3H63A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c) with two mn2+ atoms originally soaked with cantharidin (which is present in the structure in the hydrolyzed form)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 315
sequence length 315
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h63A00
3DSDA 5DNYA 1MF8A 2YVTA 3N5UA 3PSOA 2DFJA 2HYOA 1T71A 2GJUA 1OI8A 1XZWA 3QFKA 4DT2A 2Z72A 3GVEA 1JK7A 3K7VC 1IT6A 4O4KA 1V73A 4O43A 2Z1AA 3IVDA 4LU9A 2BDXA 2WDEA 1OIEA 3KBPA 1HPUA 4ZVZA 3JYFA 3ZU0A 2CV9A 1FJMA 4V0VA 2NXFA 3AV0A 1S8EA 5JJTA 3EGHA 5INBA 3H69A 3C9FA 3DW8C 2Z06A 2O8GA 1OIDA 2QFRA 4FBKA 1UF3A 1W24A 4TUIA 4I5LC 5GTUA 1S3NA 1U32A 4JA7A 3DSCA 3RQZA 3ICFA 2NYMC 2XMOA 1Z2WA 3IB8A 4DSYA 3IB7A 2ZBMA 4UT3A 3QFNA 4JA9A 2IAEC 5C1VA 4WWLA 2IE4C 3E7AA 1T70A 1AUIA 4G9JA 5HPEA 1TCOA 2WDFA 3H61A 3LL8A 4J6OA 2NPPC 1KBPA 1S3MA 4NZVA 2QFPA 4O24A 3K7WC 3P71C 1WAO1 4ORAA 4H1YP 2IE3C 3QG5C 3TGHA 2KKNA 3QFMA 4DHLA 5JPEA 1QFCA 4I5NC 2A22A 4H2BA 4MOVA 1XM7A 3H63A 3FGAC 3QFOA 4ORBA 3E7BA 4HD0A 4UWQA 2NYLC 4O5GA 1S3LA 3T1IA 3EGGA 3IVEA 4UT2A 4FBWA 2AHDA 2HYPA 4MP0A 3PSNA 4XPNA 4TUGA 4H2FA 1G5BA 5F3WA 1USHA 2BQ8X 2O8AA 3THOB 1QHWA 4IYPC 2JOGA 4LACC 3HVQA 1NNWA 4MOYA 1HP1A 4UT3B 4V0WA 1S70A 3V4YA 4ORCA 2P6BA 4YKEA 3H62B 1II7A 4H2IA 3RL5A 5B8IA 4KKZA 5JPFA 2WDCA 3CK2A 4LTYA 4FCXA 3H60A 4H2GA 1UTEA 4Q7FA 3ZTVA 3AUZA 1SU1A 4IL1A 4V0XA 5IOHA 4M0VA 4F0ZA 2WDDA 4OR9A 3THNA 1Z2XA 2USHA 3H64A 3RL3A 4B2OA 5EQVA 2Q8UA 3RL4A 2BCDA 4FBQA 1M63A 3C5WC 1HO5A 4H1SA 1S95A 2R17A 4ZX2A 3H68A 3H67A 4KBPA 1WARA 2HY1A 5J28A 2QJCA 3H66A
chains in the Genus database with same CATH superfamily
3DSDA 5DNYA 1MF8A 2YVTA 3N5UA 3PSOA 2DFJA 2HYOA 3FLOA 1T71A 2GJUA 1OI8A 1XZWA 3QFKA 4DT2A 2Z72A 3E0JA 3GVEA 1JK7A 3K7VC 1IT6A 4O4KA 1V73A 4O43A 2Z1AA 3IVDA 4LU9A 2BDXA 2WDEA 1OIEA 3KBPA 1HPUA 4ZVZA 3JYFA 3ZU0A 2CV9A 1FJMA 4V0VA 2NXFA 3AV0A 1S8EA 5JJTA 3EGHA 5INBA 3H69A 3C9FA 3DW8C 2Z06A 2O8GA 2DXLA 1OIDA 2QFRA 4FBKA 1UF3A 1W24A 4TUIA 4I5LC 5GTUA 1S3NA 1U32A 4JA7A 3DSCA 3RQZA 3ICFA 2NYMC 2XMOA 1Z2WA 2ZOAA 3IB8A 4DSYA 3IB7A 2ZBMA 4UT3A 3QFNA 4JA9A 2IAEC 5C1VA 4WWLA 2IE4C 3E7AA 1T70A 1AUIA 4G9JA 5HPEA 1TCOA 2WDFA 3H61A 3LL8A 4J6OA 2NPPC 1KBPA 1S3MA 4NZVA 2QFPA 4O24A 3K7WC 3P71C 1WAO1 2DXNA 4ORAA 4H1YP 2IE3C 3QG5C 3TGHA 2KKNA 3QFMA 4DHLA 5JPEA 1QFCA 4I5NC 2A22A 4H2BA 4MOVA 1XM7A 3H63A 3FGAC 3QFOA 4ORBA 3E7BA 4HD0A 4UWQA 2NYLC 4O5GA 1S3LA 3T1IA 3EGGA 3IVEA 4UT2A 4FBWA 2AHDA 2HYPA 4MP0A 3PSNA 4XPNA 4TUGA 4H2FA 1G5BA 5F3WA 1USHA 2BQ8X 2O8AA 3THOB 1QHWA 4IYPC 2JOGA 4LACC 3HVQA 1NNWA 3D03A 4MOYA 1HP1A 4UT3B 4V0WA 1S70A 3V4YA 4ORCA 2P6BA 4YKEA 3H62B 1II7A 4H2IA 3RL5A 5B8IA 4KKZA 5JPFA 2WDCA 3CK2A 4LTYA 4FCXA 3H60A 4H2GA 1UTEA 4Q7FA 2YEQA 3ZTVA 3AUZA 1SU1A 2ZO9B 4IL1A 4V0XA 5IOHA 4M0VA 4F0ZA 2WDDA 4OR9A 3THNA 1Z2XA 2USHA 3H64A 3RL3A 4B2OA 5EQVA 2Q8UA 3RL4A 2BCDA 4FBQA 1M63A 3C5WC 1HO5A 4H1SA 1S95A 2R17A 4ZX2A 3H68A 3H67A 4KBPA 1WARA 2HY1A 5J28A 2QJCA 3H66A
chains in the Genus database with same CATH topology
3DSDA 5DNYA 1MF8A 2YVTA 3N5UA 3PSOA 2DFJA 2HYOA 3FLOA 1T71A 2GJUA 1OI8A 1XZWA 3QFKA 4DT2A 2Z72A 3E0JA 3GVEA 1JK7A 3K7VC 1IT6A 4O4KA 1V73A 4O43A 2Z1AA 3IVDA 4LU9A 2BDXA 2WDEA 1OIEA 3KBPA 1HPUA 4ZVZA 3JYFA 3ZU0A 2CV9A 1FJMA 4V0VA 2NXFA 3AV0A 1S8EA 5JJTA 3EGHA 5INBA 3H69A 3C9FA 3DW8C 2Z06A 2O8GA 2DXLA 1OIDA 2QFRA 4FBKA 1UF3A 1W24A 4TUIA 4I5LC 5GTUA 1S3NA 1U32A 4JA7A 3DSCA 3RQZA 3ICFA 2NYMC 2XMOA 1Z2WA 2ZOAA 3IB8A 4DSYA 3IB7A 2ZBMA 4UT3A 3QFNA 4JA9A 2IAEC 5C1VA 4WWLA 2IE4C 3E7AA 1T70A 1AUIA 4G9JA 5HPEA 1TCOA 2WDFA 3H61A 3LL8A 4J6OA 2NPPC 1KBPA 1S3MA 4NZVA 2QFPA 4O24A 3K7WC 3P71C 1WAO1 2DXNA 4ORAA 4H1YP 2IE3C 3QG5C 3TGHA 2KKNA 3QFMA 4DHLA 5JPEA 1QFCA 4I5NC 2A22A 4H2BA 4MOVA 1XM7A 3H63A 3FGAC 3QFOA 4ORBA 3E7BA 4HD0A 4UWQA 2NYLC 4O5GA 1S3LA 3T1IA 3EGGA 3IVEA 4UT2A 4FBWA 2AHDA 2HYPA 4MP0A 3PSNA 4XPNA 4TUGA 4H2FA 1G5BA 5F3WA 1USHA 2BQ8X 2O8AA 3THOB 1QHWA 4IYPC 2JOGA 4LACC 3HVQA 1NNWA 3D03A 4MOYA 1HP1A 4UT3B 4V0WA 1S70A 3V4YA 4ORCA 2P6BA 4YKEA 3H62B 1II7A 4H2IA 3RL5A 5B8IA 4KKZA 5JPFA 2WDCA 3CK2A 4LTYA 4FCXA 3H60A 4H2GA 1UTEA 4Q7FA 2YEQA 3ZTVA 3AUZA 1SU1A 2ZO9B 4IL1A 4V0XA 5IOHA 4M0VA 4F0ZA 2WDDA 4OR9A 3THNA 1Z2XA 2USHA 3H64A 3RL3A 4B2OA 5EQVA 2Q8UA 3RL4A 2BCDA 4FBQA 1M63A 3C5WC 1HO5A 4H1SA 1S95A 2R17A 4ZX2A 3H68A 3H67A 4KBPA 1WARA 2HY1A 5J28A 2QJCA 3H66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSD A;  5DNY A;  1MF8 A;  2YVT A;  3N5U A;  3PSO A;  2DFJ A;  2HYO A;  1T71 A;  2GJU A;  1OI8 A;  1XZW A;  3QFK A;  4DT2 A;  2Z72 A;  3GVE A;  1JK7 A;  3K7V C;  1IT6 A;  4O4K A;  1V73 A;  4O43 A;  2Z1A A;  3IVD A;  4LU9 A;  2BDX A;  2WDE A;  1OIE A;  3KBP A;  1HPU A;  4ZVZ A;  3JYF A;  3ZU0 A;  2CV9 A;  1FJM A;  4V0V A;  2NXF A;  3AV0 A;  1S8E A;  5JJT A;  3EGH A;  5INB A;  3H69 A;  3C9F A;  3DW8 C;  2Z06 A;  2O8G A;  1OID A;  2QFR A;  4FBK A;  1UF3 A;  1W24 A;  4TUI A;  4I5L C;  5GTU A;  1S3N A;  1U32 A;  4JA7 A;  3DSC A;  3RQZ A;  3ICF A;  2NYM C;  2XMO A;  1Z2W A;  3IB8 A;  4DSY A;  3IB7 A;  2ZBM A;  4UT3 A;  3QFN A;  4JA9 A;  2IAE C;  5C1V A;  4WWL A;  2IE4 C;  3E7A A;  1T70 A;  1AUI A;  4G9J A;  5HPE A;  1TCO A;  2WDF A;  3H61 A;  3LL8 A;  4J6O A;  2NPP C;  1KBP A;  1S3M A;  4NZV A;  2QFP A;  4O24 A;  3K7W C;  3P71 C;  1WAO 1;  4ORA A;  4H1Y P;  2IE3 C;  3QG5 C;  3TGH A;  2KKN A;  3QFM A;  4DHL A;  5JPE A;  1QFC A;  4I5N C;  2A22 A;  4H2B A;  4MOV A;  1XM7 A;  3H63 A;  3FGA C;  3QFO A;  4ORB A;  3E7B A;  4HD0 A;  4UWQ A;  2NYL C;  4O5G A;  1S3L A;  3T1I A;  3EGG A;  3IVE A;  4UT2 A;  4FBW A;  2AHD A;  2HYP A;  4MP0 A;  3PSN A;  4XPN A;  4TUG A;  4H2F A;  1G5B A;  5F3W A;  1USH A;  2BQ8 X;  2O8A A;  3THO B;  1QHW A;  4IYP C;  2JOG A;  4LAC C;  3HVQ A;  1NNW A;  4MOY A;  1HP1 A;  4UT3 B;  4V0W A;  1S70 A;  3V4Y A;  4ORC A;  2P6B A;  4YKE A;  3H62 B;  1II7 A;  4H2I A;  3RL5 A;  5B8I A;  4KKZ A;  5JPF A;  2WDC A;  3CK2 A;  4LTY A;  4FCX A;  3H60 A;  4H2G A;  1UTE A;  4Q7F A;  3ZTV A;  3AUZ A;  1SU1 A;  4IL1 A;  4V0X A;  5IOH A;  4M0V A;  4F0Z A;  2WDD A;  4OR9 A;  3THN A;  1Z2X A;  2USH A;  3H64 A;  3RL3 A;  4B2O A;  5EQV A;  2Q8U A;  3RL4 A;  2BCD A;  4FBQ A;  1M63 A;  3C5W C;  1HO5 A;  4H1S A;  1S95 A;  2R17 A;  4ZX2 A;  3H68 A;  3H67 A;  4KBP A;  1WAR A;  2HY1 A;  5J28 A;  2QJC A;  3H66 A; 
#chains in the Genus database with same CATH topology
 3DSD A;  5DNY A;  1MF8 A;  2YVT A;  3N5U A;  3PSO A;  2DFJ A;  2HYO A;  3FLO A;  1T71 A;  2GJU A;  1OI8 A;  1XZW A;  3QFK A;  4DT2 A;  2Z72 A;  3E0J A;  3GVE A;  1JK7 A;  3K7V C;  1IT6 A;  4O4K A;  1V73 A;  4O43 A;  2Z1A A;  3IVD A;  4LU9 A;  2BDX A;  2WDE A;  1OIE A;  3KBP A;  1HPU A;  4ZVZ A;  3JYF A;  3ZU0 A;  2CV9 A;  1FJM A;  4V0V A;  2NXF A;  3AV0 A;  1S8E A;  5JJT A;  3EGH A;  5INB A;  3H69 A;  3C9F A;  3DW8 C;  2Z06 A;  2O8G A;  2DXL A;  1OID A;  2QFR A;  4FBK A;  1UF3 A;  1W24 A;  4TUI A;  4I5L C;  5GTU A;  1S3N A;  1U32 A;  4JA7 A;  3DSC A;  3RQZ A;  3ICF A;  2NYM C;  2XMO A;  1Z2W A;  2ZOA A;  3IB8 A;  4DSY A;  3IB7 A;  2ZBM A;  4UT3 A;  3QFN A;  4JA9 A;  2IAE C;  5C1V A;  4WWL A;  2IE4 C;  3E7A A;  1T70 A;  1AUI A;  4G9J A;  5HPE A;  1TCO A;  2WDF A;  3H61 A;  3LL8 A;  4J6O A;  2NPP C;  1KBP A;  1S3M A;  4NZV A;  2QFP A;  4O24 A;  3K7W C;  3P71 C;  1WAO 1;  2DXN A;  4ORA A;  4H1Y P;  2IE3 C;  3QG5 C;  3TGH A;  2KKN A;  3QFM A;  4DHL A;  5JPE A;  1QFC A;  4I5N C;  2A22 A;  4H2B A;  4MOV A;  1XM7 A;  3H63 A;  3FGA C;  3QFO A;  4ORB A;  3E7B A;  4HD0 A;  4UWQ A;  2NYL C;  4O5G A;  1S3L A;  3T1I A;  3EGG A;  3IVE A;  4UT2 A;  4FBW A;  2AHD A;  2HYP A;  4MP0 A;  3PSN A;  4XPN A;  4TUG A;  4H2F A;  1G5B A;  5F3W A;  1USH A;  2BQ8 X;  2O8A A;  3THO B;  1QHW A;  4IYP C;  2JOG A;  4LAC C;  3HVQ A;  1NNW A;  3D03 A;  4MOY A;  1HP1 A;  4UT3 B;  4V0W A;  1S70 A;  3V4Y A;  4ORC A;  2P6B A;  4YKE A;  3H62 B;  1II7 A;  4H2I A;  3RL5 A;  5B8I A;  4KKZ A;  5JPF A;  2WDC A;  3CK2 A;  4LTY A;  4FCX A;  3H60 A;  4H2G A;  1UTE A;  4Q7F A;  2YEQ A;  3ZTV A;  3AUZ A;  1SU1 A;  2ZO9 B;  4IL1 A;  4V0X A;  5IOH A;  4M0V A;  4F0Z A;  2WDD A;  4OR9 A;  3THN A;  1Z2X A;  2USH A;  3H64 A;  3RL3 A;  4B2O A;  5EQV A;  2Q8U A;  3RL4 A;  2BCD A;  4FBQ A;  1M63 A;  3C5W C;  1HO5 A;  4H1S A;  1S95 A;  2R17 A;  4ZX2 A;  3H68 A;  3H67 A;  4KBP A;  1WAR A;  2HY1 A;  5J28 A;  2QJC A;  3H66 A; 
#chains in the Genus database with same CATH homology
 3DSD A;  5DNY A;  1MF8 A;  2YVT A;  3N5U A;  3PSO A;  2DFJ A;  2HYO A;  3FLO A;  1T71 A;  2GJU A;  1OI8 A;  1XZW A;  3QFK A;  4DT2 A;  2Z72 A;  3E0J A;  3GVE A;  1JK7 A;  3K7V C;  1IT6 A;  4O4K A;  1V73 A;  4O43 A;  2Z1A A;  3IVD A;  4LU9 A;  2BDX A;  2WDE A;  1OIE A;  3KBP A;  1HPU A;  4ZVZ A;  3JYF A;  3ZU0 A;  2CV9 A;  1FJM A;  4V0V A;  2NXF A;  3AV0 A;  1S8E A;  5JJT A;  3EGH A;  5INB A;  3H69 A;  3C9F A;  3DW8 C;  2Z06 A;  2O8G A;  2DXL A;  1OID A;  2QFR A;  4FBK A;  1UF3 A;  1W24 A;  4TUI A;  4I5L C;  5GTU A;  1S3N A;  1U32 A;  4JA7 A;  3DSC A;  3RQZ A;  3ICF A;  2NYM C;  2XMO A;  1Z2W A;  2ZOA A;  3IB8 A;  4DSY A;  3IB7 A;  2ZBM A;  4UT3 A;  3QFN A;  4JA9 A;  2IAE C;  5C1V A;  4WWL A;  2IE4 C;  3E7A A;  1T70 A;  1AUI A;  4G9J A;  5HPE A;  1TCO A;  2WDF A;  3H61 A;  3LL8 A;  4J6O A;  2NPP C;  1KBP A;  1S3M A;  4NZV A;  2QFP A;  4O24 A;  3K7W C;  3P71 C;  1WAO 1;  2DXN A;  4ORA A;  4H1Y P;  2IE3 C;  3QG5 C;  3TGH A;  2KKN A;  3QFM A;  4DHL A;  5JPE A;  1QFC A;  4I5N C;  2A22 A;  4H2B A;  4MOV A;  1XM7 A;  3H63 A;  3FGA C;  3QFO A;  4ORB A;  3E7B A;  4HD0 A;  4UWQ A;  2NYL C;  4O5G A;  1S3L A;  3T1I A;  3EGG A;  3IVE A;  4UT2 A;  4FBW A;  2AHD A;  2HYP A;  4MP0 A;  3PSN A;  4XPN A;  4TUG A;  4H2F A;  1G5B A;  5F3W A;  1USH A;  2BQ8 X;  2O8A A;  3THO B;  1QHW A;  4IYP C;  2JOG A;  4LAC C;  3HVQ A;  1NNW A;  3D03 A;  4MOY A;  1HP1 A;  4UT3 B;  4V0W A;  1S70 A;  3V4Y A;  4ORC A;  2P6B A;  4YKE A;  3H62 B;  1II7 A;  4H2I A;  3RL5 A;  5B8I A;  4KKZ A;  5JPF A;  2WDC A;  3CK2 A;  4LTY A;  4FCX A;  3H60 A;  4H2G A;  1UTE A;  4Q7F A;  2YEQ A;  3ZTV A;  3AUZ A;  1SU1 A;  2ZO9 B;  4IL1 A;  4V0X A;  5IOH A;  4M0V A;  4F0Z A;  2WDD A;  4OR9 A;  3THN A;  1Z2X A;  2USH A;  3H64 A;  3RL3 A;  4B2O A;  5EQV A;  2Q8U A;  3RL4 A;  2BCD A;  4FBQ A;  1M63 A;  3C5W C;  1HO5 A;  4H1S A;  1S95 A;  2R17 A;  4ZX2 A;  3H68 A;  3H67 A;  4KBP A;  1WAR A;  2HY1 A;  5J28 A;  2QJC A;  3H66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...