8A 4WWLA 2Y21A 2F5SA 4X62E 4LFAM 4L4UA 1ZAEA 5KQDA 3SHFA 3HTXA 3QG5C 4DUZE 4GC9A 2R62A 3K92A 1GZ6A 2Z1AA 2L09A 1NHWC 3GRUA 4LJ8A 2HKJA 4NL4H 3GLGA 3ADLA 1G5BA 3IWDA 1DGHA 1N36M 5LMUM 4LF8M 2BQ8X 2ZM6M 2F4VM 3NBIA 3U6OA 4LFCM 4B3SM 4M9SA 3PNVA 4DV0M 3SC3A 2RGHA 4FW9A 4X64M 2L33A 3H66A 2J7NA 3DOAA 5IWAE 3N5UA 1K3XA 3DSCA 4LJ4A 3F6HA 1NY5A 3M0EA 4F9AB 4OVZA 4IBGA 4QOZC 4WSPA 2XFSA 3HPSA 1Z5BA 1T70A 2WDFA 3SARA 2KW0A 1TH3A 4JV5M 4AKGA 3GPPA 4DT2A 5FTJA 5KPZA 4X62M 2RS6A 2B3TB 2CFOA 3IVDA 4BCAA 1N78A 3HXLA 3U6CA 2DIXA 1OIEA 3JR5A 1OFIA 3A98B 1I4WA 2FOIC 3A45A 3H09A 3KP0E 4UT2A 4O4KA 3T38A 3PVSA 1NJGA 3DFZA 1Z5CA 1FJGE 4F9CB 3LMMA 4FCTA 3BOSA 4KO8A 2EO2A 4DR4E 1G41A 2NUFA 3L28A 3FTCA 5AE3A 4DV4E 2NUEA 2ZBKB 4LZZA 2JY9A 5IWAM 1QAOA 4M0DA 3MK6A 4CHTB 4IBDA 2JA2A 2CEAA 3V4YA 1IXSB 1S70A 4PT5A 3C4BA 2V89A 4DR2E 4AI6A 3VKGA 3K1JA 2Y0TA 3IG8A 5KPTA 1XMQE 2Z4SA 2FFJA 2EUCA 2XFTA 4PDIA 2B7TA 2DB2A 4MGIE 4UWQA 2JOGA 4L8NA 2H36X 3JTZA 1HR0E 5HPEA 4G9JA 3SYKA 2OPFA 4LRTA 4JI0E 3ADIA 4IBFA 2R18A 3J27B 3A42A 4LF5E 1STUA 1FJGM 3DZDA 2HYPA 3CF6E 5LMNE 1L8QA 4LFBE 1X37A 2DZOB 2JOXA 4DV4M 4X66M 2IE4C 4B3RE 2KZUA 3Q8XA 2IHR1 4REZA 5FTKA 2KA6B 2X8AA 1NY6A 4TUIA 3QFOA 3AJIB 3KWRA 3C4TA 4V0XA 4YHHE 3JU0A 4DR2M 4DR6E 2BNKA 3HHZA 1E9SA 3HHXA 4H1SA 1R2ZA 1XMQM 1HQCA 5C1VA 4QNMA 2LE2A 1MU5A 3M6AA 4HD0A 2CUZA 3IWCA 1EE8A 3A46A 2V6ZM 2CV1A 1XXHA 3RMPA 2L7HA 1HR0M 3ZCBB 1R2YA 4JI0M 4FWGA 2ZAOA 2QFRA 2IE3C 3VK6A 1UHZA 1L2DA 2C9OA 1TH4A 2DVWB 4M0VA 2IAEC 3U5ZA 5AASA 4DR1E 4QOSA 1O0WA 3C5WC 3GLHA 2W82A 3I4VA 3SBJA 4L15A 1NJFA 5LMNM 3KVWA 2K4VA 4LGMA 3HJSA 1X49A 3GLIA 2L92A 3QAUA 4LFBM 3K7WC 4ORAA 4NRVA 3TPZA 1GLNA 4L78A 5EP1A 4B3RM 4LGYA 1QFCA 3TE6A 4B3TE 4OX9E 4JXJA 4G4NA 1TDHA 2LTRA 5JPEA 3U61B 3E4RA 2HYOA 3GP1A 2KHXA 4YHHM 3L2AA 1Q39A 3VFDA 4DR6M 2G8LA 3FD9A 4MGZE 4DV1E 1IN5A 3E7AA 3UZUA 1ORYB 3AKZA 4I4LA 3TL4X 2MC5A 2D7EA 2Y0QA 1RC7A 4IBJA 1DGHB 4G4RA 7CATA 4FCVA 1U32A 4M9ZA 1QYRA 4X8WA 1TCOA 2DZNB 2YR0A 3ZH9B 1IQPA 2HL7A 3K8ZA 3K2LA 2RS7A 3CF2A 3THGA 3FUUA 2D7HA 5C1BA 3H68A 5A2QS 4DR1M 4FBWA 1EKZA 2QBYA 1QZMA 4XBOA 4V0WA 4OVZB 4AZFA 4OU7A 1XWIA 1PJJA 1AUIA 5IOHA 4LFAE 4LF7M 3U6SA 2E5LM 4JI1E 5C18A 1GL6A 3U6PA 4OX9M 2L8TA 5AE1A 1S95A 2BCDA 4UT3B 1JR3D 3LVVA 1S3LA 1K3WA 4TUWA 4QNRA 4MM3B 4MOYA 3QWLA 4H2GA 4PD2A 2Q2EB 5LMUE 4DV1M 1IN4A 1WHQA 2LMZA 3LQQA 4GITA 4B3SE 2X4AA 3WHKA 4DV0E 2QFPA 3H4MA 4I5LC 4LG2A 3HJ8A 2DXIA 4KZSA 4CGYB 2M7QA 5ITYA 3THNA 1IBKE 2KOUA 3IG5A 4W5WA 3TWKA 5E26A 1KSFX 3AOGA 3EIEA 1IY0A 5KQ8A 3JR4A 3MHVC 4L8RC 5EP3A 3UGJA 4MGYE 1HP1A 3GPUA 5ITQA 1XZWA 3P1XA 4ZVZA 3K6QA 5J28A 3HQ1A 2RGOA 3CTWB 2XZUA 4ORCA 2DWMA 4IJEA 3QFMA 1C1KA 3VKHA 3GRRA 2F5QA 4ITQA 4JI1M 1PJIA 3ADJA 4IBEA 3U6DA 1W5TA 2F5PA 2LH0A 4LU9A 3RL5A 5EQTA 1QU6A 1SXJE 1FJMA 1GQEA 3M7GA 1SU1A 2BJWA 3GVEA 2NUGA 4LACC 1HNZE 3MSWA 2LUPB 3R9XB 3THOB 2LBSB 2V1CA 1IBKM 1NHGC 2Z72A 3PXGA 4L16A 1NVMA 1UF3A 1XMOE 3U60B 1DO2A 4DSYA 2Q8UA 2KZSA 2R17A 3HPZA 3KW6A 2Z7JA 1JK7A 2C96A 4LJ9A 1KFVA 2C5RA 1NSFA 2VQFE 1T4LB 2USHA 4OR9A 4DV3E 2LNHC 3R8FA 5INBA 4L5NC 2I7NA 3E0JA 3D8LA 3SMSA 4RNAA 1J26A 3T15A 1S3MA 4GH9A 2G5GX 2CV9A 2HY1A 3TQSA 2M4IA 1E94E 5JI3E 4J8ZA 4X66E 1HNZM 1Z6TA 1QHWA 2XF3A 1HPUA 2AHMA 4B2OA 3SFZA 2NXFA 3UJNA 3U5ZB 3GLFB 5FTLA 4WFTA 1VDDA 4WURA 4Q28A 2LJHA 1IXRC 2WZOA 3AL0C 5FSWA 1TGUA 3C58A 5ITRA 1XMOM 3QFNA 3J7Yp 4LTYA 2FTXB 4AQYE 1SXJA 1SXJC 4WW0A 2UUCE 3WHLA 4R03A 4CISA 4Z6YA 4R7GA 2VQFM 4DUYM 1IN8A 3U6LA 1X47A 1USHA 4DV3M 1WXQA 3CF0A 5KPRA 3KFUG 2R4JA 1FKAE 3ZTVA 1E32A 2HCBA 2MC6A 1OI8A 2EWLA 4P7DA 1J7KA 3T1IA 1OFHA 2YNMD 4AG6A 3P71C 2RKOA 3J7BA 3NWLA 3JYFA 2YZTA 2G7HA 1UTEA 2FE8A 4LF6E 2F5OA 3AOEA 1NNUC 4PDGA 3H67A 3AOEC 2YVTA 2QBYB 2Z4RA 3KOZE 3GO8A 4GHLA 3H64A 5EXXA 3LVWA 1IBLM 4NRWA 4GMQA 1DQ3A 4K0KE 2UXDE 2ZANA 2B7VA 4IYPC 3RFWA 1S8EA 3SAUA 2CPNA 1YUBA 3L27A 3TGHA 3KDSE 4D81A 3J2PB 2K47A 4AQYM 3VYXA 4RF0A 2KRUA 4WPYA 2UUCM 2M5ZA 2C9CA 1NNJA 3W0FA 1DI2A 3CK2A 2GJUA 3ZU0A 3H69A 4HL4A 3KS4A 1II7A 5IREB 1QAQA 1HT1E 3KOXE 4BC9A 4MGKE 1XHBA 1HNWM 3SHGB 3T1YE 2UXBE 3FLOA 1X48A 4LRSA 5IZ7D 5IT9C 2M60A 4O5GA 3FGAC 4JI5E 4FWDA 1R6BX 1IXZA 4M9XA 3DA1A 4NXNE 4LF6M 4LF7E 4WYQB 1MX0A 1QANA 3F6GA 2A5YB 1L1ZA 2E5LE 3GQ5A 3VK8A 1TDZA 1T4OA 2ODRC 4H2BA 2WDDA 3H62B 2EZ6A 4K0KM 5FTMA 2UXDM 3HU2A 1N33E 2M1SA 4F54A 1IY2A 2OQ4A 3DW8C 2V86A 3VLFB 4B7HA 1J09A 2ZBMA 4JA7A 2DXNA 1HNXE 4D80A 3GLGB 2C98A 1M63A 4GKKM 3OTOE 4IL1A 4LF4E 3JAMC 3TWLA 4BLCA 3GPYA 4O43A 2VQEM 1IY1A 1ZBQA 3IVEA 1MF8A 1L2CA 4JI2E 2QJCA 3AUZA 4B3MM 1Q3BA 4DHLA 4JN6A 2L3JA 4FWHA 4R3DA 1YYKA 2N3HA 1J5EE 3T1YM 2UXBM 4YY3E 2XLJA 2RSMA 2E1MA 2VE7C 4JI5M 4F0ZA 4AW4A 3ZOQB 2CV0A 4I5NC 3GPXA 3HGIA 4NXNM 3FYDA 4JI6M 2UUBM 2L2MA 2F8BA 2XSZA 4ZPXA 1JR3A 1Z5AA 2L7IA 4KODA 5ITUA 2FNAA 5T6JA 2CHQA 4O24A 1N33M 3J80C 2LTSA 4NXME 1XM7A 5LL6R 1WAO1 3HHWA 4G4QA 4KKZA 3DJWA 2H1RA 3K7VC 4LZJA 4RF1A 4DR7M 2VF1A 3RE8A 2QPAA 1HNXM 1SR9A 3OTOM 4LF4M 2UU9E 2V1UA 3J81S 2V85A 4OOGC 4XGIA 4IBBA 4JI2M 3FTEA 1QQWA 1J5EM 4YY3M 1WHNA 3KSXA 3KXEC 2HHHE 5EXTA 2UUAE 2KKNA 1DGBA 3J81C 4YKEA 3B9PA 4I8OA 2WDCA 4KLNA 2DWLA 4BBAA 4Z8XA 3GQ4A 1SXJB 3UK6A 4IBCA 1N34E 4ORBA 4M2ZA 2I7PA 3PNYA 3U61A 1QAMA 3HU3A 4GHAA 3TWMA 3MJ5A 3AFHA 5FLXC 4FCWA 3U6EA 1DGGA 4JI4E 4NXMM 4M0WA 4D82A 4Q7FA 4MH0E 2JWOA 1IN7A 1KYIA 3HVQA 3FUTA 4OW0A 5BR8E 1D2NA 4NOOB 2MDRA 4JYAE 1T71A 2UU9M 2NA2A 1W24A 4A3VB 3D03A 3ZC7B 2Y20A 2ZAMA 3RGSA 4FCXA 1I94E 2QCUA 5EP4A 2V88A 1IT6A 4DMIA 2NYMC 2LWXA 3L25A 1G4AE 3KOYE 4LJAA 2Z06A 3KSJA 4QHSA 3FUXA 3J7AG 1WARA 2KONA 2JOBA 3AV0A 2HHHM 4BBYA 4TUGA 3UMMA 8CATA 2UUAM 4P16A 2DFJA 3H63A 4P78A 2L3CA 4DUYE 4H1YP 4QHTA 1Z59A 2X49A 2LUQA 2LRSA 1YYOA 1GL7A 3FYCA 1N34M 4JI7E 1G59A 4DV2E 2O8GA 4S12A 4XPNA 3FUWA 1L2BA 2UXCE 2ZOAA 3ILKA 4UT3A 1XXHB 4JI8E 2NYLC 2CHGA 4DUZM 4JI4M 3EGGA 2DHRA 4DV7E 1N32E 4LY6A 1E9RA 2DMYA 2NPPC 2N3GA 4IBKA 2VIIA 1HT2E 3GRYA 4B08A 5DNYA 5CFFE 2LXEA 5BR8M 3GLHB 4JYAM 3SMPA 4PCZA 1IBLE 3EGHA 4NZVA 2R46A 4X65E 5F3WA 3GLIB 3SAVA 5EJCA 1I94M 1R7RA 3RQZA 3GRVA 1V73A 5ADZA 2ERCA 1GKIA 1IM2A 4MB7A 1TH2A 4GIPA 4I5SA 3VDUA 1YYWA 5AE2A 3FUVA 2XMOA 4JI7M 4ZX2A 4GEQB 1OIDA 4DV2M 5ITTA 1SXJD 1PKPA 2V8QB 2UXCM 5JI2E 2L6OA 1H6UA 3D8BA 4MP0A 1T3TA 1HNWE 1RQ0A 3VYYA 4HLQA 1G8PA 1FNNA 5EXSA 4FD2A 3IB8A 3I4YA 4JI8M 4DR3E 2R65A 4DV7M 1N32M 3E7BA 3LMLA 5E6JA 1XNQE 4EIWA 1XNRE 1UM8A 1Z2XA 4G6ZA 3L29A 3H60A 2BJVA 4H2FA 3RGPA 4DR4M 2QP9X 4X65M 2Z3XA 3I51A 2KXEA 2WDEA 1HQYE 4NSRA 1N75A 3U60A 3VK7A 4DKKA 1IBME 5B8IA 3QFKA 2CV2A 2DXLA 2QZ4A 4BMJA 5IT9S 3U6MA 4GKKE 2P6BA 2XH9A 5EP2A 4GKJE 3OMLA 2V87A 3FIGA 3PSNA 5EQVA 4DV6E 2VQEE 2YFQA 3LQRA 3LLHA 4B3ME 4M30A 4BS9A 1PM5A 3IB7A 1ZQ9A 4IJFA 5GTUA 4DR3M 4FBKA 2FGGA 1S3NA 4BC7A 1YZ9A 2QENA 2YT4A 1T4NA 2P5TA 1XNQM 2V83A 4JI6E 1S3SA 1XNRM 2UUBE 4LF5M 4MGHA 2A22A 4B7GA 3GLFA 2O8AA 2ZO9B 2JR1A 5JPFA 4AKHA 2BDXA 1UILA 3KBPA 2NQ8C 3HKPA 1OJLA 3JAMS 4AG5A 5ITXE 4GRIA 1QVRA 4LJ7A 3DSDA 1Z2WA 2XZFA 1YE9A 2AHDA 4LJ5A 3VDPA 2KEBA 3ICFA 3RL4A 3FKEA 1IBMM 3FTFA 4I81A 5FTNA 4DR7E 2ODRD 2F5NA 4R8OA 1IN6A 2B9DA 2R4EA 2CHVA 5DYGA 1GVNA 4GKJM 5KO3A 4DR5E 4JI3E 4IBIA 4GC5A 3GQ3A 4DV6M 4DV5E 2C99A 3SATA 1W5SA 3ADGA 3HWSA 4LJ6A 2O5RA 3SAWA 4FBQA 3HHYA 2XGNA 3SASA 4BB9A 2L2NA 1N77A 4H2IA 1XC8A 1G3IA 2L2KB 3J80S 3FTDA 4KHPE 3EIHA 1L1TA 3E9SA 3LL8A 2XEPA 4IIWA 4LF9E 4NSOB 3W0LB 1K82A 3H61A 3KP1E 2JVAA 5JJTA 3DF6A 1JQJC 3T1HE 3HJQA 3C9FA 3J7AS 4KBPA 2YQZA 2FV4B 2DSYA 3U6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFR A;  1M63 A;  2IE3 C;  3QG5 C;  1W24 A;  2Q8U A;  3EGH A;  4NZV A;  4IL1 A;  5F3W A;  3DSD A;  1HP1 A;  1Z2W A;  3H68 A;  2WDE A;  2Z1A A;  2R17 A;  4FCX A;  4FBW A;  1JK7 A;  2AHD A;  4M0V A;  4V0W A;  1IT6 A;  2IAE C;  4O43 A;  1XZW A;  4UT2 A;  3CK2 A;  3C5W C;  2NYM C;  3ICF A;  4O4K A;  1NNW A;  2HYP A;  1MF8 A;  3IVE A;  2GJU A;  4ZVZ A;  3RL4 A;  3RQZ A;  3ZU0 A;  4DSY A;  5J28 A;  3AUZ A;  2QJC A;  1USH A;  1AUI A;  3H69 A;  4ORC A;  5B8I A;  3QFK A;  1V73 A;  2USH A;  5IOH A;  4DHL A;  1II7 A;  1G5B A;  4OR9 A;  2Z06 A;  1WAR A;  3AV0 A;  3K7W C;  3QFM A;  4ORA A;  4TUG A;  3ZTV A;  2IE4 C;  2P6B A;  2BQ8 X;  1OI8 A;  1QFC A;  5INB A;  4J6O A;  4F0Z A;  3T1I A;  2DFJ A;  2KKN A;  4O5G A;  4YKE A;  3FGA C;  3PSN A;  3H63 A;  5EQV A;  3P71 C;  1S95 A;  4I5N C;  2BCD A;  3H66 A;  2WDC A;  5JPE A;  4LU9 A;  3JYF A;  4UT3 B;  3RL5 A;  4H1Y P;  3N5U A;  4TUI A;  2XMO A;  3QFO A;  3DSC A;  1S3L A;  4ZX2 A;  1S3M A;  2HYO A;  3V4Y A;  1UTE A;  1OID A;  4FBQ A;  1FJM A;  1S70 A;  3IB7 A;  2O8G A;  4JA9 A;  4MOY A;  4V0X A;  2CV9 A;  1SU1 A;  4ORB A;  4H2G A;  5GTU A;  2HY1 A;  3GVE A;  4XPN A;  4MP0 A;  1KBP A;  4H2I A;  4LAC C;  1QHW A;  3H67 A;  2YVT A;  1HPU A;  4V0V A;  4FBK A;  3H64 A;  3RL3 A;  4B2O A;  2NXF A;  4UT3 A;  1HO5 A;  4H2B A;  3E7A A;  3IB8 A;  4MOV A;  2WDD A;  4O24 A;  4H1S A;  3H62 B;  1S3N A;  2QFP A;  2NYL C;  3EGG A;  4I5L C;  5C1V A;  3LL8 A;  3E7B A;  3THO B;  1T70 A;  3H61 A;  2WDF A;  4Q7F A;  1XM7 A;  3PSO A;  4IYP C;  1WAO 1;  1S8E A;  4HD0 A;  4DT2 A;  2NPP C;  1U32 A;  5JJT A;  4KKZ A;  3TGH A;  1Z2X A;  2A22 A;  3HVQ A;  3K7V C;  1TCO A;  3THN A;  5DNY A;  2O8A A;  4WWL A;  3DW8 C;  5JPF A;  2Z72 A;  4UWQ A;  3QFN A;  4LTY A;  1UF3 A;  2JOG A;  2ZBM A;  3C9F A;  3IVD A;  4JA7 A;  4KBP A;  2BDX A;  3KBP A;  3H60 A;  1OIE A;  4H2F A;  5HPE A;  4G9J A;  1T71 A; 
#chains in the Genus database with same CATH topology
 1A1F A;  1AUA A;  2EN2 A;  1WXR A;  2YEQ A;  1V34 A;  4B3T M;  2EA0 A;  1F4I A;  4LCB A;  1LV7 A;  3L26 A;  5A2Q C;  1NNW A;  2XSZ D;  2K9D A;  4F2L A;  3HU1 A;  1A1J A;  1PJT A;  1ZMU A;  5H37 D;  3PFI A;  2DWN A;  5GKN A;  2L6M A;  3C6K A;  4DR5 M;  2LHG A;  4JI3 M;  1N36 E;  4J6O A;  4LF8 E;  5BPV A;  2ZM6 E;  4DV5 M;  2F4V E;  4LFC E;  1DO0 A;  2HWJ A;  3NBX X;  4F9B B;  4X64 E;  1OAI A;  5ITX A;  1ZBT A;  5DYI A;  4G4O A;  3BGH A;  4FVM A;  2CE7 A;  4JA9 A;  2R45 A;  2DWZ B;  1YSY A;  1DGF A;  2EMC A;  1OIP A;  4AKI A;  3KOW E;  3SYL A;  1KBP A;  2EN3 A;  2J7O A;  4UN2 B;  1WGN A;  4V0V A;  3RL3 A;  3KZZ A;  5FLX S;  1VG5 A;  1HO5 A;  4MOV A;  4KHP M;  1EIJ A;  4LF9 M;  2YTN A;  2CWB A;  2HAK A;  1Q3C A;  2APL A;  1VQ1 A;  2D7G A;  2RTX A;  3PSO A;  5EXP A;  4B7F A;  2KRK A;  3IWB A;  4JV5 E;  4II7 A;  3T1H M;  3KS8 A;  1TTE A;  4WWL A;  2YU8 A;  2Y21 A;  2F5S A;  4X62 E;  4LFA M;  4L4U A;  1ZAE A;  5KQD A;  3SHF A;  3HTX A;  3QG5 C;  2JZ1 A;  4DUZ E;  4GC9 A;  2R62 A;  3K92 A;  1GZ6 A;  2GHF A;  2Z1A A;  2EPX A;  2L09 A;  1NHW C;  3GRU A;  4LJ8 A;  2HKJ A;  4NL4 H;  4IJD A;  3GLG A;  3ADL A;  1G5B A;  2EJS A;  3IWD A;  1DGH A;  3C9P A;  3HY5 A;  2DNA A;  1N36 M;  1GJT A;  2EPN A;  5LMU M;  1EH6 A;  4LF8 M;  2EMY A;  2BQ8 X;  2ZM6 M;  2F4V M;  3NBI A;  3U6O A;  1SFE A;  4LFC M;  4B3S M;  4M9S A;  3PNV A;  4DV0 M;  3SC3 A;  2RGH A;  4ZYD A;  4FW9 A;  4X64 M;  2L33 A;  3H66 A;  1WJP A;  2J7N A;  5KL7 A;  3DOA A;  3K9O A;  5IWA E;  3N5U A;  4WXC A;  1K3X A;  3DSC A;  4LJ4 A;  3F6H A;  2J7J A;  1NY5 A;  3M0E A;  4F9A B;  4BHB A;  4OVZ A;  4IBG A;  4QOZ C;  1NV8 A;  4WSP A;  3EQ1 A;  3MHH C;  2XFS A;  1BBO A;  3HPS A;  2L4E A;  1Z5B A;  2FH0 A;  2BWE A;  1T70 A;  2O25 A;  2WDF A;  3SAR A;  2KW0 A;  3QYB A;  1TH3 A;  1LLM C;  2EOX A;  4JV5 M;  4AKG A;  3GPP A;  4DT2 A;  5FTJ A;  1P3Q Q;  3KZY A;  1A1H A;  5KPZ A;  4X62 M;  3BBG A;  2RS6 A;  2B3T B;  2CFO A;  3IVD A;  4BCA A;  1N78 A;  3HXL A;  3U6C A;  2DIX A;  1OIE A;  3JR5 A;  2VF8 A;  2EJ4 A;  1OFI A;  3A98 B;  2EM9 A;  1I4W A;  2FOI C;  3C3E A;  2JY8 A;  3A45 A;  3H09 A;  3KP0 E;  2JPA A;  4UT2 A;  4O4K A;  3T38 A;  3PVS A;  1NJG A;  3DFZ A;  1Z5C A;  1FJG E;  3EPL A;  4F9C B;  2JP7 A;  2N35 A;  3F92 A;  3LMM A;  4FCT A;  3BOS A;  4KO8 A;  2L2D A;  2EQ3 A;  2YRH A;  2QSF X;  2EO2 A;  4DR4 E;  1G41 A;  2NUF A;  3L28 A;  2KNZ A;  3FTC A;  2LV2 A;  5AE3 A;  4DV4 E;  2NUE A;  2L4F A;  3BID A;  2ZBK B;  4LZZ A;  2JY9 A;  5IWA M;  1QAO A;  4M0D A;  1XXH E;  1VDL A;  3MK6 A;  4CHT B;  4IBD A;  2JA2 A;  2CP8 A;  5A69 A;  2CEA A;  2WSC F;  3V4Y A;  1ZMV A;  1GO5 A;  1PRB A;  1IXS B;  1S70 A;  4PT5 A;  5AC5 A;  4BHC A;  3C4B A;  2V89 A;  4DR2 E;  4HTG A;  1KYQ A;  4AI6 A;  3VKG A;  3K1J A;  4WSG A;  2Y0T A;  3IG8 A;  5KPT A;  1XMQ E;  5AC4 A;  2Z4S A;  2FFJ A;  3GLI E;  4R2S A;  2EUC A;  2XFT A;  3E21 A;  4PDI A;  2B7T A;  2DB2 A;  2MJ5 B;  2DLQ A;  2EN4 A;  4MGI E;  1UBD C;  3FRH A;  2EPZ A;  4UWQ A;  1WGL A;  5A6J A;  2JOG A;  4L8N A;  2H36 X;  3JTZ A;  2QHO B;  2K7I A;  1OAO C;  4MLQ A;  1HR0 E;  5HPE A;  4G9J A;  3SYK A;  2OPF A;  4LRT A;  1OTR A;  4JI0 E;  3ADI A;  4IBF A;  3H4J A;  2R18 A;  3J27 B;  3W68 A;  3A42 A;  4LF5 E;  1STU A;  1FJG M;  3DZD A;  2HYP A;  4ZYE A;  3CF6 E;  5LMN E;  1A1I A;  1L8Q A;  4LFB E;  1X37 A;  2DZO B;  2JOX A;  1T43 A;  4DV4 M;  4X66 M;  2IE4 C;  4B3R E;  2KZU A;  2YTD A;  3Q8X A;  2IHR 1;  4REZ A;  5FTK A;  2BWB A;  2KA6 B;  2X8A A;  1NY6 A;  4TUI A;  3QFO A;  2OO9 A;  3AJI B;  1P47 A;  3KWR A;  3HX3 A;  3C4T A;  4V0X A;  4YHH E;  2QNJ A;  2WSE F;  3JU0 A;  4DR2 M;  1X5W A;  4DR6 E;  5A6A A;  2BNK A;  3HHZ A;  1E9S A;  3HHX A;  2YTP A;  1QNT A;  4H1S A;  1OQY A;  1R2Z A;  1XMQ M;  1HQC A;  5C1V A;  4IS1 C;  4QNM A;  2LE2 A;  1MU5 A;  3M6A A;  2YWQ A;  4HD0 A;  2CUZ A;  3IWC A;  1EE8 A;  3A46 A;  4R71 A;  2V6Z M;  2CV1 A;  1XXH A;  3RMP A;  2L7H A;  1HR0 M;  3ZCB B;  4KT0 F;  2Z8Y M;  1R2Y A;  4JI0 M;  4FWG A;  2ZAO A;  2QFR A;  2IE3 C;  3VK6 A;  1UHZ A;  1L2D A;  1VEG A;  2C9O A;  1TH4 A;  2EM0 A;  1TF0 B;  2DVW B;  4M0V A;  2IAE C;  3U5Z A;  5AAS A;  4DR1 E;  1PDA A;  4QOS A;  1O0W A;  3C5W C;  3GLH A;  2W82 A;  3I4V A;  3SBJ A;  4L15 A;  1NJF A;  5LMN M;  3KVW A;  2K4V A;  2JUJ A;  4LGM A;  3HJS A;  4R2C A;  1X49 A;  3GLI A;  2L92 A;  3QAU A;  4LFB M;  3K7W C;  4ORA A;  2LVN C;  4NRV A;  3TPZ A;  1GLN A;  4L78 A;  5EP1 A;  4B3R M;  4LGY A;  1QFC A;  2EOE A;  3TE6 A;  4B3T E;  4OX9 E;  4JXJ A;  1X3C A;  4G4N A;  4WXD A;  4RH8 A;  1TDH A;  2LTR A;  5JPE A;  3U61 B;  4N4R B;  3LCU A;  3E4R A;  2HYO A;  3GP1 A;  2KHX A;  4YHH M;  3L2A A;  1Q39 A;  2YTF A;  3VFD A;  4DR6 M;  2R1F A;  2EOF A;  2G8L A;  2EN7 A;  3FD9 A;  2YSO A;  5LLQ A;  4MGZ E;  2ADR A;  1IN5 A;  4DV1 E;  3E7A A;  3UZU A;  1MJG M;  1ORY B;  3AKZ A;  2EM2 A;  4I4L A;  1NCS A;  3TL4 X;  2MC5 A;  2D7E A;  2Y0Q A;  1RC7 A;  4IBJ A;  1NV9 A;  3VHT B;  1DGH B;  4G4R A;  7CAT A;  4FCV A;  1U32 A;  4M9Z A;  1T38 A;  1QYR A;  4X8W A;  2KNV A;  1TCO A;  2EKK A;  2DZN B;  2YR0 A;  1YPN A;  3ZH9 B;  2GLI A;  1LTM A;  1IQP A;  3BF2 A;  2HL7 A;  3K8Z A;  2HGH A;  3B89 A;  3K2L A;  2RS7 A;  3CF2 A;  3THG A;  3FUU A;  2D7H A;  1JK2 A;  5C1B A;  3H68 A;  5A2Q S;  3ZQJ A;  4DR1 M;  4FBW A;  1EKZ A;  1Y8G A;  1QZM A;  4XBO A;  2QBY A;  2EPR A;  4V0W A;  4OVZ B;  1TF6 A;  1VEJ A;  4AZF A;  4OU7 A;  1WJ7 A;  1XWI A;  1AH5 A;  1PJJ A;  2YTI A;  1AUI A;  5IOH A;  2CSH A;  4LFA E;  2EMI A;  4LF7 M;  3U6S A;  3BXW A;  2E5L M;  4JI1 E;  2EPM X;  5C18 A;  1GL6 A;  3U6P A;  4OX9 M;  2L8T A;  1WIV A;  2PRT A;  5AE1 A;  1S95 A;  2BCD A;  4F6N A;  4UT3 B;  1JR3 D;  3LVV A;  1S3L A;  1YLA A;  1K3W A;  4TUW A;  4QNR A;  4MM3 B;  4MOY A;  5TSE A;  3QWL A;  4H2G A;  4PD2 A;  2LVP C;  2YSP A;  2Q2E B;  5LMU E;  1B69 A;  4XK8 F;  4DV1 M;  1IN4 A;  2KHH A;  1WHQ A;  1ZU1 A;  2LMZ A;  3LQQ A;  4GIT A;  2EMX A;  4B3S E;  3EPH A;  2EMA A;  2X4A A;  3WHK A;  1X6H A;  4DV0 E;  2QFP A;  3H4M A;  4I5L C;  2EMB A;  4LG2 A;  4G3O A;  3HJ8 A;  2DXI A;  4KZS A;  4CGY B;  1JB0 F;  5KL3 A;  2M7Q A;  5ITY A;  2WSF F;  2GPI A;  1D0L A;  3THN A;  1IBK E;  2KOU A;  3IG5 A;  4W5W A;  2CRU A;  4R2P A;  3TWK A;  5E26 A;  1KSF X;  1MN3 A;  3AOG A;  3EIE A;  1IY0 A;  5KQ8 A;  3JR4 A;  3MHV C;  4L8R C;  5EP3 A;  3UGJ A;  2ENH A;  4MGY E;  1HP1 A;  2EM5 A;  3GPU A;  4F1I A;  5ITQ A;  1XZW A;  3P1X A;  4ZVZ A;  2YTO A;  3K6Q A;  5J28 A;  3HQ1 A;  2RGO A;  3CTW B;  2XZU A;  4ORC A;  2N8X A;  2DWM A;  2DLK A;  4IJE A;  3QFM A;  1C1K A;  3VKH A;  3GRR A;  2F5Q A;  4ITQ A;  4JI1 M;  1PJI A;  1JK1 A;  3ADJ A;  3I01 M;  4IBE A;  2EM6 A;  3U6D A;  1W5T A;  2DZL A;  2F5P A;  2LH0 A;  4LU9 A;  3RL5 A;  5EQT A;  1QU6 A;  1SXJ E;  2ENA A;  1FJM A;  1GQE A;  3M7G A;  3IEC A;  1SU1 A;  2BJW A;  2WBS A;  3GVE A;  2NUG A;  2RQL A;  4LAC C;  1HNZ E;  3MSW A;  2LUP B;  2I9I A;  3R9X B;  1XB2 B;  3THO B;  2LBS B;  4KWY A;  3MMP A;  2EOY A;  2V1C A;  1IBK M;  2E72 A;  1WHC A;  1NHG C;  2JWS A;  2Z72 A;  3PXG A;  4L16 A;  1NVM A;  1AAY A;  1UF3 A;  1XMO E;  5A6B A;  5IXM B;  3U60 B;  2EPO A;  2OOA A;  1DO2 A;  4DSY A;  2Q8U A;  2MR9 A;  1EH8 A;  2ELZ A;  2KZS A;  2R17 A;  3HPZ A;  3KW6 A;  2Z7J A;  1JK7 A;  2C96 A;  4LJ9 A;  3LCV B;  1KFV A;  2C5R A;  1NSF A;  2VQF E;  1BVS A;  1T4L B;  2USH A;  4OR9 A;  1V33 A;  4DV3 E;  3QYE A;  2LNH C;  5IV8 B;  1WR1 B;  1F2I G;  3R8F A;  5INB A;  4L5N C;  4Q7J A;  2M9A A;  2I7N A;  2YTE A;  1EH7 A;  1OKS A;  3E0J A;  2EMG A;  3D8L A;  3SMS A;  2EOI A;  4RNA A;  2WBT A;  1SG9 A;  1J26 A;  3T15 A;  1S3M A;  1Q02 A;  1YSA C;  4GH9 A;  2G5G X;  2CV9 A;  2HY1 A;  3TQS A;  2M4I A;  1E94 E;  5JI3 E;  4J8Z A;  4X66 E;  1HNZ M;  1Z6T A;  1QHW A;  2K6B A;  2XF3 A;  1HPU A;  2AHM A;  4B2O A;  3SFZ A;  2NXF A;  3UJN A;  3U5Z B;  3GLF B;  5FTL A;  4WFT A;  1VDD A;  4WUR A;  4Q28 A;  2LJH A;  1IXR C;  2WZO A;  3AL0 C;  5FSW A;  1TGU A;  3C58 A;  5ITR A;  1XMO M;  3QFN A;  3J7Y p;  4LTY A;  2FTX B;  4AQY E;  1SXJ A;  3GLH E;  2H5X A;  5A6K A;  1SXJ C;  4WW0 A;  3ECR A;  1G71 A;  2UUC E;  3WHL A;  2YU5 A;  2NAB A;  4F6M A;  4R03 A;  4CIS A;  2VRD A;  1G2F C;  4Z6Y A;  4R7G A;  2VQF M;  2LO3 A;  4DUY M;  1IN8 A;  3U6L A;  1X47 A;  1USH A;  2YRK A;  4DV3 M;  2EM8 A;  1WXQ A;  3E46 A;  3CF0 A;  2KNA A;  5KPR A;  3KFU G;  2R4J A;  1FKA E;  3ZTV A;  1E32 A;  1R5L A;  2HCB A;  2MC6 A;  1OI8 A;  2EWL A;  4P7D A;  1J7K A;  3T1I A;  1OFH A;  2YNM D;  4AG6 A;  3P71 C;  2RKO A;  3J7B A;  3NWL A;  3JYF A;  1TF3 A;  2YZT A;  2G7H A;  1UTE A;  1IFY A;  2FE8 A;  1RMD A;  2EPU A;  4LF6 E;  1RU3 A;  2F5O A;  2YTJ A;  3AOE A;  1DV0 A;  1NNU C;  4PDG A;  3H67 A;  3AOE C;  2YVT A;  2DKL A;  2ZTD A;  2QBY B;  2Z4R A;  3KOZ E;  3GO8 A;  4GHL A;  3H64 A;  5EXX A;  2EM7 A;  3LVW A;  1IBL M;  2JXP A;  4NRW A;  4GMQ A;  1DQ3 A;  2LT7 A;  4K0K E;  2UXD E;  2ZAN A;  2B7V A;  4IYP C;  3RFW A;  1S8E A;  1VEK A;  3SAU A;  2CPN A;  1YUB A;  3L27 A;  4CJ6 A;  3TGH A;  3KDS E;  2GNO A;  4D81 A;  1G2D C;  5KL5 A;  3J2P B;  2K47 A;  4AQY M;  3B7Z A;  3VYX A;  4RF0 A;  2LBC A;  2KRU A;  2A25 A;  4WPY A;  2UUC M;  3HZJ A;  2M5Z A;  2LVA A;  1GTK A;  2C9C A;  2MH8 A;  1NNJ A;  2I13 A;  3W0F A;  1DI2 A;  3FE3 A;  3CK2 A;  1JR3 E;  4NC6 A;  2GJU A;  2YTG A;  3ZU0 A;  1ZMW A;  3H69 A;  2VDB B;  4HL4 A;  1QDR A;  3KS4 A;  1II7 A;  1IQO A;  5IRE B;  1QAQ A;  1HT1 E;  3KOX E;  2BBG A;  4BC9 A;  4MGK E;  1XHB A;  3CGW A;  1HNW M;  3SHG B;  3T1Y E;  2UXB E;  3FLO A;  1X48 A;  4LRS A;  5IZ7 D;  5IT9 C;  2M60 A;  2KDL A;  1MEY C;  4O5G A;  3FGA C;  4JI5 E;  4FWD A;  4Q35 B;  1R6B X;  1IXZ A;  2EPA A;  4M9X A;  2RRU A;  1A5T A;  3DA1 A;  1EFU B;  4NXN E;  2ZTC A;  2BB8 A;  4LF6 M;  4LF7 E;  4WYQ B;  1MX0 A;  2MRO B;  1QAN A;  3F6G A;  1D0K A;  2A5Y B;  2LVQ D;  1L1Z A;  2E5L E;  4M9V C;  3GQ5 A;  3VK8 A;  2JZ0 A;  1TDZ A;  1T4O A;  3M99 B;  2ODR C;  4H2B A;  1GJS A;  2WDD A;  3H62 B;  2EZ6 A;  1IXS A;  4K0K M;  3MHS C;  5FTM A;  2UXD M;  5L8R F;  1QDT A;  3HU2 A;  5KL6 A;  2EMW A;  1N33 E;  2M1S A;  4F54 A;  1IY2 A;  5DFL A;  2OQ4 A;  3DW8 C;  2V86 A;  3VLF B;  4B7H A;  1J09 A;  2ZBM A;  1A1K A;  1A1L A;  4JA7 A;  2DXN A;  2EKF A;  1HNX E;  4RKU F;  2DMI A;  4D80 A;  3GLG B;  2C98 A;  1M63 A;  2R6F A;  4GKK M;  3OTO E;  4IL1 A;  4LF4 E;  3JAM C;  2JY5 A;  2DAG A;  2EMH A;  3TWL A;  4BLC A;  3GPY A;  4O43 A;  3BBZ A;  2VQE M;  1IY1 A;  1ZBQ A;  3IVE A;  1MF8 A;  1L2C A;  4JI2 E;  3AUZ A;  2QJC A;  4B3M M;  2EOO A;  1Q3B A;  4DHL A;  4JN6 A;  1D0M A;  2L3J A;  4FWH A;  4R3D A;  1YYK A;  3V76 A;  1TN9 A;  2N3H A;  1J5E E;  3T1Y M;  2UXB M;  4YY3 E;  2XLJ A;  2RSM A;  2E1M A;  2VE7 C;  4JI5 M;  2EOR A;  4CIZ A;  4F0Z A;  4AW4 A;  3ZOQ B;  2CV0 A;  4I5N C;  3GPX A;  3HGI A;  1X6F A;  4NXN M;  3FYD A;  4JI6 M;  2EPC A;  2RSI A;  2UUB M;  2L2M A;  2F8B A;  2XSZ A;  4ZPX A;  1JR3 A;  1Z5A A;  2L7I A;  2LHC A;  4KOD A;  5ITU A;  2FNA A;  5T6J A;  2JNH A;  2CHQ A;  1PJS A;  4O24 A;  3C3D A;  2DAK A;  1TR8 A;  2EE8 A;  3B7N A;  4DBG B;  1N33 M;  3J80 C;  2LTS A;  4NXM E;  1XM7 A;  3T6P A;  2EM4 A;  2R0I A;  2DAE A;  5LL6 R;  1WAO 1;  3HHW A;  4G4Q A;  4KKZ A;  3DJW A;  2H1R A;  3K7V C;  4LZJ A;  4RF1 A;  1X6E A;  4DR7 M;  2VF1 A;  3RE8 A;  2QPA A;  1V92 A;  1HNX M;  1SR9 A;  2DI0 A;  3OTO M;  4LF4 M;  4WP2 A;  2UU9 E;  2HJJ A;  2V1U A;  3J81 S;  2V85 A;  1IQS A;  2JXN A;  4OOG C;  4XGI A;  4IBB A;  4JI2 M;  3FTE A;  1QQW A;  1J5E M;  4YY3 M;  4WX9 A;  1WHN A;  2G3Q A;  3KSX A;  2EN8 A;  3KXE C;  2HHH E;  5EXT A;  2UUA E;  2KKN A;  1DGB A;  3J81 C;  4YKE A;  3B9P A;  4I8O A;  2WDC A;  4KLN A;  2EPL X;  2DWL A;  4BBA A;  2DEN A;  4Z8X A;  3GQ4 A;  1A1G A;  2EMF A;  1SXJ B;  3UK6 A;  4IBC A;  3B7Q A;  1N34 E;  4ORB A;  4M2Z A;  2I7P A;  3PNY A;  3U61 A;  4R2R A;  1QZE A;  1QAM A;  2CT1 A;  3HU3 A;  4GHA A;  1NEI A;  2DAM A;  3TWM A;  3MJ5 A;  3AFH A;  5FLX C;  4FCW A;  3U6E A;  1DGG A;  4JI4 E;  4NXM M;  4M0W A;  4D82 A;  2YPN A;  4Q7F A;  4MH0 E;  1T39 A;  2JWO A;  1IN7 A;  1KYI A;  3HVQ A;  3FUT A;  4OW0 A;  5BR8 E;  1D2N A;  4NOO B;  2MDR A;  4JYA E;  1T71 A;  4ZYH A;  2UU9 M;  2NA2 A;  1W24 A;  4A3V B;  3D03 A;  3ZC7 B;  2Y20 A;  2ZAM A;  2EL5 A;  2LJU A;  1L4S A;  3RGS A;  4FCX A;  1I94 E;  2QCU A;  3I04 M;  5EP4 A;  2V88 A;  2RPC A;  1IT6 A;  4DMI A;  1N3G A;  2NYM C;  1QUT A;  2LWX A;  3L25 A;  1G4A E;  3KOY E;  4LJA A;  2Z06 A;  3KSJ A;  4QHS A;  3FUX A;  3J7A G;  1WAR A;  2KON A;  2JOB A;  3AV0 A;  1ZR9 A;  2HHH M;  1AIP C;  4BBY A;  4TUG A;  3UMM A;  2EPP A;  8CAT A;  2UUA M;  4P16 A;  2DFJ A;  5KL2 A;  3H63 A;  4P78 A;  2R76 A;  1HJP A;  2L3C A;  4DUY E;  4H1Y P;  4QHT A;  1DGC A;  1Z59 A;  2R44 A;  2X49 A;  2LUQ A;  2LRS A;  1R4G A;  1YYO A;  1GL7 A;  3FYC A;  1N34 M;  4JI7 E;  1G59 A;  5A6B D;  4DV2 E;  2O8G A;  2EMZ A;  4S12 A;  4XPN A;  3FUW A;  1L2B A;  2UXC E;  2ZOA A;  3ILK A;  4F2J C;  4UT3 A;  2EOZ A;  3FRI A;  1XXH B;  4JI8 E;  2NYL C;  2CHG A;  4DUZ M;  4JI4 M;  3EGG A;  4R2E A;  2DHR A;  4DV7 E;  1N32 E;  4LY6 A;  1E9R A;  1MGT A;  2WBU A;  2DMY A;  2NPP C;  2N3G A;  4IBK A;  2VII A;  1HT2 E;  3GRY A;  1PJQ A;  1UN6 B;  4B08 A;  5DNY A;  4NHR A;  1Z1B A;  5CFF E;  2LXE A;  5BR8 M;  2EN6 A;  4MLV A;  3GLH B;  4JYA M;  2FS1 A;  3SMP A;  4PCZ A;  1ZAA C;  1IBL E;  4NZV A;  3EGH A;  2R46 A;  4X65 E;  5F3W A;  3GLI B;  3SAV A;  5EJC A;  1I94 M;  4Y28 F;  2OOB A;  2JYA A;  2CTD A;  1R7R A;  3RQZ A;  2O01 F;  2EOQ A;  3GRV A;  1V73 A;  5ADZ A;  2MKN A;  2ERC A;  3L00 A;  1GKI A;  2JP9 A;  1IM2 A;  4MB7 A;  1TH2 A;  2MDG A;  1BB8 A;  1PGY A;  3Q8G A;  4GIP A;  3UK3 C;  4I5S A;  3VDU A;  3GLF E;  1YYW A;  5AE2 A;  3FUV A;  2XMO A;  4JI7 M;  4ZX2 A;  4GEQ B;  1OID A;  4DV2 M;  5ITT A;  1SXJ D;  1PKP A;  2EQ0 A;  1CUK A;  2YTQ A;  2V8Q B;  2UXC M;  5JI2 E;  2L6O A;  1H6U A;  3D8B A;  4R2A A;  4GZN C;  4MP0 A;  1T3T A;  2EM3 A;  1HNW E;  1RQ0 A;  3VYY A;  4HLQ A;  2EOM A;  1G8P A;  1FNN A;  5EXS A;  4FD2 A;  2GQF A;  2ENC A;  2EOS A;  3I4Y A;  4JI8 M;  4R2D A;  4DR3 E;  3IB8 A;  2R65 A;  2EPK X;  4DV7 M;  1N32 M;  3E7B A;  3LML A;  3TQM A;  5E6J A;  2LTU A;  1XNQ E;  4EIW A;  1XNR E;  1UM8 A;  1Z2X A;  4G6Z A;  3IHP A;  3L29 A;  1WRJ A;  3LW5 F;  3H60 A;  1YUJ A;  2BJV A;  4H2F A;  3RGP A;  4DR4 M;  2QP9 X;  4X65 M;  2Z3X A;  2JY7 A;  2WCC 3;  3I51 A;  2KXE A;  2WDE A;  1HQY E;  4NSR A;  1N75 A;  3U60 A;  4HEO A;  3VK7 A;  4DKK A;  1IBM E;  5B8I A;  3QFK A;  2CV2 A;  2DXL A;  2QZ4 A;  4BMJ A;  3B74 A;  5KL4 A;  5IT9 S;  3U6M A;  4GKK E;  2P6B A;  3C6M A;  2XH9 A;  5EP2 A;  4GKJ E;  3OML A;  2DGC A;  2V87 A;  4X9J A;  2B3T A;  3FIG A;  3PSN A;  1IMU A;  5EQV A;  2EQ1 A;  4DV6 E;  2VQE E;  2YFQ A;  3LQR A;  3LLH A;  2MKD A;  4B3M E;  2LVO C;  4M30 A;  4BS9 A;  1KJK A;  1PM5 A;  1C7Y A;  3IB7 A;  1ZQ9 A;  4IJF A;  4L6V 6;  2D9H A;  5GTU A;  3K9P A;  4DR3 M;  4FBK A;  2LCE A;  2FGG A;  1S3N A;  4BC7 A;  1YZ9 A;  2QEN A;  2YT4 A;  1T4N A;  2EOJ A;  4FK5 C;  2P5T A;  1QUS A;  1XNQ M;  2LVH A;  1GAB A;  2V83 A;  4JI6 E;  1S3S A;  1YFH A;  2HC5 A;  1XNR M;  2UUB E;  4LF5 M;  4MGH A;  2A22 A;  4B7G A;  3GLF A;  2O8A A;  2ZO9 B;  2JR1 A;  5JPF A;  4AKH A;  2BDX A;  1UIL A;  3KBP A;  2EN1 A;  2MGW A;  1OJL A;  2NQ8 C;  3HKP A;  3JAM S;  4AG5 A;  5ITX E;  2DHY A;  4GRI A;  1QVR A;  4LJ7 A;  3DSD A;  2JY6 B;  1Z2W A;  1NO1 A;  2XZF A;  2J5Y A;  1YE9 A;  2EL6 A;  2AHD A;  2EL4 A;  4LJ5 A;  3VDP A;  2KEB A;  3ICF A;  1ZV1 A;  3FKE A;  1IBM M;  3RL4 A;  3FTF A;  4I81 A;  2EMK A;  5FTN A;  4DR7 E;  2EML A;  1OIZ A;  1YUI A;  2ODR D;  2F5N A;  4R8O A;  3W67 A;  2ELY A;  4R2Q A;  1IN6 A;  2B9D A;  2R4E A;  2CHV A;  1BBG A;  2QQ8 A;  5DYG A;  2EP3 A;  1GVN A;  4GKJ M;  5KO3 A;  4GEW A;  4DR5 E;  4JI3 E;  4IBI A;  4GC5 A;  3GQ3 A;  4DV6 M;  4DV5 E;  1UFZ A;  2C99 A;  3SAT A;  1W5S A;  3ADG A;  3HWS A;  4HEI A;  4LJ6 A;  2O5R A;  3SAW A;  1T6O A;  4FBQ A;  2DRP A;  3HHY A;  2XGN A;  3SAS A;  4BB9 A;  2L2N A;  2DAI A;  1N77 A;  4H2I A;  2K0B X;  3EPK A;  1XC8 A;  1G3I A;  4ZYG A;  2L2K B;  2VF7 A;  3J80 S;  2EOH A;  3FTD A;  3GLG E;  3EIH A;  4KHP E;  1L1T A;  3E9S A;  4IIW A;  2XEP A;  4LF9 E;  3LL8 A;  4NSO B;  3W0L B;  4P17 A;  1K82 A;  3H61 A;  3KP1 E;  2WZJ A;  2JVA A;  5JJT A;  3DF6 A;  1JQJ C;  4RHB B;  2YRM A;  3T1H E;  3HJQ A;  3C9F A;  3J7A S;  4KBP A;  2YQZ A;  2FV4 B;  3EPJ A;  2DSY A;  3U6Q A;  4ANR A; 
#chains in the Genus database with same CATH homology
 1WXR A;  2YEQ A;  4B3T M;  2EA0 A;  4LCB A;  1LV7 A;  3L26 A;  5A2Q C;  1NNW A;  2XSZ D;  3HU1 A;  5H37 D;  3PFI A;  2DWN A;  5GKN A;  2L6M A;  4DR5 M;  4JI3 M;  1N36 E;  4J6O A;  4LF8 E;  5BPV A;  2ZM6 E;  4DV5 M;  2F4V E;  4LFC E;  1DO0 A;  4F9B B;  4X64 E;  5ITX A;  1ZBT A;  5DYI A;  4G4O A;  4FVM A;  2CE7 A;  4JA9 A;  2R45 A;  2DWZ B;  1YSY A;  1DGF A;  4AKI A;  3KOW E;  3SYL A;  1KBP A;  2J7O A;  4V0V A;  3RL3 A;  5FLX S;  1HO5 A;  4MOV A;  4KHP M;  4LF9 M;  1Q3C A;  2D7G A;  2RTX A;  3PSO A;  5EXP A;  4B7F A;  2KRK A;  3IWB A;  4JV5 E;  4II7 A;  3T1H M;  3KS8 A;  4WWL A;  2Y21 A;  2F5S A;  4X62 E;  4LFA M;  4L4U A;  1ZAE A;  5KQD A;  3SHF A;  3HTX A;  3QG5 C;  4DUZ E;  4GC9 A;  2R62 A;  3K92 A;  1GZ6 A;  2Z1A A;  2L09 A;  1NHW C;  3GRU A;  4LJ8 A;  2HKJ A;  4NL4 H;  3GLG A;  3ADL A;  1G5B A;  3IWD A;  1DGH A;  1N36 M;  5LMU M;  4LF8 M;  2BQ8 X;  2ZM6 M;  2F4V M;  3NBI A;  3U6O A;  4LFC M;  4B3S M;  4M9S A;  3PNV A;  4DV0 M;  3SC3 A;  2RGH A;  4FW9 A;  4X64 M;  2L33 A;  3H66 A;  2J7N A;  3DOA A;  5IWA E;  3N5U A;  1K3X A;  3DSC A;  4LJ4 A;  3F6H A;  1NY5 A;  3M0E A;  4F9A B;  4OVZ A;  4IBG A;  4QOZ C;  4WSP A;  2XFS A;  3HPS A;  1Z5B A;  1T70 A;  2WDF A;  3SAR A;  2KW0 A;  1TH3 A;  4JV5 M;  4AKG A;  3GPP A;  4DT2 A;  5FTJ A;  5KPZ A;  4X62 M;  2RS6 A;  2B3T B;  2CFO A;  3IVD A;  4BCA A;  1N78 A;  3HXL A;  3U6C A;  2DIX A;  1OIE A;  3JR5 A;  1OFI A;  3A98 B;  1I4W A;  2FOI C;  3A45 A;  3H09 A;  3KP0 E;  4UT2 A;  4O4K A;  3T38 A;  3PVS A;  1NJG A;  3DFZ A;  1Z5C A;  1FJG E;  4F9C B;  3LMM A;  4FCT A;  3BOS A;  4KO8 A;  2EO2 A;  4DR4 E;  1G41 A;  2NUF A;  3L28 A;  3FTC A;  5AE3 A;  4DV4 E;  2NUE A;  2ZBK B;  4LZZ A;  2JY9 A;  5IWA M;  1QAO A;  4M0D A;  3MK6 A;  4CHT B;  4IBD A;  2JA2 A;  2CEA A;  3V4Y A;  1IXS B;  1S70 A;  4PT5 A;  3C4B A;  2V89 A;  4DR2 E;  4AI6 A;  3VKG A;  3K1J A;  2Y0T A;  3IG8 A;  5KPT A;  1XMQ E;  2Z4S A;  2FFJ A;  2EUC A;  2XFT A;  4PDI A;  2B7T A;  2DB2 A;  4MGI E;  4UWQ A;  2JOG A;  4L8N A;  2H36 X;  3JTZ A;  1HR0 E;  5HPE A;  4G9J A;  3SYK A;  2OPF A;  4LRT A;  4JI0 E;  3ADI A;  4IBF A;  2R18 A;  3J27 B;  3A42 A;  4LF5 E;  1STU A;  1FJG M;  3DZD A;  2HYP A;  3CF6 E;  5LMN E;  1L8Q A;  4LFB E;  1X37 A;  2DZO B;  2JOX A;  4DV4 M;  4X66 M;  2IE4 C;  4B3R E;  2KZU A;  3Q8X A;  2IHR 1;  4REZ A;  5FTK A;  2KA6 B;  2X8A A;  1NY6 A;  4TUI A;  3QFO A;  3AJI B;  3KWR A;  3C4T A;  4V0X A;  4YHH E;  3JU0 A;  4DR2 M;  4DR6 E;  2BNK A;  3HHZ A;  1E9S A;  3HHX A;  4H1S A;  1R2Z A;  1XMQ M;  1HQC A;  5C1V A;  4QNM A;  2LE2 A;  1MU5 A;  3M6A A;  4HD0 A;  2CUZ A;  3IWC A;  1EE8 A;  3A46 A;  2V6Z M;  2CV1 A;  1XXH A;  3RMP A;  2L7H A;  1HR0 M;  3ZCB B;  1R2Y A;  4JI0 M;  4FWG A;  2ZAO A;  2QFR A;  2IE3 C;  3VK6 A;  1UHZ A;  1L2D A;  2C9O A;  1TH4 A;  2DVW B;  4M0V A;  2IAE C;  3U5Z A;  5AAS A;  4DR1 E;  4QOS A;  1O0W A;  3C5W C;  3GLH A;  2W82 A;  3I4V A;  3SBJ A;  4L15 A;  1NJF A;  5LMN M;  3KVW A;  2K4V A;  4LGM A;  3HJS A;  1X49 A;  3GLI A;  2L92 A;  3QAU A;  4LFB M;  3K7W C;  4ORA A;  4NRV A;  3TPZ A;  1GLN A;  4L78 A;  5EP1 A;  4B3R M;  4LGY A;  1QFC A;  3TE6 A;  4B3T E;  4OX9 E;  4JXJ A;  4G4N A;  1TDH A;  2LTR A;  5JPE A;  3U61 B;  3E4R A;  2HYO A;  3GP1 A;  2KHX A;  4YHH M;  3L2A A;  1Q39 A;  3VFD A;  4DR6 M;  2G8L A;  3FD9 A;  4MGZ E;  4DV1 E;  1IN5 A;  3E7A A;  3UZU A;  1ORY B;  3AKZ A;  4I4L A;  3TL4 X;  2MC5 A;  2D7E A;  2Y0Q A;  1RC7 A;  4IBJ A;  1DGH B;  4G4R A;  7CAT A;  4FCV A;  1U32 A;  4M9Z A;  1QYR A;  4X8W A;  1TCO A;  2DZN B;  2YR0 A;  3ZH9 B;  1IQP A;  2HL7 A;  3K8Z A;  3K2L A;  2RS7 A;  3CF2 A;  3THG A;  3FUU A;  2D7H A;  5C1B A;  3H68 A;  5A2Q S;  4DR1 M;  4FBW A;  1EKZ A;  2QBY A;  1QZM A;  4XBO A;  4V0W A;  4OVZ B;  4AZF A;  4OU7 A;  1XWI A;  1PJJ A;  1AUI A;  5IOH A;  4LFA E;  4LF7 M;  3U6S A;  2E5L M;  4JI1 E;  5C18 A;  1GL6 A;  3U6P A;  4OX9 M;  2L8T A;  5AE1 A;  1S95 A;  2BCD A;  4UT3 B;  1JR3 D;  3LVV A;  1S3L A;  1K3W A;  4TUW A;  4QNR A;  4MM3 B;  4MOY A;  3QWL A;  4H2G A;  4PD2 A;  2Q2E B;  5LMU E;  4DV1 M;  1IN4 A;  1WHQ A;  2LMZ A;  3LQQ A;  4GIT A;  4B3S E;  2X4A A;  3WHK A;  4DV0 E;  2QFP A;  3H4M A;  4I5L C;  4LG2 A;  3HJ8 A;  2DXI A;  4KZS A;  4CGY B;  2M7Q A;  5ITY A;  3THN A;  1IBK E;  2KOU A;  3IG5 A;  4W5W A;  3TWK A;  5E26 A;  1KSF X;  3AOG A;  3EIE A;  1IY0 A;  5KQ8 A;  3JR4 A;  3MHV C;  4L8R C;  5EP3 A;  3UGJ A;  4MGY E;  1HP1 A;  3GPU A;  5ITQ A;  1XZW A;  3P1X A;  4ZVZ A;  3K6Q A;  5J28 A;  3HQ1 A;  2RGO A;  3CTW B;  2XZU A;  4ORC A;  2DWM A;  4IJE A;  3QFM A;  1C1K A;  3VKH A;  3GRR A;  2F5Q A;  4ITQ A;  4JI1 M;  1PJI A;  3ADJ A;  4IBE A;  3U6D A;  1W5T A;  2F5P A;  2LH0 A;  4LU9 A;  3RL5 A;  5EQT A;  1QU6 A;  1SXJ E;  1FJM A;  1GQE A;  3M7G A;  1SU1 A;  2BJW A;  3GVE A;  2NUG A;  4LAC C;  1HNZ E;  3MSW A;  2LUP B;  3R9X B;  3THO B;  2LBS B;  2V1C A;  1IBK M;  1NHG C;  2Z72 A;  3PXG A;  4L16 A;  1NVM A;  1UF3 A;  1XMO E;  3U60 B;  1DO2 A;  4DSY A;  2Q8U A;  2KZS A;  2R17 A;  3HPZ A;  3KW6 A;  2Z7J A;  1JK7 A;  2C96 A;  4LJ9 A;  1KFV A;  2C5R A;  1NSF A;  2VQF E;  1T4L B;  2USH A;  4OR9 A;  4DV3 E;  2LNH C;  3R8F A;  5INB A;  4L5N C;  2I7N A;  3E0J A;  3D8L A;  3SMS A;  4RNA A;  1J26 A;  3T15 A;  1S3M A;  4GH9 A;  2G5G X;  2CV9 A;  2HY1 A;  3TQS A;  2M4I A;  1E94 E;  5JI3 E;  4J8Z A;  4X66 E;  1HNZ M;  1Z6T A;  1QHW A;  2XF3 A;  1HPU A;  2AHM A;  4B2O A;  3SFZ A;  2NXF A;  3UJN A;  3U5Z B;  3GLF B;  5FTL A;  4WFT A;  1VDD A;  4WUR A;  4Q28 A;  2LJH A;  1IXR C;  2WZO A;  3AL0 C;  5FSW A;  1TGU A;  3C58 A;  5ITR A;  1XMO M;  3QFN A;  3J7Y p;  4LTY A;  2FTX B;  4AQY E;  1SXJ A;  1SXJ C;  4WW0 A;  2UUC E;  3WHL A;  4R03 A;  4CIS A;  4Z6Y A;  4R7G A;  2VQF M;  4DUY M;  1IN8 A;  3U6L A;  1X47 A;  1USH A;  4DV3 M;  1WXQ A;  3CF0 A;  5KPR A;  3KFU G;  2R4J A;  1FKA E;  3ZTV A;  1E32 A;  2HCB A;  2MC6 A;  1OI8 A;  2EWL A;  4P7D A;  1J7K A;  3T1I A;  1OFH A;  2YNM D;  4AG6 A;  3P71 C;  2RKO A;  3J7B A;  3NWL A;  3JYF A;  2YZT A;  2G7H A;  1UTE A;  2FE8 A;  4LF6 E;  2F5O A;  3AOE A;  1NNU C;  4PDG A;  3H67 A;  3AOE C;  2YVT A;  2QBY B;  2Z4R A;  3KOZ E;  3GO8 A;  4GHL A;  3H64 A;  5EXX A;  3LVW A;  1IBL M;  4NRW A;  4GMQ A;  1DQ3 A;  4K0K E;  2UXD E;  2ZAN A;  2B7V A;  4IYP C;  3RFW A;  1S8E A;  3SAU A;  2CPN A;  1YUB A;  3L27 A;  3TGH A;  3KDS E;  4D81 A;  3J2P B;  2K47 A;  4AQY M;  3VYX A;  4RF0 A;  2KRU A;  4WPY A;  2UUC M;  2M5Z A;  2C9C A;  1NNJ A;  3W0F A;  1DI2 A;  3CK2 A;  2GJU A;  3ZU0 A;  3H69 A;  4HL4 A;  3KS4 A;  1II7 A;  5IRE B;  1QAQ A;  1HT1 E;  3KOX E;  4BC9 A;  4MGK E;  1XHB A;  1HNW M;  3SHG B;  3T1Y E;  2UXB E;  3FLO A;  1X48 A;  4LRS A;  5IZ7 D;  5IT9 C;  2M60 A;  4O5G A;  3FGA C;  4JI5 E;  4FWD A;  1R6B X;  1IXZ A;  4M9X A;  3DA1 A;  4NXN E;  4LF6 M;  4LF7 E;  4WYQ B;  1MX0 A;  1QAN A;  3F6G A;  2A5Y B;  1L1Z A;  2E5L E;  3GQ5 A;  3VK8 A;  1TDZ A;  1T4O A;  2ODR C;  4H2B A;  2WDD A;  3H62 B;  2EZ6 A;  4K0K M;  5FTM A;  2UXD M;  3HU2 A;  1N33 E;  2M1S A;  4F54 A;  1IY2 A;  2OQ4 A;  3DW8 C;  2V86 A;  3VLF B;  4B7H A;  1J09 A;  2ZBM A;  4JA7 A;  2DXN A;  1HNX E;  4D80 A;  3GLG B;  2C98 A;  1M63 A;  4GKK M;  3OTO E;  4IL1 A;  4LF4 E;  3JAM C;  3TWL A;  4BLC A;  3GPY A;  4O43 A;  2VQE M;  1IY1 A;  1ZBQ A;  3IVE A;  1MF8 A;  1L2C A;  4JI2 E;  2QJC A;  3AUZ A;  4B3M M;  1Q3B A;  4DHL A;  4JN6 A;  2L3J A;  4FWH A;  4R3D A;  1YYK A;  2N3H A;  1J5E E;  3T1Y M;  2UXB M;  4YY3 E;  2XLJ A;  2RSM A;  2E1M A;  2VE7 C;  4JI5 M;  4F0Z A;  4AW4 A;  3ZOQ B;  2CV0 A;  4I5N C;  3GPX A;  3HGI A;  4NXN M;  3FYD A;  4JI6 M;  2UUB M;  2L2M A;  2F8B A;  2XSZ A;  4ZPX A;  1JR3 A;  1Z5A A;  2L7I A;  4KOD A;  5ITU A;  2FNA A;  5T6J A;  2CHQ A;  4O24 A;  1N33 M;  3J80 C;  2LTS A;  4NXM E;  1XM7 A;  5LL6 R;  1WAO 1;  3HHW A;  4G4Q A;  4KKZ A;  3DJW A;  2H1R A;  3K7V C;  4LZJ A;  4RF1 A;  4DR7 M;  2VF1 A;  3RE8 A;  2QPA A;  1HNX M;  1SR9 A;  3OTO M;  4LF4 M;  2UU9 E;  2V1U A;  3J81 S;  2V85 A;  4OOG C;  4XGI A;  4IBB A;  4JI2 M;  3FTE A;  1QQW A;  1J5E M;  4YY3 M;  1WHN A;  3KSX A;  3KXE C;  2HHH E;  5EXT A;  2UUA E;  2KKN A;  1DGB A;  3J81 C;  4YKE A;  3B9P A;  4I8O A;  2WDC A;  4KLN A;  2DWL A;  4BBA A;  4Z8X A;  3GQ4 A;  1SXJ B;  3UK6 A;  4IBC A;  1N34 E;  4ORB A;  4M2Z A;  2I7P A;  3PNY A;  3U61 A;  1QAM A;  3HU3 A;  4GHA A;  3TWM A;  3MJ5 A;  3AFH A;  5FLX C;  4FCW A;  3U6E A;  1DGG A;  4JI4 E;  4NXM M;  4M0W A;  4D82 A;  4Q7F A;  4MH0 E;  2JWO A;  1IN7 A;  1KYI A;  3HVQ A;  3FUT A;  4OW0 A;  5BR8 E;  1D2N A;  4NOO B;  2MDR A;  4JYA E;  1T71 A;  2UU9 M;  2NA2 A;  1W24 A;  4A3V B;  3D03 A;  3ZC7 B;  2Y20 A;  2ZAM A;  3RGS A;  4FCX A;  1I94 E;  2QCU A;  5EP4 A;  2V88 A;  1IT6 A;  4DMI A;  2NYM C;  2LWX A;  3L25 A;  1G4A E;  3KOY E;  4LJA A;  2Z06 A;  3KSJ A;  4QHS A;  3FUX A;  3J7A G;  1WAR A;  2KON A;  2JOB A;  3AV0 A;  2HHH M;  4BBY A;  4TUG A;  3UMM A;  8CAT A;  2UUA M;  4P16 A;  2DFJ A;  3H63 A;  4P78 A;  2L3C A;  4DUY E;  4H1Y P;  4QHT A;  1Z59 A;  2X49 A;  2LUQ A;  2LRS A;  1YYO A;  1GL7 A;  3FYC A;  1N34 M;  4JI7 E;  1G59 A;  4DV2 E;  2O8G A;  4S12 A;  4XPN A;  3FUW A;  1L2B A;  2UXC E;  2ZOA A;  3ILK A;  4UT3 A;  1XXH B;  4JI8 E;  2NYL C;  2CHG A;  4DUZ M;  4JI4 M;  3EGG A;  2DHR A;  4DV7 E;  1N32 E;  4LY6 A;  1E9R A;  2DMY A;  2NPP C;  2N3G A;  4IBK A;  2VII A;  1HT2 E;  3GRY A;  4B08 A;  5DNY A;  5CFF E;  2LXE A;  5BR8 M;  3GLH B;  4JYA M;  3SMP A;  4PCZ A;  1IBL E;  3EGH A;  4NZV A;  2R46 A;  4X65 E;  5F3W A;  3GLI B;  3SAV A;  5EJC A;  1I94 M;  1R7R A;  3RQZ A;  3GRV A;  1V73 A;  5ADZ A;  2ERC A;  1GKI A;  1IM2 A;  4MB7 A;  1TH2 A;  4GIP A;  4I5S A;  3VDU A;  1YYW A;  5AE2 A;  3FUV A;  2XMO A;  4JI7 M;  4ZX2 A;  4GEQ B;  1OID A;  4DV2 M;  5ITT A;  1SXJ D;  1PKP A;  2V8Q B;  2UXC M;  5JI2 E;  2L6O A;  1H6U A;  3D8B A;  4MP0 A;  1T3T A;  1HNW E;  1RQ0 A;  3VYY A;  4HLQ A;  1G8P A;  1FNN A;  5EXS A;  4FD2 A;  3IB8 A;  3I4Y A;  4JI8 M;  4DR3 E;  2R65 A;  4DV7 M;  1N32 M;  3E7B A;  3LML A;  5E6J A;  1XNQ E;  4EIW A;  1XNR E;  1UM8 A;  1Z2X A;  4G6Z A;  3L29 A;  3H60 A;  2BJV A;  4H2F A;  3RGP A;  4DR4 M;  2QP9 X;  4X65 M;  2Z3X A;  3I51 A;  2KXE A;  2WDE A;  1HQY E;  4NSR A;  1N75 A;  3U60 A;  3VK7 A;  4DKK A;  1IBM E;  5B8I A;  3QFK A;  2CV2 A;  2DXL A;  2QZ4 A;  4BMJ A;  5IT9 S;  3U6M A;  4GKK E;  2P6B A;  2XH9 A;  5EP2 A;  4GKJ E;  3OML A;  2V87 A;  3FIG A;  3PSN A;  5EQV A;  4DV6 E;  2VQE E;  2YFQ A;  3LQR A;  3LLH A;  4B3M E;  4M30 A;  4BS9 A;  1PM5 A;  3IB7 A;  1ZQ9 A;  4IJF A;  5GTU A;  4DR3 M;  4FBK A;  2FGG A;  1S3N A;  4BC7 A;  1YZ9 A;  2QEN A;  2YT4 A;  1T4N A;  2P5T A;  1XNQ M;  2V83 A;  4JI6 E;  1S3S A;  1XNR M;  2UUB E;  4LF5 M;  4MGH A;  2A22 A;  4B7G A;  3GLF A;  2O8A A;  2ZO9 B;  2JR1 A;  5JPF A;  4AKH A;  2BDX A;  1UIL A;  3KBP A;  2NQ8 C;  3HKP A;  1OJL A;  3JAM S;  4AG5 A;  5ITX E;  4GRI A;  1QVR A;  4LJ7 A;  3DSD A;  1Z2W A;  2XZF A;  1YE9 A;  2AHD A;  4LJ5 A;  3VDP A;  2KEB A;  3ICF A;  3RL4 A;  3FKE A;  1IBM M;  3FTF A;  4I81 A;  5FTN A;  4DR7 E;  2ODR D;  2F5N A;  4R8O A;  1IN6 A;  2B9D A;  2R4E A;  2CHV A;  5DYG A;  1GVN A;  4GKJ M;  5KO3 A;  4DR5 E;  4JI3 E;  4IBI A;  4GC5 A;  3GQ3 A;  4DV6 M;  4DV5 E;  2C99 A;  3SAT A;  1W5S A;  3ADG A;  3HWS A;  4LJ6 A;  2O5R A;  3SAW A;  4FBQ A;  3HHY A;  2XGN A;  3SAS A;  4BB9 A;  2L2N A;  1N77 A;  4H2I A;  1XC8 A;  1G3I A;  2L2K B;  3J80 S;  3FTD A;  4KHP E;  3EIH A;  1L1T A;  3E9S A;  3LL8 A;  2XEP A;  4IIW A;  4LF9 E;  4NSO B;  3W0L B;  1K82 A;  3H61 A;  3KP1 E;  2JVA A;  5JJT A;  3DF6 A;  1JQJ C;  3T1H E;  3HJQ A;  3C9F A;  3J7A S;  4KBP A;  2YQZ A;  2FV4 B;  2DSY A;  3U6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...