3V4YA

Crystal structure of the first nuclear pp1 holoenzyme
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title The Molecular Basis for Substrate Specificity of the Nuclear NIPP1:PP1 Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 293
sequence length 293
chains with identical sequence C, E, G
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3v4yA00
2Z1AA 1OIEA 3QG5C 3H64A 4IL1A 2A22A 4O5GA 2DFJA 1S3NA 4TUGA 4V0VA 4H2FA 2IE4C 4ZX2A 3DSDA 3H63A 2NPPC 4DHLA 1TCOA 3ICFA 3EGHA 3IVDA 3RL4A 3LL8A 1G5BA 4MOVA 4KKZA 3IB7A 1T70A 2WDEA 2WDFA 3ZU0A 2YVTA 4UT3B 4I5LC 4IYPC 5JPFA 4F0ZA 1MF8A 1NNWA 1UTEA 4JA9A 2IE3C 2CV9A 4V0WA 5EQVA 1HP1A 3K7WC 3CK2A 2XMOA 2WDDA 3H68A 1OIDA 1JK7A 1QHWA 3C9FA 2P6BA 3AV0A 1XZWA 1II7A 4Q7FA 5C1VA 1S8EA 2NXFA 3T1IA 2Q8UA 3PSNA 5J28A 4TUIA 2QFPA 1S3LA 3H61A 3ZTVA 3H62B 1S3MA 2AHDA 5B8IA 4MOYA 4DSYA 3H66A 1HO5A 2BDXA 4H2BA 4UT2A 4I5NC 1W24A 3P71C 4FBKA 1XM7A 1KBPA 2USHA 4ZVZA 1UF3A 2HYPA 3DW8C 2O8AA 4DT2A 2O8GA 1T71A 4G9JA 1V73A 2R17A 1Z2XA 5DNYA 2BQ8X 4O4KA 4KBPA 4O24A 4H1SA 4V0XA 2Z06A 1IT6A 2QJCA 4OR9A 5JPEA 3K7VC 3THOB 3E7AA 3HVQA 3N5UA 4J6OA 4JA7A 1AUIA 2NYMC 2QFRA 3H67A 3DSCA 4H2GA 4LACC 3H60A 2BCDA 3THNA 1WARA 3PSOA 1S95A 4H1YP 2JOGA 4B2OA 4FCXA 1HPUA 3IB8A 3RL5A 4ORBA 4ORAA 4O43A 5F3WA 5IOHA 3KBPA 2HYOA 4MP0A 2GJUA 1USHA 1M63A 2WDCA 1SU1A 4UT3A 2HY1A 3QFNA 4LTYA 4UWQA 2NYLC 5GTUA 3E7BA 3TGHA 3C5WC 4FBQA 3QFOA 3GVEA 5INBA 1WAO1 4LU9A 3V4YA 1QFCA 4XPNA 4YKEA 3IVEA 3QFMA 2IAEC 3H69A 4FBWA 1S70A 4ORCA 3QFKA 2Z72A 2KKNA 1FJMA 4NZVA 1OI8A 4H2IA 4M0VA 5HPEA 1U32A 4HD0A 3JYFA 3RL3A 4WWLA 3EGGA 3RQZA 3FGAC 1Z2WA 5JJTA 3AUZA 2ZBMA
chains in the Genus database with same CATH superfamily
2Z1AA 1OIEA 3QG5C 3H64A 4IL1A 2A22A 4O5GA 2DFJA 1S3NA 4TUGA 4V0VA 4H2FA 2IE4C 4ZX2A 3DSDA 3H63A 2NPPC 4DHLA 1TCOA 3ICFA 3EGHA 3IVDA 3RL4A 3LL8A 1G5BA 4MOVA 4KKZA 3IB7A 1T70A 2WDEA 2WDFA 3ZU0A 2YVTA 4UT3B 4I5LC 4IYPC 5JPFA 4F0ZA 1MF8A 1NNWA 1UTEA 4JA9A 2IE3C 2CV9A 4V0WA 5EQVA 1HP1A 3K7WC 3CK2A 2XMOA 2WDDA 3H68A 1OIDA 1JK7A 1QHWA 3C9FA 2P6BA 3AV0A 1XZWA 1II7A 4Q7FA 5C1VA 1S8EA 2NXFA 3T1IA 2Q8UA 3PSNA 5J28A 2ZO9B 2QFPA 1S3LA 3H61A 3ZTVA 4TUIA 3H62B 1S3MA 2DXNA 2AHDA 5B8IA 4MOYA 4DSYA 3H66A 1HO5A 2BDXA 4H2BA 4UT2A 4I5NC 2DXLA 1W24A 3P71C 4FBKA 1XM7A 1KBPA 2USHA 4ZVZA 3D03A 1UF3A 2HYPA 3DW8C 2O8AA 4DT2A 2O8GA 1T71A 4G9JA 1V73A 2R17A 1Z2XA 5DNYA 2YEQA 2BQ8X 4O4KA 4KBPA 4O24A 4H1SA 4V0XA 2Z06A 1IT6A 2QJCA 4OR9A 5JPEA 3K7VC 3THOB 3E7AA 3HVQA 3N5UA 4J6OA 4JA7A 1AUIA 2NYMC 2QFRA 3H67A 3DSCA 4H2GA 4LACC 3H60A 2BCDA 3THNA 3E0JA 1WARA 3PSOA 1S95A 4H1YP 2JOGA 4B2OA 4FCXA 1HPUA 3IB8A 3RL5A 4ORBA 4ORAA 4O43A 5F3WA 5IOHA 3KBPA 2HYOA 4MP0A 2GJUA 1USHA 1M63A 2WDCA 1SU1A 4UT3A 2HY1A 3QFNA 4LTYA 4UWQA 2NYLC 3FLOA 5GTUA 3E7BA 3TGHA 3C5WC 4FBQA 3QFOA 3GVEA 5INBA 1WAO1 4LU9A 3V4YA 1QFCA 4XPNA 4YKEA 3IVEA 3QFMA 2IAEC 3H69A 4FBWA 1S70A 4ORCA 3QFKA 2Z72A 2KKNA 1FJMA 2ZOAA 4NZVA 1OI8A 4H2IA 4M0VA 5HPEA 1U32A 4HD0A 3JYFA 3RL3A 4WWLA 3EGGA 3RQZA 3FGAC 1Z2WA 5JJTA 3AUZA 2ZBMA
chains in the Genus database with same CATH topology
2Z1AA 1OIEA 3QG5C 3H64A 4IL1A 2A22A 4O5GA 2DFJA 1S3NA 4TUGA 4V0VA 4H2FA 2IE4C 4ZX2A 3DSDA 3H63A 2NPPC 4DHLA 1TCOA 3ICFA 3EGHA 3IVDA 3RL4A 3LL8A 1G5BA 4MOVA 4KKZA 3IB7A 1T70A 2WDEA 2WDFA 3ZU0A 2YVTA 4UT3B 4I5LC 4IYPC 5JPFA 4F0ZA 1MF8A 1NNWA 1UTEA 4JA9A 2IE3C 2CV9A 4V0WA 5EQVA 1HP1A 3K7WC 3CK2A 2XMOA 2WDDA 3H68A 1OIDA 1JK7A 1QHWA 3C9FA 2P6BA 3AV0A 1XZWA 1II7A 4Q7FA 5C1VA 1S8EA 2NXFA 3T1IA 2Q8UA 3PSNA 5J28A 2ZO9B 2QFPA 1S3LA 3H61A 3ZTVA 4TUIA 3H62B 1S3MA 2DXNA 2AHDA 5B8IA 4MOYA 4DSYA 3H66A 1HO5A 2BDXA 4H2BA 4UT2A 4I5NC 2DXLA 1W24A 3P71C 4FBKA 1XM7A 1KBPA 2USHA 4ZVZA 3D03A 1UF3A 2HYPA 3DW8C 2O8AA 4DT2A 2O8GA 1T71A 4G9JA 1V73A 2R17A 1Z2XA 5DNYA 2YEQA 2BQ8X 4O4KA 4KBPA 4O24A 4H1SA 4V0XA 2Z06A 1IT6A 2QJCA 4OR9A 5JPEA 3K7VC 3THOB 3E7AA 3HVQA 3N5UA 4J6OA 4JA7A 1AUIA 2NYMC 2QFRA 3H67A 3DSCA 4H2GA 4LACC 3H60A 2BCDA 3THNA 3E0JA 1WARA 3PSOA 1S95A 4H1YP 2JOGA 4B2OA 4FCXA 1HPUA 3IB8A 3RL5A 4ORBA 4ORAA 4O43A 5F3WA 5IOHA 3KBPA 2HYOA 4MP0A 2GJUA 1USHA 1M63A 2WDCA 1SU1A 4UT3A 2HY1A 3QFNA 4LTYA 4UWQA 2NYLC 3FLOA 5GTUA 3E7BA 3TGHA 3C5WC 4FBQA 3QFOA 3GVEA 5INBA 1WAO1 4LU9A 3V4YA 1QFCA 4XPNA 4YKEA 3IVEA 3QFMA 2IAEC 3H69A 4FBWA 1S70A 4ORCA 3QFKA 2Z72A 2KKNA 1FJMA 2ZOAA 4NZVA 1OI8A 4H2IA 4M0VA 5HPEA 1U32A 4HD0A 3JYFA 3RL3A 4WWLA 3EGGA 3RQZA 3FGAC 1Z2WA 5JJTA 3AUZA 2ZBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1A A;  1OIE A;  3QG5 C;  3H64 A;  4IL1 A;  2A22 A;  4O5G A;  2DFJ A;  1S3N A;  4TUG A;  4V0V A;  4H2F A;  2IE4 C;  4ZX2 A;  3DSD A;  3H63 A;  2NPP C;  4DHL A;  1TCO A;  3ICF A;  3EGH A;  3IVD A;  3RL4 A;  3LL8 A;  1G5B A;  4MOV A;  4KKZ A;  3IB7 A;  1T70 A;  2WDE A;  2WDF A;  3ZU0 A;  2YVT A;  4UT3 B;  4I5L C;  4IYP C;  5JPF A;  4F0Z A;  1MF8 A;  1NNW A;  1UTE A;  4JA9 A;  2IE3 C;  2CV9 A;  4V0W A;  5EQV A;  1HP1 A;  3K7W C;  3CK2 A;  2XMO A;  2WDD A;  3H68 A;  1OID A;  1JK7 A;  1QHW A;  3C9F A;  2P6B A;  3AV0 A;  1XZW A;  1II7 A;  4Q7F A;  5C1V A;  1S8E A;  2NXF A;  3T1I A;  2Q8U A;  3PSN A;  5J28 A;  4TUI A;  2QFP A;  1S3L A;  3H61 A;  3ZTV A;  3H62 B;  1S3M A;  2AHD A;  5B8I A;  4MOY A;  4DSY A;  3H66 A;  1HO5 A;  2BDX A;  4H2B A;  4UT2 A;  4I5N C;  1W24 A;  3P71 C;  4FBK A;  1XM7 A;  1KBP A;  2USH A;  4ZVZ A;  1UF3 A;  2HYP A;  3DW8 C;  2O8A A;  4DT2 A;  2O8G A;  1T71 A;  4G9J A;  1V73 A;  2R17 A;  1Z2X A;  5DNY A;  2BQ8 X;  4O4K A;  4KBP A;  4O24 A;  4H1S A;  4V0X A;  2Z06 A;  1IT6 A;  2QJC A;  4OR9 A;  5JPE A;  3K7V C;  3THO B;  3E7A A;  3HVQ A;  3N5U A;  4J6O A;  4JA7 A;  1AUI A;  2NYM C;  2QFR A;  3H67 A;  3DSC A;  4H2G A;  4LAC C;  3H60 A;  2BCD A;  3THN A;  1WAR A;  3PSO A;  1S95 A;  4H1Y P;  2JOG A;  4B2O A;  4FCX A;  1HPU A;  3IB8 A;  3RL5 A;  4ORB A;  4ORA A;  4O43 A;  5F3W A;  5IOH A;  3KBP A;  2HYO A;  4MP0 A;  2GJU A;  1USH A;  1M63 A;  2WDC A;  1SU1 A;  4UT3 A;  2HY1 A;  3QFN A;  4LTY A;  4UWQ A;  2NYL C;  5GTU A;  3E7B A;  3TGH A;  3C5W C;  4FBQ A;  3QFO A;  3GVE A;  5INB A;  1WAO 1;  4LU9 A;  3V4Y A;  1QFC A;  4XPN A;  4YKE A;  3IVE A;  3QFM A;  2IAE C;  3H69 A;  4FBW A;  1S70 A;  4ORC A;  3QFK A;  2Z72 A;  2KKN A;  1FJM A;  4NZV A;  1OI8 A;  4H2I A;  4M0V A;  5HPE A;  1U32 A;  4HD0 A;  3JYF A;  3RL3 A;  4WWL A;  3EGG A;  3RQZ A;  3FGA C;  1Z2W A;  5JJT A;  3AUZ A;  2ZBM A; 
#chains in the Genus database with same CATH topology
 2Z1A A;  1OIE A;  3QG5 C;  3H64 A;  4IL1 A;  2A22 A;  4O5G A;  2DFJ A;  1S3N A;  4TUG A;  4V0V A;  4H2F A;  2IE4 C;  4ZX2 A;  3DSD A;  3H63 A;  2NPP C;  4DHL A;  1TCO A;  3ICF A;  3EGH A;  3IVD A;  3RL4 A;  3LL8 A;  1G5B A;  4MOV A;  4KKZ A;  3IB7 A;  1T70 A;  2WDE A;  2WDF A;  3ZU0 A;  2YVT A;  4UT3 B;  4I5L C;  4IYP C;  5JPF A;  4F0Z A;  1MF8 A;  1NNW A;  1UTE A;  4JA9 A;  2IE3 C;  2CV9 A;  4V0W A;  5EQV A;  1HP1 A;  3K7W C;  3CK2 A;  2XMO A;  2WDD A;  3H68 A;  1OID A;  1JK7 A;  1QHW A;  3C9F A;  2P6B A;  3AV0 A;  1XZW A;  1II7 A;  4Q7F A;  5C1V A;  1S8E A;  2NXF A;  3T1I A;  2Q8U A;  3PSN A;  5J28 A;  2ZO9 B;  2QFP A;  1S3L A;  3H61 A;  3ZTV A;  4TUI A;  3H62 B;  1S3M A;  2DXN A;  2AHD A;  5B8I A;  4MOY A;  4DSY A;  3H66 A;  1HO5 A;  2BDX A;  4H2B A;  4UT2 A;  4I5N C;  2DXL A;  1W24 A;  3P71 C;  4FBK A;  1XM7 A;  1KBP A;  2USH A;  4ZVZ A;  3D03 A;  1UF3 A;  2HYP A;  3DW8 C;  2O8A A;  4DT2 A;  2O8G A;  1T71 A;  4G9J A;  1V73 A;  2R17 A;  1Z2X A;  5DNY A;  2YEQ A;  2BQ8 X;  4O4K A;  4KBP A;  4O24 A;  4H1S A;  4V0X A;  2Z06 A;  1IT6 A;  2QJC A;  4OR9 A;  5JPE A;  3K7V C;  3THO B;  3E7A A;  3HVQ A;  3N5U A;  4J6O A;  4JA7 A;  1AUI A;  2NYM C;  2QFR A;  3H67 A;  3DSC A;  4H2G A;  4LAC C;  3H60 A;  2BCD A;  3THN A;  3E0J A;  1WAR A;  3PSO A;  1S95 A;  4H1Y P;  2JOG A;  4B2O A;  4FCX A;  1HPU A;  3IB8 A;  3RL5 A;  4ORB A;  4ORA A;  4O43 A;  5F3W A;  5IOH A;  3KBP A;  2HYO A;  4MP0 A;  2GJU A;  1USH A;  1M63 A;  2WDC A;  1SU1 A;  4UT3 A;  2HY1 A;  3QFN A;  4LTY A;  4UWQ A;  2NYL C;  3FLO A;  5GTU A;  3E7B A;  3TGH A;  3C5W C;  4FBQ A;  3QFO A;  3GVE A;  5INB A;  1WAO 1;  4LU9 A;  3V4Y A;  1QFC A;  4XPN A;  4YKE A;  3IVE A;  3QFM A;  2IAE C;  3H69 A;  4FBW A;  1S70 A;  4ORC A;  3QFK A;  2Z72 A;  2KKN A;  1FJM A;  2ZOA A;  4NZV A;  1OI8 A;  4H2I A;  4M0V A;  5HPE A;  1U32 A;  4HD0 A;  3JYF A;  3RL3 A;  4WWL A;  3EGG A;  3RQZ A;  3FGA C;  1Z2W A;  5JJT A;  3AUZ A;  2ZBM A; 
#chains in the Genus database with same CATH homology
 2Z1A A;  1OIE A;  3QG5 C;  3H64 A;  4IL1 A;  2A22 A;  4O5G A;  2DFJ A;  1S3N A;  4TUG A;  4V0V A;  4H2F A;  2IE4 C;  4ZX2 A;  3DSD A;  3H63 A;  2NPP C;  4DHL A;  1TCO A;  3ICF A;  3EGH A;  3IVD A;  3RL4 A;  3LL8 A;  1G5B A;  4MOV A;  4KKZ A;  3IB7 A;  1T70 A;  2WDE A;  2WDF A;  3ZU0 A;  2YVT A;  4UT3 B;  4I5L C;  4IYP C;  5JPF A;  4F0Z A;  1MF8 A;  1NNW A;  1UTE A;  4JA9 A;  2IE3 C;  2CV9 A;  4V0W A;  5EQV A;  1HP1 A;  3K7W C;  3CK2 A;  2XMO A;  2WDD A;  3H68 A;  1OID A;  1JK7 A;  1QHW A;  3C9F A;  2P6B A;  3AV0 A;  1XZW A;  1II7 A;  4Q7F A;  5C1V A;  1S8E A;  2NXF A;  3T1I A;  2Q8U A;  3PSN A;  5J28 A;  2ZO9 B;  2QFP A;  1S3L A;  3H61 A;  3ZTV A;  4TUI A;  3H62 B;  1S3M A;  2DXN A;  2AHD A;  5B8I A;  4MOY A;  4DSY A;  3H66 A;  1HO5 A;  2BDX A;  4H2B A;  4UT2 A;  4I5N C;  2DXL A;  1W24 A;  3P71 C;  4FBK A;  1XM7 A;  1KBP A;  2USH A;  4ZVZ A;  3D03 A;  1UF3 A;  2HYP A;  3DW8 C;  2O8A A;  4DT2 A;  2O8G A;  1T71 A;  4G9J A;  1V73 A;  2R17 A;  1Z2X A;  5DNY A;  2YEQ A;  2BQ8 X;  4O4K A;  4KBP A;  4O24 A;  4H1S A;  4V0X A;  2Z06 A;  1IT6 A;  2QJC A;  4OR9 A;  5JPE A;  3K7V C;  3THO B;  3E7A A;  3HVQ A;  3N5U A;  4J6O A;  4JA7 A;  1AUI A;  2NYM C;  2QFR A;  3H67 A;  3DSC A;  4H2G A;  4LAC C;  3H60 A;  2BCD A;  3THN A;  3E0J A;  1WAR A;  3PSO A;  1S95 A;  4H1Y P;  2JOG A;  4B2O A;  4FCX A;  1HPU A;  3IB8 A;  3RL5 A;  4ORB A;  4ORA A;  4O43 A;  5F3W A;  5IOH A;  3KBP A;  2HYO A;  4MP0 A;  2GJU A;  1USH A;  1M63 A;  2WDC A;  1SU1 A;  4UT3 A;  2HY1 A;  3QFN A;  4LTY A;  4UWQ A;  2NYL C;  3FLO A;  5GTU A;  3E7B A;  3TGH A;  3C5W C;  4FBQ A;  3QFO A;  3GVE A;  5INB A;  1WAO 1;  4LU9 A;  3V4Y A;  1QFC A;  4XPN A;  4YKE A;  3IVE A;  3QFM A;  2IAE C;  3H69 A;  4FBW A;  1S70 A;  4ORC A;  3QFK A;  2Z72 A;  2KKN A;  1FJM A;  2ZOA A;  4NZV A;  1OI8 A;  4H2I A;  4M0V A;  5HPE A;  1U32 A;  4HD0 A;  3JYF A;  3RL3 A;  4WWL A;  3EGG A;  3RQZ A;  3FGA C;  1Z2W A;  5JJT A;  3AUZ A;  2ZBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...