3V4YA

Crystal structure of the first nuclear pp1 holoenzyme
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title The Molecular Basis for Substrate Specificity of the Nuclear NIPP1:PP1 Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 293
sequence length 293
chains with identical sequence C, E, G
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3v4yA00
5J28A 3H60A 2QFPA 1HO5A 3AV0A 4MOVA 4V0XA 2P6BA 2Q8UA 5C1VA 1S3LA 4O24A 2R17A 3T1IA 1OIDA 2Z06A 1TCOA 2WDEA 4H1SA 4ZVZA 4IL1A 3JYFA 2AHDA 4DHLA 1USHA 4J6OA 1T71A 1IT6A 2O8GA 4HD0A 2HYOA 4TUGA 4I5LC 4M0VA 1Z2WA 1AUIA 5EQVA 2QJCA 1WARA 2IE4C 2QFRA 1KBPA 4KBPA 3E7AA 3THOB 5INBA 5IOHA 4H2BA 2NPPC 1SU1A 4ORCA 1HPUA 1OIEA 3HVQA 2HY1A 2JOGA 3P71C 2GJUA 4ORAA 3ZTVA 1S3NA 3FGAC 1S70A 3IB8A 3QG5C 5F3WA 3DW8C 3H62B 4FBQA 1QFCA 5HPEA 3TGHA 4JA7A 4IYPC 2USHA 3QFMA 1S95A 3EGHA 4H2FA 5GTUA 4O43A 1HP1A 4B2OA 2O8AA 1M63A 4ORBA 2CV9A 3EGGA 4ZX2A 1S3MA 2BDXA 4UT2A 2XMOA 1U32A 3LL8A 3N5UA 3E7BA 4MOYA 1II7A 4NZVA 1WAO1 3DSCA 4OR9A 3H69A 3H68A 1JK7A 4DSYA 4KKZA 3DSDA 2KKNA 1T70A 3AUZA 4G9JA 1UF3A 2IAEC 3QFKA 4XPNA 1FJMA 4FBWA 4TUIA 3K7WC 1MF8A 4I5NC 2HYPA 3IVEA 1OI8A 1Z2XA 2A22A 3C5WC 3RL5A 3PSOA 4YKEA 3THNA 3PSNA 3RL3A 1XM7A 2WDCA 2BQ8X 2NXFA 4F0ZA 5DNYA 4UT3A 3KBPA 3RL4A 2YVTA 4MP0A 3H66A 4UT3B 4JA9A 2WDFA 2Z72A 4UWQA 4O5GA 3ICFA 3V4YA 3K7VC 4V0WA 2BCDA 3QFNA 4LTYA 4H2IA 3CK2A 4LACC 3ZU0A 1G5BA 2WDDA 2ZBMA 5JPFA 4V0VA 1QHWA 1V73A 3GVEA 3RQZA 3H61A 3IVDA 3H67A 4LU9A 5B8IA 2Z1AA 5JPEA 4DT2A 2NYMC 2DFJA 3C9FA 4H1YP 3H64A 4FCXA 4O4KA 4H2GA 1UTEA 3QFOA 3H63A 1W24A 4FBKA 1XZWA 5JJTA 1NNWA 2IE3C 4Q7FA 4WWLA 1S8EA 3IB7A 2NYLC
chains in the Genus database with same CATH superfamily
5J28A 3H60A 2QFPA 1HO5A 3AV0A 4MOVA 4V0XA 2P6BA 2Q8UA 5C1VA 1S3LA 4O24A 2R17A 3T1IA 1OIDA 2Z06A 1TCOA 2WDEA 4H1SA 4ZVZA 4IL1A 3JYFA 2AHDA 4DHLA 1USHA 4J6OA 1T71A 1IT6A 2O8GA 4HD0A 2HYOA 4TUGA 4I5LC 4M0VA 1Z2WA 1AUIA 3FLOA 5EQVA 2QJCA 1WARA 2IE4C 2QFRA 1KBPA 4KBPA 3E7AA 3THOB 5INBA 5IOHA 4H2BA 2NPPC 1SU1A 4ORCA 1HPUA 1OIEA 3HVQA 2HY1A 2JOGA 3P71C 2GJUA 4ORAA 3ZTVA 1S3NA 3FGAC 1S70A 3IB8A 3QG5C 5F3WA 3DW8C 3H62B 4FBQA 1QFCA 5HPEA 3TGHA 4JA7A 4IYPC 2USHA 3QFMA 1S95A 3EGHA 4H2FA 5GTUA 4O43A 1HP1A 4B2OA 2O8AA 1M63A 4ORBA 2CV9A 3EGGA 4ZX2A 1S3MA 2BDXA 4UT2A 2XMOA 1U32A 3LL8A 3N5UA 3E7BA 4MOYA 1II7A 4NZVA 1WAO1 3DSCA 4OR9A 3H69A 3H68A 1JK7A 4DSYA 4KKZA 3DSDA 2KKNA 1T70A 3AUZA 4G9JA 1UF3A 2IAEC 2YEQA 3QFKA 4XPNA 1FJMA 4FBWA 4TUIA 3K7WC 1MF8A 4I5NC 2HYPA 3IVEA 1OI8A 1Z2XA 3D03A 2A22A 3C5WC 3RL5A 3PSOA 4YKEA 3THNA 3PSNA 3RL3A 3E0JA 1XM7A 2WDCA 2BQ8X 2NXFA 4F0ZA 5DNYA 4UT3A 3KBPA 3RL4A 2YVTA 4MP0A 3H66A 4UT3B 4JA9A 2WDFA 2Z72A 4UWQA 4O5GA 3ICFA 3V4YA 3K7VC 4V0WA 2BCDA 3QFNA 4LTYA 4H2IA 3CK2A 4LACC 3ZU0A 1G5BA 2WDDA 2ZBMA 5JPFA 4V0VA 1QHWA 1V73A 3GVEA 3RQZA 3H61A 3IVDA 3H67A 4LU9A 5B8IA 2Z1AA 5JPEA 4DT2A 2NYMC 2DFJA 3C9FA 4H1YP 3H64A 4FCXA 2DXLA 4H2GA 1UTEA 3QFOA 4O4KA 3H63A 1W24A 4FBKA 1XZWA 2ZOAA 5JJTA 1NNWA 2ZO9B 2IE3C 4Q7FA 4WWLA 1S8EA 2DXNA 3IB7A 2NYLC
chains in the Genus database with same CATH topology
5J28A 3H60A 2QFPA 1HO5A 3AV0A 4MOVA 4V0XA 2P6BA 2Q8UA 5C1VA 1S3LA 4O24A 2R17A 3T1IA 1OIDA 2Z06A 1TCOA 2WDEA 4H1SA 4ZVZA 4IL1A 3JYFA 2AHDA 4DHLA 1USHA 4J6OA 1T71A 1IT6A 2O8GA 4HD0A 2HYOA 4TUGA 4I5LC 4M0VA 1Z2WA 1AUIA 3FLOA 5EQVA 2QJCA 1WARA 2IE4C 2QFRA 1KBPA 4KBPA 3E7AA 3THOB 5INBA 5IOHA 4H2BA 2NPPC 1SU1A 4ORCA 1HPUA 1OIEA 3HVQA 2HY1A 2JOGA 3P71C 2GJUA 4ORAA 3ZTVA 1S3NA 3FGAC 1S70A 3IB8A 3QG5C 5F3WA 3DW8C 3H62B 4FBQA 1QFCA 5HPEA 3TGHA 4JA7A 4IYPC 2USHA 3QFMA 1S95A 3EGHA 4H2FA 5GTUA 4O43A 1HP1A 4B2OA 2O8AA 1M63A 4ORBA 2CV9A 3EGGA 4ZX2A 1S3MA 2BDXA 4UT2A 2XMOA 1U32A 3LL8A 3N5UA 3E7BA 4MOYA 1II7A 4NZVA 1WAO1 3DSCA 4OR9A 3H69A 3H68A 1JK7A 4DSYA 4KKZA 3DSDA 2KKNA 1T70A 3AUZA 4G9JA 1UF3A 2IAEC 2YEQA 3QFKA 4XPNA 1FJMA 4FBWA 4TUIA 3K7WC 1MF8A 4I5NC 2HYPA 3IVEA 1OI8A 1Z2XA 3D03A 2A22A 3C5WC 3RL5A 3PSOA 4YKEA 3THNA 3PSNA 3RL3A 3E0JA 1XM7A 2WDCA 2BQ8X 2NXFA 4F0ZA 5DNYA 4UT3A 3KBPA 3RL4A 2YVTA 4MP0A 3H66A 4UT3B 4JA9A 2WDFA 2Z72A 4UWQA 4O5GA 3ICFA 3V4YA 3K7VC 4V0WA 2BCDA 3QFNA 4LTYA 4H2IA 3CK2A 4LACC 3ZU0A 1G5BA 2WDDA 2ZBMA 5JPFA 4V0VA 1QHWA 1V73A 3GVEA 3RQZA 3H61A 3IVDA 3H67A 4LU9A 5B8IA 2Z1AA 5JPEA 4DT2A 2NYMC 2DFJA 3C9FA 4H1YP 3H64A 4FCXA 2DXLA 4H2GA 1UTEA 3QFOA 4O4KA 3H63A 1W24A 4FBKA 1XZWA 2ZOAA 5JJTA 1NNWA 2ZO9B 2IE3C 4Q7FA 4WWLA 1S8EA 2DXNA 3IB7A 2NYLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J28 A;  3H60 A;  2QFP A;  1HO5 A;  3AV0 A;  4MOV A;  4V0X A;  2P6B A;  2Q8U A;  5C1V A;  1S3L A;  4O24 A;  2R17 A;  3T1I A;  1OID A;  2Z06 A;  1TCO A;  2WDE A;  4H1S A;  4ZVZ A;  4IL1 A;  3JYF A;  2AHD A;  4DHL A;  1USH A;  4J6O A;  1T71 A;  1IT6 A;  2O8G A;  4HD0 A;  2HYO A;  4TUG A;  4I5L C;  4M0V A;  1Z2W A;  1AUI A;  5EQV A;  2QJC A;  1WAR A;  2IE4 C;  2QFR A;  1KBP A;  4KBP A;  3E7A A;  3THO B;  5INB A;  5IOH A;  4H2B A;  2NPP C;  1SU1 A;  4ORC A;  1HPU A;  1OIE A;  3HVQ A;  2HY1 A;  2JOG A;  3P71 C;  2GJU A;  4ORA A;  3ZTV A;  1S3N A;  3FGA C;  1S70 A;  3IB8 A;  3QG5 C;  5F3W A;  3DW8 C;  3H62 B;  4FBQ A;  1QFC A;  5HPE A;  3TGH A;  4JA7 A;  4IYP C;  2USH A;  3QFM A;  1S95 A;  3EGH A;  4H2F A;  5GTU A;  4O43 A;  1HP1 A;  4B2O A;  2O8A A;  1M63 A;  4ORB A;  2CV9 A;  3EGG A;  4ZX2 A;  1S3M A;  2BDX A;  4UT2 A;  2XMO A;  1U32 A;  3LL8 A;  3N5U A;  3E7B A;  4MOY A;  1II7 A;  4NZV A;  1WAO 1;  3DSC A;  4OR9 A;  3H69 A;  3H68 A;  1JK7 A;  4DSY A;  4KKZ A;  3DSD A;  2KKN A;  1T70 A;  3AUZ A;  4G9J A;  1UF3 A;  2IAE C;  3QFK A;  4XPN A;  1FJM A;  4FBW A;  4TUI A;  3K7W C;  1MF8 A;  4I5N C;  2HYP A;  3IVE A;  1OI8 A;  1Z2X A;  2A22 A;  3C5W C;  3RL5 A;  3PSO A;  4YKE A;  3THN A;  3PSN A;  3RL3 A;  1XM7 A;  2WDC A;  2BQ8 X;  2NXF A;  4F0Z A;  5DNY A;  4UT3 A;  3KBP A;  3RL4 A;  2YVT A;  4MP0 A;  3H66 A;  4UT3 B;  4JA9 A;  2WDF A;  2Z72 A;  4UWQ A;  4O5G A;  3ICF A;  3V4Y A;  3K7V C;  4V0W A;  2BCD A;  3QFN A;  4LTY A;  4H2I A;  3CK2 A;  4LAC C;  3ZU0 A;  1G5B A;  2WDD A;  2ZBM A;  5JPF A;  4V0V A;  1QHW A;  1V73 A;  3GVE A;  3RQZ A;  3H61 A;  3IVD A;  3H67 A;  4LU9 A;  5B8I A;  2Z1A A;  5JPE A;  4DT2 A;  2NYM C;  2DFJ A;  3C9F A;  4H1Y P;  3H64 A;  4FCX A;  4O4K A;  4H2G A;  1UTE A;  3QFO A;  3H63 A;  1W24 A;  4FBK A;  1XZW A;  5JJT A;  1NNW A;  2IE3 C;  4Q7F A;  4WWL A;  1S8E A;  3IB7 A;  2NYL C; 
#chains in the Genus database with same CATH topology
 5J28 A;  3H60 A;  2QFP A;  1HO5 A;  3AV0 A;  4MOV A;  4V0X A;  2P6B A;  2Q8U A;  5C1V A;  1S3L A;  4O24 A;  2R17 A;  3T1I A;  1OID A;  2Z06 A;  1TCO A;  2WDE A;  4H1S A;  4ZVZ A;  4IL1 A;  3JYF A;  2AHD A;  4DHL A;  1USH A;  4J6O A;  1T71 A;  1IT6 A;  2O8G A;  4HD0 A;  2HYO A;  4TUG A;  4I5L C;  4M0V A;  1Z2W A;  1AUI A;  3FLO A;  5EQV A;  2QJC A;  1WAR A;  2IE4 C;  2QFR A;  1KBP A;  4KBP A;  3E7A A;  3THO B;  5INB A;  5IOH A;  4H2B A;  2NPP C;  1SU1 A;  4ORC A;  1HPU A;  1OIE A;  3HVQ A;  2HY1 A;  2JOG A;  3P71 C;  2GJU A;  4ORA A;  3ZTV A;  1S3N A;  3FGA C;  1S70 A;  3IB8 A;  3QG5 C;  5F3W A;  3DW8 C;  3H62 B;  4FBQ A;  1QFC A;  5HPE A;  3TGH A;  4JA7 A;  4IYP C;  2USH A;  3QFM A;  1S95 A;  3EGH A;  4H2F A;  5GTU A;  4O43 A;  1HP1 A;  4B2O A;  2O8A A;  1M63 A;  4ORB A;  2CV9 A;  3EGG A;  4ZX2 A;  1S3M A;  2BDX A;  4UT2 A;  2XMO A;  1U32 A;  3LL8 A;  3N5U A;  3E7B A;  4MOY A;  1II7 A;  4NZV A;  1WAO 1;  3DSC A;  4OR9 A;  3H69 A;  3H68 A;  1JK7 A;  4DSY A;  4KKZ A;  3DSD A;  2KKN A;  1T70 A;  3AUZ A;  4G9J A;  1UF3 A;  2IAE C;  2YEQ A;  3QFK A;  4XPN A;  1FJM A;  4FBW A;  4TUI A;  3K7W C;  1MF8 A;  4I5N C;  2HYP A;  3IVE A;  1OI8 A;  1Z2X A;  3D03 A;  2A22 A;  3C5W C;  3RL5 A;  3PSO A;  4YKE A;  3THN A;  3PSN A;  3RL3 A;  3E0J A;  1XM7 A;  2WDC A;  2BQ8 X;  2NXF A;  4F0Z A;  5DNY A;  4UT3 A;  3KBP A;  3RL4 A;  2YVT A;  4MP0 A;  3H66 A;  4UT3 B;  4JA9 A;  2WDF A;  2Z72 A;  4UWQ A;  4O5G A;  3ICF A;  3V4Y A;  3K7V C;  4V0W A;  2BCD A;  3QFN A;  4LTY A;  4H2I A;  3CK2 A;  4LAC C;  3ZU0 A;  1G5B A;  2WDD A;  2ZBM A;  5JPF A;  4V0V A;  1QHW A;  1V73 A;  3GVE A;  3RQZ A;  3H61 A;  3IVD A;  3H67 A;  4LU9 A;  5B8I A;  2Z1A A;  5JPE A;  4DT2 A;  2NYM C;  2DFJ A;  3C9F A;  4H1Y P;  3H64 A;  4FCX A;  2DXL A;  4H2G A;  1UTE A;  3QFO A;  4O4K A;  3H63 A;  1W24 A;  4FBK A;  1XZW A;  2ZOA A;  5JJT A;  1NNW A;  2ZO9 B;  2IE3 C;  4Q7F A;  4WWL A;  1S8E A;  2DXN A;  3IB7 A;  2NYL C; 
#chains in the Genus database with same CATH homology
 5J28 A;  3H60 A;  2QFP A;  1HO5 A;  3AV0 A;  4MOV A;  4V0X A;  2P6B A;  2Q8U A;  5C1V A;  1S3L A;  4O24 A;  2R17 A;  3T1I A;  1OID A;  2Z06 A;  1TCO A;  2WDE A;  4H1S A;  4ZVZ A;  4IL1 A;  3JYF A;  2AHD A;  4DHL A;  1USH A;  4J6O A;  1T71 A;  1IT6 A;  2O8G A;  4HD0 A;  2HYO A;  4TUG A;  4I5L C;  4M0V A;  1Z2W A;  1AUI A;  3FLO A;  5EQV A;  2QJC A;  1WAR A;  2IE4 C;  2QFR A;  1KBP A;  4KBP A;  3E7A A;  3THO B;  5INB A;  5IOH A;  4H2B A;  2NPP C;  1SU1 A;  4ORC A;  1HPU A;  1OIE A;  3HVQ A;  2HY1 A;  2JOG A;  3P71 C;  2GJU A;  4ORA A;  3ZTV A;  1S3N A;  3FGA C;  1S70 A;  3IB8 A;  3QG5 C;  5F3W A;  3DW8 C;  3H62 B;  4FBQ A;  1QFC A;  5HPE A;  3TGH A;  4JA7 A;  4IYP C;  2USH A;  3QFM A;  1S95 A;  3EGH A;  4H2F A;  5GTU A;  4O43 A;  1HP1 A;  4B2O A;  2O8A A;  1M63 A;  4ORB A;  2CV9 A;  3EGG A;  4ZX2 A;  1S3M A;  2BDX A;  4UT2 A;  2XMO A;  1U32 A;  3LL8 A;  3N5U A;  3E7B A;  4MOY A;  1II7 A;  4NZV A;  1WAO 1;  3DSC A;  4OR9 A;  3H69 A;  3H68 A;  1JK7 A;  4DSY A;  4KKZ A;  3DSD A;  2KKN A;  1T70 A;  3AUZ A;  4G9J A;  1UF3 A;  2IAE C;  2YEQ A;  3QFK A;  4XPN A;  1FJM A;  4FBW A;  4TUI A;  3K7W C;  1MF8 A;  4I5N C;  2HYP A;  3IVE A;  1OI8 A;  1Z2X A;  3D03 A;  2A22 A;  3C5W C;  3RL5 A;  3PSO A;  4YKE A;  3THN A;  3PSN A;  3RL3 A;  3E0J A;  1XM7 A;  2WDC A;  2BQ8 X;  2NXF A;  4F0Z A;  5DNY A;  4UT3 A;  3KBP A;  3RL4 A;  2YVT A;  4MP0 A;  3H66 A;  4UT3 B;  4JA9 A;  2WDF A;  2Z72 A;  4UWQ A;  4O5G A;  3ICF A;  3V4Y A;  3K7V C;  4V0W A;  2BCD A;  3QFN A;  4LTY A;  4H2I A;  3CK2 A;  4LAC C;  3ZU0 A;  1G5B A;  2WDD A;  2ZBM A;  5JPF A;  4V0V A;  1QHW A;  1V73 A;  3GVE A;  3RQZ A;  3H61 A;  3IVD A;  3H67 A;  4LU9 A;  5B8I A;  2Z1A A;  5JPE A;  4DT2 A;  2NYM C;  2DFJ A;  3C9F A;  4H1Y P;  3H64 A;  4FCX A;  2DXL A;  4H2G A;  1UTE A;  3QFO A;  4O4K A;  3H63 A;  1W24 A;  4FBK A;  1XZW A;  2ZOA A;  5JJT A;  1NNW A;  2ZO9 B;  2IE3 C;  4Q7F A;  4WWL A;  1S8E A;  2DXN A;  3IB7 A;  2NYL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...