1IRNA

Rubredoxin (zn-substituted) at 1.2 angstroms resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Zinc- and iron-rubredoxins from Clostridium pasteurianum at atomic resolution: a high-precision model of a ZnS4 coordination unit in a protein.
pubmed doi rcsb
molecule tags Electron transport
total genus 9
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1995-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1irnA00
1YK5A 4RXNA 1S2ZA 1T9PA 1S24A 1SMMA 2M4YA 4POGA 3RZTA 1YV1A 2MS3A 1B13A 1LKOA 6RXNA 3KYUA 1IRNA 1FHMA 1DVBA 2PVEA 1RWDA 1QCVA 4AR3A 1BQ9A 1RDGA 4TPUA 1T9OA 3SS2A 7RXNA 1R0IA 2RDVA 1CAAA 1B2JA 1ZRPA 1T9QA 1YK4A 3QVDA 1RYTA 3RYGA 1YUZA 1R0JA 2VL6A 2V3BB 1CADA 1DX8A 1R0HA 1IROA 1E8JA 5AI2A 1QYBA 2GMGA 3KYYA 4YWLA 1IU5A 2QL0A 1SMUA 1LKPA 1S30A 3PZAA 1B2OA 3RZ6A 4AR4A 2PYAA 2KN9A 4ME3A 1RB9A 2KKDA 4POFA 1JYBA 4AR6A 1BRFA 1FHHA 3KYVA 3KYXA 5RXNA 1H7VA 3A44A 1BFYA 2HR5A 2PVXA 1R0GA 1SMWA 4AR5A 5IY0A 1R0FA 1NNQA 2LCQA 3PWFA 1LTLA 3KYWA 1IU6A 3MPSA 1BE7A 2K2DA 8RXNA 1YUXA 2DSXA 1C09A 1BQ8A 1VCXA 4YWMA 4K9FA 1LKMA 1B71A 5AI3A 1RDVA
chains in the Genus database with same CATH superfamily
2NVTL 3PKIA 2PMZP 2WAQP 3RZTA 1YV1A 2MS3A 2ERSA 3KYUA 1RWDA 2A69D 4A3GL 2NVQL 1BQ9A 7RXNA 4A3BL 4A3CL 2JA7L 2RDVA 4AHZA 5FJ8L 3S2DL 4A3IL 1B2JA 4BY7L 1YK4A 1RYQA 1RYTA 4AI3A 4JAEA 1YUZA 5IYCL 1VZHA 2V3BB 1TWGL 3GTJL 1CADA 2V0FA 1SFOL 3PO2L 3PIO1 4X6AL 4C2M1 1QYBA 5MFZA 4A3EL 4XGHA 1Y1WL 2EY4E 1SMUA 2QL0A 4AI2A 4ZN3B 4A3FL 2JA6L 4G6BA 3RZ6A 4AR4A 2A68D 3GTOL 4JAGA 1PFYA 5JVG1 1OWBA 1FHHA 1BFYA 2CKCA 1R0GA 4Y52L 4AR5A 5IY0A 2M6PA 2XJQA 3RZOL 3HOWL 3H9CA 4AI1A 3KYWA 3WWLA 4AI0A 3VPBE 2PSMC 4YWMA 1Z92B 1B71A 4BXXL 2PVXA 1RDVA 4QIWP 1S2ZA 2XJRA 1SMMA 3P8BA 4POGA 2WB1P 4E6YA 3GTLL 4WFN1 3S2HL 3PO3L 3P2AA 1I50L 2PVEA 3H9BA 1QCVA 3ZG6A 3HJYB 3FDJA 3HOXL 1CAAA 2M4VA 2V0EA 5GAHc 3RZDL 3S17L 2Z3QB 5GAGc 2C6AA 3NFPI 3QVDA 1TWHL 5H1Sc 1R0JA 2VL6A 4A3JL 1DX8A 3S15L 1R0HA 1IROA 5MF6A 5DM71 5C44L 3J7Y1 2E2IL 2XJTA 1TWFL 2PYAA 5DM61 2PPTA 2O5JD 4AYBP 2KKDA 4BBSL 3K35A 4A3KL 5MLC3 3KYXA 2JI3A 2HR5A 3GTKL 1SMWA 5C4XL 3S14L 2A6ED 3B0AB 1IU6A 3I4ML 4BY1L 3I4NL 1R9TL 4XXBB 5IYDL 2XJUA 2M6OA 1NXEA 4RXNA 4BBRL 2JA8L 2H12A 2M4YA 2Y0SP 3S1NL 1PZXA 1TWAL 5GADc 2R92L 3LWVB 3FKIL 1B13A 1QQTA 3M4OL 1K83L 2NVXL 5IYBL 1LKOA 4A3DL 6RXNA 2CKAA 1FHMA 1P7PA 5M5YL 4AR3A 1RDGA 4TPUA 2B5ID 3SS2A 5GAEc 3H3VM 3HKZP 1ZRPA 1T9QA 3LWPB 3HJWB 3M3YL 3RYGA 3LWOB 2AUSB 4LHLA 1TWCL 4AHYA 1VZGA 5IP9L 4AHXA 4LHNA 4JAFA 5EINC 3GTGL 1E8JA 3H99A 5AI2A 1PFVA 2GMGA 4YWLA 2XJPA 1IU5A 1S30A 5K2ME 3PZAA 2R7ZL 3PIP1 3HOVL 2KN9A 4V196 4ME3A 1NXGA 1RB9A 4POFA 2B63L 1JYBA 3LWQB 4AR6A 2E2JL 2NYDA 3CQZL 5JVH1 5EIOC 1H7VA 3A44A 3J7Z1 4C3JL 2R93L 3GTQL 3GTPL 3HOUL 3HOYL 1R0FA 3GTML 2NVYL 4AHWA 2ERJA 3PWFA 1LTLA 1I3QL 5M5XL 2L0ZA 2AQCA 1OWCA 3JR7A 5M3ML 1BE7A 5M5WL 3S1QL 3MSUA 2K2DA 3B08B 5C3EL 2RFKB 4U671 2C6BA 2JI1A 3QQCE 3WWNB 4A3LL 5M3FL 3S1RL 5AI3A 1YK5A 1WJVA 1T9PA 2HVYC 1S24A 2JI2A 3H97A 3LNLA 2AYJA 3IU3I 1IRNA 4TVMA 2Z3RB 3PKJA 1PFWA 4UY81 1DVBA 5C4JL 1T9OA 2YU9L 1R0IA 5FLML 2APOB 1F4LA 3LPEB 1VZIA 4A3ML 5MGNA 2A6HD 2J9UB 3HOZL 4ZN1B 3S16L 4JADA 2CR8A 4Y7NL 3S1ML 1I6HL 5IP7L 1WCML 3MQKB 4GS7D 3KYYA 2E2HL 1LKPA 2XJVA 3LWRB 1B2OA 4C3IL 3HAXC 2VUML 1PFUA 3H0GL 5AN9H 2XJSA 4A93L 1BRFA 3KYVA 5RXNA 2JA5L 5MFPA 1ODHA 1NNQA 2LCQA 1IW7D 1Y1VL 2ZIXA 3MPSA 8RXNA 1YUXA 2DSXA 1C09A 4B8CD 3K7AL 1BQ8A 1VCXA 4C3HL 4K9FA 1LKMA 2BE5D 3PL5A
chains in the Genus database with same CATH topology
1YK5A 1WJVA 4RXNA 1S2ZA 3PKIA 1T9PA 2XJRA 1S24A 1SMMA 2H12A 2M4YA 3P8BA 4POGA 2JI2A 3RZTA 3LNLA 5GADc 4E6YA 1YV1A 2MS3A 1B13A 4WFN1 2AYJA 3IU3I 2ERSA 1LKOA 6RXNA 3KYUA 1IRNA 2CKAA 1FHMA 4TVMA 2Z3RB 3PKJA 4UY81 1DVBA 2PVEA 3P2AA 1RWDA 1QCVA 2A69D 4AR3A 3ZG6A 1BQ9A 1RDGA 4TPUA 2B5ID 1T9OA 3SS2A 7RXNA 5GAEc 1R0IA 2RDVA 1CAAA 2M4VA 4AHZA 2V0EA 1B2JA 5GAHc 1ZRPA 1T9QA 2Z3QB 3LPEB 1YK4A 5GAGc 2C6AA 1VZIA 3NFPI 1RYQA 3QVDA 1RYTA 5MGNA 2A6HD 3RYGA 5H1Sc 4AI3A 2J9UB 1YUZA 4JAEA 1R0JA 4ZN1B 2VL6A 1VZHA 2CR8A 2V3BB 4JADA 4LHLA 4AHYA 1VZGA 1CADA 2V0FA 4AHXA 1DX8A 1R0HA 3PIO1 1IROA 4LHNA 4JAFA 5EINC 5MF6A 5DM71 4GS7D 1E8JA 5AI2A 1QYBA 5MFZA 2GMGA 3KYYA 4XGHA 2XJPA 1IU5A 2QL0A 1SMUA 1LKPA 4YWLA 4AI2A 4ZN3B 3J7Y1 1S30A 5K2ME 2XJVA 3PZAA 1B2OA 2XJTA 3PIP1 4G6BA 3RZ6A 4AR4A 2PYAA 5DM61 2KN9A 2A68D 2PPTA 2XJSA 4ME3A 5AN9H 4V196 1NXGA 1RB9A 2KKDA 4POFA 1JYBA 2O5JD 3K35A 4JAGA 4AR6A 1BRFA 5MLC3 1OWBA 2NYDA 5JVG1 5JVH1 1FHHA 3KYVA 5EIOC 3KYXA 5RXNA 1H7VA 2JI3A 3A44A 3J7Z1 2HR5A 1BFYA 2CKCA 2PVXA 5MFPA 1R0GA 1SMWA 4AR5A 5IY0A 2M6PA 2XJQA 1ODHA 1R0FA 1NNQA 4AHWA 2ERJA 3PWFA 1LTLA 2LCQA 2L0ZA 3KYWA 2A6ED 4AI1A 1OWCA 1IW7D 3B0AB 1IU6A 3WWLA 2ZIXA 4AI0A 3MPSA 1BE7A 3VPBE 4XXBB 2PSMC 3MSUA 2K2DA 8RXNA 3B08B 1YUXA 2DSXA 4U671 1C09A 2C6BA 4B8CD 1BQ8A 2JI1A 1VCXA 4YWMA 2XJUA 2M6OA 1Z92B 4K9FA 1LKMA 3QQCE 2BE5D 3WWNB 1NXEA 1B71A 5AI3A 1RDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK5 A;  4RXN A;  1S2Z A;  1T9P A;  1S24 A;  1SMM A;  2M4Y A;  4POG A;  3RZT A;  1YV1 A;  2MS3 A;  1B13 A;  1LKO A;  6RXN A;  3KYU A;  1IRN A;  1FHM A;  1DVB A;  2PVE A;  1RWD A;  1QCV A;  4AR3 A;  1BQ9 A;  1RDG A;  4TPU A;  1T9O A;  3SS2 A;  7RXN A;  1R0I A;  2RDV A;  1CAA A;  1B2J A;  1ZRP A;  1T9Q A;  1YK4 A;  3QVD A;  1RYT A;  3RYG A;  1YUZ A;  1R0J A;  2VL6 A;  2V3B B;  1CAD A;  1DX8 A;  1R0H A;  1IRO A;  1E8J A;  5AI2 A;  1QYB A;  2GMG A;  3KYY A;  4YWL A;  1IU5 A;  2QL0 A;  1SMU A;  1LKP A;  1S30 A;  3PZA A;  1B2O A;  3RZ6 A;  4AR4 A;  2PYA A;  2KN9 A;  4ME3 A;  1RB9 A;  2KKD A;  4POF A;  1JYB A;  4AR6 A;  1BRF A;  1FHH A;  3KYV A;  3KYX A;  5RXN A;  1H7V A;  3A44 A;  1BFY A;  2HR5 A;  2PVX A;  1R0G A;  1SMW A;  4AR5 A;  5IY0 A;  1R0F A;  1NNQ A;  2LCQ A;  3PWF A;  1LTL A;  3KYW A;  1IU6 A;  3MPS A;  1BE7 A;  2K2D A;  8RXN A;  1YUX A;  2DSX A;  1C09 A;  1BQ8 A;  1VCX A;  4YWM A;  4K9F A;  1LKM A;  1B71 A;  5AI3 A;  1RDV A; 
#chains in the Genus database with same CATH topology
 2NVT L;  3PKI A;  2PMZ P;  2WAQ P;  3RZT A;  1YV1 A;  2MS3 A;  2ERS A;  3KYU A;  1RWD A;  2A69 D;  4A3G L;  2NVQ L;  1BQ9 A;  7RXN A;  4A3B L;  4A3C L;  2JA7 L;  2RDV A;  4AHZ A;  5FJ8 L;  3S2D L;  4A3I L;  1B2J A;  4BY7 L;  1YK4 A;  1RYQ A;  1RYT A;  4AI3 A;  4JAE A;  1YUZ A;  5IYC L;  1VZH A;  2V3B B;  1TWG L;  3GTJ L;  1CAD A;  2V0F A;  1SFO L;  3PO2 L;  3PIO 1;  4X6A L;  4C2M 1;  1QYB A;  5MFZ A;  4A3E L;  4XGH A;  1Y1W L;  2EY4 E;  1SMU A;  2QL0 A;  4AI2 A;  4ZN3 B;  4A3F L;  2JA6 L;  4G6B A;  3RZ6 A;  4AR4 A;  2A68 D;  3GTO L;  4JAG A;  1PFY A;  5JVG 1;  1OWB A;  1FHH A;  1BFY A;  2CKC A;  1R0G A;  4Y52 L;  4AR5 A;  5IY0 A;  2M6P A;  2XJQ A;  3RZO L;  3HOW L;  3H9C A;  4AI1 A;  3KYW A;  3WWL A;  4AI0 A;  3VPB E;  2PSM C;  4YWM A;  1Z92 B;  1B71 A;  4BXX L;  2PVX A;  1RDV A;  4QIW P;  1S2Z A;  2XJR A;  1SMM A;  3P8B A;  4POG A;  2WB1 P;  4E6Y A;  3GTL L;  4WFN 1;  3S2H L;  3PO3 L;  3P2A A;  1I50 L;  2PVE A;  3H9B A;  1QCV A;  3ZG6 A;  3HJY B;  3FDJ A;  3HOX L;  1CAA A;  2M4V A;  2V0E A;  5GAH c;  3RZD L;  3S17 L;  2Z3Q B;  5GAG c;  2C6A A;  3NFP I;  3QVD A;  1TWH L;  5H1S c;  1R0J A;  2VL6 A;  4A3J L;  1DX8 A;  3S15 L;  1R0H A;  1IRO A;  5MF6 A;  5DM7 1;  5C44 L;  3J7Y 1;  2E2I L;  2XJT A;  1TWF L;  2PYA A;  5DM6 1;  2PPT A;  2O5J D;  4AYB P;  2KKD A;  4BBS L;  3K35 A;  4A3K L;  5MLC 3;  3KYX A;  2JI3 A;  2HR5 A;  3GTK L;  1SMW A;  5C4X L;  3S14 L;  2A6E D;  3B0A B;  1IU6 A;  3I4M L;  4BY1 L;  3I4N L;  1R9T L;  4XXB B;  5IYD L;  2XJU A;  2M6O A;  1NXE A;  4RXN A;  4BBR L;  2JA8 L;  2H12 A;  2M4Y A;  2Y0S P;  3S1N L;  1PZX A;  1TWA L;  5GAD c;  2R92 L;  3LWV B;  3FKI L;  1B13 A;  1QQT A;  3M4O L;  1K83 L;  2NVX L;  5IYB L;  1LKO A;  4A3D L;  6RXN A;  2CKA A;  1FHM A;  1P7P A;  5M5Y L;  4AR3 A;  1RDG A;  4TPU A;  2B5I D;  3SS2 A;  5GAE c;  3H3V M;  3HKZ P;  1ZRP A;  1T9Q A;  3LWP B;  3HJW B;  3M3Y L;  3RYG A;  3LWO B;  2AUS B;  4LHL A;  1TWC L;  4AHY A;  1VZG A;  5IP9 L;  4AHX A;  4LHN A;  4JAF A;  5EIN C;  3GTG L;  1E8J A;  3H99 A;  5AI2 A;  1PFV A;  2GMG A;  4YWL A;  2XJP A;  1IU5 A;  1S30 A;  5K2M E;  3PZA A;  2R7Z L;  3PIP 1;  3HOV L;  2KN9 A;  4V19 6;  4ME3 A;  1NXG A;  1RB9 A;  4POF A;  2B63 L;  1JYB A;  3LWQ B;  4AR6 A;  2E2J L;  2NYD A;  3CQZ L;  5JVH 1;  5EIO C;  1H7V A;  3A44 A;  3J7Z 1;  4C3J L;  2R93 L;  3GTQ L;  3GTP L;  3HOU L;  3HOY L;  1R0F A;  3GTM L;  2NVY L;  4AHW A;  2ERJ A;  3PWF A;  1LTL A;  1I3Q L;  5M5X L;  2L0Z A;  2AQC A;  1OWC A;  3JR7 A;  5M3M L;  1BE7 A;  5M5W L;  3S1Q L;  3MSU A;  2K2D A;  3B08 B;  5C3E L;  2RFK B;  4U67 1;  2C6B A;  2JI1 A;  3QQC E;  3WWN B;  4A3L L;  5M3F L;  3S1R L;  5AI3 A;  1YK5 A;  1WJV A;  1T9P A;  2HVY C;  1S24 A;  2JI2 A;  3H97 A;  3LNL A;  2AYJ A;  3IU3 I;  1IRN A;  4TVM A;  2Z3R B;  3PKJ A;  1PFW A;  4UY8 1;  1DVB A;  5C4J L;  1T9O A;  2YU9 L;  1R0I A;  5FLM L;  2APO B;  1F4L A;  3LPE B;  1VZI A;  4A3M L;  5MGN A;  2A6H D;  2J9U B;  3HOZ L;  4ZN1 B;  3S16 L;  4JAD A;  2CR8 A;  4Y7N L;  3S1M L;  1I6H L;  5IP7 L;  1WCM L;  3MQK B;  4GS7 D;  3KYY A;  2E2H L;  1LKP A;  2XJV A;  3LWR B;  1B2O A;  4C3I L;  3HAX C;  2VUM L;  1PFU A;  3H0G L;  5AN9 H;  2XJS A;  4A93 L;  1BRF A;  3KYV A;  5RXN A;  2JA5 L;  5MFP A;  1ODH A;  1NNQ A;  2LCQ A;  1IW7 D;  1Y1V L;  2ZIX A;  3MPS A;  8RXN A;  1YUX A;  2DSX A;  1C09 A;  4B8C D;  3K7A L;  1BQ8 A;  1VCX A;  4C3H L;  4K9F A;  1LKM A;  2BE5 D;  3PL5 A; 
#chains in the Genus database with same CATH homology
 1YK5 A;  1WJV A;  4RXN A;  1S2Z A;  3PKI A;  1T9P A;  2XJR A;  1S24 A;  1SMM A;  2H12 A;  2M4Y A;  3P8B A;  4POG A;  2JI2 A;  3RZT A;  3LNL A;  5GAD c;  4E6Y A;  1YV1 A;  2MS3 A;  1B13 A;  4WFN 1;  2AYJ A;  3IU3 I;  2ERS A;  1LKO A;  6RXN A;  3KYU A;  1IRN A;  2CKA A;  1FHM A;  4TVM A;  2Z3R B;  3PKJ A;  4UY8 1;  1DVB A;  2PVE A;  3P2A A;  1RWD A;  1QCV A;  2A69 D;  4AR3 A;  3ZG6 A;  1BQ9 A;  1RDG A;  4TPU A;  2B5I D;  1T9O A;  3SS2 A;  7RXN A;  5GAE c;  1R0I A;  2RDV A;  1CAA A;  2M4V A;  4AHZ A;  2V0E A;  1B2J A;  5GAH c;  1ZRP A;  1T9Q A;  2Z3Q B;  3LPE B;  1YK4 A;  5GAG c;  2C6A A;  1VZI A;  3NFP I;  1RYQ A;  3QVD A;  1RYT A;  5MGN A;  2A6H D;  3RYG A;  5H1S c;  4AI3 A;  2J9U B;  1YUZ A;  4JAE A;  1R0J A;  4ZN1 B;  2VL6 A;  1VZH A;  2CR8 A;  2V3B B;  4JAD A;  4LHL A;  4AHY A;  1VZG A;  1CAD A;  2V0F A;  4AHX A;  1DX8 A;  1R0H A;  3PIO 1;  1IRO A;  4LHN A;  4JAF A;  5EIN C;  5MF6 A;  5DM7 1;  4GS7 D;  1E8J A;  5AI2 A;  1QYB A;  5MFZ A;  2GMG A;  3KYY A;  4XGH A;  2XJP A;  1IU5 A;  2QL0 A;  1SMU A;  1LKP A;  4YWL A;  4AI2 A;  4ZN3 B;  3J7Y 1;  1S30 A;  5K2M E;  2XJV A;  3PZA A;  1B2O A;  2XJT A;  3PIP 1;  4G6B A;  3RZ6 A;  4AR4 A;  2PYA A;  5DM6 1;  2KN9 A;  2A68 D;  2PPT A;  2XJS A;  4ME3 A;  5AN9 H;  4V19 6;  1NXG A;  1RB9 A;  2KKD A;  4POF A;  1JYB A;  2O5J D;  3K35 A;  4JAG A;  4AR6 A;  1BRF A;  5MLC 3;  1OWB A;  2NYD A;  5JVG 1;  5JVH 1;  1FHH A;  3KYV A;  5EIO C;  3KYX A;  5RXN A;  1H7V A;  2JI3 A;  3A44 A;  3J7Z 1;  2HR5 A;  1BFY A;  2CKC A;  2PVX A;  5MFP A;  1R0G A;  1SMW A;  4AR5 A;  5IY0 A;  2M6P A;  2XJQ A;  1ODH A;  1R0F A;  1NNQ A;  4AHW A;  2ERJ A;  3PWF A;  1LTL A;  2LCQ A;  2L0Z A;  3KYW A;  2A6E D;  4AI1 A;  1OWC A;  1IW7 D;  3B0A B;  1IU6 A;  3WWL A;  2ZIX A;  4AI0 A;  3MPS A;  1BE7 A;  3VPB E;  4XXB B;  2PSM C;  3MSU A;  2K2D A;  8RXN A;  3B08 B;  1YUX A;  2DSX A;  4U67 1;  1C09 A;  2C6B A;  4B8C D;  1BQ8 A;  2JI1 A;  1VCX A;  4YWM A;  2XJU A;  2M6O A;  1Z92 B;  4K9F A;  1LKM A;  3QQC E;  2BE5 D;  3WWN B;  1NXE A;  1B71 A;  5AI3 A;  1RDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...