5F3WA

Structure of the atprs-mre11/rad50-dna complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
366
structure length
352
Chain Sequence
HMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDNIKELLVDYANRQGIDGDLVLSLYKALLNNENWKELLDEYYNTKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP-dependent DNA binding, unwinding, and resection by the Mre11/Rad50 complex
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Dna binding protein/hydrolase/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 105
structure length 352
sequence length 366
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.670 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5f3wA03
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5f3wA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5f3wA01
1Z2WA 3H69A 4IL1A 1XM7A 5JJTA 4H2BA 3QFMA 1S95A 4Q7FA 2NPPC 2GJUA 4ORAA 2ZBMA 5JPFA 2IAEC 1AUIA 4MP0A 1II7A 1HO5A 3PSOA 3DSDA 1WARA 3HVQA 3JYFA 1UTEA 2WDEA 3QG5C 2BCDA 1JK7A 1OI8A 1SU1A 2KKNA 2NYMC 4B2OA 4UT3B 3C5WC 4ORCA 4ZVZA 3H66A 4NZVA 1IT6A 4V0XA 4H1YP 4V0WA 2JOGA 3T1IA 3GVEA 5INBA 2IE4C 1QFCA 3EGHA 2YVTA 4F0ZA 3TGHA 4FBQA 4I5LC 3H60A 1UF3A 1USHA 2NXFA 1XZWA 3IB7A 3KBPA 3DSCA 2NYLC 3IVDA 3N5UA 2BQ8X 4TUGA 5JPEA 1OIDA 2P6BA 2QFRA 4UT3A 3P71C 1Z2XA 3DW8C 3E7AA 3QFOA 3ICFA 4UWQA 2Z06A 4H2FA 3RL5A 1S3MA 2O8GA 1WAO1 2Z72A 3AV0A 3QFKA 4FBWA 2QJCA 4MOYA 4V0VA 4YKEA 4H2GA 4O5GA 5HPEA 4G9JA 3H68A 2USHA 4O4KA 5IOHA 4DHLA 3H64A 4J6OA 4I5NC 4DT2A 5F3WA 3H63A 4MOVA 3C9FA 4KBPA 3THOB 2WDDA 3THNA 4UT2A 4HD0A 1V73A 3E7BA 3EGGA 1G5BA 2IE3C 1S70A 2O8AA 2Z1AA 1S3NA 3AUZA 1W24A 2WDCA 4ORBA 4OR9A 4DSYA 3PSNA 4M0VA 3IVEA 4XPNA 4LU9A 1QHWA 2HYPA 3ZTVA 2Q8UA 3CK2A 2DFJA 3IB8A 5B8IA 1OIEA 1T71A 1S8EA 1S3LA 5EQVA 2BDXA 5GTUA 1HPUA 3H62B 4KKZA 4ZX2A 1NNWA 3K7VC 3H61A 4H1SA 1MF8A 3QFNA 4FBKA 3V4YA 4JA9A 3FGAC 3RL4A 2A22A 1FJMA 4LTYA 4O43A 1U32A 3LL8A 4O24A 5J28A 4JA7A 4H2IA 2HYOA 3ZU0A 1M63A 4LACC 2WDFA 4FCXA 4WWLA 2CV9A 5C1VA 3K7WC 4IYPC 1TCOA 3H67A 3RQZA 4TUIA 2QFPA 1KBPA 3RL3A 2AHDA 2R17A 2XMOA 1HP1A 2HY1A 5DNYA 1T70A
chains in the Genus database with same CATH superfamily
5T6JA 2UXCE 5JJTA 1GJTA 3ADGA 3VFDA 3K92A 3RMPA 2YTDA 2EMLA 5FTNA 1J5EM 2EMKA 3IWBA 5EP2A 3LQQA 3GVEA 4QHTA 3SHFA 2JA2A 2EOFA 3P1XA 2DVWB 2HHHE 2DAGA 4I5SA 3VKGA 4DV7E 2P6BA 4DUYE 1UFZA 3QFOA 3FTFA 3C58A 1N36M 1NY5A 1N36E 1PJIA 5AASA 1PM5A 3U6CA 2K0BX 2LVHA 2E5LE 5KPTA 3FUVA 3UK6A 3VYYA 4I81A 4GEQB 3GRVA 4ZYGA 3FD9A 4LF5M 1DO2A 2V89A 5AC5A 3FUXA 3BIDA 3MSWA 4DR2E 1TF3A 5ITYA 2Y0QA 2KNAA 4P16A 2DZNB 5A69A 1UN6B 3PNVA 4L78A 4DSYA 5ITRA 1IQSA 1WJ7A 2N8XA 2DFJA 2LVAA 4Q28A 4GKKE 2CUZA 1HT2E 1X48A 1R6BX 1T38A 2CFOA 1GL6A 4FCTA 3SMPA 4KODA 2A22A 3L26A 4IIWA 4JI5M 2KA6B 1IXZA 1J09A 2EOJA 2JY7A 1RC7A 1IN5A 2EMBA 1YYWA 1T4LB 5BPVA 4Z8XA 3QFMA 4L6V6 5JPFA 4GH9A 1AUIA 4DBGB 4IJEA 3PSOA 1OFIA 1FKAE 1VDDA 2L33A 2EM7A 3T1YM 5KL3A 1V33A 2FFJA 2KDLA 2QCUA 2W82A 4B3SE 3FTCA 2G8LA 4F0ZA 4BC9A 2LE2A 2Z4SA 3IB7A 1X37A 1WXQA 2YQZA 1UILA 2MDGA 1G3IA 3L00A 4B08A 3VYXA 3ECRA 2G5GX 3GLHE 1N32M 4OX9E 4GMQA 4IBKA 2KONA 3AKZA 2BJWA 2KHXA 3LQRA 5ITXA 2WDDA 3I4VA 2L2DA 3HWSA 3U60B 2UU9E 1YSAC 1KFVA 3FIGA 3LW5F 2I9IA 1ZMVA 3QYBA 5EP1A 2UUBE 2EM3A 2YTFA 2NQ8C 4ZX2A 1I94M 3T1HM 3BF2A 1Y8GA 2YR0A 2YRMA 2CV1A 2N3GA 2NUFA 4X64M 2UXDM 3EIEA 2XGNA 4FWGA 5KQDA 1TDZA 1GABA 2HY1A 4IL1A 2P5TA 4F9AB 2HL7A 2Y20A 2XZFA 4M0WA 2DAMA 2LTUA 2ZANA 4LF7M 2IHR1 2BCDA 1AAYA 3GRRA 3VK6A 4NRVA 1JK7A 2M1SA 2XH9A 5KL2A 3C3EA 4H1YP 4M9XA 5AE2A 2Z7JA 2EE8A 2IE4C 4D80A 3TGHA 4L16A 3IG5A 1OJLA 2UXBM 4F2JC 2LVNC 1XMOE 1W5TA 3IG8A 5JPEA 2C96A 4W5WA 4UWQA 3HY5A 3SASA 2DMIA 4JI1E 1QVRA 3K9OA 2GPIA 2YRKA 4IBJA 3FUUA 4DR4M 2HKJA 3W0LB 4G9JA 1OIPA 2XZUA 4LF6E 2J7JA 4DHLA 1G2DC 1D0MA 2WBUA 4LCBA 3MK6A 3B7NA 2EPRA 1YYKA 4M2ZA 3VDPA 4FVMA 2CRUA 3U6LA 2EN6A 4LFBE 2EOZA 4LJ8A 2DWMA 2RTXA 3T6PA 5E6JA 2DAEA 2MH8A 3BXWA 1W24A 2WDCA 1UHZA 3JR4A 2UUBM 5FTMA 5LMUE 2LTRA 4CGYB 4KKZA 4P17A 5KO3A 5IV8B 2Y21A 3HU3A 2UU9M 1LLMC 4LTYA 2EP3A 5J28A 4I8OA 4IJDA 2C9CA 2DI0A 2EOYA 3U6SA 2EZ6A 3K7WC 3EQ1A 3C6MA 1L1TA 3I51A 1KSFX 1KBPA 2AHDA 2XMOA 4LG2A 2EOOA 3DFZA 1YE9A 1GTKA 3J7AS 2DGCA 2GJUA 1X6FA 1II7A 2L2KB 3HVQA 2HWJA 3AL0C 4OVZA 1TF0B 2CEAA 2WCC3 4R2AA 5A6BD 4Q35B 4YY3E 4NZVA 1IT6A 4BLCA 4F1IA 1G41A 3CGWA 1SXJD 1VQ1A 5INBA 5LMUM 1TH4A 4B3TE 2ZM6M 1B69A 3V76A 4R2QA 1XNRE 2K4VA 2L2MA 2G7HA 1OIDA 2QFRA 1YUIA 3FE3A 1L8QA 2YRHA 4LFBM 1EFUB 2O8GA 3VDUA 3F6GA 4YKEA 5HPEA 1N34M 3D03A 2EMHA 1HQYE 3VK8A 3R8FA 1VDLA 4DR4E 1HNZM 2DZLA 4CHTB 4AKIA 5GKNA 1PGYA 3ZH9B 3HHXA 1JB0F 1MX0A 1QUTA 2FS1A 2C9OA 4IBCA 1R4GA 1GZ6A 4M9VC 2Y0TA 2R0IA 4GKKM 3K2LA 1ZQ9A 4DV3E 2GNOA 2ERCA 2JPAA 1NVMA 2EMWA 2EPUA 1YLAA 1C7YA 1NNWA 3HTXA 3VHTB 3V4YA 3HGIA 2R44A 4O43A 4WX9A 3UMMA 2EPNA 1M63A 1V34A 3GLFE 2EM5A 3WHKA 1NSFA 2EPKX 4BBAA 2DXNA 5IT9C 2R17A 1T70A 3DZDA 3AOEC 1XXHB 5EJCA 2YFQA 4M30A 3JAMC 1XC8A 1HO5A 4LFCE 3HX3A 4FWDA 4DV7M 1A1FA 1XHBA 5A6BA 4M0DA 4ZYHA 3JAMS 3GQ4A 2CT1A 1PJQA 3E9SA 4GKJM 1OI8A 2F5SA 1GLNA 3HPZA 2D7GA 2XFSA 3U6QA 5KQ8A 1KYQA 2LMZA 1N33E 2OO9A 3H66A 4X65M 2LUPB 2M5ZA 1EIJA 4NXME 5A2QC 1WGLA 1JR3D 4OVZB 2EN1A 1USHA 4R2DA 2DZOB 1IBKE 3IVDA 4MGIE 2EOIA 4UT3A 4R7GA 3KWRA 3E7AA 4BHBA 2FTXB 2YTIA 1ZU1A 5FTKA 2Z72A 2DNAA 2RGHA 5EXPA 3DA1A 4BC7A 1JK1A 1QAOA 3B7ZA 4LF6M 4J8ZA 2LTSA 1SFEA 3AOEA 2YNMD 1P47A 2Z8YM 1F4IA 2V85A 3THOB 4DR1M 5IREB 3THNA 1NY6A 4HD0A 1G5BA 2VF7A 4WXCA 2N35A 2D9HA 1GQEA 3AUZA 4REZA 1SXJC 3U5ZB 2WSEF 3I01M 5DYGA 1A1LA 2D7EA 1T71A 4BHCA 5GTUA 4H1SA 1G4AE 2X8AA 4GITA 2B7VA 3UZUA 1T4OA 2WDFA 3U6MA 2F4VM 3AOGA 1TCOA 3PXGA 3C6KA 3JU0A 1OAIA 4EIWA 3BGHA 1A1HA 5IT9S 2M7QA 3KSXA 2WBTA 2K6BA 4F54A 4RHBB 2E5LM 2DWNA 2IAEC 2K9DA 5JI2E 2ENAA 2CHGA 2WDEA 2EPPA 4JV5E 1IQOA 2JR1A 2EJSA 1QANA 3K9PA 4GHLA 4DV2M 4II7A 1OIZA 3HJQA 1LV7A 5KPZA 3RFWA 5DYIA 2LBCA 4JI3M 3W0FA 4LJAA 1L4SA 1DGFA 4PDGA 1XWIA 1R2ZA 2DENA 3TWKA 1QFCA 2LVPC 2L7HA 5BR8M 4NRWA 1XNQM 4G4RA 2EOHA 2MROB 2A5YB 2QBYB 1VEKA 3LMLA 4TUGA 1QU6A 3GP1A 1DV0A 3MHSC 2J5YA 1X47A 1MEYC 2DHYA 4F6MA 3J7Yp 1ZBTA 3L27A 4JYAE 3RE8A 4H2GA 2EL6A 1YUJA 2X49A 2UXCM 2OQ4A 2Z3XA 2LCEA 4J6OA 2V86A 2LH0A 5F3WA 4X8WA 3H63A 2XLJA 2HJJA 4LFAM 1TTEA 3FKEA 3EGGA 1A1JA 2A25A 1S70A 2QBYA 2B7TA 1HNXM 1HNWM 2K47A 3DF6A 1H6UA 4DV0M 3KDSE 4X62E 3HPSA 1N3GA 1IN7A 4RKUF 4B3SM 4JXJA 4JA9A 2V83A 4LJ7A 4DUZM 3RL4A 3T1YE 1PRBA 3CF6E 2LRSA 2V88A 1TN9A 1E9RA 2XFTA 4ZYDA 4WWLA 4DR3M 4DV1E 1QNTA 2R76A 3H69A 1O0WA 4DR1E 2OOAA 3QYEA 3TQMA 3FTEA 2JY9A 3C4TA 1T39A 3MHHC 1IXSB 2EUCA 4AG5A 2L3CA 4YHHM 2ZO9B 3KSJA 1IBMM 4ORCA 2JZ0A 4AG6A 3A98B 4G6ZA 1IN6A 2MC6A 3Q8XA 4DV1M 3NBIA 2VQEE 2EMCA 1BBGA 5ADZA 3DOAA 1QZEA 1W5SA 3KBPA 4MGKE 3DSCA 4LF4M 1HQCA 1A5TA 1NNUC 1RMDA 2GLIA 4S12A 3TWMA 3LCVB 2EMGA 1R2YA 5IWAE 2LUQA 3J80S 3QFKA 4NXMM 4DV0E 4KHPE 2MC5A 4AW4A 2YTPA 2I7NA 4WURA 4DR7M 4NHRA 4M9ZA 2EN3A 2EMZA 4DT2A 2DRPA 2DAIA 1E9SA 4L5NC 4WPYA 2RQLA 2DMYA 4LRTA 2JUJA 2CE7A 5KL6A 5A6KA 2R1FA 3UGJA 5LMNE 2UUCE 2QP9X 3KOYE 1GO5A 3IB8A 1Z6TA 1S3LA 5EXTA 2J7NA 1T43A 1J5EE 2YT4A 3HJ8A 2LVOC 3U61B 4ITQA 3ZC7B 3ZU0A 1FJGE 4XGIA 2BBGA 4IBGA 1AUAA 2HAKA 1XB2B 1R5LA 2O25A 4WFTA 5AC4A 4Q7FA 1TDHA 3IWDA 3GPYA 4X66E 1IBLE 4DR6E 2JY8A 2D7HA 2KKNA 4B2OA 1JK2A 1P3QQ 4L15A 3OTOM 3KOXE 1WRJA 2EA0A 2GHFA 3C9PA 1A1GA 1J7KA 4FBQA 3H60A 1ORYB 2ODRD 2MR9A 4AKHA 5FTLA 4B3TM 3GLGB 2R65A 2Z06A 4I4LA 3JTZA 1NNJA 1DGCA 2R6FA 3HU1A 3J27B 2O01F 3KS4A 1STUA 3GO8A 4RF0A 1QZMA 1D0LA 3H64A 4MOVA 4PD2A 1SXJB 4KBPA 2I7PA 1QYRA 4NOOB 3L29A 2PRTA 2RPCA 1YSYA 2DSYA 1LTMA 4R2EA 4NXNE 4OR9A 4ORBA 3J7AG 3HQ1A 1XXHA 2QPAA 2LXEA 4WXDA 1ZMUA 5E26A 4HEIA 1FJMA 2HYOA 2ENHA 3KW6A 3M0EA 4GZNC 2NUEA 3GLFB 3U6OA 1HP1A 1NEIA 3AJIB 2FH0A 1MU5A 2YSPA 3DSDA 2JNHA 1K3WA 4FD2A 3KZYA 2L4FA 2KRUA 2YTGA 4LF9M 4HL4A 3LLHA 4GIPA 2CPNA 4B3MM 1ZMWA 2EMAA 2KHHA 1ZBQA 3D8LA 4HLQA 4ZVZA 4JN6A 2LVQD 4WSGA 2VQFE 1YFHA 4JI1M 2FE8A 4FW9A 3K8ZA 1XMOM 3F92A 2Z4RA 5H37D 3W68A 3KFUG 5FTJA 3DJWA 3P71C 4NSOB 3AV0A 4FBWA 1N77A 1Q3CA 2EMFA 1K3XA 5FLXC 3ADJA 4DV4M 3GLFA 3GQ5A 3PNYA 2WZJA 4FWHA 1PJSA 2K7IA 1D0KA 3TE6A 2KEBA 4DR5M 5FLXS 2O5RA 3SAVA 3R9XB 2DB2A 2O8AA 1FNNA 2ZTDA 1X6EA 2GQFA 3J80C 4LU9A 4QOSA 2L3JA 2Q8UA 5AE3A 5B8IA 3W67A 1XMQM 4AI6A 1EH8A 2R4EA 2DLQA 2QENA 5EP3A 3FYCA 4FBKA 1A1KA 2FNAA 2ZAMA 2JVAA 2ZAOA 2XSZD 4JYAM 3T1HE 2YU5A 4LACC 4G3OA 2EN2A 3M99B 1FJGM 2EN7A 4R71A 2VF8A 4PT5A 4G4NA 2KRKA 4BB9A 2HCBA 4IBDA 2NPPC 1IMUA 2EM8A 4IBEA 1T3TA 4TUWA 3QG5C 5ITXE 2F5OA 2CV0A 4JI8E 4DV6M 4R2SA 4JI3E 1CUKA 4NL4H 4RF1A 4YHHE 2RS6A 4BCAA 5A6AA 1Q39A 2R62A 4MGHA 5ITQA 3SFZA 2DWZB 2L6MA 4LZZA 2WZOA 3A45A 4HTGA 5IZ7D 4GEWA 3EPKA 2EL4A 2CSHA 5IWAM 3NWLA 3ILKA 3RL5A 4L4UA 2DKLA 4P7DA 1WAO1 2R46A 1IXSA 2EPLX 4B7GA 3EIHA 3J81C 4LF4E 3J2PB 1DQ3A 2EPZA 2ENCA 5IOHA 4N4RB 3PFIA 1JQJC 4MGYE 2L92A 2YEQA 3C9FA 4FK5C 4CIZA 2NUGA 1HNWE 2G3QA 3SMSA 3E4RA 1IBME 4QHSA 3U6DA 4DR6M 3ZTVA 4LF8M 1QHWA 4OU7A 3U6PA 3FUTA 1ZR9A 1QAMA 2EO2A 3HU2A 1MGTA 3NBXX 4R8OA 4DKKA 2AHMA 1HPUA 4JI6M 1QAQA 3GRUA 3KP0E 4QOZC 1DO0A 3CTWB 3U60A 4GHAA 2V1UA 4IYPC 5C1VA 4D81A 2EOQA 1NHWC 4TUIA 3RL3A 2VF1A 1YPNA 2VDBB 3FRIA 3UJNA 3TWLA 3C4BA 2BWEA 4H2BA 4B7HA 2ZBMA 2J7OA 4KWYA 2JY6B 3EPHA 2FOIC 3MJ5A 1NV8A 2ZOAA 3T38A 1KJKA 4MGZE 2NYMC 4UT3B 3C5WC 1OQYA 1HNXE 4AQYM 2VE7C 4GKJE 4V0XA 3GPUA 1A1IA 2JOGA 1L2BA 1S3SA 4GC9A 4AQYE 3FLOA 1IQPA 1VG5A 2KZUA 2ELYA 2EPOA 2HHHM 2KXEA 4G4OA 5IXMB 4IBIA 5C18A 2JY5A 1SXJA 4DV4E 3DW8C 3HHZA 4X9JA 4RNAA 4KHPM 1J26A 1X5WA 1WJPA 1NCSA 5TSEA 1KYIA 1OKSA 1XNQE 4MLVA 3E21A 2QNJA 2KNZA 2MKDA 2UUAM 1OTRA 4UT2A 2M4IA 2JXPA 1PJJA 1V73A 3E7BA 4PDIA 5FSWA 1HT1E 4WSPA 2Z1AA 1RQ0A 1Z5AA 1ZAEA 2YSOA 2XSZA 3BOSA 2JP7A 1F2IG 5EQVA 3GQ3A 1WHCA 4Q7JA 1MF8A 2JZ1A 2LHCA 1Q02A 2UUAE 3I04M 4FCXA 2BWBA 2EN8A 3IHPA 3VLFB 2FGGA 4B3RM 3GLGA 4CISA 2DWLA 2WSCF 3K1JA 8CATA 1EKZA 4DUZE 4AKGA 1IN8A 3C3DA 2F5QA 1G8PA 4A3VB 1DI2A 2NA2A 3LVWA 2MKNA 4QNRA 4JI4M 2N3HA 3KZZA 1E94E 2DXIA 1DGBA 4L8NA 4L8RC 2KOUA 4V0WA 1RU3A 1Z59A 3MMPA 3LVVA 4AZFA 4LFCM 1N75A 3QWLA 2XF3A 4D82A 1IBLM 3AFHA 5DFLA 4ZPXA 5EP4A 2EKFA 1OFHA 2LO3A 4GC5A 3GLHA 1MN3A 2NABA 2YWQA 2MJ5B 4ANRA 3U5ZA 2QJCA 4F6NA 2YTQA 2EMYA 3QAUA 4HEOA 3T15A 3H4MA 1IBKM 3H68A 4O4KA 3BBGA 3B9PA 3GPXA 3KXEC 2C99A 2EM0A 3HKPA 4IS1C 2L8TA 4GRIA 2ELZA 1YZ9A 3KS8A 4MB7A 4M0VA 3OTOE 2LV2A 3IVEA 4K0KE 1OAOC 1XMQE 2ODRC 2F5NA 4LF8E 1BBOA 4JV5M 3GLIB 4DR5E 1DGGA 2JXNA 2L09A 1EH7A 2ZTCA 3FGAC 2JWOA 2LBSB 4O24A 3WHLA 3PVSA 3Q8GA 1L2DA 4R3DA 4WP2A 2YPNA 4F9CB 2RKOA 3IWCA 5JI3E 1WGNA 3FRHA 1X6HA 3FYDA 3U6EA 2UXBE 2ZM6E 4PCZA 4BBYA 4R2PA 4B3RE 2JWSA 2E1MA 2JYAA 4CJ6A 2EOXA 1UTEA 3KOZE 3SYLA 3OMLA 1IXRC 3IECA 3GLIA 2OPFA 2CHVA 1IY0A 2XEPA 1Q3BA 5LMNM 2UUCM 5KPRA 1I4WA 2VQFM 1X3CA 4LF7E 4BS9A 3TQSA 2EOMA 1HNZE 3HHWA 4MLQA 1NO1A 3EPLA 7CATA 1HR0M 1L1ZA 1T4NA 3EPJA 4OW0A 1TH2A 1K82A 1BB8A 2WBSA 4H2FA 4X64E 2UXDE 2RGOA 2EM4A 4R2RA 2I13A 4O5GA 3TPZA 4JI2M 3B7QA 2R4JA 4FCWA 3UK3C 4XK8F 3KP1E 2EMXA 1E32A 2BJVA 1GKIA 4DMIA 2VQEM 4R03A 1C1KA 4BMJA 4NXNM 2CHQA 1GL7A 2DLKA 2DXLA 3H61A 5C1BA 2BB8A 3CF2A 2QHOB 3MHVC 4ZYEA 4LJ5A 5ITTA 4DV6E 3TL4X 4JI8M 3ZOQB 3RQZA 3THGA 2QFPA 2EQ0A 5EXXA 2LNHC 3SAUA 2H5XA 4DR3E 5ITUA 4MM3B 4ORAA 2RSMA 3J7BA 3K6QA 4MP0A 3JYFA 3SC3A 2V8QB 2LJHA 1DGHA 2EOSA 1WHQA 1PJTA 3HXLA 2L2NA 3L28A 4IJFA 2CV2A 2YTJA 2APLA 4JI6E 1VEJA 3B74A 5KL4A 3M7GA 2QQ8A 2MDRA 2KW0A 2YVTA 4IBFA 1GVNA 1UF3A 2NXFA 1NHGC 2LT7A 2NYLC 3E46A 2HC5A 3N5UA 2DHRA 1YYOA 1XXHE 2QZ4A 3SHGB 5KL7A 3SAWA 4B3ME 1NV9A 2F8BA 3B89A 4MOYA 1JR3E 5EQTA 4V0VA 4JI5E 3GLHB 3LCUA 2EM9A 2EQ3A 2USHA 4LJ4A 2EPMX 4JI0E 1YUBA 2EM6A 4Y28F 5A6JA 3SARA 3M6AA 2Q2EB 4I5NC 1T6OA 4KT0F 1BVSA 2KNVA 1V92A 4MH0E 2CWBA 1EH6A 1QUSA 1D2NA 2IE3C 1IY2A 3I4YA 5BR8E 3RGSA 4YY3M 2JOBA 4M9SA 3J81S 2L6OA 1OIEA 4LF5E 2X4AA 1AH5A 4OX9M 1L2CA 3QFNA 5L8RF 1JR3A 1WIVA 4H2IA 2EPAA 4LZJA 2CV9A 2V87A 2RRUA 3H67A 4JI4E 3GRYA 4WW0A 1Z2WA 1XM7A 1Z5BA 3ADIA 1S95A 2V6ZM 2BNKA 1SR9A 4LJ9A 4LGMA 2EWLA 2VRDA 1WARA 4KLNA 2B3TA 1QDRA 1SU1A 2L7IA 3VKHA 4F2LA 3KOWE 4WYQB 1TGUA 3T1IA 3HHYA 4JI2E 4LRSA 3CF0A 4KO8A 4R2CA 2DAKA 1DGHB 2MGWA 2ADRA 3FUWA 1XZWA 1UBDC 2JP9A 5A2QS 1N32E 4NSRA 4B7FA 2BQ8X 2YTNA 3A46A 1HR0E 3ICFA 1S3MA 4Z6YA 4LGYA 1IFYA 1ZAAC 4DV5E 1SXJE 2B9DA 2C98A 2FV4B 5EXSA 2EPXA 1AIPC 5LL6R 3RGPA 2RSIA 1UM8A 1MJGM 2LJUA 3ZCBB 1X49A 3HZJA 1S3NA 4JI0M 4DR2M 1TH3A 2EORA 3KVWA 3PSNA 4XPNA 4X65E 3CK2A 2CTDA 1Z5CA 1G59A 3JR5A 1N33M 2EMIA 1G2FC 4X62M 2BDXA 4IBBA 2EPCA 4OOGC 2ZBKB 3K7VC 2OOBA 5CFFE 1PKPA 2EN4A 4JA7A 3ADLA 1TF6A 4F9BB 2E72A 2F5PA 4K0KM 2EM2A 4LFAE 4LF9E 1EE8A 2M9AA 2EL5A 2HGHA 4DUYM 2R45A 2LWXA 3VK7A 1I94E 3H4JA 4LY6A 1ZV1A 1XNRM 1IM2A 3ZQJA 3U61A 3GLIE 4UN2B 4QNMA 2YU8A 2V1CA 3SATA 4RH8A 1SG9A 4DV3M 4G4QA 2YTOA 1VEGA 2KZSA 2R18A 3EGHA 2WSFF 4I5LC 2B3TB 4DV2E 1WXRA 5LLQA 3GPPA 3SYKA 2EQ1A 1NJFA 1Z2XA 3BBZA 3L2AA 1WR1B 2VIIA 4JI7E 1QDTA 1NJGA 1N34E 1HJPA 4LJ6A 4XBOA 2DIXA 2EJ4A 4DR7E 4KZSA 2M60A 4NC6A 2F4VE 2YZTA 1QQWA 5KL5A 2CP8A 3SBJA 4FCVA 2EKKA 3L25A 2L4EA 3FTDA 3E0JA 2LHGA 2C5RA 3GLGE 3LMMA 2H36X 2HYPA 2EOEA 1GJSA 5AE1A 2H1RA 1S8EA 1Z1BA 1IN4A 3H62B 4P78A 1IY1A 3H09A 3F6HA 1PDAA 2RS7A 1R7RA 1U32A 1WHNA 3LL8A 1N78A 4DV5M 1TR8A 2JOXA 4JI7M 3A42A 4X66M 3HJSA 3D8BA 1G71A 2QSFX 2YTEA 5DNYA
chains in the Genus database with same CATH topology
3AJIB 3AOEC 3FYDA 3U6EA 5T6JA 2UXCE 5JJTA 1XXHB 5EJCA 2UXBE 2YFQA 2ZM6E 4PCZA 4M30A 4BBYA 3JAMC 4B3RE 1MU5A 2E1MA 3ADGA 3DSDA 1K3WA 4FD2A 1XC8A 1HO5A 4LFCE 2KRUA 4FWDA 3VFDA 1XHBA 3KOZE 4DV7M 4LF9M 4HL4A 3SYLA 3LLHA 3OMLA 1IXRC 4M0DA 4GIPA 2CPNA 4B3MM 3JAMS 3K92A 3GQ4A 3E9SA 3RMPA 4GKJM 1OI8A 2F5SA 3GLIA 1GLNA 2OPFA 1ZBQA 3HPZA 2CHVA 3D8LA 1IY0A 2D7GA 2XFSA 4HLQA 5KQ8A 3U6QA 5FTNA 2LMZA 4JN6A 1N33E 3H66A 4ZVZA 2VQFE 1J5EM 4X65M 2LUPB 2XEPA 4JI1M 2FE8A 1Q3BA 2M5ZA 5LMNM 5EP2A 3LQQA 2UUCM 5KPRA 1I4WA 4FW9A 2VQFM 4QHTA 4LF7E 3GVEA 4NXME 5A2QC 1JR3D 3K8ZA 4OVZB 4BS9A 3TQSA 1XMOM 1HNZE 1USHA 3HHWA 3SHFA 2JA2A 2DZOB 2Z4RA 7CATA 5H37D 1HR0M 1L1ZA 3P1XA 1IBKE 2DVWB 2HHHE 3IVDA 3KFUG 4F0ZA 5FTJA 1T4NA 4MGIE 4I5SA 4OW0A 1TH2A 3VKGA 3DJWA 4DUYE 1K82A 4R7GA 4DV7E 3KWRA 2P6BA 3E7AA 3FTFA 3P71C 3C58A 3QFOA 1N36M 4H2FA 4X64E 2FTXB 1NY5A 2UXDE 4NSOB 5FTKA 1N36E 2RGOA 2Z72A 3AV0A 1PJIA 2RGHA 5AASA 4FBWA 1PM5A 3U6CA 4O5GA 5EXPA 3DA1A 2E5LE 4BC7A 3TPZA 1QAOA 1N77A 5KPTA 4JI2M 4LF6M 1Q3CA 3FUVA 3UK6A 3VYYA 2R4JA 4FCWA 4J8ZA 4I81A 2LTSA 3AOEA 2YNMD 1K3XA 4GEQB 3GRVA 3FD9A 5FLXC 3ADJA 3KP1E 4DV4M 4LF5M 3GLFA 3GQ5A 3PNYA 1DO2A 1E32A 4FWHA 2V85A 3THOB 4DR1M 2BJVA 5IREB 2V89A 3THNA 3TE6A 3FUXA 1NY6A 2KEBA 4DR5M 1GKIA 3MSWA 4DR2E 5FLXS 2O5RA 3SAVA 3R9XB 5ITYA 2DB2A 1G5BA 4HD0A 2Y0QA 4P16A 4DMIA 2O8AA 2DZNB 1FNNA 2VQEM 1GQEA 3AUZA 3PNVA 4REZA 4L78A 3J80C 1SXJC 3U5ZB 4DSYA 4R03A 4LU9A 5ITRA 1C1KA 4QOSA 4BMJA 5DYGA 2L3JA 4NXNM 2Q8UA 2DFJA 4Q28A 4GKKE 5AE3A 5B8IA 2D7EA 1T71A 2CHQA 2CUZA 1HT2E 1XMQM 2R4EA 4AI6A 5GTUA 1X48A 1GL7A 1R6BX 2DXLA 3H61A 4H1SA 2CFOA 1GL6A 2QENA 3FYCA 5EP3A 4FCTA 5C1BA 3SMPA 4FBKA 4V0XA 1G4AE 2FNAA 2X8AA 2ZAMA 4GITA 2JVAA 4KODA 2B7VA 2A22A 3CF2A 2ZAOA 2XSZD 3MHVC 4IIWA 2KA6B 3L26A 3UZUA 4JI5M 4JYAM 3T1HE 4LJ5A 5ITTA 4LACC 1IXZA 1T4OA 2WDFA 4DV6E 3U6MA 1J09A 3TL4X 4JI8M 2F4VM 3AOGA 1FJGM 3ZOQB 1TCOA 3RQZA 3THGA 3PXGA 2QFPA 4PT5A 1RC7A 4G4NA 2KRKA 5EXXA 3JU0A 4BB9A 2LNHC 1IN5A 4EIWA 3SAUA 2HCBA 1YYWA 5IT9S 1T4LB 5BPVA 4DR3E 2M7QA 3KSXA 5ITUA 4IBDA 4Z8XA 3QFMA 4F54A 2NPPC 4MM3B 4ORAA 2RSMA 3J7BA 2E5LM 3K6QA 4GH9A 2DWNA 1AUIA 2IAEC 4MP0A 3PSOA 4IJEA 5JPFA 4IBEA 5JI2E 3SC3A 2V8QB 3JYFA 1T3TA 1OFIA 2CHGA 4TUWA 2LJHA 2WDEA 4JV5E 3QG5C 5ITXE 2F5OA 2CV0A 4JI8E 1FKAE 1DGHA 4DV6M 1VDDA 2JR1A 2L33A 1QANA 4GHLA 1WHQA 3HXLA 4DV2M 4II7A 3HJQA 2L2NA 1LV7A 3L28A 4IJFA 5KPZA 3T1YM 4JI3E 2CV2A 4NL4H 3RFWA 2FFJA 4RF1A 5DYIA 4YHHE 2RS6A 2QCUA 4JI3M 2W82A 4BCAA 3W0FA 4LJAA 1Q39A 2R62A 4MGHA 5ITQA 1DGFA 4B3SE 4JI6E 4PDGA 3FTCA 2G8LA 3SFZA 3M7GA 1XWIA 2DWZB 1R2ZA 4LZZA 3TWKA 2KW0A 3A45A 2L6MA 2LE2A 2MDRA 2L7HA 2Z4SA 5BR8M 4IBFA 4NRWA 1XNQM 4BC9A 1GVNA 5IZ7D 1UF3A 2NXFA 4G4RA 1NHGC 3IB7A 2NYLC 2A5YB 1X37A 2QBYB 3N5UA 2DHRA 3LMLA 1YYOA 2QZ4A 4TUGA 1QU6A 3GP1A 3SHGB 1WXQA 2YQZA 3SAWA 1UILA 4B3ME 5IWAM 3NWLA 3ILKA 3RL5A 4L4UA 1G3IA 1X47A 4P7DA 2F8BA 1WAO1 2R46A 4B08A 3J7Yp 4MOYA 5EQTA 1ZBTA 4V0VA 3L27A 4JI5E 3RE8A 4JYAE 4H2GA 3GLHB 4B7GA 3EIHA 3J81C 2X49A 3VYXA 2G5GX 2UXCM 4LF4E 3J2PB 2OQ4A 1N32M 1DQ3A 2USHA 4LJ4A 4JI0E 1YUBA 2Z3XA 4OX9E 5IOHA 3PFIA 4GMQA 3SARA 3M6AA 4J6OA 4IBKA 2Q2EB 2V86A 4I5NC 1JQJC 2LH0A 4MGYE 2KONA 2L92A 3AKZA 5F3WA 2BJWA 4X8WA 2YEQA 2KHXA 2NUGA 3LQRA 3C9FA 5ITXA 3H63A 2XLJA 4MH0E 2WDDA 4LFAM 3FKEA 1HNWE 3I4VA 3EGGA 1D2NA 3E4RA 3SMSA 1S70A 3HWSA 2IE3C 1IY2A 2QBYA 2B7TA 1HNXM 1IBME 3I4YA 3U60B 2UU9E 5BR8E 1HNWM 1KFVA 2K47A 4QHSA 3U6DA 4DR6M 3RGSA 4YY3M 2JOBA 4M9SA 3DF6A 3FIGA 1H6UA 3J81S 3ZTVA 4LF8M 1QHWA 2L6OA 3KDSE 4OU7A 4DV0M 3U6PA 3FUTA 4X62E 1QAMA 2EO2A 3HU2A 1OIEA 4LF5E 3HPSA 5EP1A 4R8OA 4DKKA 2UUBE 1UTEA 2AHMA 2X4AA 1HPUA 1IN7A 2NQ8C 4OX9M 4B3SM 4JI6M 4ZX2A 1L2CA 1QAQA 1I94M 3QFNA 3T1HM 4JXJA 4JA9A 2YR0A 1JR3A 3GRUA 4LJ7A 4DUZM 3KP0E 4QOZC 2V83A 3T1YE 3RL4A 3CF6E 2LRSA 4H2IA 2V88A 2CV1A 2N3GA 1DO0A 3CTWB 1E9RA 2XFTA 4LZJA 3U60A 2NUFA 4GHAA 4X64M 2UXDM 2V1UA 2CV9A 2V87A 4IYPC 4D81A 4WWLA 3H67A 5C1VA 3EIEA 1NHWC 4DR3M 4TUIA 2XGNA 4FWGA 4DV1E 5KQDA 2VF1A 3RL3A 1TDZA 2HY1A 4JI4E 3UJNA 3GRYA 3TWLA 4WW0A 1Z2WA 3H69A 3C4BA 4IL1A 2P5TA 4F9AB 1O0WA 1Z5BA 3ADIA 1XM7A 4H2BA 1S95A 4DR1E 4B7HA 2V6ZM 2HL7A 2ZBMA 2BNKA 2Y20A 2XZFA 2J7OA 4LJ9A 1SR9A 4LGMA 2EWLA 1WARA 3FTEA 4M0WA 2JY9A 2ZANA 4LF7M 2IHR1 3C4TA 2BCDA 4KLNA 2FOIC 3MJ5A 1IXSB 2ZOAA 2EUCA 3GRRA 3T38A 4NRVA 4AG5A 3VK6A 2L3CA 1JK7A 4MGZE 4YHHM 2M1SA 1SU1A 2NYMC 3KSJA 2XH9A 2ZO9B 3C5WC 1IBMM 2L7IA 1HNXE 4ORCA 4UT3B 4AG6A 3VKHA 3KOWE 4WYQB 4AQYM 3A98B 4G6ZA 1TGUA 3GPUA 2VE7C 4GKJE 2JOGA 1IN6A 4M9XA 3HHYA 1S3SA 1L2BA 4H1YP 2MC6A 4JI2E 3T1IA 4GC9A 3Q8XA 4LRSA 5AE2A 2Z7JA 3CF0A 4KO8A 4DV1M 4AQYE 2IE4C 3NBIA 2VQEE 4D80A 3FLOA 4L16A 1DGHB 1IQPA 5ADZA 3TGHA 3DOAA 2KZUA 3FUWA 3IG5A 1XZWA 2HHHM 1OJLA 2UXBM 1W5SA 3KBPA 4MGKE 3DSCA 2KXEA 5A2QS 4NSRA 4G4OA 4B7FA 1N32E 4LF4M 4IBIA 1HQCA 1XMOE 1W5TA 3IG8A 5C18A 2BQ8X 5JPEA 1NNUC 1SXJA 2C96A 4W5WA 4S12A 3HHZA 3A46A 3TWMA 4DV4E 1HR0E 3DW8C 3ICFA 4RNAA 4UWQA 3SASA 4JI1E 1S3MA 4Z6YA 4LGYA 4KHPM 1J26A 1R2YA 5IWAE 2LUQA 3J80S 1QVRA 3QFKA 4NXMM 4DV5E 4IBJA 3FUUA 1SXJE 4DV0E 4KHPE 2MC5A 4DR4M 2B9DA 2HKJA 2C98A 3W0LB 4AW4A 4G9JA 2I7NA 4WURA 2XZUA 2FV4B 4LF6E 4DR7M 5EXSA 4M9ZA 4DHLA 1KYIA 1XNQE 5LL6R 4DT2A 4LCBA 3MK6A 1YYKA 1E9SA 3RGPA 3VDPA 4FVMA 4L5NC 4M2ZA 4WPYA 3U6LA 4LFBE 2DMYA 4LJ8A 1UM8A 4LRTA 2DWMA 2UUAM 2RTXA 2M4IA 4FBQA 4UT2A 1PJJA 1V73A 2CE7A 3ZCBB 4PDIA 5FSWA 1X49A 5E6JA 1HT1E 3E7BA 4WSPA 3IWBA 2Z1AA 1S3NA 4JI0M 4DR2M 1TH3A 1W24A 1RQ0A 1Z5AA 1ZAEA 2WDCA 3KVWA 2YVTA 3UGJA 5LMNE 2UUCE 1UHZA 3PSNA 4XPNA 2QP9X 3JR4A 4X65E 3KOYE 2UUBM 5FTMA 2XSZA 3CK2A 1Z5CA 1G59A 3BOSA 3IB8A 3JR5A 1Z6TA 1N33M 2LTRA 5LMUE 1S3LA 5EQVA 5EXTA 4X62M 4IBBA 2BDXA 2J7NA 4CGYB 4OOGC 4KKZA 3GQ3A 1J5EE 2ZBKB 5KO3A 2YT4A 3K7VC 1MF8A 2Y21A 3HJ8A 3HU3A 5CFFE 2UU9M 1PKPA 4LTYA 3U61B 5J28A 4JA7A 4I8OA 3ADLA 4ITQA 3ZC7B 2UUAE 4F9BB 4I5LC 3ZU0A 2C9CA 2F5PA 4K0KM 4LFAE 1FJGE 3U6SA 4FCXA 4LF9E 1EE8A 4XGIA 2EZ6A 3K7WC 3VLFB 4IBGA 2FGGA 1L1TA 4DUYM 3I51A 1KSFX 1KBPA 2R45A 2AHDA 2XMOA 4B3RM 2LWXA 3GLGA 4LG2A 4CISA 3DFZA 2DWLA 3K1JA 3VK7A 1YE9A 4WFTA 3J7AS 1I94E 8CATA 1EKZA 4Q7FA 4LY6A 2GJUA 4DUZE 1TDHA 4AKGA 1IN8A 2F5QA 3IWDA 1II7A 2L2KB 3GPYA 1XNRM 1IM2A 3HVQA 1G8PA 3AL0C 4X66E 3U61A 4OVZA 4A3VB 1IBLE 1DI2A 4DR6E 2CEAA 2NA2A 3LVWA 2D7HA 4QNRA 2KKNA 4B2OA 4JI4M 2N3HA 1E94E 4QNMA 1DGBA 2DXIA 4L8NA 4L8RC 2KOUA 2V1CA 3SATA 4YY3E 1IT6A 4NZVA 4V0WA 4BLCA 1Z59A 4DV3M 4G4QA 4L15A 3OTOM 1G41A 3KOXE 3LVVA 1SXJD 2KZSA 2R18A 4AZFA 2EA0A 5LMUM 4LFCM 3EGHA 5INBA 1TH4A 1N75A 4UT3A 3QWLA 1J7KA 2XF3A 4D82A 3AFHA 1IBLM 2B3TB 1ORYB 4ZPXA 2ZM6M 2ODRD 5EP4A 4B3TE 3H60A 4AKHA 1OFHA 4DV2E 1WXRA 1XNRE 5FTLA 2K4VA 4GC5A 3GPPA 2G7HA 2L2MA 3GLHA 4B3TM 3SYKA 3GLGB 1OIDA 2QFRA 1NJFA 2R65A 1L8QA 1Z2XA 3L2AA 2VIIA 2Z06A 4JI7E 4I4LA 3JTZA 4LFBM 2O8GA 3VDUA 3U5ZA 1NNJA 1NJGA 2QJCA 3F6GA 3J27B 3HU1A 1N34E 4YKEA 5HPEA 4LJ6A 4XBOA 2DIXA 3KS4A 1STUA 3GO8A 3QAUA 3T15A 1N34M 4DR7E 4RF0A 1HQYE 3D03A 4KZSA 2M60A 3VK8A 3R8FA 3H4MA 1IBKM 2F4VE 3H68A 1QZMA 4O4KA 2YZTA 3B9PA 3GPXA 4DR4E 3H64A 1HNZM 2WZOA 3KXEC 2C99A 1QQWA 3HKPA 4CHTB 4MOVA 4AKIA 4PD2A 5GKNA 3ZH9B 1SXJB 4KBPA 3HHXA 3SBJA 2I7PA 2L8TA 4FCVA 1MX0A 3L25A 1QYRA 4NOOB 2C9OA 4IBCA 3L29A 4GRIA 1GZ6A 3FTDA 1YZ9A 1YSYA 2Y0TA 2DSYA 3E0JA 4GKKM 3K2LA 2C5RA 1ZQ9A 3KS8A 4NXNE 3LMMA 2H36X 4OR9A 4ORBA 4MB7A 4M0VA 3OTOE 3IVEA 2HYPA 3J7AG 4DV3E 4K0KE 1XMQE 3HQ1A 5AE1A 2ERCA 2ODRC 1XXHA 2QPAA 2F5NA 2H1RA 1S8EA 1IN4A 4LF8E 1NVMA 4P78A 1IY1A 2LXEA 3H09A 3H62B 3F6HA 4JV5M 3HTXA 1NNWA 3GLIB 4DR5E 1DGGA 5E26A 2RS7A 2L09A 3V4YA 3HGIA 3FGAC 1FJMA 4O43A 1R7RA 2JWOA 1U32A 1WHNA 2LBSB 1N78A 3LL8A 4DV5M 4O24A 3WHLA 3PVSA 2HYOA 3UMMA 1M63A 3KW6A 1L2DA 4R3DA 2JOXA 4JI7M 3A42A 4X66M 3HJSA 3WHKA 1NSFA 3M0EA 4F9CB 3D8BA 1QFCA 2NUEA 3GLFB 4BBAA 3U6OA 2DXNA 2RKOA 5IT9C 2R17A 3IWCA 1HP1A 5JI3E 5DNYA 1T70A 3DZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2W A;  3H69 A;  4IL1 A;  1XM7 A;  5JJT A;  4H2B A;  3QFM A;  1S95 A;  4Q7F A;  2NPP C;  2GJU A;  4ORA A;  2ZBM A;  5JPF A;  2IAE C;  1AUI A;  4MP0 A;  1II7 A;  1HO5 A;  3PSO A;  3DSD A;  1WAR A;  3HVQ A;  3JYF A;  1UTE A;  2WDE A;  3QG5 C;  2BCD A;  1JK7 A;  1OI8 A;  1SU1 A;  2KKN A;  2NYM C;  4B2O A;  4UT3 B;  3C5W C;  4ORC A;  4ZVZ A;  3H66 A;  4NZV A;  1IT6 A;  4V0X A;  4H1Y P;  4V0W A;  2JOG A;  3T1I A;  3GVE A;  5INB A;  2IE4 C;  1QFC A;  3EGH A;  2YVT A;  4F0Z A;  3TGH A;  4FBQ A;  4I5L C;  3H60 A;  1UF3 A;  1USH A;  2NXF A;  1XZW A;  3IB7 A;  3KBP A;  3DSC A;  2NYL C;  3IVD A;  3N5U A;  2BQ8 X;  4TUG A;  5JPE A;  1OID A;  2P6B A;  2QFR A;  4UT3 A;  3P71 C;  1Z2X A;  3DW8 C;  3E7A A;  3QFO A;  3ICF A;  4UWQ A;  2Z06 A;  4H2F A;  3RL5 A;  1S3M A;  2O8G A;  1WAO 1;  2Z72 A;  3AV0 A;  3QFK A;  4FBW A;  2QJC A;  4MOY A;  4V0V A;  4YKE A;  4H2G A;  4O5G A;  5HPE A;  4G9J A;  3H68 A;  2USH A;  4O4K A;  5IOH A;  4DHL A;  3H64 A;  4J6O A;  4I5N C;  4DT2 A;  5F3W A;  3H63 A;  4MOV A;  3C9F A;  4KBP A;  3THO B;  2WDD A;  3THN A;  4UT2 A;  4HD0 A;  1V73 A;  3E7B A;  3EGG A;  1G5B A;  2IE3 C;  1S70 A;  2O8A A;  2Z1A A;  1S3N A;  3AUZ A;  1W24 A;  2WDC A;  4ORB A;  4OR9 A;  4DSY A;  3PSN A;  4M0V A;  3IVE A;  4XPN A;  4LU9 A;  1QHW A;  2HYP A;  3ZTV A;  2Q8U A;  3CK2 A;  2DFJ A;  3IB8 A;  5B8I A;  1OIE A;  1T71 A;  1S8E A;  1S3L A;  5EQV A;  2BDX A;  5GTU A;  1HPU A;  3H62 B;  4KKZ A;  4ZX2 A;  1NNW A;  3K7V C;  3H61 A;  4H1S A;  1MF8 A;  3QFN A;  4FBK A;  3V4Y A;  4JA9 A;  3FGA C;  3RL4 A;  2A22 A;  1FJM A;  4LTY A;  4O43 A;  1U32 A;  3LL8 A;  4O24 A;  5J28 A;  4JA7 A;  4H2I A;  2HYO A;  3ZU0 A;  1M63 A;  4LAC C;  2WDF A;  4FCX A;  4WWL A;  2CV9 A;  5C1V A;  3K7W C;  4IYP C;  1TCO A;  3H67 A;  3RQZ A;  4TUI A;  2QFP A;  1KBP A;  3RL3 A;  2AHD A;  2R17 A;  2XMO A;  1HP1 A;  2HY1 A;  5DNY A;  1T70 A; 
#chains in the Genus database with same CATH topology
 5T6J A;  2UXC E;  5JJT A;  1GJT A;  3ADG A;  3VFD A;  3K92 A;  3RMP A;  2YTD A;  2EML A;  5FTN A;  1J5E M;  2EMK A;  3IWB A;  5EP2 A;  3LQQ A;  3GVE A;  4QHT A;  3SHF A;  2JA2 A;  2EOF A;  3P1X A;  2DVW B;  2HHH E;  2DAG A;  4I5S A;  3VKG A;  4DV7 E;  2P6B A;  4DUY E;  1UFZ A;  3QFO A;  3FTF A;  3C58 A;  1N36 M;  1NY5 A;  1N36 E;  1PJI A;  5AAS A;  1PM5 A;  3U6C A;  2K0B X;  2LVH A;  2E5L E;  5KPT A;  3FUV A;  3UK6 A;  3VYY A;  4I81 A;  4GEQ B;  3GRV A;  4ZYG A;  3FD9 A;  4LF5 M;  1DO2 A;  2V89 A;  5AC5 A;  3FUX A;  3BID A;  3MSW A;  4DR2 E;  1TF3 A;  5ITY A;  2Y0Q A;  2KNA A;  4P16 A;  2DZN B;  5A69 A;  1UN6 B;  3PNV A;  4L78 A;  4DSY A;  5ITR A;  1IQS A;  1WJ7 A;  2N8X A;  2DFJ A;  2LVA A;  4Q28 A;  4GKK E;  2CUZ A;  1HT2 E;  1X48 A;  1R6B X;  1T38 A;  2CFO A;  1GL6 A;  4FCT A;  3SMP A;  4KOD A;  2A22 A;  3L26 A;  4IIW A;  4JI5 M;  2KA6 B;  1IXZ A;  1J09 A;  2EOJ A;  2JY7 A;  1RC7 A;  1IN5 A;  2EMB A;  1YYW A;  1T4L B;  5BPV A;  4Z8X A;  3QFM A;  4L6V 6;  5JPF A;  4GH9 A;  1AUI A;  4DBG B;  4IJE A;  3PSO A;  1OFI A;  1FKA E;  1VDD A;  2L33 A;  2EM7 A;  3T1Y M;  5KL3 A;  1V33 A;  2FFJ A;  2KDL A;  2QCU A;  2W82 A;  4B3S E;  3FTC A;  2G8L A;  4F0Z A;  4BC9 A;  2LE2 A;  2Z4S A;  3IB7 A;  1X37 A;  1WXQ A;  2YQZ A;  1UIL A;  2MDG A;  1G3I A;  3L00 A;  4B08 A;  3VYX A;  3ECR A;  2G5G X;  3GLH E;  1N32 M;  4OX9 E;  4GMQ A;  4IBK A;  2KON A;  3AKZ A;  2BJW A;  2KHX A;  3LQR A;  5ITX A;  2WDD A;  3I4V A;  2L2D A;  3HWS A;  3U60 B;  2UU9 E;  1YSA C;  1KFV A;  3FIG A;  3LW5 F;  2I9I A;  1ZMV A;  3QYB A;  5EP1 A;  2UUB E;  2EM3 A;  2YTF A;  2NQ8 C;  4ZX2 A;  1I94 M;  3T1H M;  3BF2 A;  1Y8G A;  2YR0 A;  2YRM A;  2CV1 A;  2N3G A;  2NUF A;  4X64 M;  2UXD M;  3EIE A;  2XGN A;  4FWG A;  5KQD A;  1TDZ A;  1GAB A;  2HY1 A;  4IL1 A;  2P5T A;  4F9A B;  2HL7 A;  2Y20 A;  2XZF A;  4M0W A;  2DAM A;  2LTU A;  2ZAN A;  4LF7 M;  2IHR 1;  2BCD A;  1AAY A;  3GRR A;  3VK6 A;  4NRV A;  1JK7 A;  2M1S A;  2XH9 A;  5KL2 A;  3C3E A;  4H1Y P;  4M9X A;  5AE2 A;  2Z7J A;  2EE8 A;  2IE4 C;  4D80 A;  3TGH A;  4L16 A;  3IG5 A;  1OJL A;  2UXB M;  4F2J C;  2LVN C;  1XMO E;  1W5T A;  3IG8 A;  5JPE A;  2C96 A;  4W5W A;  4UWQ A;  3HY5 A;  3SAS A;  2DMI A;  4JI1 E;  1QVR A;  3K9O A;  2GPI A;  2YRK A;  4IBJ A;  3FUU A;  4DR4 M;  2HKJ A;  3W0L B;  4G9J A;  1OIP A;  2XZU A;  4LF6 E;  2J7J A;  4DHL A;  1G2D C;  1D0M A;  2WBU A;  4LCB A;  3MK6 A;  3B7N A;  2EPR A;  1YYK A;  4M2Z A;  3VDP A;  4FVM A;  2CRU A;  3U6L A;  2EN6 A;  4LFB E;  2EOZ A;  4LJ8 A;  2DWM A;  2RTX A;  3T6P A;  5E6J A;  2DAE A;  2MH8 A;  3BXW A;  1W24 A;  2WDC A;  1UHZ A;  3JR4 A;  2UUB M;  5FTM A;  5LMU E;  2LTR A;  4CGY B;  4KKZ A;  4P17 A;  5KO3 A;  5IV8 B;  2Y21 A;  3HU3 A;  2UU9 M;  1LLM C;  4LTY A;  2EP3 A;  5J28 A;  4I8O A;  4IJD A;  2C9C A;  2DI0 A;  2EOY A;  3U6S A;  2EZ6 A;  3K7W C;  3EQ1 A;  3C6M A;  1L1T A;  3I51 A;  1KSF X;  1KBP A;  2AHD A;  2XMO A;  4LG2 A;  2EOO A;  3DFZ A;  1YE9 A;  1GTK A;  3J7A S;  2DGC A;  2GJU A;  1X6F A;  1II7 A;  2L2K B;  3HVQ A;  2HWJ A;  3AL0 C;  4OVZ A;  1TF0 B;  2CEA A;  2WCC 3;  4R2A A;  5A6B D;  4Q35 B;  4YY3 E;  4NZV A;  1IT6 A;  4BLC A;  4F1I A;  1G41 A;  3CGW A;  1SXJ D;  1VQ1 A;  5INB A;  5LMU M;  1TH4 A;  4B3T E;  2ZM6 M;  1B69 A;  3V76 A;  4R2Q A;  1XNR E;  2K4V A;  2L2M A;  2G7H A;  1OID A;  2QFR A;  1YUI A;  3FE3 A;  1L8Q A;  2YRH A;  4LFB M;  1EFU B;  2O8G A;  3VDU A;  3F6G A;  4YKE A;  5HPE A;  1N34 M;  3D03 A;  2EMH A;  1HQY E;  3VK8 A;  3R8F A;  1VDL A;  4DR4 E;  1HNZ M;  2DZL A;  4CHT B;  4AKI A;  5GKN A;  1PGY A;  3ZH9 B;  3HHX A;  1JB0 F;  1MX0 A;  1QUT A;  2FS1 A;  2C9O A;  4IBC A;  1R4G A;  1GZ6 A;  4M9V C;  2Y0T A;  2R0I A;  4GKK M;  3K2L A;  1ZQ9 A;  4DV3 E;  2GNO A;  2ERC A;  2JPA A;  1NVM A;  2EMW A;  2EPU A;  1YLA A;  1C7Y A;  1NNW A;  3HTX A;  3VHT B;  3V4Y A;  3HGI A;  2R44 A;  4O43 A;  4WX9 A;  3UMM A;  2EPN A;  1M63 A;  1V34 A;  3GLF E;  2EM5 A;  3WHK A;  1NSF A;  2EPK X;  4BBA A;  2DXN A;  5IT9 C;  2R17 A;  1T70 A;  3DZD A;  3AOE C;  1XXH B;  5EJC A;  2YFQ A;  4M30 A;  3JAM C;  1XC8 A;  1HO5 A;  4LFC E;  3HX3 A;  4FWD A;  4DV7 M;  1A1F A;  1XHB A;  5A6B A;  4M0D A;  4ZYH A;  3JAM S;  3GQ4 A;  2CT1 A;  1PJQ A;  3E9S A;  4GKJ M;  1OI8 A;  2F5S A;  1GLN A;  3HPZ A;  2D7G A;  2XFS A;  3U6Q A;  5KQ8 A;  1KYQ A;  2LMZ A;  1N33 E;  2OO9 A;  3H66 A;  4X65 M;  2LUP B;  2M5Z A;  1EIJ A;  4NXM E;  5A2Q C;  1WGL A;  1JR3 D;  4OVZ B;  2EN1 A;  1USH A;  4R2D A;  2DZO B;  1IBK E;  3IVD A;  4MGI E;  2EOI A;  4UT3 A;  4R7G A;  3KWR A;  3E7A A;  4BHB A;  2FTX B;  2YTI A;  1ZU1 A;  5FTK A;  2Z72 A;  2DNA A;  2RGH A;  5EXP A;  3DA1 A;  4BC7 A;  1JK1 A;  1QAO A;  3B7Z A;  4LF6 M;  4J8Z A;  2LTS A;  1SFE A;  3AOE A;  2YNM D;  1P47 A;  2Z8Y M;  1F4I A;  2V85 A;  3THO B;  4DR1 M;  5IRE B;  3THN A;  1NY6 A;  4HD0 A;  1G5B A;  2VF7 A;  4WXC A;  2N35 A;  2D9H A;  1GQE A;  3AUZ A;  4REZ A;  1SXJ C;  3U5Z B;  2WSE F;  3I01 M;  5DYG A;  1A1L A;  2D7E A;  1T71 A;  4BHC A;  5GTU A;  4H1S A;  1G4A E;  2X8A A;  4GIT A;  2B7V A;  3UZU A;  1T4O A;  2WDF A;  3U6M A;  2F4V M;  3AOG A;  1TCO A;  3PXG A;  3C6K A;  3JU0 A;  1OAI A;  4EIW A;  3BGH A;  1A1H A;  5IT9 S;  2M7Q A;  3KSX A;  2WBT A;  2K6B A;  4F54 A;  4RHB B;  2E5L M;  2DWN A;  2IAE C;  2K9D A;  5JI2 E;  2ENA A;  2CHG A;  2WDE A;  2EPP A;  4JV5 E;  1IQO A;  2JR1 A;  2EJS A;  1QAN A;  3K9P A;  4GHL A;  4DV2 M;  4II7 A;  1OIZ A;  3HJQ A;  1LV7 A;  5KPZ A;  3RFW A;  5DYI A;  2LBC A;  4JI3 M;  3W0F A;  4LJA A;  1L4S A;  1DGF A;  4PDG A;  1XWI A;  1R2Z A;  2DEN A;  3TWK A;  1QFC A;  2LVP C;  2L7H A;  5BR8 M;  4NRW A;  1XNQ M;  4G4R A;  2EOH A;  2MRO B;  2A5Y B;  2QBY B;  1VEK A;  3LML A;  4TUG A;  1QU6 A;  3GP1 A;  1DV0 A;  3MHS C;  2J5Y A;  1X47 A;  1MEY C;  2DHY A;  4F6M A;  3J7Y p;  1ZBT A;  3L27 A;  4JYA E;  3RE8 A;  4H2G A;  2EL6 A;  1YUJ A;  2X49 A;  2UXC M;  2OQ4 A;  2Z3X A;  2LCE A;  4J6O A;  2V86 A;  2LH0 A;  5F3W A;  4X8W A;  3H63 A;  2XLJ A;  2HJJ A;  4LFA M;  1TTE A;  3FKE A;  3EGG A;  1A1J A;  2A25 A;  1S70 A;  2QBY A;  2B7T A;  1HNX M;  1HNW M;  2K47 A;  3DF6 A;  1H6U A;  4DV0 M;  3KDS E;  4X62 E;  3HPS A;  1N3G A;  1IN7 A;  4RKU F;  4B3S M;  4JXJ A;  4JA9 A;  2V83 A;  4LJ7 A;  4DUZ M;  3RL4 A;  3T1Y E;  1PRB A;  3CF6 E;  2LRS A;  2V88 A;  1TN9 A;  1E9R A;  2XFT A;  4ZYD A;  4WWL A;  4DR3 M;  4DV1 E;  1QNT A;  2R76 A;  3H69 A;  1O0W A;  4DR1 E;  2OOA A;  3QYE A;  3TQM A;  3FTE A;  2JY9 A;  3C4T A;  1T39 A;  3MHH C;  1IXS B;  2EUC A;  4AG5 A;  2L3C A;  4YHH M;  2ZO9 B;  3KSJ A;  1IBM M;  4ORC A;  2JZ0 A;  4AG6 A;  3A98 B;  4G6Z A;  1IN6 A;  2MC6 A;  3Q8X A;  4DV1 M;  3NBI A;  2VQE E;  2EMC A;  1BBG A;  5ADZ A;  3DOA A;  1QZE A;  1W5S A;  3KBP A;  4MGK E;  3DSC A;  4LF4 M;  1HQC A;  1A5T A;  1NNU C;  1RMD A;  2GLI A;  4S12 A;  3TWM A;  3LCV B;  2EMG A;  1R2Y A;  5IWA E;  2LUQ A;  3J80 S;  3QFK A;  4NXM M;  4DV0 E;  4KHP E;  2MC5 A;  4AW4 A;  2YTP A;  2I7N A;  4WUR A;  4DR7 M;  4NHR A;  4M9Z A;  2EN3 A;  2EMZ A;  4DT2 A;  2DRP A;  2DAI A;  1E9S A;  4L5N C;  4WPY A;  2RQL A;  2DMY A;  4LRT A;  2JUJ A;  2CE7 A;  5KL6 A;  5A6K A;  2R1F A;  3UGJ A;  5LMN E;  2UUC E;  2QP9 X;  3KOY E;  1GO5 A;  3IB8 A;  1Z6T A;  1S3L A;  5EXT A;  2J7N A;  1T43 A;  1J5E E;  2YT4 A;  3HJ8 A;  2LVO C;  3U61 B;  4ITQ A;  3ZC7 B;  3ZU0 A;  1FJG E;  4XGI A;  2BBG A;  4IBG A;  1AUA A;  2HAK A;  1XB2 B;  1R5L A;  2O25 A;  4WFT A;  5AC4 A;  4Q7F A;  1TDH A;  3IWD A;  3GPY A;  4X66 E;  1IBL E;  4DR6 E;  2JY8 A;  2D7H A;  2KKN A;  4B2O A;  1JK2 A;  1P3Q Q;  4L15 A;  3OTO M;  3KOX E;  1WRJ A;  2EA0 A;  2GHF A;  3C9P A;  1A1G A;  1J7K A;  4FBQ A;  3H60 A;  1ORY B;  2ODR D;  2MR9 A;  4AKH A;  5FTL A;  4B3T M;  3GLG B;  2R65 A;  2Z06 A;  4I4L A;  3JTZ A;  1NNJ A;  1DGC A;  2R6F A;  3HU1 A;  3J27 B;  2O01 F;  3KS4 A;  1STU A;  3GO8 A;  4RF0 A;  1QZM A;  1D0L A;  3H64 A;  4MOV A;  4PD2 A;  1SXJ B;  4KBP A;  2I7P A;  1QYR A;  4NOO B;  3L29 A;  2PRT A;  2RPC A;  1YSY A;  2DSY A;  1LTM A;  4R2E A;  4NXN E;  4OR9 A;  4ORB A;  3J7A G;  3HQ1 A;  1XXH A;  2QPA A;  2LXE A;  4WXD A;  1ZMU A;  5E26 A;  4HEI A;  1FJM A;  2HYO A;  2ENH A;  3KW6 A;  3M0E A;  4GZN C;  2NUE A;  3GLF B;  3U6O A;  1HP1 A;  1NEI A;  3AJI B;  2FH0 A;  1MU5 A;  2YSP A;  3DSD A;  2JNH A;  1K3W A;  4FD2 A;  3KZY A;  2L4F A;  2KRU A;  2YTG A;  4LF9 M;  4HL4 A;  3LLH A;  4GIP A;  2CPN A;  4B3M M;  1ZMW A;  2EMA A;  2KHH A;  1ZBQ A;  3D8L A;  4HLQ A;  4ZVZ A;  4JN6 A;  2LVQ D;  4WSG A;  2VQF E;  1YFH A;  4JI1 M;  2FE8 A;  4FW9 A;  3K8Z A;  1XMO M;  3F92 A;  2Z4R A;  5H37 D;  3W68 A;  3KFU G;  5FTJ A;  3DJW A;  3P71 C;  4NSO B;  3AV0 A;  4FBW A;  1N77 A;  1Q3C A;  2EMF A;  1K3X A;  5FLX C;  3ADJ A;  4DV4 M;  3GLF A;  3GQ5 A;  3PNY A;  2WZJ A;  4FWH A;  1PJS A;  2K7I A;  1D0K A;  3TE6 A;  2KEB A;  4DR5 M;  5FLX S;  2O5R A;  3SAV A;  3R9X B;  2DB2 A;  2O8A A;  1FNN A;  2ZTD A;  1X6E A;  2GQF A;  3J80 C;  4LU9 A;  4QOS A;  2L3J A;  2Q8U A;  5AE3 A;  5B8I A;  3W67 A;  1XMQ M;  4AI6 A;  1EH8 A;  2R4E A;  2DLQ A;  2QEN A;  5EP3 A;  3FYC A;  4FBK A;  1A1K A;  2FNA A;  2ZAM A;  2JVA A;  2ZAO A;  2XSZ D;  4JYA M;  3T1H E;  2YU5 A;  4LAC C;  4G3O A;  2EN2 A;  3M99 B;  1FJG M;  2EN7 A;  4R71 A;  2VF8 A;  4PT5 A;  4G4N A;  2KRK A;  4BB9 A;  2HCB A;  4IBD A;  2NPP C;  1IMU A;  2EM8 A;  4IBE A;  1T3T A;  4TUW A;  3QG5 C;  5ITX E;  2F5O A;  2CV0 A;  4JI8 E;  4DV6 M;  4R2S A;  4JI3 E;  1CUK A;  4NL4 H;  4RF1 A;  4YHH E;  2RS6 A;  4BCA A;  5A6A A;  1Q39 A;  2R62 A;  4MGH A;  5ITQ A;  3SFZ A;  2DWZ B;  2L6M A;  4LZZ A;  2WZO A;  3A45 A;  4HTG A;  5IZ7 D;  4GEW A;  3EPK A;  2EL4 A;  2CSH A;  5IWA M;  3NWL A;  3ILK A;  3RL5 A;  4L4U A;  2DKL A;  4P7D A;  1WAO 1;  2R46 A;  1IXS A;  2EPL X;  4B7G A;  3EIH A;  3J81 C;  4LF4 E;  3J2P B;  1DQ3 A;  2EPZ A;  2ENC A;  5IOH A;  4N4R B;  3PFI A;  1JQJ C;  4MGY E;  2L92 A;  2YEQ A;  3C9F A;  4FK5 C;  4CIZ A;  2NUG A;  1HNW E;  2G3Q A;  3SMS A;  3E4R A;  1IBM E;  4QHS A;  3U6D A;  4DR6 M;  3ZTV A;  4LF8 M;  1QHW A;  4OU7 A;  3U6P A;  3FUT A;  1ZR9 A;  1QAM A;  2EO2 A;  3HU2 A;  1MGT A;  3NBX X;  4R8O A;  4DKK A;  2AHM A;  1HPU A;  4JI6 M;  1QAQ A;  3GRU A;  3KP0 E;  4QOZ C;  1DO0 A;  3CTW B;  3U60 A;  4GHA A;  2V1U A;  4IYP C;  5C1V A;  4D81 A;  2EOQ A;  1NHW C;  4TUI A;  3RL3 A;  2VF1 A;  1YPN A;  2VDB B;  3FRI A;  3UJN A;  3TWL A;  3C4B A;  2BWE A;  4H2B A;  4B7H A;  2ZBM A;  2J7O A;  4KWY A;  2JY6 B;  3EPH A;  2FOI C;  3MJ5 A;  1NV8 A;  2ZOA A;  3T38 A;  1KJK A;  4MGZ E;  2NYM C;  4UT3 B;  3C5W C;  1OQY A;  1HNX E;  4AQY M;  2VE7 C;  4GKJ E;  4V0X A;  3GPU A;  1A1I A;  2JOG A;  1L2B A;  1S3S A;  4GC9 A;  4AQY E;  3FLO A;  1IQP A;  1VG5 A;  2KZU A;  2ELY A;  2EPO A;  2HHH M;  2KXE A;  4G4O A;  5IXM B;  4IBI A;  5C18 A;  2JY5 A;  1SXJ A;  4DV4 E;  3DW8 C;  3HHZ A;  4X9J A;  4RNA A;  4KHP M;  1J26 A;  1X5W A;  1WJP A;  1NCS A;  5TSE A;  1KYI A;  1OKS A;  1XNQ E;  4MLV A;  3E21 A;  2QNJ A;  2KNZ A;  2MKD A;  2UUA M;  1OTR A;  4UT2 A;  2M4I A;  2JXP A;  1PJJ A;  1V73 A;  3E7B A;  4PDI A;  5FSW A;  1HT1 E;  4WSP A;  2Z1A A;  1RQ0 A;  1Z5A A;  1ZAE A;  2YSO A;  2XSZ A;  3BOS A;  2JP7 A;  1F2I G;  5EQV A;  3GQ3 A;  1WHC A;  4Q7J A;  1MF8 A;  2JZ1 A;  2LHC A;  1Q02 A;  2UUA E;  3I04 M;  4FCX A;  2BWB A;  2EN8 A;  3IHP A;  3VLF B;  2FGG A;  4B3R M;  3GLG A;  4CIS A;  2DWL A;  2WSC F;  3K1J A;  8CAT A;  1EKZ A;  4DUZ E;  4AKG A;  1IN8 A;  3C3D A;  2F5Q A;  1G8P A;  4A3V B;  1DI2 A;  2NA2 A;  3LVW A;  2MKN A;  4QNR A;  4JI4 M;  2N3H A;  3KZZ A;  1E94 E;  2DXI A;  1DGB A;  4L8N A;  4L8R C;  2KOU A;  4V0W A;  1RU3 A;  1Z59 A;  3MMP A;  3LVV A;  4AZF A;  4LFC M;  1N75 A;  3QWL A;  2XF3 A;  4D82 A;  1IBL M;  3AFH A;  5DFL A;  4ZPX A;  5EP4 A;  2EKF A;  1OFH A;  2LO3 A;  4GC5 A;  3GLH A;  1MN3 A;  2NAB A;  2YWQ A;  2MJ5 B;  4ANR A;  3U5Z A;  2QJC A;  4F6N A;  2YTQ A;  2EMY A;  3QAU A;  4HEO A;  3T15 A;  3H4M A;  1IBK M;  3H68 A;  4O4K A;  3BBG A;  3B9P A;  3GPX A;  3KXE C;  2C99 A;  2EM0 A;  3HKP A;  4IS1 C;  2L8T A;  4GRI A;  2ELZ A;  1YZ9 A;  3KS8 A;  4MB7 A;  4M0V A;  3OTO E;  2LV2 A;  3IVE A;  4K0K E;  1OAO C;  1XMQ E;  2ODR C;  2F5N A;  4LF8 E;  1BBO A;  4JV5 M;  3GLI B;  4DR5 E;  1DGG A;  2JXN A;  2L09 A;  1EH7 A;  2ZTC A;  3FGA C;  2JWO A;  2LBS B;  4O24 A;  3WHL A;  3PVS A;  3Q8G A;  1L2D A;  4R3D A;  4WP2 A;  2YPN A;  4F9C B;  2RKO A;  3IWC A;  5JI3 E;  1WGN A;  3FRH A;  1X6H A;  3FYD A;  3U6E A;  2UXB E;  2ZM6 E;  4PCZ A;  4BBY A;  4R2P A;  4B3R E;  2JWS A;  2E1M A;  2JYA A;  4CJ6 A;  2EOX A;  1UTE A;  3KOZ E;  3SYL A;  3OML A;  1IXR C;  3IEC A;  3GLI A;  2OPF A;  2CHV A;  1IY0 A;  2XEP A;  1Q3B A;  5LMN M;  2UUC M;  5KPR A;  1I4W A;  2VQF M;  1X3C A;  4LF7 E;  4BS9 A;  3TQS A;  2EOM A;  1HNZ E;  3HHW A;  4MLQ A;  1NO1 A;  3EPL A;  7CAT A;  1HR0 M;  1L1Z A;  1T4N A;  3EPJ A;  4OW0 A;  1TH2 A;  1K82 A;  1BB8 A;  2WBS A;  4H2F A;  4X64 E;  2UXD E;  2RGO A;  2EM4 A;  4R2R A;  2I13 A;  4O5G A;  3TPZ A;  4JI2 M;  3B7Q A;  2R4J A;  4FCW A;  3UK3 C;  4XK8 F;  3KP1 E;  2EMX A;  1E32 A;  2BJV A;  1GKI A;  4DMI A;  2VQE M;  4R03 A;  1C1K A;  4BMJ A;  4NXN M;  2CHQ A;  1GL7 A;  2DLK A;  2DXL A;  3H61 A;  5C1B A;  2BB8 A;  3CF2 A;  2QHO B;  3MHV C;  4ZYE A;  4LJ5 A;  5ITT A;  4DV6 E;  3TL4 X;  4JI8 M;  3ZOQ B;  3RQZ A;  3THG A;  2QFP A;  2EQ0 A;  5EXX A;  2LNH C;  3SAU A;  2H5X A;  4DR3 E;  5ITU A;  4MM3 B;  4ORA A;  2RSM A;  3J7B A;  3K6Q A;  4MP0 A;  3JYF A;  3SC3 A;  2V8Q B;  2LJH A;  1DGH A;  2EOS A;  1WHQ A;  1PJT A;  3HXL A;  2L2N A;  3L28 A;  4IJF A;  2CV2 A;  2YTJ A;  2APL A;  4JI6 E;  1VEJ A;  3B74 A;  5KL4 A;  3M7G A;  2QQ8 A;  2MDR A;  2KW0 A;  2YVT A;  4IBF A;  1GVN A;  1UF3 A;  2NXF A;  1NHG C;  2LT7 A;  2NYL C;  3E46 A;  2HC5 A;  3N5U A;  2DHR A;  1YYO A;  1XXH E;  2QZ4 A;  3SHG B;  5KL7 A;  3SAW A;  4B3M E;  1NV9 A;  2F8B A;  3B89 A;  4MOY A;  1JR3 E;  5EQT A;  4V0V A;  4JI5 E;  3GLH B;  3LCU A;  2EM9 A;  2EQ3 A;  2USH A;  4LJ4 A;  2EPM X;  4JI0 E;  1YUB A;  2EM6 A;  4Y28 F;  5A6J A;  3SAR A;  3M6A A;  2Q2E B;  4I5N C;  1T6O A;  4KT0 F;  1BVS A;  2KNV A;  1V92 A;  4MH0 E;  2CWB A;  1EH6 A;  1QUS A;  1D2N A;  2IE3 C;  1IY2 A;  3I4Y A;  5BR8 E;  3RGS A;  4YY3 M;  2JOB A;  4M9S A;  3J81 S;  2L6O A;  1OIE A;  4LF5 E;  2X4A A;  1AH5 A;  4OX9 M;  1L2C A;  3QFN A;  5L8R F;  1JR3 A;  1WIV A;  4H2I A;  2EPA A;  4LZJ A;  2CV9 A;  2V87 A;  2RRU A;  3H67 A;  4JI4 E;  3GRY A;  4WW0 A;  1Z2W A;  1XM7 A;  1Z5B A;  3ADI A;  1S95 A;  2V6Z M;  2BNK A;  1SR9 A;  4LJ9 A;  4LGM A;  2EWL A;  2VRD A;  1WAR A;  4KLN A;  2B3T A;  1QDR A;  1SU1 A;  2L7I A;  3VKH A;  4F2L A;  3KOW E;  4WYQ B;  1TGU A;  3T1I A;  3HHY A;  4JI2 E;  4LRS A;  3CF0 A;  4KO8 A;  4R2C A;  2DAK A;  1DGH B;  2MGW A;  2ADR A;  3FUW A;  1XZW A;  1UBD C;  2JP9 A;  5A2Q S;  1N32 E;  4NSR A;  4B7F A;  2BQ8 X;  2YTN A;  3A46 A;  1HR0 E;  3ICF A;  1S3M A;  4Z6Y A;  4LGY A;  1IFY A;  1ZAA C;  4DV5 E;  1SXJ E;  2B9D A;  2C98 A;  2FV4 B;  5EXS A;  2EPX A;  1AIP C;  5LL6 R;  3RGP A;  2RSI A;  1UM8 A;  1MJG M;  2LJU A;  3ZCB B;  1X49 A;  3HZJ A;  1S3N A;  4JI0 M;  4DR2 M;  1TH3 A;  2EOR A;  3KVW A;  3PSN A;  4XPN A;  4X65 E;  3CK2 A;  2CTD A;  1Z5C A;  1G59 A;  3JR5 A;  1N33 M;  2EMI A;  1G2F C;  4X62 M;  2BDX A;  4IBB A;  2EPC A;  4OOG C;  2ZBK B;  3K7V C;  2OOB A;  5CFF E;  1PKP A;  2EN4 A;  4JA7 A;  3ADL A;  1TF6 A;  4F9B B;  2E72 A;  2F5P A;  4K0K M;  2EM2 A;  4LFA E;  4LF9 E;  1EE8 A;  2M9A A;  2EL5 A;  2HGH A;  4DUY M;  2R45 A;  2LWX A;  3VK7 A;  1I94 E;  3H4J A;  4LY6 A;  1ZV1 A;  1XNR M;  1IM2 A;  3ZQJ A;  3U61 A;  3GLI E;  4UN2 B;  4QNM A;  2YU8 A;  2V1C A;  3SAT A;  4RH8 A;  1SG9 A;  4DV3 M;  4G4Q A;  2YTO A;  1VEG A;  2KZS A;  2R18 A;  3EGH A;  2WSF F;  4I5L C;  2B3T B;  4DV2 E;  1WXR A;  5LLQ A;  3GPP A;  3SYK A;  2EQ1 A;  1NJF A;  1Z2X A;  3BBZ A;  3L2A A;  1WR1 B;  2VII A;  4JI7 E;  1QDT A;  1NJG A;  1N34 E;  1HJP A;  4LJ6 A;  4XBO A;  2DIX A;  2EJ4 A;  4DR7 E;  4KZS A;  2M60 A;  4NC6 A;  2F4V E;  2YZT A;  1QQW A;  5KL5 A;  2CP8 A;  3SBJ A;  4FCV A;  2EKK A;  3L25 A;  2L4E A;  3FTD A;  3E0J A;  2LHG A;  2C5R A;  3GLG E;  3LMM A;  2H36 X;  2HYP A;  2EOE A;  1GJS A;  5AE1 A;  2H1R A;  1S8E A;  1Z1B A;  1IN4 A;  3H62 B;  4P78 A;  1IY1 A;  3H09 A;  3F6H A;  1PDA A;  2RS7 A;  1R7R A;  1U32 A;  1WHN A;  3LL8 A;  1N78 A;  4DV5 M;  1TR8 A;  2JOX A;  4JI7 M;  3A42 A;  4X66 M;  3HJS A;  3D8B A;  1G71 A;  2QSF X;  2YTE A;  5DNY A; 
#chains in the Genus database with same CATH homology
 3AJI B;  3AOE C;  3FYD A;  3U6E A;  5T6J A;  2UXC E;  5JJT A;  1XXH B;  5EJC A;  2UXB E;  2YFQ A;  2ZM6 E;  4PCZ A;  4M30 A;  4BBY A;  3JAM C;  4B3R E;  1MU5 A;  2E1M A;  3ADG A;  3DSD A;  1K3W A;  4FD2 A;  1XC8 A;  1HO5 A;  4LFC E;  2KRU A;  4FWD A;  3VFD A;  1XHB A;  3KOZ E;  4DV7 M;  4LF9 M;  4HL4 A;  3SYL A;  3LLH A;  3OML A;  1IXR C;  4M0D A;  4GIP A;  2CPN A;  4B3M M;  3JAM S;  3K92 A;  3GQ4 A;  3E9S A;  3RMP A;  4GKJ M;  1OI8 A;  2F5S A;  3GLI A;  1GLN A;  2OPF A;  1ZBQ A;  3HPZ A;  2CHV A;  3D8L A;  1IY0 A;  2D7G A;  2XFS A;  4HLQ A;  5KQ8 A;  3U6Q A;  5FTN A;  2LMZ A;  4JN6 A;  1N33 E;  3H66 A;  4ZVZ A;  2VQF E;  1J5E M;  4X65 M;  2LUP B;  2XEP A;  4JI1 M;  2FE8 A;  1Q3B A;  2M5Z A;  5LMN M;  5EP2 A;  3LQQ A;  2UUC M;  5KPR A;  1I4W A;  4FW9 A;  2VQF M;  4QHT A;  4LF7 E;  3GVE A;  4NXM E;  5A2Q C;  1JR3 D;  3K8Z A;  4OVZ B;  4BS9 A;  3TQS A;  1XMO M;  1HNZ E;  1USH A;  3HHW A;  3SHF A;  2JA2 A;  2DZO B;  2Z4R A;  7CAT A;  5H37 D;  1HR0 M;  1L1Z A;  3P1X A;  1IBK E;  2DVW B;  2HHH E;  3IVD A;  3KFU G;  4F0Z A;  5FTJ A;  1T4N A;  4MGI E;  4I5S A;  4OW0 A;  1TH2 A;  3VKG A;  3DJW A;  4DUY E;  1K82 A;  4R7G A;  4DV7 E;  3KWR A;  2P6B A;  3E7A A;  3FTF A;  3P71 C;  3C58 A;  3QFO A;  1N36 M;  4H2F A;  4X64 E;  2FTX B;  1NY5 A;  2UXD E;  4NSO B;  5FTK A;  1N36 E;  2RGO A;  2Z72 A;  3AV0 A;  1PJI A;  2RGH A;  5AAS A;  4FBW A;  1PM5 A;  3U6C A;  4O5G A;  5EXP A;  3DA1 A;  2E5L E;  4BC7 A;  3TPZ A;  1QAO A;  1N77 A;  5KPT A;  4JI2 M;  4LF6 M;  1Q3C A;  3FUV A;  3UK6 A;  3VYY A;  2R4J A;  4FCW A;  4J8Z A;  4I81 A;  2LTS A;  3AOE A;  2YNM D;  1K3X A;  4GEQ B;  3GRV A;  3FD9 A;  5FLX C;  3ADJ A;  3KP1 E;  4DV4 M;  4LF5 M;  3GLF A;  3GQ5 A;  3PNY A;  1DO2 A;  1E32 A;  4FWH A;  2V85 A;  3THO B;  4DR1 M;  2BJV A;  5IRE B;  2V89 A;  3THN A;  3TE6 A;  3FUX A;  1NY6 A;  2KEB A;  4DR5 M;  1GKI A;  3MSW A;  4DR2 E;  5FLX S;  2O5R A;  3SAV A;  3R9X B;  5ITY A;  2DB2 A;  1G5B A;  4HD0 A;  2Y0Q A;  4P16 A;  4DMI A;  2O8A A;  2DZN B;  1FNN A;  2VQE M;  1GQE A;  3AUZ A;  3PNV A;  4REZ A;  4L78 A;  3J80 C;  1SXJ C;  3U5Z B;  4DSY A;  4R03 A;  4LU9 A;  5ITR A;  1C1K A;  4QOS A;  4BMJ A;  5DYG A;  2L3J A;  4NXN M;  2Q8U A;  2DFJ A;  4Q28 A;  4GKK E;  5AE3 A;  5B8I A;  2D7E A;  1T71 A;  2CHQ A;  2CUZ A;  1HT2 E;  1XMQ M;  2R4E A;  4AI6 A;  5GTU A;  1X48 A;  1GL7 A;  1R6B X;  2DXL A;  3H61 A;  4H1S A;  2CFO A;  1GL6 A;  2QEN A;  3FYC A;  5EP3 A;  4FCT A;  5C1B A;  3SMP A;  4FBK A;  4V0X A;  1G4A E;  2FNA A;  2X8A A;  2ZAM A;  4GIT A;  2JVA A;  4KOD A;  2B7V A;  2A22 A;  3CF2 A;  2ZAO A;  2XSZ D;  3MHV C;  4IIW A;  2KA6 B;  3L26 A;  3UZU A;  4JI5 M;  4JYA M;  3T1H E;  4LJ5 A;  5ITT A;  4LAC C;  1IXZ A;  1T4O A;  2WDF A;  4DV6 E;  3U6M A;  1J09 A;  3TL4 X;  4JI8 M;  2F4V M;  3AOG A;  1FJG M;  3ZOQ B;  1TCO A;  3RQZ A;  3THG A;  3PXG A;  2QFP A;  4PT5 A;  1RC7 A;  4G4N A;  2KRK A;  5EXX A;  3JU0 A;  4BB9 A;  2LNH C;  1IN5 A;  4EIW A;  3SAU A;  2HCB A;  1YYW A;  5IT9 S;  1T4L B;  5BPV A;  4DR3 E;  2M7Q A;  3KSX A;  5ITU A;  4IBD A;  4Z8X A;  3QFM A;  4F54 A;  2NPP C;  4MM3 B;  4ORA A;  2RSM A;  3J7B A;  2E5L M;  3K6Q A;  4GH9 A;  2DWN A;  1AUI A;  2IAE C;  4MP0 A;  3PSO A;  4IJE A;  5JPF A;  4IBE A;  5JI2 E;  3SC3 A;  2V8Q B;  3JYF A;  1T3T A;  1OFI A;  2CHG A;  4TUW A;  2LJH A;  2WDE A;  4JV5 E;  3QG5 C;  5ITX E;  2F5O A;  2CV0 A;  4JI8 E;  1FKA E;  1DGH A;  4DV6 M;  1VDD A;  2JR1 A;  2L33 A;  1QAN A;  4GHL A;  1WHQ A;  3HXL A;  4DV2 M;  4II7 A;  3HJQ A;  2L2N A;  1LV7 A;  3L28 A;  4IJF A;  5KPZ A;  3T1Y M;  4JI3 E;  2CV2 A;  4NL4 H;  3RFW A;  2FFJ A;  4RF1 A;  5DYI A;  4YHH E;  2RS6 A;  2QCU A;  4JI3 M;  2W82 A;  4BCA A;  3W0F A;  4LJA A;  1Q39 A;  2R62 A;  4MGH A;  5ITQ A;  1DGF A;  4B3S E;  4JI6 E;  4PDG A;  3FTC A;  2G8L A;  3SFZ A;  3M7G A;  1XWI A;  2DWZ B;  1R2Z A;  4LZZ A;  3TWK A;  2KW0 A;  3A45 A;  2L6M A;  2LE2 A;  2MDR A;  2L7H A;  2Z4S A;  5BR8 M;  4IBF A;  4NRW A;  1XNQ M;  4BC9 A;  1GVN A;  5IZ7 D;  1UF3 A;  2NXF A;  4G4R A;  1NHG C;  3IB7 A;  2NYL C;  2A5Y B;  1X37 A;  2QBY B;  3N5U A;  2DHR A;  3LML A;  1YYO A;  2QZ4 A;  4TUG A;  1QU6 A;  3GP1 A;  3SHG B;  1WXQ A;  2YQZ A;  3SAW A;  1UIL A;  4B3M E;  5IWA M;  3NWL A;  3ILK A;  3RL5 A;  4L4U A;  1G3I A;  1X47 A;  4P7D A;  2F8B A;  1WAO 1;  2R46 A;  4B08 A;  3J7Y p;  4MOY A;  5EQT A;  1ZBT A;  4V0V A;  3L27 A;  4JI5 E;  3RE8 A;  4JYA E;  4H2G A;  3GLH B;  4B7G A;  3EIH A;  3J81 C;  2X49 A;  3VYX A;  2G5G X;  2UXC M;  4LF4 E;  3J2P B;  2OQ4 A;  1N32 M;  1DQ3 A;  2USH A;  4LJ4 A;  4JI0 E;  1YUB A;  2Z3X A;  4OX9 E;  5IOH A;  3PFI A;  4GMQ A;  3SAR A;  3M6A A;  4J6O A;  4IBK A;  2Q2E B;  2V86 A;  4I5N C;  1JQJ C;  2LH0 A;  4MGY E;  2KON A;  2L92 A;  3AKZ A;  5F3W A;  2BJW A;  4X8W A;  2YEQ A;  2KHX A;  2NUG A;  3LQR A;  3C9F A;  5ITX A;  3H63 A;  2XLJ A;  4MH0 E;  2WDD A;  4LFA M;  3FKE A;  1HNW E;  3I4V A;  3EGG A;  1D2N A;  3E4R A;  3SMS A;  1S70 A;  3HWS A;  2IE3 C;  1IY2 A;  2QBY A;  2B7T A;  1HNX M;  1IBM E;  3I4Y A;  3U60 B;  2UU9 E;  5BR8 E;  1HNW M;  1KFV A;  2K47 A;  4QHS A;  3U6D A;  4DR6 M;  3RGS A;  4YY3 M;  2JOB A;  4M9S A;  3DF6 A;  3FIG A;  1H6U A;  3J81 S;  3ZTV A;  4LF8 M;  1QHW A;  2L6O A;  3KDS E;  4OU7 A;  4DV0 M;  3U6P A;  3FUT A;  4X62 E;  1QAM A;  2EO2 A;  3HU2 A;  1OIE A;  4LF5 E;  3HPS A;  5EP1 A;  4R8O A;  4DKK A;  2UUB E;  1UTE A;  2AHM A;  2X4A A;  1HPU A;  1IN7 A;  2NQ8 C;  4OX9 M;  4B3S M;  4JI6 M;  4ZX2 A;  1L2C A;  1QAQ A;  1I94 M;  3QFN A;  3T1H M;  4JXJ A;  4JA9 A;  2YR0 A;  1JR3 A;  3GRU A;  4LJ7 A;  4DUZ M;  3KP0 E;  4QOZ C;  2V83 A;  3T1Y E;  3RL4 A;  3CF6 E;  2LRS A;  4H2I A;  2V88 A;  2CV1 A;  2N3G A;  1DO0 A;  3CTW B;  1E9R A;  2XFT A;  4LZJ A;  3U60 A;  2NUF A;  4GHA A;  4X64 M;  2UXD M;  2V1U A;  2CV9 A;  2V87 A;  4IYP C;  4D81 A;  4WWL A;  3H67 A;  5C1V A;  3EIE A;  1NHW C;  4DR3 M;  4TUI A;  2XGN A;  4FWG A;  4DV1 E;  5KQD A;  2VF1 A;  3RL3 A;  1TDZ A;  2HY1 A;  4JI4 E;  3UJN A;  3GRY A;  3TWL A;  4WW0 A;  1Z2W A;  3H69 A;  3C4B A;  4IL1 A;  2P5T A;  4F9A B;  1O0W A;  1Z5B A;  3ADI A;  1XM7 A;  4H2B A;  1S95 A;  4DR1 E;  4B7H A;  2V6Z M;  2HL7 A;  2ZBM A;  2BNK A;  2Y20 A;  2XZF A;  2J7O A;  4LJ9 A;  1SR9 A;  4LGM A;  2EWL A;  1WAR A;  3FTE A;  4M0W A;  2JY9 A;  2ZAN A;  4LF7 M;  2IHR 1;  3C4T A;  2BCD A;  4KLN A;  2FOI C;  3MJ5 A;  1IXS B;  2ZOA A;  2EUC A;  3GRR A;  3T38 A;  4NRV A;  4AG5 A;  3VK6 A;  2L3C A;  1JK7 A;  4MGZ E;  4YHH M;  2M1S A;  1SU1 A;  2NYM C;  3KSJ A;  2XH9 A;  2ZO9 B;  3C5W C;  1IBM M;  2L7I A;  1HNX E;  4ORC A;  4UT3 B;  4AG6 A;  3VKH A;  3KOW E;  4WYQ B;  4AQY M;  3A98 B;  4G6Z A;  1TGU A;  3GPU A;  2VE7 C;  4GKJ E;  2JOG A;  1IN6 A;  4M9X A;  3HHY A;  1S3S A;  1L2B A;  4H1Y P;  2MC6 A;  4JI2 E;  3T1I A;  4GC9 A;  3Q8X A;  4LRS A;  5AE2 A;  2Z7J A;  3CF0 A;  4KO8 A;  4DV1 M;  4AQY E;  2IE4 C;  3NBI A;  2VQE E;  4D80 A;  3FLO A;  4L16 A;  1DGH B;  1IQP A;  5ADZ A;  3TGH A;  3DOA A;  2KZU A;  3FUW A;  3IG5 A;  1XZW A;  2HHH M;  1OJL A;  2UXB M;  1W5S A;  3KBP A;  4MGK E;  3DSC A;  2KXE A;  5A2Q S;  4NSR A;  4G4O A;  4B7F A;  1N32 E;  4LF4 M;  4IBI A;  1HQC A;  1XMO E;  1W5T A;  3IG8 A;  5C18 A;  2BQ8 X;  5JPE A;  1NNU C;  1SXJ A;  2C96 A;  4W5W A;  4S12 A;  3HHZ A;  3A46 A;  3TWM A;  4DV4 E;  1HR0 E;  3DW8 C;  3ICF A;  4RNA A;  4UWQ A;  3SAS A;  4JI1 E;  1S3M A;  4Z6Y A;  4LGY A;  4KHP M;  1J26 A;  1R2Y A;  5IWA E;  2LUQ A;  3J80 S;  1QVR A;  3QFK A;  4NXM M;  4DV5 E;  4IBJ A;  3FUU A;  1SXJ E;  4DV0 E;  4KHP E;  2MC5 A;  4DR4 M;  2B9D A;  2HKJ A;  2C98 A;  3W0L B;  4AW4 A;  4G9J A;  2I7N A;  4WUR A;  2XZU A;  2FV4 B;  4LF6 E;  4DR7 M;  5EXS A;  4M9Z A;  4DHL A;  1KYI A;  1XNQ E;  5LL6 R;  4DT2 A;  4LCB A;  3MK6 A;  1YYK A;  1E9S A;  3RGP A;  3VDP A;  4FVM A;  4L5N C;  4M2Z A;  4WPY A;  3U6L A;  4LFB E;  2DMY A;  4LJ8 A;  1UM8 A;  4LRT A;  2DWM A;  2UUA M;  2RTX A;  2M4I A;  4FBQ A;  4UT2 A;  1PJJ A;  1V73 A;  2CE7 A;  3ZCB B;  4PDI A;  5FSW A;  1X49 A;  5E6J A;  1HT1 E;  3E7B A;  4WSP A;  3IWB A;  2Z1A A;  1S3N A;  4JI0 M;  4DR2 M;  1TH3 A;  1W24 A;  1RQ0 A;  1Z5A A;  1ZAE A;  2WDC A;  3KVW A;  2YVT A;  3UGJ A;  5LMN E;  2UUC E;  1UHZ A;  3PSN A;  4XPN A;  2QP9 X;  3JR4 A;  4X65 E;  3KOY E;  2UUB M;  5FTM A;  2XSZ A;  3CK2 A;  1Z5C A;  1G59 A;  3BOS A;  3IB8 A;  3JR5 A;  1Z6T A;  1N33 M;  2LTR A;  5LMU E;  1S3L A;  5EQV A;  5EXT A;  4X62 M;  4IBB A;  2BDX A;  2J7N A;  4CGY B;  4OOG C;  4KKZ A;  3GQ3 A;  1J5E E;  2ZBK B;  5KO3 A;  2YT4 A;  3K7V C;  1MF8 A;  2Y21 A;  3HJ8 A;  3HU3 A;  5CFF E;  2UU9 M;  1PKP A;  4LTY A;  3U61 B;  5J28 A;  4JA7 A;  4I8O A;  3ADL A;  4ITQ A;  3ZC7 B;  2UUA E;  4F9B B;  4I5L C;  3ZU0 A;  2C9C A;  2F5P A;  4K0K M;  4LFA E;  1FJG E;  3U6S A;  4FCX A;  4LF9 E;  1EE8 A;  4XGI A;  2EZ6 A;  3K7W C;  3VLF B;  4IBG A;  2FGG A;  1L1T A;  4DUY M;  3I51 A;  1KSF X;  1KBP A;  2R45 A;  2AHD A;  2XMO A;  4B3R M;  2LWX A;  3GLG A;  4LG2 A;  4CIS A;  3DFZ A;  2DWL A;  3K1J A;  3VK7 A;  1YE9 A;  4WFT A;  3J7A S;  1I94 E;  8CAT A;  1EKZ A;  4Q7F A;  4LY6 A;  2GJU A;  4DUZ E;  1TDH A;  4AKG A;  1IN8 A;  2F5Q A;  3IWD A;  1II7 A;  2L2K B;  3GPY A;  1XNR M;  1IM2 A;  3HVQ A;  1G8P A;  3AL0 C;  4X66 E;  3U61 A;  4OVZ A;  4A3V B;  1IBL E;  1DI2 A;  4DR6 E;  2CEA A;  2NA2 A;  3LVW A;  2D7H A;  4QNR A;  2KKN A;  4B2O A;  4JI4 M;  2N3H A;  1E94 E;  4QNM A;  1DGB A;  2DXI A;  4L8N A;  4L8R C;  2KOU A;  2V1C A;  3SAT A;  4YY3 E;  1IT6 A;  4NZV A;  4V0W A;  4BLC A;  1Z59 A;  4DV3 M;  4G4Q A;  4L15 A;  3OTO M;  1G41 A;  3KOX E;  3LVV A;  1SXJ D;  2KZS A;  2R18 A;  4AZF A;  2EA0 A;  5LMU M;  4LFC M;  3EGH A;  5INB A;  1TH4 A;  1N75 A;  4UT3 A;  3QWL A;  1J7K A;  2XF3 A;  4D82 A;  3AFH A;  1IBL M;  2B3T B;  1ORY B;  4ZPX A;  2ZM6 M;  2ODR D;  5EP4 A;  4B3T E;  3H60 A;  4AKH A;  1OFH A;  4DV2 E;  1WXR A;  1XNR E;  5FTL A;  2K4V A;  4GC5 A;  3GPP A;  2G7H A;  2L2M A;  3GLH A;  4B3T M;  3SYK A;  3GLG B;  1OID A;  2QFR A;  1NJF A;  2R65 A;  1L8Q A;  1Z2X A;  3L2A A;  2VII A;  2Z06 A;  4JI7 E;  4I4L A;  3JTZ A;  4LFB M;  2O8G A;  3VDU A;  3U5Z A;  1NNJ A;  1NJG A;  2QJC A;  3F6G A;  3J27 B;  3HU1 A;  1N34 E;  4YKE A;  5HPE A;  4LJ6 A;  4XBO A;  2DIX A;  3KS4 A;  1STU A;  3GO8 A;  3QAU A;  3T15 A;  1N34 M;  4DR7 E;  4RF0 A;  1HQY E;  3D03 A;  4KZS A;  2M60 A;  3VK8 A;  3R8F A;  3H4M A;  1IBK M;  2F4V E;  3H68 A;  1QZM A;  4O4K A;  2YZT A;  3B9P A;  3GPX A;  4DR4 E;  3H64 A;  1HNZ M;  2WZO A;  3KXE C;  2C99 A;  1QQW A;  3HKP A;  4CHT B;  4MOV A;  4AKI A;  4PD2 A;  5GKN A;  3ZH9 B;  1SXJ B;  4KBP A;  3HHX A;  3SBJ A;  2I7P A;  2L8T A;  4FCV A;  1MX0 A;  3L25 A;  1QYR A;  4NOO B;  2C9O A;  4IBC A;  3L29 A;  4GRI A;  1GZ6 A;  3FTD A;  1YZ9 A;  1YSY A;  2Y0T A;  2DSY A;  3E0J A;  4GKK M;  3K2L A;  2C5R A;  1ZQ9 A;  3KS8 A;  4NXN E;  3LMM A;  2H36 X;  4OR9 A;  4ORB A;  4MB7 A;  4M0V A;  3OTO E;  3IVE A;  2HYP A;  3J7A G;  4DV3 E;  4K0K E;  1XMQ E;  3HQ1 A;  5AE1 A;  2ERC A;  2ODR C;  1XXH A;  2QPA A;  2F5N A;  2H1R A;  1S8E A;  1IN4 A;  4LF8 E;  1NVM A;  4P78 A;  1IY1 A;  2LXE A;  3H09 A;  3H62 B;  3F6H A;  4JV5 M;  3HTX A;  1NNW A;  3GLI B;  4DR5 E;  1DGG A;  5E26 A;  2RS7 A;  2L09 A;  3V4Y A;  3HGI A;  3FGA C;  1FJM A;  4O43 A;  1R7R A;  2JWO A;  1U32 A;  1WHN A;  2LBS B;  1N78 A;  3LL8 A;  4DV5 M;  4O24 A;  3WHL A;  3PVS A;  2HYO A;  3UMM A;  1M63 A;  3KW6 A;  1L2D A;  4R3D A;  2JOX A;  4JI7 M;  3A42 A;  4X66 M;  3HJS A;  3WHK A;  1NSF A;  3M0E A;  4F9C B;  3D8B A;  1QFC A;  2NUE A;  3GLF B;  4BBA A;  3U6O A;  2DXN A;  2RKO A;  5IT9 C;  2R17 A;  3IWC A;  1HP1 A;  5JI3 E;  5DNY A;  1T70 A;  3DZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...