1B2JA

Clostridium pasteurianum rubredoxin g43a mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (RUBREDOXIN)
publication title Rubredoxin from Clostridium pasteurianum. Structures of G10A, G43A and G10VG43A mutant proteins. Mutation of conserved glycine 10 to valine causes the 9-10 peptide link to invert.
pubmed doi rcsb
source organism Clostridium pasteurianum
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1b2jA00
4ME3A 2K2DA 1B2OA 3RYGA 1C09A 4AR4A 1JYBA 1BFYA 1YK5A 1BRFA 2LCQA 1S30A 1H7VA 1B71A 1SMMA 1B13A 3PZAA 1LKOA 1S24A 4AR6A 1YUXA 1QCVA 1LKMA 1YV1A 1R0IA 1IRNA 2PVEA 3KYYA 5AI3A 1BE7A 1BQ9A 1RB9A 5IY0A 1LTLA 1CADA 3MPSA 2HR5A 7RXNA 1VCXA 4AR5A 1IROA 3SS2A 1RYTA 3KYUA 5RXNA 1NNQA 1T9PA 4POGA 2VL6A 5AI2A 2KKDA 1T9QA 2GMGA 2QL0A 1B2JA 3KYWA 2PYAA 1QYBA 1FHHA 4YWLA 8RXNA 1DX8A 1YUZA 1R0GA 2RDVA 3PWFA 4POFA 4RXNA 1CAAA 2KN9A 3RZTA 1FHMA 1RDVA 1ZRPA 1DVBA 1S2ZA 1BQ8A 1R0FA 1IU6A 3KYXA 2V3BB 6RXNA 1RDGA 4AR3A 2PVXA 4K9FA 2DSXA 1LKPA 1SMUA 3RZ6A 1YK4A 4TPUA 1R0HA 3KYVA 3A44A 2MS3A 1T9OA 1SMWA 4YWMA 1IU5A 1RWDA 1R0JA 3QVDA 1E8JA 2M4YA
chains in the Genus database with same CATH superfamily
4ME3A 2K2DA 2H12A 1ODHA 4UY81 2AUSB 5M3ML 4AHYA 3LWPB 1H7VA 4AI0A 2M4VA 5C4JL 5MLC3 3RZDL 3HAXC 1LKOA 3B0AB 1S24A 4A3EL 3S2HL 1TWGL 4BBSL 4XGHA 5MF6A 2NVQL 2O5JD 3P8BA 3PIP1 2AQCA 2VUML 1NNQA 5M5WL 1T9PA 5GAEc 5H1Sc 4POGA 1F4LA 2VL6A 4AI1A 4JAFA 1T9QA 2GMGA 2QL0A 3P2AA 2NVXL 5EIOC 1QYBA 8RXNA 1SFOL 2JI2A 5FJ8L 1R0GA 2B5ID 5FLML 4A3FL 2XJTA 4V196 4AYBP 2XJRA 1Z92B 3M4OL 3RZTA 1ZRPA 1I3QL 1DVBA 4C3JL 4X6AL 1IU6A 1OWBA 3H0GL 1VZHA 2E2IL 4A93L 4A3IL 3PKIA 1P7PA 4QIWP 1TWFL 4A3KL 4K9FA 5DM61 1LKPA 1SMUA 3RZ6A 3PO3L 4TPUA 3QQCE 3S14L 1WJVA 3RZOL 2XJQA 2JA6L 3A44A 1VZGA 2MS3A 1SMWA 2JI3A 3JR7A 3GTGL 1IU5A 1RWDA 3LWRB 3I4ML 2JI1A 3RYGA 1C09A 3HOUL 1BFYA 2LCQA 3LNLA 1SMMA 5IP7L 4C3HL 3S1RL 2JA8L 2CR8A 1K83L 1NXEA 1RYQA 5M5YL 3IU3I 1I6HL 5MGNA 2E2HL 1TWCL 2A6HD 2PVEA 4C2M1 2NVYL 1BE7A 1BQ9A 4G6BA 1Y1VL 2Z3RB 3PO2L 1RB9A 1LTLA 4A3ML 2HR5A 7RXNA 1VCXA 4AR5A 1IROA 3SS2A 2JA7L 2ERSA 5IYCL 3H9CA 1VZIA 5GADc 4BXXL 3HOVL 1B2JA 1NXGA 3H97A 4AI2A 2RDVA 4TVMA 3PKJA 3GTJL 3HOWL 2XJSA 3HJWB 4A3LL 1WCML 1FHMA 3VPBE 1RDVA 4BBRL 3S1ML 3PIO1 2JA5L 1R0FA 4A3DL 3S16L 2V3BB 4AHXA 2RFKB 3M3YL 5C3EL 5IYBL 2DSXA 2PSMC 2AYJA 1PFVA 5JVG1 1T9OA 2APOB 3HOZL 5DM71 2M6PA 1E8JA 4A3BL 4AI3A 3S17L 2V0FA 2A68D 3HKZP 3S15L 4GS7D 3I4NL 1BRFA 2L0ZA 3WWLA 1B71A 2C6AA 1B13A 3ZG6A 3PZAA 2XJPA 1OWCA 2WAQP 1QCVA 1LKMA 4A3JL 1YV1A 5MFPA 3FDJA 2HVYC 1PZXA 4A3CL 2J9UB 5IY0A 3GTLL 3HJYB 3K7AL 1CADA 2M6OA 3J7Z1 4A3GL 2V0EA 2E2JL 5RXNA 2B63L 3B08B 4AHWA 3GTML 1FHHA 4YWLA 1DX8A 4POFA 2KN9A 2NVTL 2XJUA 3NFPI 3HOXL 2WB1P 4AR3A 3LWOB 3LWVB 3S2DL 5C4XL 1PFYA 3H3VM 4WFN1 5GAHc 3WWNB 3CQZL 2EY4E 4JAEA 1R0HA 3GTQL 1PFWA 5EINC 3KYVA 4Y52L 5C44L 3QVDA 4ZN3B 1B2OA 4JADA 4XXBB 4AR4A 2Z3QB 2Y0SP 1JYBA 1YK5A 1R9TL 3H99A 2PMZP 1S30A 4LHNA 2NYDA 3J7Y1 3S1NL 2PPTA 3H9BA 4AHZA 2R92L 2BE5D 4ZN1B 4AR6A 1YUXA 3GTPL 4B8CD 1I50L 1R0IA 1IRNA 2CKCA 2ERJA 3MSUA 5M5XL 5AI3A 3KYYA 3K35A 3GTOL 3MPSA 4LHLA 1PFUA 1RYTA 3KYUA 3LWQB 5AI2A 2KKDA 4JAGA 3FKIL 3KYWA 2ZIXA 2PYAA 1TWAL 4C3IL 5MFZA 2A6ED 1YUZA 3PL5A 1Y1WL 4BY7L 3PWFA 4U671 1IW7D 5IP9L 1QQTA 5JVH1 3GTKL 4RXNA 1CAAA 2XJVA 3MQKB 2CKAA 1S2ZA 1BQ8A 2YU9L 3KYXA 4Y7NL 6RXNA 1RDGA 4E6YA 2PVXA 3HOYL 5AN9H 5K2ME 3LPEB 1YK4A 5IYDL 1TWHL 2A69D 3S1QL 2R93L 4YWMA 4BY1L 2C6BA 5M3FL 2R7ZL 1R0JA 2M4YA 5GAGc
chains in the Genus database with same CATH topology
4ME3A 2K2DA 4ZN3B 1B2OA 2JI1A 3RYGA 2H12A 1ODHA 4JADA 4AI3A 4UY81 4XXBB 1C09A 4AR4A 2V0FA 2A68D 2Z3QB 1JYBA 1BFYA 1YK5A 4GS7D 1BRFA 2L0ZA 2LCQA 3LNLA 3WWLA 4AHYA 1S30A 4LHNA 1H7VA 4AI0A 1B71A 1SMMA 2C6AA 2M4VA 1B13A 2NYDA 3J7Y1 3ZG6A 5MLC3 2PPTA 3QVDA 3PZAA 4AHZA 1LKOA 2XJPA 2CR8A 1NXEA 1RYQA 3B0AB 3IU3I 1S24A 1OWCA 2BE5D 4ZN1B 4AR6A 1YUXA 1QCVA 1LKMA 5MGNA 1YV1A 5MFPA 4B8CD 2A6HD 1R0IA 1IRNA 2CKCA 2ERJA 3MSUA 2PVEA 3KYYA 5AI3A 3K35A 1BE7A 1BQ9A 4G6BA 2J9UB 2Z3RB 1RB9A 4XGHA 5IY0A 5MF6A 2O5JD 3P8BA 1LTLA 1CADA 2M6OA 3J7Z1 3MPSA 3PIP1 4LHLA 2HR5A 7RXNA 1VCXA 4AR5A 1IROA 3SS2A 1RYTA 2V0EA 3KYUA 2ERSA 5RXNA 1NNQA 1T9PA 5GAEc 5H1Sc 4POGA 1VZIA 2VL6A 5AI2A 4AI1A 4JAFA 3B08B 2KKDA 5GADc 4JAGA 1T9QA 2GMGA 2QL0A 3P2AA 1B2JA 2ZIXA 3KYWA 5EIOC 4AHWA 1NXGA 2PYAA 5MFZA 1QYBA 1FHHA 2A6ED 4YWLA 8RXNA 2JI2A 1DX8A 1YUZA 1R0GA 4AI2A 2B5ID 2RDVA 3PWFA 2XJTA 4TVMA 4POFA 4U671 4V196 3PKJA 1IW7D 5JVH1 2XJRA 1Z92B 2XJSA 4RXNA 1CAAA 2KN9A 3RZTA 2XJVA 2CKAA 1FHMA 3VPBE 1RDVA 1ZRPA 1DVBA 1S2ZA 2XJUA 3PIO1 1BQ8A 1R0FA 1IU6A 3NFPI 1OWBA 1VZHA 3KYXA 2V3BB 4AHXA 6RXNA 1RDGA 3PKIA 4E6YA 4AR3A 2PVXA 5AN9H 5K2ME 3LPEB 4K9FA 4WFN1 2DSXA 5GAHc 5DM61 1LKPA 1SMUA 3RZ6A 3WWNB 1YK4A 2PSMC 4TPUA 2AYJA 3QQCE 4JAEA 1R0HA 1WJVA 2XJQA 2A69D 5JVG1 5EINC 3KYVA 3A44A 1VZGA 2MS3A 1T9OA 1SMWA 2JI3A 4YWMA 2C6BA 5DM71 1IU5A 1RWDA 1R0JA 2M6PA 1E8JA 2M4YA 5GAGc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME3 A;  2K2D A;  1B2O A;  3RYG A;  1C09 A;  4AR4 A;  1JYB A;  1BFY A;  1YK5 A;  1BRF A;  2LCQ A;  1S30 A;  1H7V A;  1B71 A;  1SMM A;  1B13 A;  3PZA A;  1LKO A;  1S24 A;  4AR6 A;  1YUX A;  1QCV A;  1LKM A;  1YV1 A;  1R0I A;  1IRN A;  2PVE A;  3KYY A;  5AI3 A;  1BE7 A;  1BQ9 A;  1RB9 A;  5IY0 A;  1LTL A;  1CAD A;  3MPS A;  2HR5 A;  7RXN A;  1VCX A;  4AR5 A;  1IRO A;  3SS2 A;  1RYT A;  3KYU A;  5RXN A;  1NNQ A;  1T9P A;  4POG A;  2VL6 A;  5AI2 A;  2KKD A;  1T9Q A;  2GMG A;  2QL0 A;  1B2J A;  3KYW A;  2PYA A;  1QYB A;  1FHH A;  4YWL A;  8RXN A;  1DX8 A;  1YUZ A;  1R0G A;  2RDV A;  3PWF A;  4POF A;  4RXN A;  1CAA A;  2KN9 A;  3RZT A;  1FHM A;  1RDV A;  1ZRP A;  1DVB A;  1S2Z A;  1BQ8 A;  1R0F A;  1IU6 A;  3KYX A;  2V3B B;  6RXN A;  1RDG A;  4AR3 A;  2PVX A;  4K9F A;  2DSX A;  1LKP A;  1SMU A;  3RZ6 A;  1YK4 A;  4TPU A;  1R0H A;  3KYV A;  3A44 A;  2MS3 A;  1T9O A;  1SMW A;  4YWM A;  1IU5 A;  1RWD A;  1R0J A;  3QVD A;  1E8J A;  2M4Y A; 
#chains in the Genus database with same CATH topology
 4ME3 A;  2K2D A;  2H12 A;  1ODH A;  4UY8 1;  2AUS B;  5M3M L;  4AHY A;  3LWP B;  1H7V A;  4AI0 A;  2M4V A;  5C4J L;  5MLC 3;  3RZD L;  3HAX C;  1LKO A;  3B0A B;  1S24 A;  4A3E L;  3S2H L;  1TWG L;  4BBS L;  4XGH A;  5MF6 A;  2NVQ L;  2O5J D;  3P8B A;  3PIP 1;  2AQC A;  2VUM L;  1NNQ A;  5M5W L;  1T9P A;  5GAE c;  5H1S c;  4POG A;  1F4L A;  2VL6 A;  4AI1 A;  4JAF A;  1T9Q A;  2GMG A;  2QL0 A;  3P2A A;  2NVX L;  5EIO C;  1QYB A;  8RXN A;  1SFO L;  2JI2 A;  5FJ8 L;  1R0G A;  2B5I D;  5FLM L;  4A3F L;  2XJT A;  4V19 6;  4AYB P;  2XJR A;  1Z92 B;  3M4O L;  3RZT A;  1ZRP A;  1I3Q L;  1DVB A;  4C3J L;  4X6A L;  1IU6 A;  1OWB A;  3H0G L;  1VZH A;  2E2I L;  4A93 L;  4A3I L;  3PKI A;  1P7P A;  4QIW P;  1TWF L;  4A3K L;  4K9F A;  5DM6 1;  1LKP A;  1SMU A;  3RZ6 A;  3PO3 L;  4TPU A;  3QQC E;  3S14 L;  1WJV A;  3RZO L;  2XJQ A;  2JA6 L;  3A44 A;  1VZG A;  2MS3 A;  1SMW A;  2JI3 A;  3JR7 A;  3GTG L;  1IU5 A;  1RWD A;  3LWR B;  3I4M L;  2JI1 A;  3RYG A;  1C09 A;  3HOU L;  1BFY A;  2LCQ A;  3LNL A;  1SMM A;  5IP7 L;  4C3H L;  3S1R L;  2JA8 L;  2CR8 A;  1K83 L;  1NXE A;  1RYQ A;  5M5Y L;  3IU3 I;  1I6H L;  5MGN A;  2E2H L;  1TWC L;  2A6H D;  2PVE A;  4C2M 1;  2NVY L;  1BE7 A;  1BQ9 A;  4G6B A;  1Y1V L;  2Z3R B;  3PO2 L;  1RB9 A;  1LTL A;  4A3M L;  2HR5 A;  7RXN A;  1VCX A;  4AR5 A;  1IRO A;  3SS2 A;  2JA7 L;  2ERS A;  5IYC L;  3H9C A;  1VZI A;  5GAD c;  4BXX L;  3HOV L;  1B2J A;  1NXG A;  3H97 A;  4AI2 A;  2RDV A;  4TVM A;  3PKJ A;  3GTJ L;  3HOW L;  2XJS A;  3HJW B;  4A3L L;  1WCM L;  1FHM A;  3VPB E;  1RDV A;  4BBR L;  3S1M L;  3PIO 1;  2JA5 L;  1R0F A;  4A3D L;  3S16 L;  2V3B B;  4AHX A;  2RFK B;  3M3Y L;  5C3E L;  5IYB L;  2DSX A;  2PSM C;  2AYJ A;  1PFV A;  5JVG 1;  1T9O A;  2APO B;  3HOZ L;  5DM7 1;  2M6P A;  1E8J A;  4A3B L;  4AI3 A;  3S17 L;  2V0F A;  2A68 D;  3HKZ P;  3S15 L;  4GS7 D;  3I4N L;  1BRF A;  2L0Z A;  3WWL A;  1B71 A;  2C6A A;  1B13 A;  3ZG6 A;  3PZA A;  2XJP A;  1OWC A;  2WAQ P;  1QCV A;  1LKM A;  4A3J L;  1YV1 A;  5MFP A;  3FDJ A;  2HVY C;  1PZX A;  4A3C L;  2J9U B;  5IY0 A;  3GTL L;  3HJY B;  3K7A L;  1CAD A;  2M6O A;  3J7Z 1;  4A3G L;  2V0E A;  2E2J L;  5RXN A;  2B63 L;  3B08 B;  4AHW A;  3GTM L;  1FHH A;  4YWL A;  1DX8 A;  4POF A;  2KN9 A;  2NVT L;  2XJU A;  3NFP I;  3HOX L;  2WB1 P;  4AR3 A;  3LWO B;  3LWV B;  3S2D L;  5C4X L;  1PFY A;  3H3V M;  4WFN 1;  5GAH c;  3WWN B;  3CQZ L;  2EY4 E;  4JAE A;  1R0H A;  3GTQ L;  1PFW A;  5EIN C;  3KYV A;  4Y52 L;  5C44 L;  3QVD A;  4ZN3 B;  1B2O A;  4JAD A;  4XXB B;  4AR4 A;  2Z3Q B;  2Y0S P;  1JYB A;  1YK5 A;  1R9T L;  3H99 A;  2PMZ P;  1S30 A;  4LHN A;  2NYD A;  3J7Y 1;  3S1N L;  2PPT A;  3H9B A;  4AHZ A;  2R92 L;  2BE5 D;  4ZN1 B;  4AR6 A;  1YUX A;  3GTP L;  4B8C D;  1I50 L;  1R0I A;  1IRN A;  2CKC A;  2ERJ A;  3MSU A;  5M5X L;  5AI3 A;  3KYY A;  3K35 A;  3GTO L;  3MPS A;  4LHL A;  1PFU A;  1RYT A;  3KYU A;  3LWQ B;  5AI2 A;  2KKD A;  4JAG A;  3FKI L;  3KYW A;  2ZIX A;  2PYA A;  1TWA L;  4C3I L;  5MFZ A;  2A6E D;  1YUZ A;  3PL5 A;  1Y1W L;  4BY7 L;  3PWF A;  4U67 1;  1IW7 D;  5IP9 L;  1QQT A;  5JVH 1;  3GTK L;  4RXN A;  1CAA A;  2XJV A;  3MQK B;  2CKA A;  1S2Z A;  1BQ8 A;  2YU9 L;  3KYX A;  4Y7N L;  6RXN A;  1RDG A;  4E6Y A;  2PVX A;  3HOY L;  5AN9 H;  5K2M E;  3LPE B;  1YK4 A;  5IYD L;  1TWH L;  2A69 D;  3S1Q L;  2R93 L;  4YWM A;  4BY1 L;  2C6B A;  5M3F L;  2R7Z L;  1R0J A;  2M4Y A;  5GAG c; 
#chains in the Genus database with same CATH homology
 4ME3 A;  2K2D A;  4ZN3 B;  1B2O A;  2JI1 A;  3RYG A;  2H12 A;  1ODH A;  4JAD A;  4AI3 A;  4UY8 1;  4XXB B;  1C09 A;  4AR4 A;  2V0F A;  2A68 D;  2Z3Q B;  1JYB A;  1BFY A;  1YK5 A;  4GS7 D;  1BRF A;  2L0Z A;  2LCQ A;  3LNL A;  3WWL A;  4AHY A;  1S30 A;  4LHN A;  1H7V A;  4AI0 A;  1B71 A;  1SMM A;  2C6A A;  2M4V A;  1B13 A;  2NYD A;  3J7Y 1;  3ZG6 A;  5MLC 3;  2PPT A;  3QVD A;  3PZA A;  4AHZ A;  1LKO A;  2XJP A;  2CR8 A;  1NXE A;  1RYQ A;  3B0A B;  3IU3 I;  1S24 A;  1OWC A;  2BE5 D;  4ZN1 B;  4AR6 A;  1YUX A;  1QCV A;  1LKM A;  5MGN A;  1YV1 A;  5MFP A;  4B8C D;  2A6H D;  1R0I A;  1IRN A;  2CKC A;  2ERJ A;  3MSU A;  2PVE A;  3KYY A;  5AI3 A;  3K35 A;  1BE7 A;  1BQ9 A;  4G6B A;  2J9U B;  2Z3R B;  1RB9 A;  4XGH A;  5IY0 A;  5MF6 A;  2O5J D;  3P8B A;  1LTL A;  1CAD A;  2M6O A;  3J7Z 1;  3MPS A;  3PIP 1;  4LHL A;  2HR5 A;  7RXN A;  1VCX A;  4AR5 A;  1IRO A;  3SS2 A;  1RYT A;  2V0E A;  3KYU A;  2ERS A;  5RXN A;  1NNQ A;  1T9P A;  5GAE c;  5H1S c;  4POG A;  1VZI A;  2VL6 A;  5AI2 A;  4AI1 A;  4JAF A;  3B08 B;  2KKD A;  5GAD c;  4JAG A;  1T9Q A;  2GMG A;  2QL0 A;  3P2A A;  1B2J A;  2ZIX A;  3KYW A;  5EIO C;  4AHW A;  1NXG A;  2PYA A;  5MFZ A;  1QYB A;  1FHH A;  2A6E D;  4YWL A;  8RXN A;  2JI2 A;  1DX8 A;  1YUZ A;  1R0G A;  4AI2 A;  2B5I D;  2RDV A;  3PWF A;  2XJT A;  4TVM A;  4POF A;  4U67 1;  4V19 6;  3PKJ A;  1IW7 D;  5JVH 1;  2XJR A;  1Z92 B;  2XJS A;  4RXN A;  1CAA A;  2KN9 A;  3RZT A;  2XJV A;  2CKA A;  1FHM A;  3VPB E;  1RDV A;  1ZRP A;  1DVB A;  1S2Z A;  2XJU A;  3PIO 1;  1BQ8 A;  1R0F A;  1IU6 A;  3NFP I;  1OWB A;  1VZH A;  3KYX A;  2V3B B;  4AHX A;  6RXN A;  1RDG A;  3PKI A;  4E6Y A;  4AR3 A;  2PVX A;  5AN9 H;  5K2M E;  3LPE B;  4K9F A;  4WFN 1;  2DSX A;  5GAH c;  5DM6 1;  1LKP A;  1SMU A;  3RZ6 A;  3WWN B;  1YK4 A;  2PSM C;  4TPU A;  2AYJ A;  3QQC E;  4JAE A;  1R0H A;  1WJV A;  2XJQ A;  2A69 D;  5JVG 1;  5EIN C;  3KYV A;  3A44 A;  1VZG A;  2MS3 A;  1T9O A;  1SMW A;  2JI3 A;  4YWM A;  2C6B A;  5DM7 1;  1IU5 A;  1RWD A;  1R0J A;  2M6P A;  1E8J A;  2M4Y A;  5GAG c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...