3SS2A

Neutron structure of perdeuterated rubredoxin using 48 hours 3rd pass data
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Rapid visualization of hydrogen positions in protein neutron crystallographic structures.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Electron transport
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3ss2A00
2VL6A 1S2ZA 2QL0A 3RZTA 1YUZA 1RWDA 1B2JA 3KYVA 1B13A 4POFA 2DSXA 1IU6A 1IU5A 3MPSA 1CADA 1RYTA 1BQ9A 1T9QA 2V3BB 1VCXA 2GMGA 5AI2A 1H7VA 1B71A 2M4YA 5RXNA 4K9FA 2PVEA 1C09A 7RXNA 1S24A 3KYUA 1YK4A 4AR3A 1BFYA 3KYWA 3PZAA 2HR5A 1SMWA 8RXNA 3RYGA 1CAAA 1YV1A 1YK5A 1S30A 1RDVA 2MS3A 1QCVA 4AR4A 1T9OA 1FHHA 1LKPA 4AR5A 4POGA 1IROA 3KYXA 1QYBA 1IRNA 1NNQA 5IY0A 2K2DA 1RB9A 1R0HA 4YWMA 1ZRPA 2LCQA 3RZ6A 1DVBA 3PWFA 1E8JA 2PYAA 1B2OA 1T9PA 1LKOA 1BE7A 1YUXA 2KN9A 1R0JA 1R0GA 1LTLA 6RXNA 1R0FA 4AR6A 4YWLA 3KYYA 1JYBA 3SS2A 5AI3A 2PVXA 1FHMA 1R0IA 1BQ8A 1BRFA 4RXNA 3A44A 1LKMA 1RDGA 4ME3A 3QVDA 1SMUA 1SMMA 1DX8A 2RDVA 2KKDA 4TPUA
chains in the Genus database with same CATH superfamily
2VL6A 2YU9L 2AQCA 4XXBB 3RZTA 3MQKB 1Z92B 5IYBL 1WJVA 1PFVA 3PO2L 1B13A 4QIWP 3H99A 2DSXA 5MFZA 3LWPB 1IU5A 2R7ZL 1NXEA 4JADA 5M3FL 3LWRB 3B08B 1T9QA 2M4YA 5RXNA 3FKIL 2XJVA 3PZAA 3MSUA 3S14L 1Y1VL 2WAQP 1T9OA 2J9UB 5MFPA 4AI2A 2E2IL 4AI3A 4A3BL 3HOVL 2NVQL 4UY81 3S1NL 2V0FA 3I4ML 3HAXC 4A3CL 3S2HL 3GTOL 3HJWB 4WFN1 2LCQA 5IP7L 3RZ6A 1DVBA 5H1Sc 3HOWL 1LKOA 1BE7A 2KN9A 3JR7A 1WCML 4BXXL 1R0FA 1OWCA 4G6BA 4AR6A 3S1QL 3PL5A 2PVXA 1FHMA 3H3VM 3B0AB 3A44A 3PIP1 3CQZL 1QQTA 1SMUA 3M3YL 5EIOC 5C3EL 2QL0A 5FLML 3M4OL 1YUZA 1VZHA 4C2M1 1B2JA 3KYVA 5C44L 2XJUA 2M4VA 3HOZL 1PZXA 1CADA 4A3GL 3P2AA 1RYTA 3LWVB 1NXGA 2JI3A 2WB1P 1VCXA 2M6PA 2R92L 2JI2A 4A3LL 1S24A 3KYUA 2A6HD 3S1RL 5AN9H 1BFYA 4X6AL 3S17L 1I6HL 3GTML 2EY4E 1LKPA 2C6BA 2AUSB 4POGA 1IROA 4AI0A 4TVMA 3HJYB 5IY0A 4Y7NL 4A3JL 4AHZA 3GTGL 2APOB 4C3JL 1E8JA 1T9PA 2JA8L 1LTLA 1TWHL 2O5JD 3LPEB 2NVTL 2H12A 4YWLA 3KYYA 1TWFL 2CR8A 1OWBA 4A3EL 1BQ8A 3QVDA 2ERSA 3H9BA 1DX8A 3IU3I 3S2DL 2ZIXA 4C3IL 1S2ZA 2Y0SP 2HVYC 2C6AA 4BBSL 3S15L 4B8CD 1VZGA 1RWDA 5M5WL 1TWCL 4BY1L 5M3ML 3GTJL 4AHWA 3P8BA 3MPSA 3H0GL 3PO3L 1BQ9A 5EINC 2V3BB 2XJQA 2JI1A 5GADc 4K9FA 1C09A 7RXNA 4A3IL 2NYDA 4A3ML 4AR3A 2CKCA 1TWAL 4JAFA 3KYWA 3GTLL 2HR5A 4JAEA 1SMWA 5C4JL 4LHNA 3LNLA 3RYGA 4E6YA 1YV1A 1YK5A 1RDVA 2MS3A 5MGNA 4AR4A 3S1ML 4AR5A 4AHYA 3LWQB 1NNQA 4Y52L 1I50L 2K2DA 3NFPI 3PKJA 2A68D 1R0HA 1IW7D 5JVG1 4AHXA 5FJ8L 3WWNB 5M5XL 3PWFA 2PYAA 3H97A 2PSMC 1P7PA 5MLC3 2M6OA 2XJPA 5GAHc 4ZN3B 3K7AL 2BE5D 3FDJA 5AI3A 2CKAA 3VPBE 1R0IA 4RXNA 1LKMA 4ME3A 1RYQA 2PPTA 4V196 1SMMA 5K2ME 3I4NL 2ERJA 1I3QL 3S16L 1SFOL 2E2JL 4POFA 5DM61 1IU6A 2Z3QB 3WWLA 3K35A 4BY7L 3ZG6A 2Z3RB 2B63L 2AYJA 4AI1A 2VUML 2GMGA 2XJRA 5AI2A 5IP9L 1H7VA 1B71A 2PVEA 3GTPL 2NVYL 1YK4A 8RXNA 1CAAA 1S30A 4LHLA 1QCVA 3HOYL 2RFKB 1FHHA 4AYBP 3HKZP 2R93L 5GAEc 4ZN1B 2PMZP 2XJSA 3KYXA 1QYBA 2E2HL 3J7Z1 1IRNA 5IYDL 4A3FL 4A3DL 1RB9A 4A93L 1VZIA 1PFUA 5GAGc 2A6ED 3HOXL 2NVXL 4A3KL 4YWMA 1ZRPA 1R9TL 3RZOL 3RZDL 1B2OA 1PFYA 2A69D 2JA7L 1K83L 1YUXA 1R0JA 1Y1WL 5C4XL 1R0GA 4JAGA 3PKIA 3H9CA 3PIO1 3HOUL 4GS7D 6RXNA 4C3HL 2L0ZA 4BBRL 1PFWA 5M5YL 1ODHA 1JYBA 3SS2A 3J7Y1 2JA5L 2V0EA 1TWGL 3QQCE 4U671 1BRFA 1RDGA 2B5ID 2JA6L 5MF6A 4XGHA 5JVH1 2XJTA 3GTKL 5DM71 1F4LA 2RDVA 3LWOB 3GTQL 2KKDA 4TPUA 5IYCL
chains in the Genus database with same CATH topology
2ERJA 2VL6A 1S2ZA 2QL0A 2C6AA 4XXBB 4B8CD 1VZGA 3RZTA 1YUZA 1RWDA 1Z92B 1VZHA 1WJVA 4TPUA 3KYVA 1B13A 2XJUA 2M4VA 4POFA 1ODHA 2DSXA 5DM61 5MFZA 1IU6A 2Z3QB 3WWLA 4AHWA 1IU5A 3P8BA 3K35A 1NXEA 3MPSA 1CADA 4JADA 3P2AA 3B08B 1RYTA 2Z3RB 3ZG6A 1BQ9A 1NXGA 2AYJA 2JI3A 1T9QA 4AI1A 5EINC 2V3BB 1VCXA 2GMGA 2XJRA 5AI2A 2M6PA 2XJQA 2JI1A 2JI2A 5GADc 1H7VA 1B71A 2M4YA 5RXNA 4K9FA 2PVEA 1C09A 7RXNA 1S24A 3KYUA 2NYDA 1YK4A 4AR3A 2A6HD 2CKCA 4JAFA 2XJVA 5AN9H 1BFYA 3KYWA 3PZAA 2HR5A 3MSUA 1SMWA 4JAEA 4LHNA 8RXNA 3LNLA 3RYGA 1CAAA 4E6YA 1YV1A 1YK5A 1S30A 1RDVA 2MS3A 4LHLA 5MGNA 1QCVA 4AR4A 1T9OA 1FHHA 2J9UB 1LKPA 4ZN1B 4AR5A 2C6BA 5GAEc 5MFPA 4AI2A 4POGA 4AI3A 3J7Y1 2XJSA 1IROA 3KYXA 1QYBA 4AI0A 4AHYA 3J7Z1 4TVMA 4UY81 1IRNA 1NNQA 5IY0A 2V0FA 2K2DA 1RB9A 3NFPI 1VZIA 5GAGc 3PKJA 2A6ED 2A68D 4AHZA 1R0HA 1IW7D 5JVG1 4AHXA 4YWMA 3WWNB 4WFN1 1ZRPA 2LCQA 3RZ6A 1DVBA 3PWFA 1E8JA 2PYAA 1B2OA 1T9PA 5H1Sc 2A69D 2PSMC 1LKOA 1BE7A 1YUXA 2KN9A 1R0JA 5MLC3 1R0GA 4JAGA 3PKIA 1LTLA 3PIO1 4GS7D 6RXNA 2M6OA 1R0FA 2XJPA 1OWCA 2O5JD 2L0ZA 3LPEB 5GAHc 4ZN3B 4G6BA 4AR6A 2H12A 4YWLA 2BE5D 3KYYA 1JYBA 2V0EA 2CR8A 5AI3A 3SS2A 1OWBA 2CKAA 2PVXA 3QQCE 1FHMA 1R0IA 3VPBE 4U671 3B0AB 1BQ8A 1BRFA 4RXNA 3A44A 1LKMA 1RDGA 4ME3A 1RYQA 3QVDA 3PIP1 2B5ID 1SMUA 2ERSA 2PPTA 5MF6A 1SMMA 4XGHA 2XJTA 5JVH1 5K2ME 5DM71 4V196 3IU3I 1DX8A 2ZIXA 2RDVA 5EIOC 2KKDA 1B2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL6 A;  1S2Z A;  2QL0 A;  3RZT A;  1YUZ A;  1RWD A;  1B2J A;  3KYV A;  1B13 A;  4POF A;  2DSX A;  1IU6 A;  1IU5 A;  3MPS A;  1CAD A;  1RYT A;  1BQ9 A;  1T9Q A;  2V3B B;  1VCX A;  2GMG A;  5AI2 A;  1H7V A;  1B71 A;  2M4Y A;  5RXN A;  4K9F A;  2PVE A;  1C09 A;  7RXN A;  1S24 A;  3KYU A;  1YK4 A;  4AR3 A;  1BFY A;  3KYW A;  3PZA A;  2HR5 A;  1SMW A;  8RXN A;  3RYG A;  1CAA A;  1YV1 A;  1YK5 A;  1S30 A;  1RDV A;  2MS3 A;  1QCV A;  4AR4 A;  1T9O A;  1FHH A;  1LKP A;  4AR5 A;  4POG A;  1IRO A;  3KYX A;  1QYB A;  1IRN A;  1NNQ A;  5IY0 A;  2K2D A;  1RB9 A;  1R0H A;  4YWM A;  1ZRP A;  2LCQ A;  3RZ6 A;  1DVB A;  3PWF A;  1E8J A;  2PYA A;  1B2O A;  1T9P A;  1LKO A;  1BE7 A;  1YUX A;  2KN9 A;  1R0J A;  1R0G A;  1LTL A;  6RXN A;  1R0F A;  4AR6 A;  4YWL A;  3KYY A;  1JYB A;  3SS2 A;  5AI3 A;  2PVX A;  1FHM A;  1R0I A;  1BQ8 A;  1BRF A;  4RXN A;  3A44 A;  1LKM A;  1RDG A;  4ME3 A;  3QVD A;  1SMU A;  1SMM A;  1DX8 A;  2RDV A;  2KKD A;  4TPU A; 
#chains in the Genus database with same CATH topology
 2VL6 A;  2YU9 L;  2AQC A;  4XXB B;  3RZT A;  3MQK B;  1Z92 B;  5IYB L;  1WJV A;  1PFV A;  3PO2 L;  1B13 A;  4QIW P;  3H99 A;  2DSX A;  5MFZ A;  3LWP B;  1IU5 A;  2R7Z L;  1NXE A;  4JAD A;  5M3F L;  3LWR B;  3B08 B;  1T9Q A;  2M4Y A;  5RXN A;  3FKI L;  2XJV A;  3PZA A;  3MSU A;  3S14 L;  1Y1V L;  2WAQ P;  1T9O A;  2J9U B;  5MFP A;  4AI2 A;  2E2I L;  4AI3 A;  4A3B L;  3HOV L;  2NVQ L;  4UY8 1;  3S1N L;  2V0F A;  3I4M L;  3HAX C;  4A3C L;  3S2H L;  3GTO L;  3HJW B;  4WFN 1;  2LCQ A;  5IP7 L;  3RZ6 A;  1DVB A;  5H1S c;  3HOW L;  1LKO A;  1BE7 A;  2KN9 A;  3JR7 A;  1WCM L;  4BXX L;  1R0F A;  1OWC A;  4G6B A;  4AR6 A;  3S1Q L;  3PL5 A;  2PVX A;  1FHM A;  3H3V M;  3B0A B;  3A44 A;  3PIP 1;  3CQZ L;  1QQT A;  1SMU A;  3M3Y L;  5EIO C;  5C3E L;  2QL0 A;  5FLM L;  3M4O L;  1YUZ A;  1VZH A;  4C2M 1;  1B2J A;  3KYV A;  5C44 L;  2XJU A;  2M4V A;  3HOZ L;  1PZX A;  1CAD A;  4A3G L;  3P2A A;  1RYT A;  3LWV B;  1NXG A;  2JI3 A;  2WB1 P;  1VCX A;  2M6P A;  2R92 L;  2JI2 A;  4A3L L;  1S24 A;  3KYU A;  2A6H D;  3S1R L;  5AN9 H;  1BFY A;  4X6A L;  3S17 L;  1I6H L;  3GTM L;  2EY4 E;  1LKP A;  2C6B A;  2AUS B;  4POG A;  1IRO A;  4AI0 A;  4TVM A;  3HJY B;  5IY0 A;  4Y7N L;  4A3J L;  4AHZ A;  3GTG L;  2APO B;  4C3J L;  1E8J A;  1T9P A;  2JA8 L;  1LTL A;  1TWH L;  2O5J D;  3LPE B;  2NVT L;  2H12 A;  4YWL A;  3KYY A;  1TWF L;  2CR8 A;  1OWB A;  4A3E L;  1BQ8 A;  3QVD A;  2ERS A;  3H9B A;  1DX8 A;  3IU3 I;  3S2D L;  2ZIX A;  4C3I L;  1S2Z A;  2Y0S P;  2HVY C;  2C6A A;  4BBS L;  3S15 L;  4B8C D;  1VZG A;  1RWD A;  5M5W L;  1TWC L;  4BY1 L;  5M3M L;  3GTJ L;  4AHW A;  3P8B A;  3MPS A;  3H0G L;  3PO3 L;  1BQ9 A;  5EIN C;  2V3B B;  2XJQ A;  2JI1 A;  5GAD c;  4K9F A;  1C09 A;  7RXN A;  4A3I L;  2NYD A;  4A3M L;  4AR3 A;  2CKC A;  1TWA L;  4JAF A;  3KYW A;  3GTL L;  2HR5 A;  4JAE A;  1SMW A;  5C4J L;  4LHN A;  3LNL A;  3RYG A;  4E6Y A;  1YV1 A;  1YK5 A;  1RDV A;  2MS3 A;  5MGN A;  4AR4 A;  3S1M L;  4AR5 A;  4AHY A;  3LWQ B;  1NNQ A;  4Y52 L;  1I50 L;  2K2D A;  3NFP I;  3PKJ A;  2A68 D;  1R0H A;  1IW7 D;  5JVG 1;  4AHX A;  5FJ8 L;  3WWN B;  5M5X L;  3PWF A;  2PYA A;  3H97 A;  2PSM C;  1P7P A;  5MLC 3;  2M6O A;  2XJP A;  5GAH c;  4ZN3 B;  3K7A L;  2BE5 D;  3FDJ A;  5AI3 A;  2CKA A;  3VPB E;  1R0I A;  4RXN A;  1LKM A;  4ME3 A;  1RYQ A;  2PPT A;  4V19 6;  1SMM A;  5K2M E;  3I4N L;  2ERJ A;  1I3Q L;  3S16 L;  1SFO L;  2E2J L;  4POF A;  5DM6 1;  1IU6 A;  2Z3Q B;  3WWL A;  3K35 A;  4BY7 L;  3ZG6 A;  2Z3R B;  2B63 L;  2AYJ A;  4AI1 A;  2VUM L;  2GMG A;  2XJR A;  5AI2 A;  5IP9 L;  1H7V A;  1B71 A;  2PVE A;  3GTP L;  2NVY L;  1YK4 A;  8RXN A;  1CAA A;  1S30 A;  4LHL A;  1QCV A;  3HOY L;  2RFK B;  1FHH A;  4AYB P;  3HKZ P;  2R93 L;  5GAE c;  4ZN1 B;  2PMZ P;  2XJS A;  3KYX A;  1QYB A;  2E2H L;  3J7Z 1;  1IRN A;  5IYD L;  4A3F L;  4A3D L;  1RB9 A;  4A93 L;  1VZI A;  1PFU A;  5GAG c;  2A6E D;  3HOX L;  2NVX L;  4A3K L;  4YWM A;  1ZRP A;  1R9T L;  3RZO L;  3RZD L;  1B2O A;  1PFY A;  2A69 D;  2JA7 L;  1K83 L;  1YUX A;  1R0J A;  1Y1W L;  5C4X L;  1R0G A;  4JAG A;  3PKI A;  3H9C A;  3PIO 1;  3HOU L;  4GS7 D;  6RXN A;  4C3H L;  2L0Z A;  4BBR L;  1PFW A;  5M5Y L;  1ODH A;  1JYB A;  3SS2 A;  3J7Y 1;  2JA5 L;  2V0E A;  1TWG L;  3QQC E;  4U67 1;  1BRF A;  1RDG A;  2B5I D;  2JA6 L;  5MF6 A;  4XGH A;  5JVH 1;  2XJT A;  3GTK L;  5DM7 1;  1F4L A;  2RDV A;  3LWO B;  3GTQ L;  2KKD A;  4TPU A;  5IYC L; 
#chains in the Genus database with same CATH homology
 2ERJ A;  2VL6 A;  1S2Z A;  2QL0 A;  2C6A A;  4XXB B;  4B8C D;  1VZG A;  3RZT A;  1YUZ A;  1RWD A;  1Z92 B;  1VZH A;  1WJV A;  4TPU A;  3KYV A;  1B13 A;  2XJU A;  2M4V A;  4POF A;  1ODH A;  2DSX A;  5DM6 1;  5MFZ A;  1IU6 A;  2Z3Q B;  3WWL A;  4AHW A;  1IU5 A;  3P8B A;  3K35 A;  1NXE A;  3MPS A;  1CAD A;  4JAD A;  3P2A A;  3B08 B;  1RYT A;  2Z3R B;  3ZG6 A;  1BQ9 A;  1NXG A;  2AYJ A;  2JI3 A;  1T9Q A;  4AI1 A;  5EIN C;  2V3B B;  1VCX A;  2GMG A;  2XJR A;  5AI2 A;  2M6P A;  2XJQ A;  2JI1 A;  2JI2 A;  5GAD c;  1H7V A;  1B71 A;  2M4Y A;  5RXN A;  4K9F A;  2PVE A;  1C09 A;  7RXN A;  1S24 A;  3KYU A;  2NYD A;  1YK4 A;  4AR3 A;  2A6H D;  2CKC A;  4JAF A;  2XJV A;  5AN9 H;  1BFY A;  3KYW A;  3PZA A;  2HR5 A;  3MSU A;  1SMW A;  4JAE A;  4LHN A;  8RXN A;  3LNL A;  3RYG A;  1CAA A;  4E6Y A;  1YV1 A;  1YK5 A;  1S30 A;  1RDV A;  2MS3 A;  4LHL A;  5MGN A;  1QCV A;  4AR4 A;  1T9O A;  1FHH A;  2J9U B;  1LKP A;  4ZN1 B;  4AR5 A;  2C6B A;  5GAE c;  5MFP A;  4AI2 A;  4POG A;  4AI3 A;  3J7Y 1;  2XJS A;  1IRO A;  3KYX A;  1QYB A;  4AI0 A;  4AHY A;  3J7Z 1;  4TVM A;  4UY8 1;  1IRN A;  1NNQ A;  5IY0 A;  2V0F A;  2K2D A;  1RB9 A;  3NFP I;  1VZI A;  5GAG c;  3PKJ A;  2A6E D;  2A68 D;  4AHZ A;  1R0H A;  1IW7 D;  5JVG 1;  4AHX A;  4YWM A;  3WWN B;  4WFN 1;  1ZRP A;  2LCQ A;  3RZ6 A;  1DVB A;  3PWF A;  1E8J A;  2PYA A;  1B2O A;  1T9P A;  5H1S c;  2A69 D;  2PSM C;  1LKO A;  1BE7 A;  1YUX A;  2KN9 A;  1R0J A;  5MLC 3;  1R0G A;  4JAG A;  3PKI A;  1LTL A;  3PIO 1;  4GS7 D;  6RXN A;  2M6O A;  1R0F A;  2XJP A;  1OWC A;  2O5J D;  2L0Z A;  3LPE B;  5GAH c;  4ZN3 B;  4G6B A;  4AR6 A;  2H12 A;  4YWL A;  2BE5 D;  3KYY A;  1JYB A;  2V0E A;  2CR8 A;  5AI3 A;  3SS2 A;  1OWB A;  2CKA A;  2PVX A;  3QQC E;  1FHM A;  1R0I A;  3VPB E;  4U67 1;  3B0A B;  1BQ8 A;  1BRF A;  4RXN A;  3A44 A;  1LKM A;  1RDG A;  4ME3 A;  1RYQ A;  3QVD A;  3PIP 1;  2B5I D;  1SMU A;  2ERS A;  2PPT A;  5MF6 A;  1SMM A;  4XGH A;  2XJT A;  5JVH 1;  5K2M E;  5DM7 1;  4V19 6;  3IU3 I;  1DX8 A;  2ZIX A;  2RDV A;  5EIO C;  2KKD A;  1B2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...