3V4YA

Crystal structure of the first nuclear pp1 holoenzyme
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis for Substrate Specificity of the Nuclear NIPP1:PP1 Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 99
structure length 293
sequence length 293
chains with identical sequence C, E, G
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3v4yA00
2Z06A 3QFMA 4MOYA 3DSCA 4I5NC 4F0ZA 5JJTA 1T71A 2GJUA 3P71C 5B8IA 4TUGA 5JPEA 1HPUA 3EGGA 5DNYA 2ZBMA 4LU9A 4H2FA 5J28A 4ZX2A 3IVDA 1S8EA 4G9JA 2P6BA 3QFKA 4DSYA 5EQVA 2QFRA 4ORAA 3RL4A 3EGHA 1WAO1 1OIEA 2HYOA 3JYFA 4O5GA 2IAEC 5C1VA 3H61A 5GTUA 3H60A 1OIDA 2NXFA 1XZWA 4ORBA 2NYLC 4LACC 2DFJA 4M0VA 1HO5A 2KKNA 3IB7A 3DSDA 3ZU0A 3THNA 4KBPA 2Q8UA 3H62B 3C5WC 4B2OA 1S3NA 1M63A 2HY1A 2O8GA 3K7WC 3RL3A 4H2GA 3KBPA 4IYPC 4WWLA 5INBA 4DHLA 3ZTVA 1W24A 4ZVZA 3IVEA 4LTYA 4HD0A 4Q7FA 1S3LA 4JA9A 1IT6A 4IL1A 2BCDA 3RQZA 1QHWA 1UTEA 2AHDA 2HYPA 1G5BA 2IE4C 3PSNA 3H63A 2BDXA 1Z2WA 3PSOA 5F3WA 3QG5C 3AV0A 3E7AA 4FBWA 4FBKA 2WDCA 3H69A 2JOGA 2QFPA 3T1IA 1TCOA 1UF3A 3GVEA 4H2BA 4O43A 3H66A 4ORCA 4KKZA 5JPFA 3QFOA 3N5UA 1XM7A 1U32A 1NNWA 3H64A 4O24A 3FGAC 1T70A 4V0XA 2O8AA 4XPNA 1SU1A 3H68A 2NYMC 5HPEA 4FBQA 2QJCA 2A22A 3CK2A 3HVQA 1MF8A 2USHA 3V4YA 2Z72A 4H1YP 4I5LC 4NZVA 4O4KA 5IOHA 1V73A 3H67A 4MOVA 4J6OA 1S3MA 4H2IA 3LL8A 2NPPC 4DT2A 1OI8A 4UWQA 4YKEA 3AUZA 1Z2XA 3IB8A 4FCXA 3ICFA 4UT3A 4TUIA 3C9FA 3RL5A 1S95A 2WDFA 4V0VA 2IE3C 1II7A 1WARA 3THOB 4UT2A 4UT3B 2WDDA 2R17A 1S70A 4MP0A 1AUIA 2XMOA 3E7BA 4H1SA 2WDEA 2BQ8X 3K7VC 2YVTA 2Z1AA 4OR9A 4V0WA 1KBPA 1USHA 1FJMA 3TGHA 1QFCA 2CV9A 1JK7A 4JA7A 1HP1A 3DW8C 3QFNA
chains in the Genus database with same CATH superfamily
2Z06A 3QFMA 4MOYA 3DSCA 4I5NC 4F0ZA 5JJTA 1T71A 2GJUA 3P71C 5B8IA 4TUGA 5JPEA 1HPUA 3EGGA 5DNYA 2ZBMA 4LU9A 4H2FA 5J28A 4ZX2A 3IVDA 1S8EA 4G9JA 2P6BA 3QFKA 4DSYA 5EQVA 2QFRA 4ORAA 3D03A 3RL4A 3EGHA 1WAO1 1OIEA 2HYOA 3JYFA 4O5GA 2IAEC 5C1VA 3H61A 5GTUA 3H60A 1OIDA 2NXFA 1XZWA 2DXLA 4ORBA 2NYLC 4LACC 2DFJA 4M0VA 1HO5A 2KKNA 3IB7A 3DSDA 3ZU0A 3THNA 4KBPA 2Q8UA 3H62B 3C5WC 4B2OA 1S3NA 1M63A 2HY1A 2O8GA 3K7WC 3RL3A 4H2GA 3KBPA 4IYPC 4WWLA 5INBA 4DHLA 3ZTVA 1W24A 4ZVZA 3IVEA 4LTYA 4HD0A 4Q7FA 1S3LA 4JA9A 1IT6A 4IL1A 2BCDA 3RQZA 1QHWA 1UTEA 2AHDA 3E0JA 2HYPA 1G5BA 2IE4C 3PSNA 2ZO9B 3H63A 2BDXA 1Z2WA 3PSOA 5F3WA 3QG5C 3AV0A 3E7AA 4FBWA 4FBKA 2DXNA 2WDCA 3H69A 2JOGA 2QFPA 3T1IA 1TCOA 1UF3A 3GVEA 4H2BA 4O43A 3FLOA 3H66A 4ORCA 4KKZA 5JPFA 3QFOA 3N5UA 1XM7A 1U32A 1NNWA 2YEQA 3H64A 4O24A 3FGAC 1T70A 4V0XA 2O8AA 4XPNA 1SU1A 3H68A 2NYMC 5HPEA 4FBQA 2QJCA 2A22A 3CK2A 3HVQA 1MF8A 2USHA 3V4YA 2Z72A 4H1YP 4I5LC 4NZVA 4O4KA 5IOHA 1V73A 3H67A 4MOVA 4J6OA 1S3MA 4H2IA 3LL8A 2NPPC 4DT2A 1OI8A 4UWQA 4YKEA 3AUZA 1Z2XA 3IB8A 4FCXA 3ICFA 4UT3A 4TUIA 2ZOAA 3C9FA 3RL5A 1S95A 2WDFA 4V0VA 2IE3C 1II7A 1WARA 3THOB 4UT2A 4UT3B 2WDDA 2R17A 1S70A 4MP0A 1AUIA 2XMOA 3E7BA 4H1SA 2WDEA 2BQ8X 3K7VC 2YVTA 2Z1AA 4OR9A 4V0WA 1KBPA 1USHA 1FJMA 3TGHA 1QFCA 2CV9A 1JK7A 4JA7A 1HP1A 3DW8C 3QFNA
chains in the Genus database with same CATH topology
2Z06A 3QFMA 4MOYA 3DSCA 4I5NC 4F0ZA 5JJTA 1T71A 2GJUA 3P71C 5B8IA 4TUGA 5JPEA 1HPUA 3EGGA 5DNYA 2ZBMA 4LU9A 4H2FA 5J28A 4ZX2A 3IVDA 1S8EA 4G9JA 2P6BA 3QFKA 4DSYA 5EQVA 2QFRA 4ORAA 3D03A 3RL4A 3EGHA 1WAO1 1OIEA 2HYOA 3JYFA 4O5GA 2IAEC 5C1VA 3H61A 5GTUA 3H60A 1OIDA 2NXFA 1XZWA 2DXLA 4ORBA 2NYLC 4LACC 2DFJA 4M0VA 1HO5A 2KKNA 3IB7A 3DSDA 3ZU0A 3THNA 4KBPA 2Q8UA 3H62B 3C5WC 4B2OA 1S3NA 1M63A 2HY1A 2O8GA 3K7WC 3RL3A 4H2GA 3KBPA 4IYPC 4WWLA 5INBA 4DHLA 3ZTVA 1W24A 4ZVZA 3IVEA 4LTYA 4HD0A 4Q7FA 1S3LA 4JA9A 1IT6A 4IL1A 2BCDA 3RQZA 1QHWA 1UTEA 2AHDA 3E0JA 2HYPA 1G5BA 2IE4C 3PSNA 2ZO9B 3H63A 2BDXA 1Z2WA 3PSOA 5F3WA 3QG5C 3AV0A 3E7AA 4FBWA 4FBKA 2DXNA 2WDCA 3H69A 2JOGA 2QFPA 3T1IA 1TCOA 1UF3A 3GVEA 4H2BA 4O43A 3FLOA 3H66A 4ORCA 4KKZA 5JPFA 3QFOA 3N5UA 1XM7A 1U32A 1NNWA 2YEQA 3H64A 4O24A 3FGAC 1T70A 4V0XA 2O8AA 4XPNA 1SU1A 3H68A 2NYMC 5HPEA 4FBQA 2QJCA 2A22A 3CK2A 3HVQA 1MF8A 2USHA 3V4YA 2Z72A 4H1YP 4I5LC 4NZVA 4O4KA 5IOHA 1V73A 3H67A 4MOVA 4J6OA 1S3MA 4H2IA 3LL8A 2NPPC 4DT2A 1OI8A 4UWQA 4YKEA 3AUZA 1Z2XA 3IB8A 4FCXA 3ICFA 4UT3A 4TUIA 2ZOAA 3C9FA 3RL5A 1S95A 2WDFA 4V0VA 2IE3C 1II7A 1WARA 3THOB 4UT2A 4UT3B 2WDDA 2R17A 1S70A 4MP0A 1AUIA 2XMOA 3E7BA 4H1SA 2WDEA 2BQ8X 3K7VC 2YVTA 2Z1AA 4OR9A 4V0WA 1KBPA 1USHA 1FJMA 3TGHA 1QFCA 2CV9A 1JK7A 4JA7A 1HP1A 3DW8C 3QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z06 A;  3QFM A;  4MOY A;  3DSC A;  4I5N C;  4F0Z A;  5JJT A;  1T71 A;  2GJU A;  3P71 C;  5B8I A;  4TUG A;  5JPE A;  1HPU A;  3EGG A;  5DNY A;  2ZBM A;  4LU9 A;  4H2F A;  5J28 A;  4ZX2 A;  3IVD A;  1S8E A;  4G9J A;  2P6B A;  3QFK A;  4DSY A;  5EQV A;  2QFR A;  4ORA A;  3RL4 A;  3EGH A;  1WAO 1;  1OIE A;  2HYO A;  3JYF A;  4O5G A;  2IAE C;  5C1V A;  3H61 A;  5GTU A;  3H60 A;  1OID A;  2NXF A;  1XZW A;  4ORB A;  2NYL C;  4LAC C;  2DFJ A;  4M0V A;  1HO5 A;  2KKN A;  3IB7 A;  3DSD A;  3ZU0 A;  3THN A;  4KBP A;  2Q8U A;  3H62 B;  3C5W C;  4B2O A;  1S3N A;  1M63 A;  2HY1 A;  2O8G A;  3K7W C;  3RL3 A;  4H2G A;  3KBP A;  4IYP C;  4WWL A;  5INB A;  4DHL A;  3ZTV A;  1W24 A;  4ZVZ A;  3IVE A;  4LTY A;  4HD0 A;  4Q7F A;  1S3L A;  4JA9 A;  1IT6 A;  4IL1 A;  2BCD A;  3RQZ A;  1QHW A;  1UTE A;  2AHD A;  2HYP A;  1G5B A;  2IE4 C;  3PSN A;  3H63 A;  2BDX A;  1Z2W A;  3PSO A;  5F3W A;  3QG5 C;  3AV0 A;  3E7A A;  4FBW A;  4FBK A;  2WDC A;  3H69 A;  2JOG A;  2QFP A;  3T1I A;  1TCO A;  1UF3 A;  3GVE A;  4H2B A;  4O43 A;  3H66 A;  4ORC A;  4KKZ A;  5JPF A;  3QFO A;  3N5U A;  1XM7 A;  1U32 A;  1NNW A;  3H64 A;  4O24 A;  3FGA C;  1T70 A;  4V0X A;  2O8A A;  4XPN A;  1SU1 A;  3H68 A;  2NYM C;  5HPE A;  4FBQ A;  2QJC A;  2A22 A;  3CK2 A;  3HVQ A;  1MF8 A;  2USH A;  3V4Y A;  2Z72 A;  4H1Y P;  4I5L C;  4NZV A;  4O4K A;  5IOH A;  1V73 A;  3H67 A;  4MOV A;  4J6O A;  1S3M A;  4H2I A;  3LL8 A;  2NPP C;  4DT2 A;  1OI8 A;  4UWQ A;  4YKE A;  3AUZ A;  1Z2X A;  3IB8 A;  4FCX A;  3ICF A;  4UT3 A;  4TUI A;  3C9F A;  3RL5 A;  1S95 A;  2WDF A;  4V0V A;  2IE3 C;  1II7 A;  1WAR A;  3THO B;  4UT2 A;  4UT3 B;  2WDD A;  2R17 A;  1S70 A;  4MP0 A;  1AUI A;  2XMO A;  3E7B A;  4H1S A;  2WDE A;  2BQ8 X;  3K7V C;  2YVT A;  2Z1A A;  4OR9 A;  4V0W A;  1KBP A;  1USH A;  1FJM A;  3TGH A;  1QFC A;  2CV9 A;  1JK7 A;  4JA7 A;  1HP1 A;  3DW8 C;  3QFN A; 
#chains in the Genus database with same CATH topology
 2Z06 A;  3QFM A;  4MOY A;  3DSC A;  4I5N C;  4F0Z A;  5JJT A;  1T71 A;  2GJU A;  3P71 C;  5B8I A;  4TUG A;  5JPE A;  1HPU A;  3EGG A;  5DNY A;  2ZBM A;  4LU9 A;  4H2F A;  5J28 A;  4ZX2 A;  3IVD A;  1S8E A;  4G9J A;  2P6B A;  3QFK A;  4DSY A;  5EQV A;  2QFR A;  4ORA A;  3D03 A;  3RL4 A;  3EGH A;  1WAO 1;  1OIE A;  2HYO A;  3JYF A;  4O5G A;  2IAE C;  5C1V A;  3H61 A;  5GTU A;  3H60 A;  1OID A;  2NXF A;  1XZW A;  2DXL A;  4ORB A;  2NYL C;  4LAC C;  2DFJ A;  4M0V A;  1HO5 A;  2KKN A;  3IB7 A;  3DSD A;  3ZU0 A;  3THN A;  4KBP A;  2Q8U A;  3H62 B;  3C5W C;  4B2O A;  1S3N A;  1M63 A;  2HY1 A;  2O8G A;  3K7W C;  3RL3 A;  4H2G A;  3KBP A;  4IYP C;  4WWL A;  5INB A;  4DHL A;  3ZTV A;  1W24 A;  4ZVZ A;  3IVE A;  4LTY A;  4HD0 A;  4Q7F A;  1S3L A;  4JA9 A;  1IT6 A;  4IL1 A;  2BCD A;  3RQZ A;  1QHW A;  1UTE A;  2AHD A;  3E0J A;  2HYP A;  1G5B A;  2IE4 C;  3PSN A;  2ZO9 B;  3H63 A;  2BDX A;  1Z2W A;  3PSO A;  5F3W A;  3QG5 C;  3AV0 A;  3E7A A;  4FBW A;  4FBK A;  2DXN A;  2WDC A;  3H69 A;  2JOG A;  2QFP A;  3T1I A;  1TCO A;  1UF3 A;  3GVE A;  4H2B A;  4O43 A;  3FLO A;  3H66 A;  4ORC A;  4KKZ A;  5JPF A;  3QFO A;  3N5U A;  1XM7 A;  1U32 A;  1NNW A;  2YEQ A;  3H64 A;  4O24 A;  3FGA C;  1T70 A;  4V0X A;  2O8A A;  4XPN A;  1SU1 A;  3H68 A;  2NYM C;  5HPE A;  4FBQ A;  2QJC A;  2A22 A;  3CK2 A;  3HVQ A;  1MF8 A;  2USH A;  3V4Y A;  2Z72 A;  4H1Y P;  4I5L C;  4NZV A;  4O4K A;  5IOH A;  1V73 A;  3H67 A;  4MOV A;  4J6O A;  1S3M A;  4H2I A;  3LL8 A;  2NPP C;  4DT2 A;  1OI8 A;  4UWQ A;  4YKE A;  3AUZ A;  1Z2X A;  3IB8 A;  4FCX A;  3ICF A;  4UT3 A;  4TUI A;  2ZOA A;  3C9F A;  3RL5 A;  1S95 A;  2WDF A;  4V0V A;  2IE3 C;  1II7 A;  1WAR A;  3THO B;  4UT2 A;  4UT3 B;  2WDD A;  2R17 A;  1S70 A;  4MP0 A;  1AUI A;  2XMO A;  3E7B A;  4H1S A;  2WDE A;  2BQ8 X;  3K7V C;  2YVT A;  2Z1A A;  4OR9 A;  4V0W A;  1KBP A;  1USH A;  1FJM A;  3TGH A;  1QFC A;  2CV9 A;  1JK7 A;  4JA7 A;  1HP1 A;  3DW8 C;  3QFN A; 
#chains in the Genus database with same CATH homology
 2Z06 A;  3QFM A;  4MOY A;  3DSC A;  4I5N C;  4F0Z A;  5JJT A;  1T71 A;  2GJU A;  3P71 C;  5B8I A;  4TUG A;  5JPE A;  1HPU A;  3EGG A;  5DNY A;  2ZBM A;  4LU9 A;  4H2F A;  5J28 A;  4ZX2 A;  3IVD A;  1S8E A;  4G9J A;  2P6B A;  3QFK A;  4DSY A;  5EQV A;  2QFR A;  4ORA A;  3D03 A;  3RL4 A;  3EGH A;  1WAO 1;  1OIE A;  2HYO A;  3JYF A;  4O5G A;  2IAE C;  5C1V A;  3H61 A;  5GTU A;  3H60 A;  1OID A;  2NXF A;  1XZW A;  2DXL A;  4ORB A;  2NYL C;  4LAC C;  2DFJ A;  4M0V A;  1HO5 A;  2KKN A;  3IB7 A;  3DSD A;  3ZU0 A;  3THN A;  4KBP A;  2Q8U A;  3H62 B;  3C5W C;  4B2O A;  1S3N A;  1M63 A;  2HY1 A;  2O8G A;  3K7W C;  3RL3 A;  4H2G A;  3KBP A;  4IYP C;  4WWL A;  5INB A;  4DHL A;  3ZTV A;  1W24 A;  4ZVZ A;  3IVE A;  4LTY A;  4HD0 A;  4Q7F A;  1S3L A;  4JA9 A;  1IT6 A;  4IL1 A;  2BCD A;  3RQZ A;  1QHW A;  1UTE A;  2AHD A;  3E0J A;  2HYP A;  1G5B A;  2IE4 C;  3PSN A;  2ZO9 B;  3H63 A;  2BDX A;  1Z2W A;  3PSO A;  5F3W A;  3QG5 C;  3AV0 A;  3E7A A;  4FBW A;  4FBK A;  2DXN A;  2WDC A;  3H69 A;  2JOG A;  2QFP A;  3T1I A;  1TCO A;  1UF3 A;  3GVE A;  4H2B A;  4O43 A;  3FLO A;  3H66 A;  4ORC A;  4KKZ A;  5JPF A;  3QFO A;  3N5U A;  1XM7 A;  1U32 A;  1NNW A;  2YEQ A;  3H64 A;  4O24 A;  3FGA C;  1T70 A;  4V0X A;  2O8A A;  4XPN A;  1SU1 A;  3H68 A;  2NYM C;  5HPE A;  4FBQ A;  2QJC A;  2A22 A;  3CK2 A;  3HVQ A;  1MF8 A;  2USH A;  3V4Y A;  2Z72 A;  4H1Y P;  4I5L C;  4NZV A;  4O4K A;  5IOH A;  1V73 A;  3H67 A;  4MOV A;  4J6O A;  1S3M A;  4H2I A;  3LL8 A;  2NPP C;  4DT2 A;  1OI8 A;  4UWQ A;  4YKE A;  3AUZ A;  1Z2X A;  3IB8 A;  4FCX A;  3ICF A;  4UT3 A;  4TUI A;  2ZOA A;  3C9F A;  3RL5 A;  1S95 A;  2WDF A;  4V0V A;  2IE3 C;  1II7 A;  1WAR A;  3THO B;  4UT2 A;  4UT3 B;  2WDD A;  2R17 A;  1S70 A;  4MP0 A;  1AUI A;  2XMO A;  3E7B A;  4H1S A;  2WDE A;  2BQ8 X;  3K7V C;  2YVT A;  2Z1A A;  4OR9 A;  4V0W A;  1KBP A;  1USH A;  1FJM A;  3TGH A;  1QFC A;  2CV9 A;  1JK7 A;  4JA7 A;  1HP1 A;  3DW8 C;  3QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...