3V4YA

Crystal structure of the first nuclear pp1 holoenzyme
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis for Substrate Specificity of the Nuclear NIPP1:PP1 Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 99
structure length 293
sequence length 293
chains with identical sequence C, E, G
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3v4yA00
3E7AA 1WAO1 4FBWA 4MOYA 4V0WA 5INBA 3QFKA 1M63A 2QFRA 3H66A 2BQ8X 1G5BA 3AUZA 2CV9A 2WDDA 1AUIA 4H1YP 4UT2A 1QFCA 1U32A 3RL5A 3EGGA 3QFNA 4MOVA 1S95A 3K7VC 1OI8A 5F3WA 1S3MA 1Z2WA 3FGAC 1HO5A 2Z72A 1QHWA 3LL8A 4HD0A 5EQVA 2IE3C 1II7A 1KBPA 1S8EA 1OIDA 2AHDA 2JOGA 2NPPC 2WDEA 3P71C 3H61A 4M0VA 3DSCA 4V0VA 4FCXA 2WDCA 2USHA 1OIEA 2HYOA 4DT2A 1W24A 3E7BA 4UT3B 3ZTVA 5JPEA 5JPFA 2A22A 4IL1A 3H67A 4IYPC 4JA9A 1S70A 2HYPA 3T1IA 4ZX2A 3THOB 3DW8C 1MF8A 4XPNA 3JYFA 1TCOA 2O8GA 2Z06A 2R17A 4J6OA 2O8AA 4KBPA 3C9FA 3PSNA 4JA7A 4O24A 2QJCA 3HVQA 5J28A 3N5UA 1FJMA 3PSOA 4O43A 3RL3A 4FBKA 4DHLA 1UTEA 5JJTA 3H68A 3KBPA 4I5LC 3IVEA 1T70A 2NYLC 4H1SA 2NXFA 1XZWA 4O5GA 5C1VA 2IE4C 3H69A 4H2IA 3AV0A 3C5WC 1WARA 3H63A 3QFOA 4I5NC 2IAEC 4ORAA 3H60A 1JK7A 2Q8UA 4LACC 4LU9A 3H64A 4NZVA 1NNWA 3EGHA 2BCDA 3ICFA 4FBQA 4Q7FA 1IT6A 1S3LA 3QG5C 4TUIA 4H2FA 2GJUA 5HPEA 4F0ZA 5IOHA 2KKNA 4MP0A 2WDFA 3GVEA 2DFJA 1SU1A 1UF3A 4ORCA 3IB7A 3TGHA 1HPUA 4YKEA 4O4KA 2QFPA 4V0XA 1XM7A 2P6BA 4G9JA 3THNA 2ZBMA 2NYMC 4UT3A 4TUGA 1V73A 3H62B 2XMOA 3K7WC 4OR9A 3RQZA 2YVTA 1T71A 1Z2XA 4WWLA 3QFMA 1USHA 2Z1AA 4H2BA 4UWQA 4LTYA 4DSYA 4ZVZA 2BDXA 3DSDA 4KKZA 1S3NA 3IB8A 3CK2A 4H2GA 4B2OA 2HY1A 5GTUA 3RL4A 1HP1A 3IVDA 4ORBA 3V4YA 3ZU0A 5B8IA 5DNYA
chains in the Genus database with same CATH superfamily
3E7AA 1WAO1 4FBWA 4MOYA 4V0WA 5INBA 3QFKA 1M63A 2QFRA 3H66A 2BQ8X 1G5BA 3AUZA 2CV9A 2WDDA 1AUIA 4H1YP 4UT2A 1QFCA 1U32A 3RL5A 3EGGA 3QFNA 4MOVA 1S95A 3D03A 3E0JA 1OI8A 3K7VC 5F3WA 1S3MA 1Z2WA 3FGAC 1HO5A 2Z72A 1QHWA 3LL8A 4HD0A 5EQVA 2IE3C 1II7A 1KBPA 1S8EA 1OIDA 2AHDA 2JOGA 2NPPC 2WDEA 3P71C 3H61A 4M0VA 3DSCA 4V0VA 4FCXA 2WDCA 2USHA 1OIEA 2HYOA 4DT2A 1W24A 3E7BA 4UT3B 3ZTVA 5JPEA 5JPFA 2A22A 4IL1A 3H67A 4IYPC 4JA9A 1S70A 2HYPA 3T1IA 4ZX2A 3THOB 3DW8C 1MF8A 4XPNA 3JYFA 1TCOA 2O8GA 2Z06A 2R17A 4J6OA 2O8AA 2YEQA 4KBPA 3C9FA 3PSNA 4JA7A 4O24A 2QJCA 3HVQA 5J28A 3N5UA 1FJMA 3PSOA 4O43A 3RL3A 4FBKA 4DHLA 1UTEA 5JJTA 3H68A 3KBPA 4I5LC 3IVEA 1T70A 2NYLC 4H1SA 2NXFA 2DXLA 1XZWA 4O5GA 5C1VA 2IE4C 3H69A 4H2IA 3AV0A 3C5WC 1WARA 3H63A 3QFOA 4I5NC 2IAEC 3FLOA 4ORAA 3H60A 1JK7A 2Q8UA 4LACC 4LU9A 3H64A 4NZVA 1NNWA 3EGHA 2BCDA 3ICFA 4FBQA 4Q7FA 1IT6A 1S3LA 3QG5C 4TUIA 4H2FA 2GJUA 5HPEA 4F0ZA 5IOHA 2KKNA 4MP0A 2WDFA 3GVEA 2DFJA 2ZO9B 1SU1A 1UF3A 2ZOAA 2DXNA 4ORCA 3IB7A 3TGHA 1HPUA 4YKEA 4O4KA 2QFPA 4V0XA 1XM7A 2P6BA 4G9JA 3THNA 2ZBMA 2NYMC 4UT3A 4TUGA 1V73A 3H62B 2XMOA 3K7WC 4OR9A 3RQZA 2YVTA 1T71A 1Z2XA 4WWLA 3QFMA 1USHA 2Z1AA 4H2BA 4UWQA 4LTYA 4DSYA 4ZVZA 2BDXA 3DSDA 4KKZA 1S3NA 3IB8A 3CK2A 4H2GA 4B2OA 2HY1A 5GTUA 3RL4A 1HP1A 3IVDA 4ORBA 3V4YA 3ZU0A 5B8IA 5DNYA
chains in the Genus database with same CATH topology
3E7AA 1WAO1 4FBWA 4MOYA 4V0WA 5INBA 3QFKA 1M63A 2QFRA 3H66A 2BQ8X 1G5BA 3AUZA 2CV9A 2WDDA 1AUIA 4H1YP 4UT2A 1QFCA 1U32A 3RL5A 3EGGA 3QFNA 4MOVA 1S95A 3D03A 3E0JA 1OI8A 3K7VC 5F3WA 1S3MA 1Z2WA 3FGAC 1HO5A 2Z72A 1QHWA 3LL8A 4HD0A 5EQVA 2IE3C 1II7A 1KBPA 1S8EA 1OIDA 2AHDA 2JOGA 2NPPC 2WDEA 3P71C 3H61A 4M0VA 3DSCA 4V0VA 4FCXA 2WDCA 2USHA 1OIEA 2HYOA 4DT2A 1W24A 3E7BA 4UT3B 3ZTVA 5JPEA 5JPFA 2A22A 4IL1A 3H67A 4IYPC 4JA9A 1S70A 2HYPA 3T1IA 4ZX2A 3THOB 3DW8C 1MF8A 4XPNA 3JYFA 1TCOA 2O8GA 2Z06A 2R17A 4J6OA 2O8AA 2YEQA 4KBPA 3C9FA 3PSNA 4JA7A 4O24A 2QJCA 3HVQA 5J28A 3N5UA 1FJMA 3PSOA 4O43A 3RL3A 4FBKA 4DHLA 1UTEA 5JJTA 3H68A 3KBPA 4I5LC 3IVEA 1T70A 2NYLC 4H1SA 2NXFA 2DXLA 1XZWA 4O5GA 5C1VA 2IE4C 3H69A 4H2IA 3AV0A 3C5WC 1WARA 3H63A 3QFOA 4I5NC 2IAEC 3FLOA 4ORAA 3H60A 1JK7A 2Q8UA 4LACC 4LU9A 3H64A 4NZVA 1NNWA 3EGHA 2BCDA 3ICFA 4FBQA 4Q7FA 1IT6A 1S3LA 3QG5C 4TUIA 4H2FA 2GJUA 5HPEA 4F0ZA 5IOHA 2KKNA 4MP0A 2WDFA 3GVEA 2DFJA 2ZO9B 1SU1A 1UF3A 2ZOAA 2DXNA 4ORCA 3IB7A 3TGHA 1HPUA 4YKEA 4O4KA 2QFPA 4V0XA 1XM7A 2P6BA 4G9JA 3THNA 2ZBMA 2NYMC 4UT3A 4TUGA 1V73A 3H62B 2XMOA 3K7WC 4OR9A 3RQZA 2YVTA 1T71A 1Z2XA 4WWLA 3QFMA 1USHA 2Z1AA 4H2BA 4UWQA 4LTYA 4DSYA 4ZVZA 2BDXA 3DSDA 4KKZA 1S3NA 3IB8A 3CK2A 4H2GA 4B2OA 2HY1A 5GTUA 3RL4A 1HP1A 3IVDA 4ORBA 3V4YA 3ZU0A 5B8IA 5DNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7A A;  1WAO 1;  4FBW A;  4MOY A;  4V0W A;  5INB A;  3QFK A;  1M63 A;  2QFR A;  3H66 A;  2BQ8 X;  1G5B A;  3AUZ A;  2CV9 A;  2WDD A;  1AUI A;  4H1Y P;  4UT2 A;  1QFC A;  1U32 A;  3RL5 A;  3EGG A;  3QFN A;  4MOV A;  1S95 A;  3K7V C;  1OI8 A;  5F3W A;  1S3M A;  1Z2W A;  3FGA C;  1HO5 A;  2Z72 A;  1QHW A;  3LL8 A;  4HD0 A;  5EQV A;  2IE3 C;  1II7 A;  1KBP A;  1S8E A;  1OID A;  2AHD A;  2JOG A;  2NPP C;  2WDE A;  3P71 C;  3H61 A;  4M0V A;  3DSC A;  4V0V A;  4FCX A;  2WDC A;  2USH A;  1OIE A;  2HYO A;  4DT2 A;  1W24 A;  3E7B A;  4UT3 B;  3ZTV A;  5JPE A;  5JPF A;  2A22 A;  4IL1 A;  3H67 A;  4IYP C;  4JA9 A;  1S70 A;  2HYP A;  3T1I A;  4ZX2 A;  3THO B;  3DW8 C;  1MF8 A;  4XPN A;  3JYF A;  1TCO A;  2O8G A;  2Z06 A;  2R17 A;  4J6O A;  2O8A A;  4KBP A;  3C9F A;  3PSN A;  4JA7 A;  4O24 A;  2QJC A;  3HVQ A;  5J28 A;  3N5U A;  1FJM A;  3PSO A;  4O43 A;  3RL3 A;  4FBK A;  4DHL A;  1UTE A;  5JJT A;  3H68 A;  3KBP A;  4I5L C;  3IVE A;  1T70 A;  2NYL C;  4H1S A;  2NXF A;  1XZW A;  4O5G A;  5C1V A;  2IE4 C;  3H69 A;  4H2I A;  3AV0 A;  3C5W C;  1WAR A;  3H63 A;  3QFO A;  4I5N C;  2IAE C;  4ORA A;  3H60 A;  1JK7 A;  2Q8U A;  4LAC C;  4LU9 A;  3H64 A;  4NZV A;  1NNW A;  3EGH A;  2BCD A;  3ICF A;  4FBQ A;  4Q7F A;  1IT6 A;  1S3L A;  3QG5 C;  4TUI A;  4H2F A;  2GJU A;  5HPE A;  4F0Z A;  5IOH A;  2KKN A;  4MP0 A;  2WDF A;  3GVE A;  2DFJ A;  1SU1 A;  1UF3 A;  4ORC A;  3IB7 A;  3TGH A;  1HPU A;  4YKE A;  4O4K A;  2QFP A;  4V0X A;  1XM7 A;  2P6B A;  4G9J A;  3THN A;  2ZBM A;  2NYM C;  4UT3 A;  4TUG A;  1V73 A;  3H62 B;  2XMO A;  3K7W C;  4OR9 A;  3RQZ A;  2YVT A;  1T71 A;  1Z2X A;  4WWL A;  3QFM A;  1USH A;  2Z1A A;  4H2B A;  4UWQ A;  4LTY A;  4DSY A;  4ZVZ A;  2BDX A;  3DSD A;  4KKZ A;  1S3N A;  3IB8 A;  3CK2 A;  4H2G A;  4B2O A;  2HY1 A;  5GTU A;  3RL4 A;  1HP1 A;  3IVD A;  4ORB A;  3V4Y A;  3ZU0 A;  5B8I A;  5DNY A; 
#chains in the Genus database with same CATH topology
 3E7A A;  1WAO 1;  4FBW A;  4MOY A;  4V0W A;  5INB A;  3QFK A;  1M63 A;  2QFR A;  3H66 A;  2BQ8 X;  1G5B A;  3AUZ A;  2CV9 A;  2WDD A;  1AUI A;  4H1Y P;  4UT2 A;  1QFC A;  1U32 A;  3RL5 A;  3EGG A;  3QFN A;  4MOV A;  1S95 A;  3D03 A;  3E0J A;  1OI8 A;  3K7V C;  5F3W A;  1S3M A;  1Z2W A;  3FGA C;  1HO5 A;  2Z72 A;  1QHW A;  3LL8 A;  4HD0 A;  5EQV A;  2IE3 C;  1II7 A;  1KBP A;  1S8E A;  1OID A;  2AHD A;  2JOG A;  2NPP C;  2WDE A;  3P71 C;  3H61 A;  4M0V A;  3DSC A;  4V0V A;  4FCX A;  2WDC A;  2USH A;  1OIE A;  2HYO A;  4DT2 A;  1W24 A;  3E7B A;  4UT3 B;  3ZTV A;  5JPE A;  5JPF A;  2A22 A;  4IL1 A;  3H67 A;  4IYP C;  4JA9 A;  1S70 A;  2HYP A;  3T1I A;  4ZX2 A;  3THO B;  3DW8 C;  1MF8 A;  4XPN A;  3JYF A;  1TCO A;  2O8G A;  2Z06 A;  2R17 A;  4J6O A;  2O8A A;  2YEQ A;  4KBP A;  3C9F A;  3PSN A;  4JA7 A;  4O24 A;  2QJC A;  3HVQ A;  5J28 A;  3N5U A;  1FJM A;  3PSO A;  4O43 A;  3RL3 A;  4FBK A;  4DHL A;  1UTE A;  5JJT A;  3H68 A;  3KBP A;  4I5L C;  3IVE A;  1T70 A;  2NYL C;  4H1S A;  2NXF A;  2DXL A;  1XZW A;  4O5G A;  5C1V A;  2IE4 C;  3H69 A;  4H2I A;  3AV0 A;  3C5W C;  1WAR A;  3H63 A;  3QFO A;  4I5N C;  2IAE C;  3FLO A;  4ORA A;  3H60 A;  1JK7 A;  2Q8U A;  4LAC C;  4LU9 A;  3H64 A;  4NZV A;  1NNW A;  3EGH A;  2BCD A;  3ICF A;  4FBQ A;  4Q7F A;  1IT6 A;  1S3L A;  3QG5 C;  4TUI A;  4H2F A;  2GJU A;  5HPE A;  4F0Z A;  5IOH A;  2KKN A;  4MP0 A;  2WDF A;  3GVE A;  2DFJ A;  2ZO9 B;  1SU1 A;  1UF3 A;  2ZOA A;  2DXN A;  4ORC A;  3IB7 A;  3TGH A;  1HPU A;  4YKE A;  4O4K A;  2QFP A;  4V0X A;  1XM7 A;  2P6B A;  4G9J A;  3THN A;  2ZBM A;  2NYM C;  4UT3 A;  4TUG A;  1V73 A;  3H62 B;  2XMO A;  3K7W C;  4OR9 A;  3RQZ A;  2YVT A;  1T71 A;  1Z2X A;  4WWL A;  3QFM A;  1USH A;  2Z1A A;  4H2B A;  4UWQ A;  4LTY A;  4DSY A;  4ZVZ A;  2BDX A;  3DSD A;  4KKZ A;  1S3N A;  3IB8 A;  3CK2 A;  4H2G A;  4B2O A;  2HY1 A;  5GTU A;  3RL4 A;  1HP1 A;  3IVD A;  4ORB A;  3V4Y A;  3ZU0 A;  5B8I A;  5DNY A; 
#chains in the Genus database with same CATH homology
 3E7A A;  1WAO 1;  4FBW A;  4MOY A;  4V0W A;  5INB A;  3QFK A;  1M63 A;  2QFR A;  3H66 A;  2BQ8 X;  1G5B A;  3AUZ A;  2CV9 A;  2WDD A;  1AUI A;  4H1Y P;  4UT2 A;  1QFC A;  1U32 A;  3RL5 A;  3EGG A;  3QFN A;  4MOV A;  1S95 A;  3D03 A;  3E0J A;  1OI8 A;  3K7V C;  5F3W A;  1S3M A;  1Z2W A;  3FGA C;  1HO5 A;  2Z72 A;  1QHW A;  3LL8 A;  4HD0 A;  5EQV A;  2IE3 C;  1II7 A;  1KBP A;  1S8E A;  1OID A;  2AHD A;  2JOG A;  2NPP C;  2WDE A;  3P71 C;  3H61 A;  4M0V A;  3DSC A;  4V0V A;  4FCX A;  2WDC A;  2USH A;  1OIE A;  2HYO A;  4DT2 A;  1W24 A;  3E7B A;  4UT3 B;  3ZTV A;  5JPE A;  5JPF A;  2A22 A;  4IL1 A;  3H67 A;  4IYP C;  4JA9 A;  1S70 A;  2HYP A;  3T1I A;  4ZX2 A;  3THO B;  3DW8 C;  1MF8 A;  4XPN A;  3JYF A;  1TCO A;  2O8G A;  2Z06 A;  2R17 A;  4J6O A;  2O8A A;  2YEQ A;  4KBP A;  3C9F A;  3PSN A;  4JA7 A;  4O24 A;  2QJC A;  3HVQ A;  5J28 A;  3N5U A;  1FJM A;  3PSO A;  4O43 A;  3RL3 A;  4FBK A;  4DHL A;  1UTE A;  5JJT A;  3H68 A;  3KBP A;  4I5L C;  3IVE A;  1T70 A;  2NYL C;  4H1S A;  2NXF A;  2DXL A;  1XZW A;  4O5G A;  5C1V A;  2IE4 C;  3H69 A;  4H2I A;  3AV0 A;  3C5W C;  1WAR A;  3H63 A;  3QFO A;  4I5N C;  2IAE C;  3FLO A;  4ORA A;  3H60 A;  1JK7 A;  2Q8U A;  4LAC C;  4LU9 A;  3H64 A;  4NZV A;  1NNW A;  3EGH A;  2BCD A;  3ICF A;  4FBQ A;  4Q7F A;  1IT6 A;  1S3L A;  3QG5 C;  4TUI A;  4H2F A;  2GJU A;  5HPE A;  4F0Z A;  5IOH A;  2KKN A;  4MP0 A;  2WDF A;  3GVE A;  2DFJ A;  2ZO9 B;  1SU1 A;  1UF3 A;  2ZOA A;  2DXN A;  4ORC A;  3IB7 A;  3TGH A;  1HPU A;  4YKE A;  4O4K A;  2QFP A;  4V0X A;  1XM7 A;  2P6B A;  4G9J A;  3THN A;  2ZBM A;  2NYM C;  4UT3 A;  4TUG A;  1V73 A;  3H62 B;  2XMO A;  3K7W C;  4OR9 A;  3RQZ A;  2YVT A;  1T71 A;  1Z2X A;  4WWL A;  3QFM A;  1USH A;  2Z1A A;  4H2B A;  4UWQ A;  4LTY A;  4DSY A;  4ZVZ A;  2BDX A;  3DSD A;  4KKZ A;  1S3N A;  3IB8 A;  3CK2 A;  4H2G A;  4B2O A;  2HY1 A;  5GTU A;  3RL4 A;  1HP1 A;  3IVD A;  4ORB A;  3V4Y A;  3ZU0 A;  5B8I A;  5DNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...