1IRNA

Rubredoxin (zn-substituted) at 1.2 angstroms resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Zinc- and iron-rubredoxins from Clostridium pasteurianum at atomic resolution: a high-precision model of a ZnS4 coordination unit in a protein.
pubmed doi rcsb
molecule tags Electron transport
total genus 9
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1995-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1irnA00
1IROA 1T9PA 3KYWA 1RB9A 2LCQA 1LKMA 3KYYA 1T9OA 4K9FA 1BQ8A 1H7VA 3KYVA 1S24A 3RZ6A 1E8JA 4POFA 1R0HA 4TPUA 1R0JA 4AR5A 3QVDA 1YUZA 2K2DA 1BQ9A 2PVEA 2PYAA 2QL0A 3A44A 2M4YA 1C09A 1T9QA 2VL6A 1ZRPA 2RDVA 1B71A 1SMWA 1BRFA 1R0GA 4AR4A 2KN9A 2V3BB 3KYUA 5IY0A 1YV1A 1CADA 1VCXA 1LKPA 6RXNA 3RZTA 1YK5A 5RXNA 1R0IA 3MPSA 1DX8A 2MS3A 1DVBA 1QYBA 1B2JA 1S30A 1B13A 1CAAA 1B2OA 2DSXA 1SMMA 1YK4A 1IU6A 2KKDA 1RDVA 1LTLA 1RWDA 4YWLA 1BE7A 1LKOA 1JYBA 1YUXA 8RXNA 4YWMA 3PWFA 2PVXA 1RYTA 4AR6A 1SMUA 5AI3A 1S2ZA 1IRNA 1FHMA 3RYGA 2GMGA 1RDGA 1R0FA 3SS2A 1NNQA 1IU5A 4RXNA 2HR5A 4ME3A 1BFYA 3KYXA 1FHHA 3PZAA 4POGA 7RXNA 1QCVA 4AR3A 5AI2A
chains in the Genus database with same CATH superfamily
5C4JL 3HJWB 5MFZA 1IROA 1K83L 1T9PA 2AUSB 2XJRA 1T9OA 3IU3I 1PFUA 1S24A 4V196 4B8CD 3LWRB 2C6BA 1NXGA 1IW7D 4TPUA 2VUML 2PSMC 5M3ML 3QVDA 1I6HL 2A6ED 4C3IL 2XJSA 1BQ9A 2PVEA 3HOVL 2PYAA 2EY4E 2M4YA 3HOYL 4Y7NL 1TWGL 2NYDA 4AHZA 4XGHA 1B71A 2B63L 1NXEA 5M3FL 3S1NL 3I4ML 1PFWA 5IY0A 1PZXA 4U671 2O5JD 1VCXA 3GTKL 1VZIA 2AYJA 5DM61 2APOB 2CR8A 2L0ZA 1QYBA 1B2JA 1CAAA 2A68D 4BXXL 4JAFA 5M5XL 3RZOL 1SMMA 2XJPA 4BY1L 5EINC 4A3ML 3GTLL 2Y0SP 3VPBE 4XXBB 2M6PA 4YWLA 2E2HL 1Y1VL 2NVXL 3H97A 1SMUA 3S2DL 3I4NL 1S2ZA 1Y1WL 2GMGA 1RDGA 1R0FA 3SS2A 2J9UB 1SFOL 3PO2L 1NNQA 3PKJA 2HR5A 3LWQB 5GAEc 3GTQL 3GTML 3M4OL 7RXNA 1PFYA 5DM71 4AR3A 5AI2A 4G6BA 3LWPB 2PMZP 5MF6A 3KYWA 2M4VA 1RB9A 2LCQA 3GTJL 3S2HL 2Z3QB 4K9FA 1BQ8A 4BY7L 3FDJA 1H7VA 2V0EA 3QQCE 3RZDL 1E8JA 2B5ID 3PIP1 2JI3A 4ZN3B 3GTGL 3H9BA 4AR5A 5IYCL 4LHLA 2JA8L 2QL0A 3A44A 2R93L 1T9QA 1ZRPA 2RDVA 3HOUL 2NVYL 5AN9H 1R0GA 3LPEB 2V3BB 3PL5A 3KYUA 2NVTL 2JA6L 3PO3L 2WB1P 2M6OA 6RXNA 3RZTA 3GTOL 2JA5L 1R0IA 4AI3A 3P8BA 2AQCA 2CKCA 4A93L 4LHNA 1DVBA 4JAGA 1B2OA 3S15L 4C2M1 4C3JL 4A3DL 4A3CL 4A3IL 3HOZL 1RWDA 1Z92B 2NVQL 1BE7A 1LKOA 1JYBA 3H99A 3J7Z1 4JADA 1TWFL 4YWMA 2PVXA 5IP7L 2XJVA 3WWLA 4AR6A 5AI3A 4UY81 1IRNA 1FHMA 3RYGA 4A3GL 2ZIXA 3B0AB 3H3VM 4TVMA 4AI1A 1IU5A 5GAGc 1BFYA 1FHHA 1R9TL 5FJ8L 2V0FA 2R92L 1F4LA 4AYBP 2JI1A 3ZG6A 3H0GL 1WCML 3GTPL 3KYYA 2WAQP 3WWNB 3P2AA 4X6AL 3KYVA 1P7PA 4A3EL 4POFA 1R0HA 4E6YA 1R0JA 1YUZA 3NFPI 5IYBL 3CQZL 2XJTA 1SMWA 4BBSL 1BRFA 3PIO1 2XJUA 2KN9A 5C4XL 1CADA 1LKPA 1YK5A 5RXNA 4BBRL 2XJQA 3MPSA 3K7AL 2MS3A 4AHYA 3J7Y1 2ERSA 3H9CA 3JR7A 5M5WL 5GAHc 3HOXL 5JVG1 1TWHL 5M5YL 4A3FL 1YUXA 8RXNA 3B08B 3S17L 1ODHA 5MFPA 2JI2A 3MQKB 2R7ZL 4AHXA 2E2JL 5C44L 5FLML 5H1Sc 4POGA 3LNLA 3S1RL 3HKZP 5MLC3 1OWBA 2E2IL 2Z3RB 1PFVA 4QIWP 4WFN1 3HOWL 5IP9L 5K2ME 4AI2A 1LKMA 2A69D 3RZ6A 4GS7D 3S1QL 4C3HL 1I3QL 2RFKB 4JAEA 1TWAL 1I50L 3LWVB 3S14L 2K2DA 3LWOB 3MSUA 4A3BL 1C09A 2VL6A 1VZHA 2HVYC 4AR4A 4A3JL 4Y52L 1YV1A 3FKIL 3K35A 2H12A 2C6AA 4AHWA 5MGNA 2A6HD 4A3KL 3S16L 5C3EL 5IYDL 1TWCL 5JVH1 3S1ML 1DX8A 1S30A 2ERJA 4ZN1B 1B13A 5EIOC 1RYQA 2DSXA 1YK4A 2JA7L 1IU6A 3HAXC 2YU9L 2KKDA 1RDVA 1OWCA 1LTLA 1QQTA 3PWFA 1RYTA 3PKIA 1VZGA 2PPTA 3HJYB 4AI0A 4RXNA 2BE5D 4ME3A 1WJVA 3KYXA 3PZAA 4A3LL 3M3YL 5GADc 1QCVA 2CKAA
chains in the Genus database with same CATH topology
1OWBA 2Z3RB 2JI1A 3ZG6A 5MFZA 1IROA 1T9PA 4WFN1 5MF6A 3KYWA 2M4VA 1RB9A 2XJRA 2LCQA 5K2ME 4AI2A 1LKMA 3KYYA 2Z3QB 1T9OA 3WWNB 4K9FA 3IU3I 1BQ8A 1H7VA 2V0EA 3P2AA 2A69D 3KYVA 3QQCE 1S24A 3RZ6A 4GS7D 4V196 4B8CD 2C6BA 1NXGA 4POFA 1E8JA 1IW7D 1R0HA 5MLC3 2B5ID 4TPUA 4E6YA 1R0JA 3PIP1 2PSMC 2JI3A 4ZN3B 4JAEA 4AR5A 3QVDA 4LHLA 2A6ED 1YUZA 3NFPI 2XJSA 2K2DA 1BQ9A 2PVEA 2PYAA 3MSUA 2QL0A 3A44A 2M4YA 1C09A 1T9QA 2VL6A 1ZRPA 2NYDA 2RDVA 1VZHA 4AHZA 2XJTA 4XGHA 1B71A 1SMWA 5AN9H 1BRFA 1R0GA 1NXEA 3LPEB 3PIO1 4AR4A 2XJUA 2KN9A 2V3BB 3KYUA 5IY0A 1YV1A 4U671 3K35A 2H12A 2O5JD 1CADA 1VCXA 2C6AA 1LKPA 2M6OA 6RXNA 4AHWA 1YK5A 3RZTA 5MGNA 2A6HD 5RXNA 1VZIA 1R0IA 4AI3A 2AYJA 5DM61 2XJQA 3MPSA 3P8BA 5JVH1 2CKCA 2CR8A 2L0ZA 5AI2A 1DX8A 2MS3A 1DVBA 1QYBA 1B2JA 4LHNA 4AHYA 3J7Y1 1S30A 2ERJA 4JAGA 1B13A 4ZN1B 5EIOC 1CAAA 1B2OA 2A68D 2ERSA 4JAFA 1RYQA 2DSXA 1SMMA 1YK4A 2XJPA 1IU6A 5EINC 5GAHc 5JVG1 3VPBE 4XXBB 2M6PA 2KKDA 1RDVA 1OWCA 1LTLA 1RWDA 4YWLA 1Z92B 1BE7A 1LKOA 1JYBA 1YUXA 8RXNA 3J7Z1 4JADA 4YWMA 3PWFA 2PVXA 1RYTA 3B08B 2XJVA 3WWLA 4AR6A 1SMUA 5AI3A 1ODHA 4UY81 1S2ZA 1IRNA 1FHMA 5MFPA 2JI2A 3RYGA 2GMGA 1RDGA 2ZIXA 1R0FA 3PKIA 1VZGA 3B0AB 3SS2A 2J9UB 4TVMA 2PPTA 4AI0A 1NNQA 3PKJA 4AI1A 1IU5A 4AHXA 4RXNA 2HR5A 2BE5D 4ME3A 5GAEc 5GAGc 1WJVA 1BFYA 3KYXA 1FHHA 5H1Sc 3PZAA 4POGA 3LNLA 5GADc 2V0FA 7RXNA 1QCVA 5DM71 2CKAA 4AR3A 4G6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRO A;  1T9P A;  3KYW A;  1RB9 A;  2LCQ A;  1LKM A;  3KYY A;  1T9O A;  4K9F A;  1BQ8 A;  1H7V A;  3KYV A;  1S24 A;  3RZ6 A;  1E8J A;  4POF A;  1R0H A;  4TPU A;  1R0J A;  4AR5 A;  3QVD A;  1YUZ A;  2K2D A;  1BQ9 A;  2PVE A;  2PYA A;  2QL0 A;  3A44 A;  2M4Y A;  1C09 A;  1T9Q A;  2VL6 A;  1ZRP A;  2RDV A;  1B71 A;  1SMW A;  1BRF A;  1R0G A;  4AR4 A;  2KN9 A;  2V3B B;  3KYU A;  5IY0 A;  1YV1 A;  1CAD A;  1VCX A;  1LKP A;  6RXN A;  3RZT A;  1YK5 A;  5RXN A;  1R0I A;  3MPS A;  1DX8 A;  2MS3 A;  1DVB A;  1QYB A;  1B2J A;  1S30 A;  1B13 A;  1CAA A;  1B2O A;  2DSX A;  1SMM A;  1YK4 A;  1IU6 A;  2KKD A;  1RDV A;  1LTL A;  1RWD A;  4YWL A;  1BE7 A;  1LKO A;  1JYB A;  1YUX A;  8RXN A;  4YWM A;  3PWF A;  2PVX A;  1RYT A;  4AR6 A;  1SMU A;  5AI3 A;  1S2Z A;  1IRN A;  1FHM A;  3RYG A;  2GMG A;  1RDG A;  1R0F A;  3SS2 A;  1NNQ A;  1IU5 A;  4RXN A;  2HR5 A;  4ME3 A;  1BFY A;  3KYX A;  1FHH A;  3PZA A;  4POG A;  7RXN A;  1QCV A;  4AR3 A;  5AI2 A; 
#chains in the Genus database with same CATH topology
 5C4J L;  3HJW B;  5MFZ A;  1IRO A;  1K83 L;  1T9P A;  2AUS B;  2XJR A;  1T9O A;  3IU3 I;  1PFU A;  1S24 A;  4V19 6;  4B8C D;  3LWR B;  2C6B A;  1NXG A;  1IW7 D;  4TPU A;  2VUM L;  2PSM C;  5M3M L;  3QVD A;  1I6H L;  2A6E D;  4C3I L;  2XJS A;  1BQ9 A;  2PVE A;  3HOV L;  2PYA A;  2EY4 E;  2M4Y A;  3HOY L;  4Y7N L;  1TWG L;  2NYD A;  4AHZ A;  4XGH A;  1B71 A;  2B63 L;  1NXE A;  5M3F L;  3S1N L;  3I4M L;  1PFW A;  5IY0 A;  1PZX A;  4U67 1;  2O5J D;  1VCX A;  3GTK L;  1VZI A;  2AYJ A;  5DM6 1;  2APO B;  2CR8 A;  2L0Z A;  1QYB A;  1B2J A;  1CAA A;  2A68 D;  4BXX L;  4JAF A;  5M5X L;  3RZO L;  1SMM A;  2XJP A;  4BY1 L;  5EIN C;  4A3M L;  3GTL L;  2Y0S P;  3VPB E;  4XXB B;  2M6P A;  4YWL A;  2E2H L;  1Y1V L;  2NVX L;  3H97 A;  1SMU A;  3S2D L;  3I4N L;  1S2Z A;  1Y1W L;  2GMG A;  1RDG A;  1R0F A;  3SS2 A;  2J9U B;  1SFO L;  3PO2 L;  1NNQ A;  3PKJ A;  2HR5 A;  3LWQ B;  5GAE c;  3GTQ L;  3GTM L;  3M4O L;  7RXN A;  1PFY A;  5DM7 1;  4AR3 A;  5AI2 A;  4G6B A;  3LWP B;  2PMZ P;  5MF6 A;  3KYW A;  2M4V A;  1RB9 A;  2LCQ A;  3GTJ L;  3S2H L;  2Z3Q B;  4K9F A;  1BQ8 A;  4BY7 L;  3FDJ A;  1H7V A;  2V0E A;  3QQC E;  3RZD L;  1E8J A;  2B5I D;  3PIP 1;  2JI3 A;  4ZN3 B;  3GTG L;  3H9B A;  4AR5 A;  5IYC L;  4LHL A;  2JA8 L;  2QL0 A;  3A44 A;  2R93 L;  1T9Q A;  1ZRP A;  2RDV A;  3HOU L;  2NVY L;  5AN9 H;  1R0G A;  3LPE B;  2V3B B;  3PL5 A;  3KYU A;  2NVT L;  2JA6 L;  3PO3 L;  2WB1 P;  2M6O A;  6RXN A;  3RZT A;  3GTO L;  2JA5 L;  1R0I A;  4AI3 A;  3P8B A;  2AQC A;  2CKC A;  4A93 L;  4LHN A;  1DVB A;  4JAG A;  1B2O A;  3S15 L;  4C2M 1;  4C3J L;  4A3D L;  4A3C L;  4A3I L;  3HOZ L;  1RWD A;  1Z92 B;  2NVQ L;  1BE7 A;  1LKO A;  1JYB A;  3H99 A;  3J7Z 1;  4JAD A;  1TWF L;  4YWM A;  2PVX A;  5IP7 L;  2XJV A;  3WWL A;  4AR6 A;  5AI3 A;  4UY8 1;  1IRN A;  1FHM A;  3RYG A;  4A3G L;  2ZIX A;  3B0A B;  3H3V M;  4TVM A;  4AI1 A;  1IU5 A;  5GAG c;  1BFY A;  1FHH A;  1R9T L;  5FJ8 L;  2V0F A;  2R92 L;  1F4L A;  4AYB P;  2JI1 A;  3ZG6 A;  3H0G L;  1WCM L;  3GTP L;  3KYY A;  2WAQ P;  3WWN B;  3P2A A;  4X6A L;  3KYV A;  1P7P A;  4A3E L;  4POF A;  1R0H A;  4E6Y A;  1R0J A;  1YUZ A;  3NFP I;  5IYB L;  3CQZ L;  2XJT A;  1SMW A;  4BBS L;  1BRF A;  3PIO 1;  2XJU A;  2KN9 A;  5C4X L;  1CAD A;  1LKP A;  1YK5 A;  5RXN A;  4BBR L;  2XJQ A;  3MPS A;  3K7A L;  2MS3 A;  4AHY A;  3J7Y 1;  2ERS A;  3H9C A;  3JR7 A;  5M5W L;  5GAH c;  3HOX L;  5JVG 1;  1TWH L;  5M5Y L;  4A3F L;  1YUX A;  8RXN A;  3B08 B;  3S17 L;  1ODH A;  5MFP A;  2JI2 A;  3MQK B;  2R7Z L;  4AHX A;  2E2J L;  5C44 L;  5FLM L;  5H1S c;  4POG A;  3LNL A;  3S1R L;  3HKZ P;  5MLC 3;  1OWB A;  2E2I L;  2Z3R B;  1PFV A;  4QIW P;  4WFN 1;  3HOW L;  5IP9 L;  5K2M E;  4AI2 A;  1LKM A;  2A69 D;  3RZ6 A;  4GS7 D;  3S1Q L;  4C3H L;  1I3Q L;  2RFK B;  4JAE A;  1TWA L;  1I50 L;  3LWV B;  3S14 L;  2K2D A;  3LWO B;  3MSU A;  4A3B L;  1C09 A;  2VL6 A;  1VZH A;  2HVY C;  4AR4 A;  4A3J L;  4Y52 L;  1YV1 A;  3FKI L;  3K35 A;  2H12 A;  2C6A A;  4AHW A;  5MGN A;  2A6H D;  4A3K L;  3S16 L;  5C3E L;  5IYD L;  1TWC L;  5JVH 1;  3S1M L;  1DX8 A;  1S30 A;  2ERJ A;  4ZN1 B;  1B13 A;  5EIO C;  1RYQ A;  2DSX A;  1YK4 A;  2JA7 L;  1IU6 A;  3HAX C;  2YU9 L;  2KKD A;  1RDV A;  1OWC A;  1LTL A;  1QQT A;  3PWF A;  1RYT A;  3PKI A;  1VZG A;  2PPT A;  3HJY B;  4AI0 A;  4RXN A;  2BE5 D;  4ME3 A;  1WJV A;  3KYX A;  3PZA A;  4A3L L;  3M3Y L;  5GAD c;  1QCV A;  2CKA A; 
#chains in the Genus database with same CATH homology
 1OWB A;  2Z3R B;  2JI1 A;  3ZG6 A;  5MFZ A;  1IRO A;  1T9P A;  4WFN 1;  5MF6 A;  3KYW A;  2M4V A;  1RB9 A;  2XJR A;  2LCQ A;  5K2M E;  4AI2 A;  1LKM A;  3KYY A;  2Z3Q B;  1T9O A;  3WWN B;  4K9F A;  3IU3 I;  1BQ8 A;  1H7V A;  2V0E A;  3P2A A;  2A69 D;  3KYV A;  3QQC E;  1S24 A;  3RZ6 A;  4GS7 D;  4V19 6;  4B8C D;  2C6B A;  1NXG A;  4POF A;  1E8J A;  1IW7 D;  1R0H A;  5MLC 3;  2B5I D;  4TPU A;  4E6Y A;  1R0J A;  3PIP 1;  2PSM C;  2JI3 A;  4ZN3 B;  4JAE A;  4AR5 A;  3QVD A;  4LHL A;  2A6E D;  1YUZ A;  3NFP I;  2XJS A;  2K2D A;  1BQ9 A;  2PVE A;  2PYA A;  3MSU A;  2QL0 A;  3A44 A;  2M4Y A;  1C09 A;  1T9Q A;  2VL6 A;  1ZRP A;  2NYD A;  2RDV A;  1VZH A;  4AHZ A;  2XJT A;  4XGH A;  1B71 A;  1SMW A;  5AN9 H;  1BRF A;  1R0G A;  1NXE A;  3LPE B;  3PIO 1;  4AR4 A;  2XJU A;  2KN9 A;  2V3B B;  3KYU A;  5IY0 A;  1YV1 A;  4U67 1;  3K35 A;  2H12 A;  2O5J D;  1CAD A;  1VCX A;  2C6A A;  1LKP A;  2M6O A;  6RXN A;  4AHW A;  1YK5 A;  3RZT A;  5MGN A;  2A6H D;  5RXN A;  1VZI A;  1R0I A;  4AI3 A;  2AYJ A;  5DM6 1;  2XJQ A;  3MPS A;  3P8B A;  5JVH 1;  2CKC A;  2CR8 A;  2L0Z A;  5AI2 A;  1DX8 A;  2MS3 A;  1DVB A;  1QYB A;  1B2J A;  4LHN A;  4AHY A;  3J7Y 1;  1S30 A;  2ERJ A;  4JAG A;  1B13 A;  4ZN1 B;  5EIO C;  1CAA A;  1B2O A;  2A68 D;  2ERS A;  4JAF A;  1RYQ A;  2DSX A;  1SMM A;  1YK4 A;  2XJP A;  1IU6 A;  5EIN C;  5GAH c;  5JVG 1;  3VPB E;  4XXB B;  2M6P A;  2KKD A;  1RDV A;  1OWC A;  1LTL A;  1RWD A;  4YWL A;  1Z92 B;  1BE7 A;  1LKO A;  1JYB A;  1YUX A;  8RXN A;  3J7Z 1;  4JAD A;  4YWM A;  3PWF A;  2PVX A;  1RYT A;  3B08 B;  2XJV A;  3WWL A;  4AR6 A;  1SMU A;  5AI3 A;  1ODH A;  4UY8 1;  1S2Z A;  1IRN A;  1FHM A;  5MFP A;  2JI2 A;  3RYG A;  2GMG A;  1RDG A;  2ZIX A;  1R0F A;  3PKI A;  1VZG A;  3B0A B;  3SS2 A;  2J9U B;  4TVM A;  2PPT A;  4AI0 A;  1NNQ A;  3PKJ A;  4AI1 A;  1IU5 A;  4AHX A;  4RXN A;  2HR5 A;  2BE5 D;  4ME3 A;  5GAE c;  5GAG c;  1WJV A;  1BFY A;  3KYX A;  1FHH A;  5H1S c;  3PZA A;  4POG A;  3LNL A;  5GAD c;  2V0F A;  7RXN A;  1QCV A;  5DM7 1;  2CKA A;  4AR3 A;  4G6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...