1R0JA

Nickel-substituted rubredoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Metal-substituted derivatives of the rubredoxin from Clostridium pasteurianum.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1r0jA00
1FHMA 1DVBA 1LKMA 6RXNA 2HR5A 3QVDA 1SMUA 1BQ9A 1T9PA 8RXNA 1C09A 1R0HA 1B2JA 4POGA 1QCVA 1NNQA 5RXNA 1B13A 3KYVA 1RB9A 1QYBA 2PYAA 5AI2A 5IY0A 4RXNA 3PWFA 1S30A 3SS2A 2MS3A 1R0FA 1H7VA 1LKOA 1ZRPA 2DSXA 4YWMA 1YV1A 2VL6A 1SMMA 2RDVA 1RWDA 4ME3A 3KYUA 1RDGA 2PVEA 1FHHA 2PVXA 4AR3A 1CADA 1YUXA 1E8JA 1IROA 4TPUA 1SMWA 1R0GA 1RDVA 1DX8A 2M4YA 1BQ8A 1BRFA 2KN9A 1LKPA 2GMGA 4AR5A 1RYTA 1T9QA 5AI3A 1S2ZA 1LTLA 3A44A 3KYWA 1R0IA 3RYGA 1YK4A 4YWLA 1BE7A 1BFYA 1CAAA 2V3BB 7RXNA 1JYBA 3PZAA 3KYXA 3RZ6A 4POFA 1T9OA 1B2OA 1IRNA 1VCXA 4AR6A 3MPSA 1YUZA 2LCQA 1B71A 2K2DA 1YK5A 2QL0A 1IU5A 4K9FA 4AR4A 3KYYA 1IU6A 1S24A 2KKDA 3RZTA 1R0JA
chains in the Genus database with same CATH superfamily
2XJTA 2JI2A 4A3JL 1SMUA 1R9TL 8RXNA 1QCVA 1PFUA 1B13A 3GTQL 3S1QL 3PO2L 1TWGL 2PYAA 3LWOB 3FKIL 1K83L 2PPTA 3J7Y1 1ZRPA 4A3EL 3HJWB 3LPEB 1F4LA 3M3YL 1RWDA 4WFN1 4AHZA 5IYBL 4B8CD 1IROA 4TPUA 1SMWA 4ZN1B 2M4YA 2XJQA 2M6PA 1BRFA 4BY7L 5AN9H 4AR5A 2E2JL 3HOYL 1OWBA 2AQCA 5MF6A 4YWLA 3H9BA 5M3FL 5C4XL 1BE7A 1BFYA 1CAAA 2A6ED 4AI1A 5IP9L 1TWHL 1T9OA 1B2OA 3GTKL 3LNLA 5IP7L 4A3CL 2K2DA 3P2AA 4K9FA 4AHYA 5JVH1 4XGHA 1IU6A 2WB1P 1VZGA 3RZTA 5MFZA 1FHMA 4A3GL 1TWCL 6RXNA 2HR5A 2M6OA 3GTPL 1BQ9A 1T9PA 1NXEA 3S2DL 1B2JA 2NVXL 1Y1WL 5RXNA 3KYVA 2AUSB 2JA7L 3HOVL 3PKIA 3LWRB 1PFWA 5MGNA 5IY0A 1RYQA 1TWAL 3SS2A 4UY81 3HOZL 2E2IL 5IYDL 1R0FA 4A3IL 1H7VA 5JVG1 4C3JL 4YWMA 3S15L 5M3ML 2R92L 3HOXL 1SMMA 1PFVA 4BXXL 3S1RL 1RDGA 2PVEA 4A3FL 1FHHA 3S1ML 1CADA 3CQZL 5IYCL 4LHNA 3MSUA 1RDVA 5GAEc 2NVYL 2CKAA 2B63L 4AI0A 1RYTA 3P8BA 1TWFL 3QQCE 5M5XL 1T9QA 3H97A 3S14L 1LTLA 5DM71 3HAXC 4A93L 4JAEA 4Y7NL 5EIOC 3RZOL 4AYBP 1IW7D 2V3BB 3S2HL 3S17L 3H9CA 4AI2A 1QQTA 1PFYA 2ERJA 4U671 4AR6A 3MPSA 3GTML 3I4ML 1VZHA 4AHWA 3NFPI 2QL0A 4E6YA 3KYYA 2XJPA 3IU3I 4AI3A 4Y52L 2AYJA 5GAHc 5EINC 2O5JD 1LKMA 4LHLA 2A68D 4C3IL 1OWCA 4C3HL 1C09A 1R0HA 2E2HL 4C2M1 1P7PA 5C44L 4POGA 3PL5A 1NNQA 2ZIXA 1QYBA 3PO3L 3ZG6A 3K7AL 2PMZP 5M5YL 4RXNA 1S30A 2V0FA 2C6AA 4A3DL 2MS3A 1Z92B 1LKOA 2NVQL 5GADc 2DSXA 3HOWL 2RDVA 2NVTL 4ME3A 2HVYC 4BBRL 4AR3A 4A3LL 5H1Sc 4GS7D 4G6BA 2NYDA 1R0GA 3HKZP 2M4VA 3GTLL 1BQ8A 2KN9A 2VUML 5GAGc 1LKPA 5C3EL 1VZIA 3GTOL 3LWQB 2ERSA 5AI3A 3GTJL 2XJVA 3JR7A 4BY1L 3KYWA 3GTGL 3WWLA 1R0IA 2BE5D 3RYGA 3H3VM 4ZN3B 2L0ZA 2A6HD 7RXNA 4A3KL 1JYBA 3H0GL 5DM61 3RZ6A 3PIP1 2Y0SP 1NXGA 4QIWP 1I50L 5FLML 3HJYB 3VPBE 1IRNA 1VCXA 2A69D 1YUZA 2WAQP 2JA6L 2JI1A 5M5WL 2C6BA 4AR4A 3S1NL 2APOB 1S24A 2KKDA 4JAFA 2B5ID 2R7ZL 5MFPA 1DVBA 3QVDA 1WJVA 3MQKB 4BBSL 1RB9A 2XJSA 2Z3RB 5AI2A 2H12A 3PWFA 5FJ8L 4JAGA 2JA5L 1PZXA 2CKCA 4X6AL 1YV1A 2VL6A 4A3BL 2YU9L 3KYUA 1I6HL 1Y1VL 2PVXA 2R93L 1WCML 1YUXA 1E8JA 3I4NL 5C4JL 1DX8A 2XJRA 1I3QL 3K35A 2GMGA 2V0EA 3RZDL 2EY4E 2XJUA 4TVMA 4JADA 1S2ZA 3PKJA 3WWNB 3A44A 2J9UB 4XXBB 2JI3A 3J7Z1 3B0AB 3S16L 1YK4A 2RFKB 1ODHA 4AHXA 3FDJA 3PZAA 2JA8L 3KYXA 2CR8A 4POFA 5K2ME 4A3ML 1SFOL 3LWPB 2Z3QB 3M4OL 2LCQA 2PSMC 1B71A 3HOUL 1YK5A 3LWVB 5MLC3 1IU5A 3PIO1 3B08B 3H99A 4V196 1R0JA
chains in the Genus database with same CATH topology
5MFZA 1FHMA 2O5JD 5MFPA 1DVBA 1LKMA 2XJTA 6RXNA 2HR5A 2JI2A 2M6OA 4LHLA 3QVDA 1SMUA 2A68D 1BQ9A 1WJVA 1T9PA 8RXNA 1NXEA 1OWCA 1C09A 1R0HA 1B2JA 4POGA 1QCVA 1NNQA 5RXNA 2ZIXA 1B13A 3KYVA 1RB9A 2XJSA 1QYBA 2Z3RB 2PYAA 5AI2A 3PKIA 3ZG6A 5MGNA 5IY0A 4RXNA 2H12A 1S30A 2V0FA 1RYQA 3PWFA 3SS2A 4UY81 2C6AA 4JAGA 2MS3A 2PPTA 1Z92B 1R0FA 3J7Y1 1H7VA 5JVG1 2CKCA 1LKOA 1ZRPA 5GADc 2DSXA 4YWMA 1YV1A 2VL6A 1SMMA 3LPEB 2RDVA 1RWDA 4ME3A 3KYUA 4WFN1 4AHZA 1RDGA 2PVEA 1FHHA 2PVXA 4AR3A 4B8CD 5H1Sc 4GS7D 4G6BA 1CADA 1YUXA 1E8JA 2NYDA 1IROA 4LHNA 1SMWA 4TPUA 1R0GA 3MSUA 1RDVA 2M4VA 1DX8A 4ZN1B 2M4YA 2XJRA 2XJQA 2M6PA 5GAEc 1BQ8A 1BRFA 2KN9A 2CKAA 3K35A 1LKPA 2GMGA 2V0EA 4AI0A 4AR5A 5GAGc 5AN9H 1RYTA 3P8BA 1VZIA 3QQCE 2XJUA 1T9QA 2ERSA 4TVMA 5AI3A 4JADA 1S2ZA 3PKJA 1LTLA 2XJVA 3WWNB 3A44A 5DM71 4JAEA 2J9UB 4XXBB 1OWBA 3KYWA 2JI3A 3J7Z1 3WWLA 1R0IA 2BE5D 5EIOC 3RYGA 4ZN3B 3B0AB 2L0ZA 5MF6A 1YK4A 4YWLA 1BE7A 1IW7D 1ODHA 1CAAA 2A6HD 2V3BB 1BFYA 2A6ED 7RXNA 4AHXA 1JYBA 3PZAA 5DM61 3KYXA 4AI1A 3RZ6A 2CR8A 3PIP1 4POFA 5K2ME 1NXGA 1T9OA 1B2OA 4AI2A 4U671 2ERJA 1IRNA 1VCXA 2A69D 2Z3QB 3VPBE 3MPSA 4AR6A 3LNLA 1YUZA 2JI1A 2LCQA 2PSMC 1B71A 1VZHA 2K2DA 3NFPI 4AHWA 1YK5A 2QL0A 3P2AA 5MLC3 4E6YA 1IU5A 2C6BA 4K9FA 4AHYA 4AR4A 5JVH1 3KYYA 4XGHA 1IU6A 2XJPA 3B08B 1S24A 3IU3I 4AI3A 3PIO1 2KKDA 2AYJA 1VZGA 4JAFA 5GAHc 2B5ID 5EINC 1R0JA 3RZTA 4V196
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FHM A;  1DVB A;  1LKM A;  6RXN A;  2HR5 A;  3QVD A;  1SMU A;  1BQ9 A;  1T9P A;  8RXN A;  1C09 A;  1R0H A;  1B2J A;  4POG A;  1QCV A;  1NNQ A;  5RXN A;  1B13 A;  3KYV A;  1RB9 A;  1QYB A;  2PYA A;  5AI2 A;  5IY0 A;  4RXN A;  3PWF A;  1S30 A;  3SS2 A;  2MS3 A;  1R0F A;  1H7V A;  1LKO A;  1ZRP A;  2DSX A;  4YWM A;  1YV1 A;  2VL6 A;  1SMM A;  2RDV A;  1RWD A;  4ME3 A;  3KYU A;  1RDG A;  2PVE A;  1FHH A;  2PVX A;  4AR3 A;  1CAD A;  1YUX A;  1E8J A;  1IRO A;  4TPU A;  1SMW A;  1R0G A;  1RDV A;  1DX8 A;  2M4Y A;  1BQ8 A;  1BRF A;  2KN9 A;  1LKP A;  2GMG A;  4AR5 A;  1RYT A;  1T9Q A;  5AI3 A;  1S2Z A;  1LTL A;  3A44 A;  3KYW A;  1R0I A;  3RYG A;  1YK4 A;  4YWL A;  1BE7 A;  1BFY A;  1CAA A;  2V3B B;  7RXN A;  1JYB A;  3PZA A;  3KYX A;  3RZ6 A;  4POF A;  1T9O A;  1B2O A;  1IRN A;  1VCX A;  4AR6 A;  3MPS A;  1YUZ A;  2LCQ A;  1B71 A;  2K2D A;  1YK5 A;  2QL0 A;  1IU5 A;  4K9F A;  4AR4 A;  3KYY A;  1IU6 A;  1S24 A;  2KKD A;  3RZT A;  1R0J A; 
#chains in the Genus database with same CATH topology
 2XJT A;  2JI2 A;  4A3J L;  1SMU A;  1R9T L;  8RXN A;  1QCV A;  1PFU A;  1B13 A;  3GTQ L;  3S1Q L;  3PO2 L;  1TWG L;  2PYA A;  3LWO B;  3FKI L;  1K83 L;  2PPT A;  3J7Y 1;  1ZRP A;  4A3E L;  3HJW B;  3LPE B;  1F4L A;  3M3Y L;  1RWD A;  4WFN 1;  4AHZ A;  5IYB L;  4B8C D;  1IRO A;  4TPU A;  1SMW A;  4ZN1 B;  2M4Y A;  2XJQ A;  2M6P A;  1BRF A;  4BY7 L;  5AN9 H;  4AR5 A;  2E2J L;  3HOY L;  1OWB A;  2AQC A;  5MF6 A;  4YWL A;  3H9B A;  5M3F L;  5C4X L;  1BE7 A;  1BFY A;  1CAA A;  2A6E D;  4AI1 A;  5IP9 L;  1TWH L;  1T9O A;  1B2O A;  3GTK L;  3LNL A;  5IP7 L;  4A3C L;  2K2D A;  3P2A A;  4K9F A;  4AHY A;  5JVH 1;  4XGH A;  1IU6 A;  2WB1 P;  1VZG A;  3RZT A;  5MFZ A;  1FHM A;  4A3G L;  1TWC L;  6RXN A;  2HR5 A;  2M6O A;  3GTP L;  1BQ9 A;  1T9P A;  1NXE A;  3S2D L;  1B2J A;  2NVX L;  1Y1W L;  5RXN A;  3KYV A;  2AUS B;  2JA7 L;  3HOV L;  3PKI A;  3LWR B;  1PFW A;  5MGN A;  5IY0 A;  1RYQ A;  1TWA L;  3SS2 A;  4UY8 1;  3HOZ L;  2E2I L;  5IYD L;  1R0F A;  4A3I L;  1H7V A;  5JVG 1;  4C3J L;  4YWM A;  3S15 L;  5M3M L;  2R92 L;  3HOX L;  1SMM A;  1PFV A;  4BXX L;  3S1R L;  1RDG A;  2PVE A;  4A3F L;  1FHH A;  3S1M L;  1CAD A;  3CQZ L;  5IYC L;  4LHN A;  3MSU A;  1RDV A;  5GAE c;  2NVY L;  2CKA A;  2B63 L;  4AI0 A;  1RYT A;  3P8B A;  1TWF L;  3QQC E;  5M5X L;  1T9Q A;  3H97 A;  3S14 L;  1LTL A;  5DM7 1;  3HAX C;  4A93 L;  4JAE A;  4Y7N L;  5EIO C;  3RZO L;  4AYB P;  1IW7 D;  2V3B B;  3S2H L;  3S17 L;  3H9C A;  4AI2 A;  1QQT A;  1PFY A;  2ERJ A;  4U67 1;  4AR6 A;  3MPS A;  3GTM L;  3I4M L;  1VZH A;  4AHW A;  3NFP I;  2QL0 A;  4E6Y A;  3KYY A;  2XJP A;  3IU3 I;  4AI3 A;  4Y52 L;  2AYJ A;  5GAH c;  5EIN C;  2O5J D;  1LKM A;  4LHL A;  2A68 D;  4C3I L;  1OWC A;  4C3H L;  1C09 A;  1R0H A;  2E2H L;  4C2M 1;  1P7P A;  5C44 L;  4POG A;  3PL5 A;  1NNQ A;  2ZIX A;  1QYB A;  3PO3 L;  3ZG6 A;  3K7A L;  2PMZ P;  5M5Y L;  4RXN A;  1S30 A;  2V0F A;  2C6A A;  4A3D L;  2MS3 A;  1Z92 B;  1LKO A;  2NVQ L;  5GAD c;  2DSX A;  3HOW L;  2RDV A;  2NVT L;  4ME3 A;  2HVY C;  4BBR L;  4AR3 A;  4A3L L;  5H1S c;  4GS7 D;  4G6B A;  2NYD A;  1R0G A;  3HKZ P;  2M4V A;  3GTL L;  1BQ8 A;  2KN9 A;  2VUM L;  5GAG c;  1LKP A;  5C3E L;  1VZI A;  3GTO L;  3LWQ B;  2ERS A;  5AI3 A;  3GTJ L;  2XJV A;  3JR7 A;  4BY1 L;  3KYW A;  3GTG L;  3WWL A;  1R0I A;  2BE5 D;  3RYG A;  3H3V M;  4ZN3 B;  2L0Z A;  2A6H D;  7RXN A;  4A3K L;  1JYB A;  3H0G L;  5DM6 1;  3RZ6 A;  3PIP 1;  2Y0S P;  1NXG A;  4QIW P;  1I50 L;  5FLM L;  3HJY B;  3VPB E;  1IRN A;  1VCX A;  2A69 D;  1YUZ A;  2WAQ P;  2JA6 L;  2JI1 A;  5M5W L;  2C6B A;  4AR4 A;  3S1N L;  2APO B;  1S24 A;  2KKD A;  4JAF A;  2B5I D;  2R7Z L;  5MFP A;  1DVB A;  3QVD A;  1WJV A;  3MQK B;  4BBS L;  1RB9 A;  2XJS A;  2Z3R B;  5AI2 A;  2H12 A;  3PWF A;  5FJ8 L;  4JAG A;  2JA5 L;  1PZX A;  2CKC A;  4X6A L;  1YV1 A;  2VL6 A;  4A3B L;  2YU9 L;  3KYU A;  1I6H L;  1Y1V L;  2PVX A;  2R93 L;  1WCM L;  1YUX A;  1E8J A;  3I4N L;  5C4J L;  1DX8 A;  2XJR A;  1I3Q L;  3K35 A;  2GMG A;  2V0E A;  3RZD L;  2EY4 E;  2XJU A;  4TVM A;  4JAD A;  1S2Z A;  3PKJ A;  3WWN B;  3A44 A;  2J9U B;  4XXB B;  2JI3 A;  3J7Z 1;  3B0A B;  3S16 L;  1YK4 A;  2RFK B;  1ODH A;  4AHX A;  3FDJ A;  3PZA A;  2JA8 L;  3KYX A;  2CR8 A;  4POF A;  5K2M E;  4A3M L;  1SFO L;  3LWP B;  2Z3Q B;  3M4O L;  2LCQ A;  2PSM C;  1B71 A;  3HOU L;  1YK5 A;  3LWV B;  5MLC 3;  1IU5 A;  3PIO 1;  3B08 B;  3H99 A;  4V19 6;  1R0J A; 
#chains in the Genus database with same CATH homology
 5MFZ A;  1FHM A;  2O5J D;  5MFP A;  1DVB A;  1LKM A;  2XJT A;  6RXN A;  2HR5 A;  2JI2 A;  2M6O A;  4LHL A;  3QVD A;  1SMU A;  2A68 D;  1BQ9 A;  1WJV A;  1T9P A;  8RXN A;  1NXE A;  1OWC A;  1C09 A;  1R0H A;  1B2J A;  4POG A;  1QCV A;  1NNQ A;  5RXN A;  2ZIX A;  1B13 A;  3KYV A;  1RB9 A;  2XJS A;  1QYB A;  2Z3R B;  2PYA A;  5AI2 A;  3PKI A;  3ZG6 A;  5MGN A;  5IY0 A;  4RXN A;  2H12 A;  1S30 A;  2V0F A;  1RYQ A;  3PWF A;  3SS2 A;  4UY8 1;  2C6A A;  4JAG A;  2MS3 A;  2PPT A;  1Z92 B;  1R0F A;  3J7Y 1;  1H7V A;  5JVG 1;  2CKC A;  1LKO A;  1ZRP A;  5GAD c;  2DSX A;  4YWM A;  1YV1 A;  2VL6 A;  1SMM A;  3LPE B;  2RDV A;  1RWD A;  4ME3 A;  3KYU A;  4WFN 1;  4AHZ A;  1RDG A;  2PVE A;  1FHH A;  2PVX A;  4AR3 A;  4B8C D;  5H1S c;  4GS7 D;  4G6B A;  1CAD A;  1YUX A;  1E8J A;  2NYD A;  1IRO A;  4LHN A;  1SMW A;  4TPU A;  1R0G A;  3MSU A;  1RDV A;  2M4V A;  1DX8 A;  4ZN1 B;  2M4Y A;  2XJR A;  2XJQ A;  2M6P A;  5GAE c;  1BQ8 A;  1BRF A;  2KN9 A;  2CKA A;  3K35 A;  1LKP A;  2GMG A;  2V0E A;  4AI0 A;  4AR5 A;  5GAG c;  5AN9 H;  1RYT A;  3P8B A;  1VZI A;  3QQC E;  2XJU A;  1T9Q A;  2ERS A;  4TVM A;  5AI3 A;  4JAD A;  1S2Z A;  3PKJ A;  1LTL A;  2XJV A;  3WWN B;  3A44 A;  5DM7 1;  4JAE A;  2J9U B;  4XXB B;  1OWB A;  3KYW A;  2JI3 A;  3J7Z 1;  3WWL A;  1R0I A;  2BE5 D;  5EIO C;  3RYG A;  4ZN3 B;  3B0A B;  2L0Z A;  5MF6 A;  1YK4 A;  4YWL A;  1BE7 A;  1IW7 D;  1ODH A;  1CAA A;  2A6H D;  2V3B B;  1BFY A;  2A6E D;  7RXN A;  4AHX A;  1JYB A;  3PZA A;  5DM6 1;  3KYX A;  4AI1 A;  3RZ6 A;  2CR8 A;  3PIP 1;  4POF A;  5K2M E;  1NXG A;  1T9O A;  1B2O A;  4AI2 A;  4U67 1;  2ERJ A;  1IRN A;  1VCX A;  2A69 D;  2Z3Q B;  3VPB E;  3MPS A;  4AR6 A;  3LNL A;  1YUZ A;  2JI1 A;  2LCQ A;  2PSM C;  1B71 A;  1VZH A;  2K2D A;  3NFP I;  4AHW A;  1YK5 A;  2QL0 A;  3P2A A;  5MLC 3;  4E6Y A;  1IU5 A;  2C6B A;  4K9F A;  4AHY A;  4AR4 A;  5JVH 1;  3KYY A;  4XGH A;  1IU6 A;  2XJP A;  3B08 B;  1S24 A;  3IU3 I;  4AI3 A;  3PIO 1;  2KKD A;  2AYJ A;  1VZG A;  4JAF A;  5GAH c;  2B5I D;  5EIN C;  1R0J A;  3RZT A;  4V19 6; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...