2XJRA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and man5(d2-d3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
257
structure length
257
Chain Sequence
LVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjrA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjrA01
4AHZA 4AI0A 4GQ7A 5A3MA 5A3LA 4AFCA 4COVA 4A3XA 4COUA 4CP2A 2XJPA 4AFBA 2XJQA 2XJUA 2XJRA 4COZA 4AI1A 4CP0A 4LHKA 2XJSA 4AHWA 4AI2A 4AHYA 2XJVA 4AFAA 4ASLA 4CP1A 4D3WA 4AHXA 4COYA 4LHNA 2XJTA 4AI3A 4LHLA 4COWA 4AF9A
chains in the Genus database with same CATH superfamily
5ANNA 1HRV3 1JU4A 2A3WA 3J9SA 1B2OA 1YI9A 2XL9A 3H50A 2JA7L 3EHKA 4NPRA 1GQGA 4ZZ5A 1HN0A 1H9WA 1OFSA 1RVF1 2EIGA 3AKPA 4OUMA 4UFMA 4XTPA 5FZIA 4AR3A 3UJQA 3WP6A 2NMNA 2ORXA 1E8JA 5FPXA 3O1SA 4C3JL 1H6YA 1Q56A 2PHTA 1PX4A 3M8LA 2R7ZL 1PO22 3A4UA 1LHVA 2QQVA 3DV8A 1UIKA 5SV5A 5T5PA 1BK0A 1DU3D 4GMP1 1BKZA 3LWRB 4A42A 3I3QA 4CRQA 5A6XA 1NX9A 1R9TL 2GSYA 2Z2SB 3CJXA 1DVBA 3ILFA 4R9BA 3KVBA 4HT1T 1RUC2 2WAOA 4D7TA 1CAUA 2PMZP 4NOTA 3U07A 3H0GL 5C9AC 1RDGA 5FZBA 1S0BA 4YM1A 3TN91 4DFSA 4E4SA 4JGZC 5IFPA 2FZ2A 4H14A 4BK4A 1WGPA 1C8M2 1A78A 1VBD3 4IE4A 1BQPA 5JPMB 3O1UA 5I0UA 5JZGC 3M4OL 3MI8A 4KQ7A 3PU8A 2NVTL 2OPKA 1HRI1 5BNNA 4RS5C 2Y6JA 4Q1RA 4HFSA 4C3HL 3I2JA 3RRDA 1IKPA 3HIFA 4AXOA 4AYBP 2L9LA 1W0OA 2WYSA 3IIAA 2OQ7A 3HEIA 4FPKA 3E5UA 3PUQA 4URAA 4XF9A 4AEDB 2WBKA 4GA9A 3GTLL 1W9TA 5FZOB 1W6QA 4BDVB 1W3XA 3HD8B 5CFDA 2YBSA 4FOWA 1CAVB 3ZG6A 3ACHA 2R49A 4GQ7A 2V0FA 2CYFA 2ZX3A 4KWLA 5LATA 2VG9A 5AC93 1FOD1 3BODA 3WNMA 5C6CA 5KHGA 3K77A 3RYPA 1YQ8A 1R1A1 3FJSA 5CG8A 4LORA 1VZIA 1XNCA 3WT3A 3EJKA 1Q8PA 2ZJCA 2OX0A 3KCCA 1DYKA 5C4JL 4A4AA 1JZ7A 2XKOA 4JKKA 3LE0A 1SLIA 5EIYB 5IYBL 1BBT1 2B5ID 3QBQA 4AVBA 1MQTC 2YG0A 4M4RA 2ZGOA 2VU9A 4DY3A 1ODMA 5KR7A 1W6MB 3O0XA 3PJYA 1RMU2 1XE0A 5M3FL 3A21A 3BVCA 2RJ2A 4P02B 4ZN1B 4N43C 4WM8C 2PLV1 2Z5WA 4XHBA 1RUI3 2RDSA 2ZAHA 4KU7A 4YVWC 5F2WA 3Q8BA 5IVYA 2V3BB 3HJRA 5JIAA 5MGNA 3WG4A 4Q0UA 1K3IA 4CVUA 3LGRA 4FVVA 2PMWB 4GZ9A 4IESA 1Z7S3 4CU9A 5IVBA 4CP2A 1QNWA 2RM21 2F4PA 3T09A 2WT2A 4PBPA 3H7YA 2VJXA 4S2DA 3PUIA 4IE0A 5I0RA 5IVFA 4NIHA 3CKHA 4JGYC 3RZGA 4K8FA 4AK3A 4XJUA 3VBFB 3WY6A 1ASJ2 4CXYA 5EIOC 4N7IA 3NAPC 4CDUB 5JCTA 1NCQB 1AJKA 3C3VA 2OA2A 3TNPB 2A69D 1ENSA 1OLRA 4BQWA 2P3KA 2E7AA 1S24A 3PO3L 1YFXA 2VQAA 1GZCA 2CGOA 2RS11 3DKWA 3GZAA 4P5YA 4YRDA 4AOCA 3MGUA 1V9U2 2EIEA 4MGQA 2I2SA 5JOXA 1O3SA 5IFTA 3MLKA 4A3LL 1DGWX 4PCRA 2B45X 3LEMA 1RHI2 5A1AA 5LBFA 2BFUS 2J7MA 5CB7A 3UGFA 3ZDSA 1GQHA 1ST8A 2PSMC 1PO23 2IXLA 1W99A 4IEQA 2B46X 3M3CA 5KXCA 3J7Z1 4K1YA 4K9SA 2VO5A 1POQA 4MYEA 2CU5A 2VVFA 3V0BB 3N7JA 3OSDA 4YVSA 3BI3A 2AH2A 4TLGA 4M0HA 1T9QA 1S2BA 2JE9A 1ZA7A 1N3QA 4XUNA 4KBZA 2QE3A 4V1PA 3I59B 4OQ8A 3WWNB 4X6AL 1TMF2 3AB0A 3PUSA 3WDXA 5A3PA 3AYCA 2P17A 2JENA 2Q8CA 3NQHA 2BTVC 2OUJA 3NV1A 2QQPA 3HN3A 5F5QA 4D6SA 4KH9A 1IS3A 2R92L 4HK8A 1V6JA 2GP5A 3GJBA 4INDA 4J1XA 4LLOA 2YYOA 1YC61 2XLFA 2X5IB 3CHXA 3HQUA 2HWB1 1GNHA 3POWA 3H3LA 4X6RB 1U5ZA 5FMDA 4LOTA 4ZY9A 1IRNA 2ARXA 4ASMB 5JOYA 4Y5Z0 5KWRA 2VUCA 1RUNA 4OCTA 4D94A 5KXEA 3QD6A 1RXGA 5M5YL 4Y20B 3WCRA 3LPGA 3MF6A 3ZKYA 1YFUA 2XUMA 1S30A 2DU1A 1ALYA 4XUOA 1W03A 3NNFA 2ZHMA 3VKMA 4NROA 1LOFC 1ULGA 4AGRA 1W05A 1XQNA 1UZYA 1SPPA 2KR2A 3WNLA 2WQ4A 4R9CA 3HN1A 3MIGA 1TME1 4SLIA 4A3GL 4QDRA 4F83A 1IROA 1CAWA 1J83A 3ZIXA 4JC1A 5CFCA 1HB2A 1W6PB 2WSVA 3K4DA 3GDBA 4MVTA 3BU7A 4XMAA 3O1MA 1BZWA 3ZFEA 3ROUA 1TWFL 2A70A 3BIWE 3HAGA 3WX5A 4C0HA 2C6AA 1NKGA 3Q8FA 2FBEA 3GTQL 1Y9GA 2XG3A 3J8F1 1FMD1 3ZFFC 4Q8KA 1D4M1 1H2NA 3IWZA 1ENXA 5CG9A 5FOBB 5KHJA 1JS9A 1RMU3 4NJ4A 1DLLA 5F7UA 3NMBA 3T2QA 3AZZA 2AZ5A 1PGSA 4IGQA 2WWUA 2VZPA 2J1UA 1R0GA 2V5YA 2GU9A 4BY1L 2WLPA 1NXEA 1G9FA 5FXVA 1JODA 5DMYA 4GH4B 2C0ZA 1I50L 3TRSB 5JSRA 2I74A 5FJKA 5IP9L 1OUSA 2ATFA 3H1WA 3WF4A 5KHIA 3VD3A 3RFRA 3GTGL 5EJZB 3MIDA 3VD7A 4COVA 3M3YL 1LKOA 2RS32 3V56A 3AKQA 3GHMA 2XBO1 5SV8A 2B39A 4M3CA 5L7OC 2P1BA 2K46A 2UWAA 5C5TA 1YQCA 2G4IA 4WFN1 2K2SA 2ZZJA 4A7KA 4BQ3A 1FT9A 2XLAA 3AMQA 1AL22 3BTYA 3B08B 1VIWB 3FDJA 1BVP1 2VNRA 3AP7A 4LUKA 4RA0A 4C90A 2P3YA 4HK9A 3JBG1 1VBC1 1HQLA 4IEUA 1GP5A 4ATFA 2UURA 4GD4A 5IW0A 1AR62 3H9CA 2DCZA 2W68A 3OPWA 5AVPA 3PKIA 3WNKA 5D21A 4Y5TA 5IY0A 5AFBA 1MS3A 1SCSA 3AZWA 5CU1A 4CU8A 4IV3C 4A3FL 4A3JL 5FZDA 5C71A 1HX6A 5F3EA 2MHFA 3MW2A 1PNGA 1WLWA 3OY8A 4FQ4A 1R083 4E8DA 2Q8DA 1F4AA 3GBGA 3U37A 3WG3A 2LM3A 4Q4Y2 1TMF3 1W8TA 3ATGA 4YW6A 5AI3A 1HIXA 1YFWA 1Y3TA 2RS51 2DV9A 3KQ4B 2EAKA 3C7EA 2CAUA 2P34A 1OH4A 4A3DL 1RUF2 3P3NA 2ZGSA 3I8TA 4LBQD 3H99A 1H6XA 1NT0A 1UXZA 1U5YA 4CDWC 2LROA 1VB2A 4PLMA 2VOVA 4A7YA 3DPRC 1PMJX 4MGIE 2R93L 4QT6A 5DZFA 4XXPA 5H9QA 2DCJA 3AYEA 4WM7C 3JD71 5EV7A 4QU2A 2K0GA 2NYYA 2B8MA 4KG8A 2YDEA 4Q4X2 4AR4A 4PHZA 1FXZA 4Q4V2 3ZPYA 3L2HA 5A1FA 1IQAA 2VM9A 2XJVA 1PK6A 3WQ0A 3PZAA 1DYOA 3RZKA 3HNYM 2VNOA 1ZRPA 1OVPA 1QJX1 4OI1A 2ILMA 4Y33A 4AQ6A 2W0XA 3U14A 1LJ7A 4RL7A 3I3EA 1AYN1 2RMU1 4QWNA 3POSA 3ZM8A 1JU3A 4B7EA 1ND3B 3IB3A 5ABJB 1K12A 1TVGA 5LASA 4BXSV 4JKLA 1UMZA 4ITCA 2Y64A 1NCRB 3BALA 2WZPP 4EV0A 3UKTA 1HB1A 1OA4A 1ZREA 2FDIA 1V00A 2Z69A 4OHZA 2ZX4A 4LKFA 4AQSA 1MEC3 3USUB 3UT0A 4XCBA 1UPIA 3FLRA 4MGZE 3KVAA 3SHRA 3FBYA 5IK5A 4OMDA 2FCUA 3JUUA 2RVAA 3OEBA 3RG0A 2VOKA 5J09A 1IHMA 2XVLA 2WKKA 2DSXA 1PO11 5D8AC 1W9YA 5T5LA 3MBWA 1VBE3 5DG1A 3SLIA 5ACA2 4Z2WA 3THPA 2WAQP 5JIUA 1AR82 4UXAA 4A2UA 1EPZA 3CF6E 2YGLA 4Q1PA 3CJIC 2AYJA 4JRAA 5J98B 3KF3A 3M4FA 3A0NA 2VBPA 4MGYE 3WDYA 2HWC1 2E6VA 2IXHA 3LOIA 5A3LA 3RPQA 2D6PA 3PIGA 3NNGA 3O12A 4L92A 1QJU2 2WNUA 4FOYA 3ACFA 4JX0A 5B4XA 1W6NA 3HKZP 1AL23 1O91A 1QJY1 2F4LA 1SBFA 2D43A 1OWCA 2JICA 4QPIC 3H9BA 4CDQB 5KXBA 1DGLA 5G05L 4DS0A 1BVVA 1C28A 1HKDA 5C8CC 1DGRA 1UQXA 3WINE 3MV01 2GC2A 3E1F1 1R0HA 5F32A 1RYTA 5RXNA 1SLBA 2IZWA 1WWYA 2DVAA 4XJ9A 2VY0A 5CIRA 3GHNA 2NVQL 1F5JA 1JI6A 4TYSA 3W59A 2QL0A 5L9BA 1OOPA 2W1QA 2WWSA 3OG2A 5LK7B 2C4XA 3BTAA 3WP4A 2OZ6A 2EY4E 4AR5A 4CEWA 4JQRA 4MHUA 5EWSA 1OLQA 3V0AA 4AGGA 1J59A 4A3ML 1WMFA 5FMOL 1I3QL 1PFVA 1DGRN 1W9WA 2RDRA 3P1IA 1UU5A 4YGDA 5A7PA 4CP0A 5DUWA 2VTXJ 4CYDA 1REEA 3NFPI 2WYFA 4PF5A 3POGA 4XFAA 5F2SA 4BHPA 3AZXA 1ZM1A 3KYYA 4XEZA 4LIUA 1ZNPA 4ASLA 5EHDA 1IS4A 4A3IL 1GNYA 2BDRA 4IV1B 4DUXA 1RITA 3VHNA 1CJDA 4A3CL 2DVBA 2O1QA 4IW3A 5A70A 2FDFA 4O9GA 5F3IA 1R091 2HWF1 2XH6A 1WA6X 1VRBA 4COWA 1W2TA 1GWLA 2BGOA 2BNNA 2V4VA 3AL5A 3K48A 5GZCA 1H8TB 3ZN4A 4IERA 1VMFA 4LBNA 2VR4A 1JYXA 1OD3A 1QY4A 4C3IL 3K4ZA 2A73B 4LK6A 3MW3A 4XZPA 4Q4X3 1Z92B 1C4RA 4AFBA 1WCQA 2ZBJA 3AC0A 4K8RB 2PVXA 4L2NA 4MADA 2GMGA 1B35C 2WNOA 1FATA 4LE4A 4LT5A 2AEZA 2D5HA 4WBBA 3B7MA 2A6VA 2VGDA 1HJGA 5JVG1 3T30A 4C1WA 3BN6A 4DRVA 4DY5A 2WJSA 4LBQB 1GNZA 1RUE2 1SEFA 1S1AA 4UWDA 1LCLA 1V6LA 4CCOA 5LA9A 2R30A 3KYVA 4N53C 3QQCE 2Y6FA 4RHV2 4M3CF 4BY7L 2HWE1 1M4WA 1OFNA 5E6HA 1DLCA 4IQPA 1UOBA 2WWJA 3OGRA 4NPLA 5BNOC 4RS5A 4BH9A 2E26A 3MICA 4XDQA 1YK5A 2W91A 3FFQA 3FN9A 3OCPA 1BQ8A 4LTAA 2XJPA 1H4GA 4YW4A 2E2HL 3JCIA 5BNPA 3CDZB 5LRSA 5JWPA 4EE2A 3K75B 3WW4A 3HWJA 2B63L 2FZ1A 4Y1UA 5A3OA 2VL6A 1JHNA 3POFA 1QU0A 4W6YA 1W6OB 4R52A 2WFF3 2WA3A 1ZBA2 3GYDA 2WT1A 5HCHA 5ACA3 2RR13 2DDUA 1Z78A 2WLQA 5FY4A 1APNA 5FY5A 1DGWA 3MLLA 2OYZA 3WNPA 5CFCB 5FZCA 1O3TA 5A32A 3H8OA 2D3SA 2JDUA 3E6DA 2OT7A 1UYPA 5C8WA 1AR92 3R4UA 4K9FA 4TVMA 1AUYA 3WNNA 3VD9A 4DZGA 4A3KL 1J58A 2KN9A 1HW5A 3IDAA 1NLSA 1GU3A 4CUAA 2QCSB 5FYHA 5HCAA 3VGIA 1MQTA 1CZSA 3O1VA 5FJHA 2ERSA 3IAPA 1AR71 2CDPA 1KS4A 3ZYHA 5CKNA 3DN7A 4PDWB 1UYXA 3LCPA 5DAWA 2BNMA 2AEYA 4JV4A 2R061 3LZZA 1S2KA 1O5UA 1G6NA 3OJBA 4FPHA 4IE7A 4M0NA 4N43A 1W39A 3GTPL 2WA4A 4YVWA 5H9SA 5LY1A 4Q5OA 5CBLA 4LQRA 3N35A 5HI0A 3ECQA 5FUNA 2FDKA 4I01A 1UU4A 2PHLA 1COV3 2XR4A 2HEYF 3KCXA 3LSDA 4K1ZA 1DZRA 1UIJA 3ASIA 5FZ8A 4NHLA 5ISLA 5FDBA 1NLQA 2YV8A 3I97A 5I8SA 5FWJA 1HXS2 3NJVA 4QQLA 2JDYA 3OBZA 3IMNA 4AEDC 1B2JA 1FPN1 4JGYA 2EF6A 2ZABA 3WG2A 4B8EA 5AVAA 3T3YA 3WD5A 4D69A 2VC9A 2VUML 3M3OA 4NN0A 5FP8A 3TOJA 3RWNA 4QKBA 5FYYA 3VBHA 1HRV1 3IDCB 4AHYA 2GP3A 2XUEA 3Q9OA 1NG0A 3JB8A 2WZEA 4XF0A 4EN8B 3D8CA 5EZWA 1KS5A 3V64A 3C8XA 5FZ0A 3ZYRA 1FNZA 1NY71 4K20A 2DUOA 5DUVA 1X9PA 4FTSA 3IM0A 4OVEA 5FZAA 4W50A 1EUUA 1S2EA 2E63A 4TLFA 4DIQA 4ZU7A 1PIV1 4E8CA 3O1TA 2X09A 5D2AA 4QX3A 1Y9QA 3VHOA 3U4XA 1O59A 2JE7A 2P4EA 3PDQA 4YG3A 4XJZA 5MFPA 2OPWA 2RDQA 1E57A 4O7XA 5BNNB 4Z82A 4XXAA 2BGCA 5FZ4A 4D6QA 1LODA 2WO2A 5LW9A 1JH5A 2VMFA 1RUE3 3SCFA 1DQ2A 3T2TA 5F37A 2Y6HA 4MLOA 5CFDB 4RHV3 4R4ZA 4ZKTB 1W04A 1VBD1 4LA2A 4KI5M 4Z1VA 1ODHA 5FQ0A 2Y26A 4JTOA 7RXNA 1UMIA 2Q0AA 3M3IA 1W90A 1OWBA 1UYYA 1CESA 2FCVA 3VBFC 1VE0A 2Y8KA 4CDUC 2AQCA 1NCQC 2Q5TA 1SZBA 2TBVA 3IPVA 2ET7A 5G04L 3AP9A 3WLUA 4COUA 3P3PA 4C0BA 4E2GA 1LGCA 1VZHA 5CKMA 1S0GA 1ONAA 2D7FA 2XHNA 4KGGA 4AR6A 4ZU5A 1ZBA3 2FDHA 1QQP3 5J96B 1LOFA 4BQ5A 2ZX1A 2VUDA 4UW6A 5FPBA 1MPXA 1UMHA 4DXSA 3D5OA 1QJZA 1PFYA 2RE9A 2ZX0A 3AFGA 3LEIA 4ARXA 4FBFA 2TUNA 1RB8G 4HL0A 4FQZA 4Q0VA 5DQ0A 1DQ1A 1F5FA 1JZ5A 1VBA3 3IDEA 2GNMA 5FYUA 3TEXA 3N7KA 3B0AB 2WZR2 4EWAA 1XYNA 3KV6A 1HDKA 1RUD3 1YXWA 4QX5A 2XVKA 2YPJA 1WCML 1BEV3 3F95A 4IGOA 2HWD2 3W5NA 2JG9C 4LO7A 4QPGA 2AC1A 2A75A 3OPZA 3ZFFA 2ZGNA 1M06G 2BERA 1AYM2 3PVOA 4OHVA 2HYXA 2JD9A 2SBAA 1JZ2A 3RI8A 2A6ED 1YO8A 1QYBA 2DUQA 4Q4W3 1KDKA 3NW4A 1NLRA 4QDQA 1PZ8A 3D0SA 2CGNA 2OVUA 3GNEA 1UOFA 5J7MA 3KT7A 4Y7NL 1X50A 5FYCA 4DQAA 2X5IC 1UOGA 2EICA 1O8PA 2MEV3 3MIBA 1VBB2 1QDOA 1N47A 3U75A 3OBTA 4LHNA 1RUJ2 1OMIA 1W2OA 4JDNA 3GGLA 1IG3A 3J7MA 1Z7S1 3PURA 4Q0SA 4IETA 4GB31 4E9KA 3KCYA 2QQKA 2HEWF 4MHRA 4Y22A 1W2UA 2VZTA 3VV1A 3ZYIB 4CCNA 2BOIA 2EXHA 2AUYA 2F17A 1SLLA 5DDJ3 2ZGKA 2ZHLA 4BOWA 3UV9A 4MXWA 4AF9A 4LKDA 4V196 4RYDA 4S2GA 3QLQA 4XJWA 4BQYA 4YVSB 4NPMA 3A44A 1QQTA 3HAXC 4NMIA 4P9XA 2BYVE 4RXNA 4BM8A 4Q26A 4GJZA 1EV12 4HVQA 3MPSA 3VPBE 3PNAA 4YW2A 2QNKA 4PBOA 3AVRA 3GALA 3PMSA 5IVEA 4LO4B 1XE8A 4YFWA 5K4LA 3LIGA 4IV3A 3OD4A 2VBDA 3I2GA 1I5PA 3T0DA 2DVGA 3HOXL 4B1LA 4DNYA 1WCDJ 1P8JA 3AYAA 3CQOA 4QPYA 5GADc 1CIYA 3C2UA 5IYCL 2G1MA 1RTVA 4XE9A 5FIXA 5GLUA 3ZXDA 1GZWA 4GH4C 1SFPA 5FMCA 1ZRRA 4LO5B 4OUEA 4NWWA 3KZ4C 4FP3A 4UBHA 4FFIA 1IU6A 1US3A 2HLEA 5FY9A 5C3QA 4GIQA 3INAA 2CY6A 4PLOA 2JB8A 1SPPB 5L19A 3G7DA 1JOBA 3GBFA 4YW7A 4KNCA 3KGZA 1UAIA 2Q1ZB 2UY8A 3A22A 4J25A 3LWCA 2QVSB 4GALA 5FYVA 3SCHA 2E32A 5HXVA 3RVHA 4ARYA 1HB3A 4BLJA 2JA8L 1CAWB 2J1AA 3B00A 1BQ9A 1O8SA 3DPRA 1PVC3 3ORJA 1DFQA 1JHJA 1YEWA 3AMNA 1C1FA 2R042 4H3WA 4RQPB 3VBUA 3VZJA 3ZYPA 5FR3A 2WUHA 3ZFEB 1TG7A 3SNMA 2C1FA 3J7LA 2E31A 3B9IA 1BXHA 2VMIA 1RUH2 1BHGA 5FZ1A 1AHSA 1LU2A 4FP2A 5KHKA 1G9CA 1UX7A 1AL0G 4N7UA 1US2A 1L7QA 4QPWA 4HLTA 2ZGQA 3E5QA 1R64A 2VZ1A 4SBVA 4XC9A 4AWDA 4NWVA 2YMZA 3PHMA 1RVF2 5GAHc 3MFCA 1Z0HA 1YNAA 2WZR3 3P5BA 1O3RA 5FREA 3I3MA 3DGTA 3LF7A 2ZS6B 4OZXA 4Y5SA 3SQOA 3UK9A 3VBRA 3NKGA 2O5JD 5A7QA 4DINB 1W06A 3S1ML 3WZ1A 2YBPA 3T2PA 3VBSA 4IDZA 5L9VA 1AYM3 3SITA 3RZLA 4QB1A 3VB9A 1TNFA 4LMFA 5CKQA 1NQDA 1GZ9A 2VH9A 3NV3A 5CNAA 3SC7X 5GZFA 4AVVA 4QMAA 2RJLA 4M3CB 3M1HA 1D2QA 3B69A 5C5UA 5F5IA 4YW1A 5K7PA 2PN5A 2ZZQA 1VBB3 4CPBA 1JBCA 2JA6L 1RUJ3 2X05A 4JQTA 1ZA4A 1W8ZA 2WO7A 3PUAA 4M01A 5FAXA 3TN92 3WVJA 3S30A 1C09A 4BXXL 3OPTA 3RS6A 1RUG3 2YBKA 4ZONA 2LW8A 4LHLA 3A7QA 3APBA 3P2AA 1CZTA 2VXRA 3LDKA 3GXUA 4NIIA 1HRI2 3LWQB 1JYCA 3HOZL 4QQOA 4UBGA 2AACA 5JAXA 4K3UA 4XUPA 2VCAA 2VULA 4N9IA 5F8PA 3OY8B 4L99A 1U12A 3ZSEA 5E16A 4XOGA 2GMPA 4QXBA 4E4ZA 5C8CA 1JZ4A 1TWHL 3SCGA 1ND3C 2BBAA 4BMBA 5ABJC 5GM0A 4A45A 1EV13 2D6NA 4GWJA 1NCRC 3MIFA 1FOD2 4RFT0 4PJYA 2XQXA 3CU7A 2ZMLA 2J22A 1R1A2 4IEWA 5GLZA 2XHKA 5LBBA 3OBAA 4NO4A 5JOZA 3AP5A 1CR7A 5DN2A 3USSA 2C6SA 1YHFA 5I0TA 4FAHA 1W9SA 2WQ8A 3WXPA 2JE8A 3WW1A 1BBT2 5CADA 1IPSA 3BGAA 1R081 3AKSA 2QDNA 4N9HA 3I4NL 2ERFA 3RGBA 2HVYC 2BOJA 1GKBA 2D97A 3HNBM 4FT8A 2ET1A 4X8PA 4HN1A 1AXKA 1KDMA 5AN9H 1L7LA 2Y34A 1WLTA 3C7HA 1PGL1 5C3SA 2PLV2 1PK6B 3HOBA 1DIWA 4OHXA 2E7TA 1UNBA 3GM8A 2WIIB 2VOTA 1DF0A 3D82A 1G9DA 4MGTA 1RUC3 1C1LA 3H0OA 4CP9B 2A6XA 1ZBE1 1PFWA 2WABA 4ONUA 1G86A 3NNLA 2RM22 2HR5A 3GZTB 4CDQC 4K7JA 3ETQA 2ZAAA 5GZDA 5LEKA 5C4WC 2KXLA 1K5MA 1O6UA 3GCXA 5FZGA 2ZHNA 1C8M3 3B01A 1MACA 3PL5A 1RUH3 1B35A 3V65A 3A23A 3JQXA 4XAAA 5FO9B 1Q8VA 4CDXC 5MF6A 5FPAA 2PAKA 1DCSA 1GOFA 4AR2A 2M4VA 1S0EA 3PIP1 3AK0A 4FXGB 1XC6A 1UXXX 2RS12 4UAPA 3JU9A 5FBJA 2WRAA 4OI4A 1RVF3 3U10A 3ZN6B 3TYJA 4CEYC 4GMP0 3LWOB 2P3JA 4HPKA 1AXZA 4LO6B 5F3CA 1VCXA 3T0AA 4XFIA 1WBFA 3RI9A 2WNVA 3KSCA 5FUIA 1PZ9A 1IG0A 4L9BA 3SMHA 2ZEWA 3LQCA 4RN5A 4AEJA 1YJKA 1W8UA 5IWFA 2VZRA 3FHAA 4KMQA 3SS2A 3S1RL 5J3UA 1C3HA 1YCIA 3KF5A 4OMCA 4CUGA 4OI0A 1NXMA 3WDWA 1LOEA 3I4ML 1JOPA 1VMHA 2XONA 4IV1C 2VNGA 1GR3A 4Y24A 2CKAA 1MEC1 3PWFA 5BXXA 5B4NA 1H30A 2TNFA 3K3NA 2GAUA 1W6NB 1AX1A 4QM9A 2UYBA 1T2XA 5A7WB 2XJQA 2F6BA 3HT1A 2G19A 4LE3A 5LA0A 2N7GA 3O1OA 1H8TC 1UZ0A 1VBE1 2H12A 1H1AA 4J1WA 1C5HA 1JN2P 3S17L 2VVDA 2DURA 3KLSA 4A6OA 2SLIA 2R071 4LO8A 3ZXEA 1ULPA 4GWMA 1G7YA 1WUVA 5JVVA 2VBBA 5K0UA 4ASKA 2AYHA 1J1LA 1X82A 3AX4A 1CD3G 1LEMA 2ZX2A 4UFKA 1HRI3 2HWB2 1PMHX 4QAWA 2WS91 5ERLA 1MS5A 3DCQA 1OOPB 2IXIA 3N9OA 4LBOA 4NRMA 3F2ZA 3RZZA 2BVVA 1WLDA 5IK7A 4CEWB 4JCKA 1LHOA 3V0AB 3ILNA 1DYPA 3B02A 2V09A 1VLNA 4L8QA 4YGEA 3N9NA 2FMYA 2WB1P 3FLTA 4EN0A 2NYDA 4CCEA 1VP6A 5LRRA 3WF2A 5JOWA 4DEQA 5A6QA 3SH5A 4EQVA 3AJZA 2D5FA 5T50A 4I30A 2O14A 1BRFA 2EXJA 1FOD3 4TXWA 3AJYA 3OB8A 5A3UA 1ASJ3 1TME2 4JAAA 2Q8EA 4BQ2A 3LPEB 3SKJE 4E2SA 5A7NA 1O4TA 4CE8A 3CMGA 4A3EL 4W4ZA 2XVGA 2YU9L 3S7EA 5GZGA 1EAH1 1V9U3 1YQ5A 4AEDA 1I6HL 1JYVA 3SH3A 4GKXA 3M3QA 3G6JB 3H9AA 3J8F2 1FMD2 2HH9A 5LK5A 1JZ6A 1D4M2 1RHI3 2BZDA 1TQ5A 2ZGRA 5IYYA 3I2OA 3FMGA 3PJQA 4EWEA 5I8YA 2ARCA 4JAFA 3BTXA 2JG8B 5FZMA 2J1VA 5GKAC 2PELA 2PLV3 1XSRA 1BMV1 3VZMA 4LR4A 2ZMNA 3N7LA 3LIHA 3ZO0B 2DTYA 4HBNA 3I54A 2GC1A 2K2DA 1F31A 1QDCA 2JI1A 2D93A 5LZ6A 1T9PA 2EAAA 2JECA 3AM2A 2OQ6A 4Z8BA 5C3PA 4PDWC 1W6MA 2BFUL 3KB5A 3W5MA 3AZVA 1OBNA 5HBAA 3TB0A 1HB4A 2XBO2 4XF3A 3GTKL 1OA2A 4MGKE 1VRH1 2W94A 1W8OA 4RR3C 4BLIA 5A6ZA 4WVVA 3VL9A 4NAOA 3WCSA 3FLPA 3KYUA 1EP0A 3VDDB 3P8BA 4MUVA 5BNPB 5HV4A 3GF6A 4R9AA 3JBG2 1GMMA 1VBC2 4HVRA 3AFKA 5FP9A 5FTTC 5F3GA 2PAMA 2YUEA 3M70A 3K51A 2D3RA 4PT6A 5GAGc 3B93A 1DDLA 4MH0E 2D98A 4BU2A 1O5LA 5FXXA 3K46A 4UW4A 1ODNA 4DEVA 1IW7D 2CR8A 1DBNA 1YQ6A 2DCTA 1OC1A 3ZFGC 3DKQA 4JTNA 1X9TA 1E5HA 2PHUA 4OZOA 4BQ1A 2FCTA 4I0WB 4WVZA 4I0AA 1EUTA 1C57A 2ZKNA 4K6BA 2E51A 1P7PA 3S7IA 2RFKB 1MQTB 2X53S 2WFF1 1UWWA 2QQOA 1S55A 5LA2A 2DTWA 1REDA 1TWCL 2RS52 2RR11 4QD2A 2DF7A 1WA4A 1J1TA 3DECA 3CZUA 5CISA 4OYUA 4AI1A 1IGOA 2OW4A 4FFGA 5HCBA 3S57A 4N43B 4Q8LA 1OI6A 3OGVA 3KV9A 1MVEA 4QB6A 2HWB3 4ZU4A 5EYYA 4YSFA 2A6ZA 3HNMA 4KWUA 5M3ML 3ZDVA 4AFAA 2QBXA 1HLCA 5BNNC 3E5XA 5GLWA 4BIOA 2WNEA 2DFCA 2JG9A 1RINA 2MNGA 2KD7A 1GWMA 1PM7A 3JD72 3K3OA 5DAXA 2VCCA 1ZYBA 3I3BA 1YJLA 1UO9A 1JW6A 3POYA 5CAZA 1G9AA 1ACCA 2VZQA 1X8EA 1FX5A 2D6KA 5CFDC 1NAEA 2RS33 1ZX5A 2EA7A 3KV5A 4HONA 4EZ4A 2HJIA 2BEOA 3O1RA 4UI9L 4BA6A 1XU2A 1QJX2 2X5IA 1PFUA 3KM5A 2QQWA 4LXLA 3VBHB 3RZMA 1GWKA 1R1ZA 2ZEZA 3CQZL 1I3HA 1SQ4A 3N9MA 4QGLA 4XUTA 2APOB 1COV1 4NHYA 3WP5A 1WBLA 1AYN2 3VBOB 4ATEA 1W2NA 2RMU2 3JR7A 2CV6A 4I3PA 1GP6A 3ZKUA 1SBEA 2Q30A 4MXVA 1FNYA 4HKOA 1OLME 3R4DB 1FI2A 3LWVB 1CX4A 1WW4A 3URFA 2PYTA 1A6CA 3J8F3 4AG4A 5C3OA 1FMD3 3ZYGA 4AQ2A 1AR63 2XJTA 1D4M3 1GV9A 4XABA 5FXWA 1R0FA 1WLCA 1ND2A 3S16L 3KWVA 4P00B 4XBNA 1NNQA 2VMHA 5JPNB 4PF1A 1HV1A 3FE5A 2P2KA 4QU1A 4JAEA 2XKPA 3ENRA 1PO12 1W6PA 3ZLIA 3ZPOA 1QIQA 2ORZA 1LECA 3LSEA 4LNVA 5IAXA 4Q4Y3 5LA1A 1AXYA 2JKXA 3WNXA 1IZ3A 4Y1YA 3WF0A 1J3QA 4B1MA 3HOVL 2HWC2 1FHMA 2CTVA 2VNVA 4QX1A 3FHQA 1QHDA 5FZ7A 1JOJA 4BYYA 2VXJA 4CUCA 5JXHA 4XJ8A 1RUF3 2VW1A 3LFMA 4C2M1 1T9OA 2Y0IA 3W20A 1KJRA 3T4VA 3TEWA 4QGMA 3D0JA 3HMYA 4OHYA 4XURA 1QJY2 2Y6KA 3FZ3A 4QXCA 3OF1A 1XYOA 3ZXFA 2NPIA 3IPVB 2JWPA 4DMIA 4ZZ8A 1NA1B 4HOOA 1XRUA 3JBG3 4LBKA 3H7JA 3U78A 5KC6A 3OUJA 1POV0 1SACA 3J26N 4Q4V3 3RZDL 2OKXA 2R32A 3T0BA 4FFFA 3HVDA 1WW5A 2NN8A 2XQRA 4P5HA 4JZRA 2G9FA 4FSJA 4AHWA 3GTJL 2ZA9A 3EYPA 4D3WA 5IK4A 2GNTA 3R05A 1UKRA 2FDJA 4CPBD 4O61A 1PHMA 1IU5A 5JUVA 1O7FA 3DXTA 2W1UA 4TSVA 1POV3 5C9AA 5A1LA 3S1QL 5JXIA 4JGZA 2Q1MA 1Q8OA 1ZZ7A 4AFDA 1ZZBA 1W8HA 1QQP1 4QPGB 4UF0B 2E7QA 5JZGA 2CWSA 1TZOA 2X29A 4OULA 2NVXL 1XNKA 4HXCA 2BUKA 1XYPA 2YC0A 2E2IL 1S4CA 3BB6A 3H1MA 1QNYA 2J1RA 2PQQA 4U671 1XNDA 4K21A 3VDCA 1PGW1 4YWMA 2V73A 1R092 2HWF2 1F35A 2O8QA 4YM3A 1A8MA 1VBA1 2VMEA 3RNSA 4CCMA 1CONA 3C7GA 3P6BA 3FL7A 3LKJA 1RUD1 1W8NA 3WQ1A 2DBIA 2QDRA 2VOWA 1BEV1 2VCBA 5FZ6A 2W52A 1AR83 2UY9A 1GOGA 2HBUA 1E5IA 2G9GA 3MFAA 4BBSL 3N36A 4Y22B 4YG6A 5FV3A 5GLTA 4CCCA 4LULA 5FY0A 4CCLA 4Q4W1 3EBRA 5FKBA 2W2IA 2VAUA 2M4YA 2C6BA 3OYWA 4URTA 2WT0A 3RZJA 4BZ4A 1QJU3 2AGSA 3OBRA 3E6CC 2MEV1 1QCVA 2WDBA 4XDOA 1OXCA 3S0MA 3S2HL 1W0PA 1W9FA 4HSLA 3UGGA 1UY2A 5CFCC 3POEA 4NE9A 3R4SA 4RQPC 5FPLA 5FO8B 1MR5A 1MS4A 4KWKA 4AVAA 1J3PA 3ZFEC 1B71A 2HWE2 4BQ4A 2MPFA 4EN7B 1X36A 1W2AX 5F6LB 5FCCA 2VTFA 1WMEA 4WM8A 1YUDA 2FDGA 1KEXA 1UZVA 1GICA 2J1SA 4IV3B 5DDJ1 1HQNA 3KHBA 2BWAA 2VVEA 1QMJA 4NIDA 1PX3A 5EYXA 4F3JA 4RGGA 4W8JA 5FZ3A 3FX3A 4XACA 3RJRA 3VKLA 1GZWB 1ND3A 1TE1B 3H3UA 4XDPA 4ZS3A 5ABJA 2UYAA 2BNOA 4YZ2A 5C70A 5D1IA 1SLCA 3AMHA 3CBNA 4YW5A 4ZN3B 3ABZA 4CTEA 4XFFA 3NAPA 3WV6A 2CSGA 2HBTA 2GZWA 4R9DA 2VD7A 2XJSA 4ZHNA 1NXD1 2EVXA 2VZOA 4PQ9A 1JMUB 1SG3A 3USUA 3WSOA 1Q3EA 3KYWA 2I07B 3AMPA 4AEKA 2QQJA 3ALQA 5IAVA 1QJY3 5DPNA 1R0JA 1UPSA 4AFMA 2ZPXA 5IVVA 2ZIXA 1CAUB 1MZ5A 1AR72 3VBUB 3LB9A 3AYDA 3NNJA 1BK1A 1G8WA 1WJVA 2AUSB 3FKIL 3WNOA 1D4VB 2LTNA 3WF1A 1QWRA 2VMCA 2C24A 2PHRA 2R062 4KWJA 1A34A 4KL1A 4MO3M 4YG0A 5IATA 1CADA 2D6LX 3CEWA 1HQWA 2VOXA 2YU1A 4AL9A 1WD3A 1GFF2 5F1RA 4UW5A 3RSJA 2XPJA 4A41A 4XILA 2VMDA 1NUKA 4CDQA 1WKYA 1J3RA 4YZ5A 2VE1A 5DZGA 1PVC1 3OOXA 5C4WA 3VBRB 5A33A 1FPN2 3ITQA 4L97A 5M5XL 3DYMA 3BIEA 1JYNA 2Q4SA 3RYGA 1W6QB 3VBSB 2BRTA 1BYHA 1UY0A 1W8WA 4FCAA 1SMUA 4A44A 3RMXA 2GMEA 4AHZA 2J1TA 3ES1A 1ULDA 2I45A 4LPLA 4PLNA 4DXTA 4NRPA 4ZXEA 4G4FA 1HRV2 1OKOA 1PZXA 4HVOA 4IUGA 5KBFA 1R093 1IOAA 4BJ0A 4CEYA 2W1WA 4O65A 3NNMA 1DQ6A 2M6OA 1LEDA 3CNAA 3N7MA 1NY72 3AXEA 2ADDA 2W47A 2QZ3A 1RXFA 2A68D 5FUPA 4N8MA 1XJAA 1LOAA 4YNIA 2C5DA 1PIV2 4CA9A 1ZZ9A 4P9YA 4DXRA 3HT2A 2RDNA 4IE5A 4H2AA 2WFPA 4IV1A 1D2SA 5AC91 5C3RA 3OGGA 1PK6C 1AR93 3IN9A 1CVNA 4FI9A 4QX2A 5HXMA 3K7AL 4BMEA 3NWKA 3KQRA 1LR5A 3TNQA 4FPJA 3ZYBA 3QOPA 1LHWA 1WZXA 5TSWA 5DG2A 4UFIA 3VL8A 3LNLA 4XTMA 3BTZA 3MIHA 4JHZA 1F15A 2B42B 1VBD2 2HWE3 5GAEc 1RUG1 3HOWL 3ZR5A 3N4MA 1U0AA 3ZOIA 3S5AA 1W3VA 5A3WA 2XGXA 1GP4A 4W65A 1LTEA 5J48A 3UL2A 1RUI1 3EMRA 1Q43A 5FZEA 3PUHA 4V2WA 3AVSA 1Q8SA 1JTZX 2A71A 2CNAA 2JDPA 3LA2A 5GZEA 1CAXA 5I0DA 5F5CA 2G9ZA 3FC0A 4EN6B 4AI0A 1HXS3 2DVDA 2ETEA 1QGLA 2JD4A 3WWLA 2WINB 1S0DA 4EWDA 3W21A 5EJ3A 5L7OA 1D7PM 3PTRB 1SDDB 5FYSA 3PO2L 1V6IA 1VR3A 5FMBA 4M00A 1UF2C 3B94A 1EY2A 3I7DA 3ZMOA 2XJRA 3I3DA 5JSPA 5JMOA 1YUZA 5FPZA 2P37A 1G9BA 3OD0A 2PFWA 4FO9A 2CL2A 2VCMA 5A80A 4AI8A 5FZFA 1X7NA 5E8AA 5I0SA 4XBQA 4DXZA 1XPWA 2JB4A 2W92A 4FOQA 2FHRA 1FV3A 2JIJA 2WO3A 1K5MB 3BOPA 2FQPA 5HCFA 2A7AA 1ULEA 4META 1PO21 4B3NA 2ENRA 5I8TA 4PI2A 1JXNA 4XETA 1IPKA 1UD1A 4YZ4A 5IHRA 2JI2A 4BB3A 3UETA 4E27A 2OZJA 4CEWC 1RUC1 2J9UB 1H0BA 3AP4A 3ZSJA 1Z7S2 4HKLA 4HPKB 5CEHA 4FPLA 3T1MA 4GB32 4YPJA 1FPN3 1XU1A 2QKDA 2RV9A 3GZUC 2WNVB 4PDWA 3ZN5A 2EALA 4QQHA 1RYQA 1C8M1 2JDZA 5EPAA 1ZRCA 3MSUA 1UZZA 5MLC3 1OH3A 1V6MA 4GWNA 5GJ6A 4RR3A 1GBGA 2JDAA 4RD7A 2PHFA 3DEMA 1UW8A 1SLTA 2Y6LA 4CDWA 3PL0A 2VZSA 4IEPA 4LBJA 4UT5A 2GC0A 1STMA 4P9LA 2W95A 2A6YA 4JRLA 1HJFA 2YXSA 5K9YA 4FTEA 4WM7A 1ZRIA 4FFHA 1UCXA 4XCAA 3UKNA 1FV2A 3ACLA 2LCQA 1OURA 2FMDA 2YPDA 4XIOA 4AQTA 1XNAA 5DAPA 1F8VA 3TBDA 3I4IA 5DUUA 3HR9A 5H9PA 1PIV3 4Q0PA 4A6SA 1OQEA 3BU0A 4LHKA 3BCWA 3FFZA 3S15L 4B4RA 5K0UB 3VD4A 4NUBA 2E33A 5FJ8L 4Y1XA 3ZFGA 2JG8C 2RG4A 5A6YA 3MIEA 2W08A 5FY1A 3EQEA 4Y26A 5LWBA 3LDRA 4TZDA 3I2HA 1CPMA 1WW6A 1V6OA 2D3PA 2HWD3 2Z42A 4IEVA 2VUAA 2IC1A 2PXJA 4JKMA 4LA3A 1LB2A 4BXFA 3CLPA 1QEXA 4LJHA 3ZIWA 4H7LA 2JKBA 2R16A 3I2IA 1DG6A 1N1SA 1RMU1 1OPMA 1KJLA 1D0HA 1YIFA 3MUY1 2ZMKA 3QCWA 5J1XA 2ZXQA 1LOCA 4YZ3A 5IVCA 4C1XA 5D8AA 1H8VA 4BPZA 4P9GA 3VDDC 3ZX7A 4FAGA 5BNPC 2Y33A 4RFRB 5FZ9A 5IUQA 3KGLA 4NRQA 2VMGA 4FPEA 2OS2A 4Y4RA 3OTFA 1RC6A 3CJIA 2P6CA 5T55A 3THDA 2JEMA 5K2ME 4YM2A 4BISA 2XL7A 4QXHA 4AZZA 1LULA 4ET7A 1W8FA 5FP4A 1ASJ1 2VW0A 3W58A 4D7SA 3FBMA 4JVAA 1RJ8A 4QPIA 3CL1A 1ULFA 1OVSA 1XSQA 1UKGA 2NM1A 5LBEA 3W9AA 1LGBA 3SKVA 3WUCA 2W9XA 4AI9A 4LUMA 1V9U1 2D44A 4YLZA 3K4AA 2ERJA 3PVNA 3U1XA 1I5ZA 3VD5A 2V4AA 5B2GB 2CWMA 4KU8A 2ZHKA 4Z2AA 1JYBA 1RHI1 1TWGL 3K35A 2E53A 3O0WA 4H55A 4IXLA 2PA7A 4NVPA 4UFJA 3D3AA 4XXBB 5FXZA 4GS7D 2CAVA 3O14A 4OFGA 5CVRA 5K8SA 3LA3A 4RGAA 2QQMA 2GMMA 3Q8EA 1T6GC 2B4KA 2DUPA 2VPVA 4NIGA 1SMMA 1OD5A 4PIXA 3TEYA 4EJRA 1CWPA 2Z3QB 3ZSLA 2ID4A 1BE7A 4WVMA 4X8NA 1L3JA 3EXUA 4E4HA 2CKCA 4FPGA 1ZZ6A 2W39A 2ES3A 2W5FA 1TMF1 2ZOEB 4GB33 4XQWA 5FP7A 1XXNA 1UY1A 2WL1A 4IEXA 1VPHA 1S0JA 1YWKA 2VZ3A 2EXIA 4PQQA 5F6KA 2ZKLA 1S0FA 3LEKA 3N9LA 5FFOC 4CCKA 2V0EA 4P14A 4UW3A 5LEJA 4CUBA 3H97A 2R6QA 2Y60A 1F4HA 4ES8A 1EPWA 3T1LA 1RJ7A 2ZEYA 4TTGA 4XZUG 5T54A 3VBHC 3UGHA 5DAQA 5CZKA 4AI3A 3LAGA 3CZJA 5FLJA 4AYUA 4R8HA 2R043 3VBOC 2BVBA 4D6RA 5DUXA 5FPVA 1DQ5A 3ETPA 1H4HA 3Q8CA 4UFLA 4TWTA 4J6GA 1L7RA 4B4QA 3ZXJA 1OA3A 4Y52L 2A6HD 1HN1A 1MS9A 4UFHA 4XHXA 4A3XA 4LLFA 3S6PA 1QKQA 2DYCA 3K2OA 3OEAA 3ON7A 1H2KA 5GLVA 5C7GA 3C7OA 3IKWA 2P6HA 2IUWA 1KD7A 1Y1WL 1QJFA 3RYRA 3UNPA 1V6NA 3N9PA 5IJRA 1N1VA 1R082 2EIBA 3ACIA 4XW3A 5ANQA 4N53A 2JG9B 4UY81 4CXWA 5APAA 4NIAA 1H2MA 1RYYA 4QDSA 1NQJA 1H9PA 1Y9MA 4HANA 3FUQA 5BNOA 3IU3I 3GJAA 4CDXB 1V70A 2R0HA 1MS0A 3O0VA 2EIDA 2H6CA 2XXZA 4GMP3 3ZVXA 1PGL2 2B9VA 3KHCA 3HBKA 3T08A 8RXNA 5FK7A 1S0IA 3M3EA 2YROA 3UYJA 2WNUB 3E6BA 3TWIA 5IYDL 1WCUA 1ZBE2 2PAEA 3LOBA 2CHHA 1SCRA 4BK5A 4QHOA 2CGPA 3NVCA 4I0BA 1PZ7A 1UN1A 3KD4A 1FHHA 1NA1C 1U5IA 3MV11 4OHWA 4MX3A 3U4SA 2R1BA 5JLVA 1YI7A 1OHFA 1HV0A 2ZGPA 1WCSA 1PVXA 1X8MA 3KT1A 3VDAA 2RS31 3RDIA 1NXGA 5AI2A 2W87A 2NP0A 5LBCA 5C44L 1ND2B 3RQ0A 3PIO1 2GDFA 4PIYA 3LWPB 1LKNA 1Q5OA 2KA3A 3OGSA 1JUIA 3HOYL 5IVJA 3NO8A 4IL7A 1AL21 1SDWA 5EXOA 4RQPA 2QQUA 4KG0A 2VQTA 1C8NA 4XYXA 5JVH1 3BPZA 4XFCA 1LHUA 4C8DA 2Y0OA 3B5LB 3H8UA 4MG2A 3NV4A 3GTML 5FO7B 4QPGC 2YZ4A 3O7OA 4LBMA 1AR61 3AZYA 1ZVFA 3QH7A 1VJ2A 1K83L 3S2DL 2QTWB 2JI3A 1R1A3 3PLQA 4XGHA 1MEC2 4D0QA 1XB9A 2ZGUA 4ISRA 4AW7A 3DXUA 4QX7A 3T2OA 3J7Y1 2X8KA 4XF1A 2PPTA 1BBT3 4IE6A 2BW8A 2O8OA 1ZRDA 5FZOA 5EQUA 1VBE2 4P9JA 3HJWB 3B3QE 5CA6A 1URXA 2VUJA 1CGPA 1CAVA 4Q4Y1 3WQ7A 2R072 3ZXAC 4BCUA 1JYWA 4OLLA 4XQDA 3ELNA 5JSOA 1OLMA 3WDUA 2YU2A 3MQKB 1IQDC 2AREA 3HPNA 5H1Sc 1QOSA 3GZEA 4PI0A 4RGKA 2WS92 1RDVA 4YYOA 4I02A 1BLZA 1OQ1A 3CO2A 1RUF1 3NJZA 3PIJA 1TEIA 4NAMA 4U36A 3VZKA 1KXGA 3PU3A 1J84A 1LGNA 1UOJA 2K9ZA 5DZEA 4E2QA 5FMOS 2VW2A 4I09A 4IEYA 5JI7A 1AJOA 3DL3A 1UYZA 1V0AA 5EJ1B 2RM23 1MS8A 5C9AB 4JGZB 5BY5A 2NMOA 1KQRA 1SHWB 2B7YA 3N3HA 3VKOA 1EYBA 2TEPA 5JZGB 4Q4X1 3KT4A 5FKCA 1JUHA 2UU8A 4Q4V1 3JQWA 4BBRL 3PVEA 4RS5B 2H0VA 2KKDA 2H0BA 3NJXA 3IZOA 4YGCA 5JMCA 5I91A 5FY7A 2RS13 2LS6A 4OI2A 5DM61 1EAH2 3ACGA 4U2AA 4COZA 1POV1 4QB2A 4QX8A 3ZYJB 1F4LA 1BCXA 1AX2A 2D40A 1QOTA 1PM4A 1R0IA 2PYAA 1OF3A 2AENA 3RZOL 4NHKA 1CZVA 4QHBA 1WMDA 4AE2A 3NKTA 4D8MA 5L36A 3DUIA 4Z07A 4OQ9A 3L9JT 3UJOA 5LY2A 3VBFA 3WDTA 4COYA 5KC5A 2WO1A 3FUOA 3R0RA 5IK8A 4CDUA 2OXBA 4PIZA 4W6WA 3VLBB 1NCQA 5LB6A 4EROA 4Z92B 1BMV2 5A32B 3GTOL 1Y7BA 3CIHA 4E4DX 2A3YA 3H1YA 3OYWB 4I2OA 4ME3A 5MFZA 1JZ8A 4YW3A 4FPYA 1ZBE3 1LNSA 1Y1VL 4YM0A 1JYIA 5EINC 5L73A 3L2YA 4Y1VA 3M7AA 5A7OA 2C26A 3VBUC 5F9TA 5ACA1 3QACA 3RZHA 1IS6A 1YK4A 4LIVA 5BV6A 4E6YA 1AR81 3VKNA 1ULOA 5H9RA 5FRAA 4KGQA 4R4XA 4HKWA 4XBLA 4AI2A 4LOSA 4WM8B 5DABA 1VRH2 2GH2A 4YVWB 1JZ3A 1QXJA 4BQXA 2Z3RB 4TN7A 3POBA 4QKFA 1NOVA 2W46A 3V0BA 5DXDA 1QJU1 4WVWA 4V2VA 4KBBA 4CP9A 2W3JA 3NRUA 3I59A 3S1NL 1W0NA 2QQNA 4XUQA 1SMVA 1GOHA 3VBRC 3RWKX 4JDOA 3NSTA 4AEMA 5JXGA 4JGYB 5FK8A 4B4PA 4C91A 2XWBB 3I2FA 1H7VA 1CN1A 4Y1ZA 5A3TA 2RDVA 3VBSC 5FOJB 5KXDA 2DCKA 1LU1A 2DVFA 5EP9A 3HOUL 3NAPB 4JHTA 2V5DA 4QQ2A 1TME3 2IFRA 2XMLA 3GCWA 5T52A 3U11A 1I1EA 2JX9A 4GJYA 3RYKA 3HBZA 2GN7A 1IPJA 3WR0A 2W1SA 3ZN6A 2NVYL 2NZ9A 3VUOA 2VQ0A 3H8XA 2QQLA 4HETA 1YRZA 1FAYA 4HG6B 3SEPA 4Y20A 2E2JL 2WFF2 3LD8A 1OQDA 5BYNA 3TEZA 2LALA 1REFA 4QM8A 2JDHA 2RR12 1UY3A 2R073 4JADA 2YC4A 2BE5D 1IKQA 3MPBA 4GWIA 4M3CE 2V72A 3WW3A 1A3KA 3ZXLA 1SFYA 2A6WA 3H3ZA 2VTXA 3VHPA 1MS1A 4AAPA 2UWCA 1VAVA 2WS93 1SLAA 2QQIA 1BFYA 4XFHA 4B8CD 1LOBA 2JJ6A 2O0OA 3S14L 4XVHA 3PKJA 5A7WA 4CSWA 4HZFA 3BKZA 1WCKA 5FP3A 5JI9A 5C3EL 3DYPA 5C4WB 2DBNA 5A33B 2Z79A 4G3YC 4WZFA 3LPFA 3MYXA 5BUVA 4CP1A 2BQPA 4FTBA 1N1YA 5FLML 4RSUA 1ZZ8A 1GSLA 2XBO3 1QXRA 1MZEA 5FQ0B 3HJYB 4A3ZA 5CYYA 4EN9B 4L11A 4Y4YA 2GN3A 2H6BA 4MZUA 4G9SB 4YZ1A 1S2ZA 1AZDA 3X29B 5A3MA 1COV2 1DZQA 2P5BA 4GH4A 4CEYB 4HMZA 1KFXL 1EAH3 4X6QB 2IXKA 5FLHA 1GQPA 4AFCA 1UZWA 1VBC3 2PHXA 1RUE1 1JYTA 1ENQA 4P9WA 5JR7B 2BP6A 3VKFC 5FZHA 1WMXA 3DF0A 4RHV1 3VZNA 1XOYA 3RJ2X 1H1IA 5FYIA 2XOMA 3MEPA 1NYWA 4POFA 1B09A 3MHZA 4HSJA 4NR1A 3T4HB 1VB4A 4CCDA 2IVIB 1I6XA 2WR9A 1H1MA 1PMIA 5T5OA 1IS5A 1OT5A 3H3VM 3I2KA 3B9CA 2YFUA 4GAZA 4YVSC 4QIWP 2Y6GA 2ZEXA 2LUWA 4QX0A 2A3XA 3WP3A 3MLJA 3WHUA 1ZBA1 4ZXKA 1X33A 3ZFFB 3SXWA 4ES9A 2M6PA 2RS53 4Q27A 3IAQA 4DUVA 1K5MC 4LITA 3ZXKA 1TWAL 4YARA 1K42A 1ULCA 4DOUA 2JG8A 2D6OX 4O9EA 1VRH3 1K45A 5F39A 5E1RA 1AR91 1DX8A 1NE4A 2J1EA 3AKTA 3AP6A 1NZCA 3AKRA 3M2MA 3MF9A 3RMYA 4CZSA 1VZGA 4GXLA 2QZ2A 5FPUA 3ZR6A 2WZ8A 5DAVA 1CJPA 2ARAA 1CAXB 1FYUA 2WSUA 4P08A 3WUDA 3RZ6A 3HQXA 2MS3A 3JD73 1AF9A 4Q0QA 5IP7L 4GKYA 2BWCA 2XB6C 4POGA 2LRPA 3I49A 2BGPA 1YFYA 3MW4A 2JXAA 2WNVC 3LA7A 4YFZA 3IBMA 2HKXA 4DUWA 5JR2A 2C9AA 2J42A 5L7OB 5FYZA 2Q1FA 1S0CA 2ZGMA 3DYOA 4XQ4A 1RGSA 3LEGA 4MOAA 1QJX3 3H42B 4MXWB 4QQPA 3VDDA 1LTLA 1GANA 1LESA 1RL3A 4CXXA 2XJUA 4MSVA 3KV4A 1AYN3 1LRHA 3WF3A 2RMU3 4AVTA 2WN3A 1A8DA 4HN0A 4BWOA 4F7ZA 1VAMA 1QQP2 1HXS1 4IEOA 1XE7A 3Q8AA 4BE3A 2PVEA 1GLHA 1AX0A 1XBFA 2BJSA 2PHDA 3JZVA 2GC3A 1DZTA 1VMJA 2UWBA 1AVBA 3AL6A 3QVDA 2IVJA 2IXJA 4LBLA 1ZRFA 3MDPA 3D4KA 3THCA 1PGW2 2WC2A 2Y0SP 5K0UC 2Y38A 2GNBA 3IDBB 1I9RA 1VBA2 4I3GA 5FZKA 3LDBA 2YFZA 1YYNA 1GZTA 4CCJA 1WD4A 1RUD2 1PO13 1LHNA 3O5SA 1BEV2 3WDVA 4M4PA 2C9KA 1CPNA 3WHTA 4D7YA 3BUCA 1YQ2A 1NCRA 2IXCA 4JDMA 4FXKB 1NE6A 3PMEA 3WOGA 3J4UH 3MZHA 4A3BL 1PNFA 1QH7A 3IIIA 2HWC3 4Q4W2 2VZVA 4XJAA 2RHPA 4RR3B 2VECA 2VQUA 1KITA 3I2DA 2MEV2 4QHZA 4CDWB 2GALA 1GYKA 2YC2A 3N9QA 5FLIA 4XMIA 3DPRB 3ES4A 3ME2A 4FOVA 4MV2A 3SEEA 5J36A 2R7EB 4WM7B 5LCWL 4CU6A 2ARBA 6RXNA 4Q2FA 4UYBA 1DQ0A 4IGPA 2DU0A 1VAKA 2CDOA 1WW7A 5FYBA 5A3NA 5M5WL 5C33A 1KGYA 2OIIA 2ZTNA 4XF4A 1LKMA 1TNRA 5DDJ2 5T5JA 2DFBA 3NV2A 4XFGA 1LENA 3ZSKA 4AVSA 1N3PA 2NLRA 2WAAA 3ZFGB 3FHIB 1SBDA 2WN2A 5KHHA 2B5HA 3R6SA 3HQRA 2IWGB 3VZLA 3VBOA 1W28A 4DRRA 4DPNA 5E88A 3UKVA 1UU6A 1H2LA 5I93A 1V6KA 2YY1A 3ZSMA 1YIPA 3A0KA 5L9RA 3S5QA 2YGMA 4DB5A 1RB9A 1QXPA 1UY4A 3GBWA 4CU7A 1RUOA 4CDXA 5HPOA 4S2FA 4LHSA 3SISA 1RIRA 4LEJA 3VN4A 1SMWA 2IFWA 2YB7A 5EFUA 2HWF3 4B7KA 4ISQA 4F8AA 4G6BA 4S2HA 4XAEA 3PVBB 1T6BX 5D8AB 2WZR1 5FYMA 1O4YA 3TN93 2BBVA 4ORFA 3ZXGA 3ILRA 3C7FA 4QKNA 4QGNA 2DWRA 4TPUA 3PTYA 1OUXA 3BYWA 4N90A 2HWD1 2PQSA 3MPPG 4XIKA 2JDMA 3OUHA 1LOGA 3CJIB 1AYM1 2D6MA 2NQYA 2VL4A 1QOOA 5A7SA 4UOJA 4AVCA 3WQBA 5FBZA 1B13A 3KYXA 3WG1A 3LFIA 5C4XL 1N1TA 5IT6A 3IMMA 1ENRA 4P9IA 2XLGA 1YLLA 3D6EA 5F5AA 1UX6A 3MO4A 5T3NA 2AR6A 2GH8A 2YHJA 1F9KA 3H8RA 4FPOB 1Y4WA 5FWEA 1K5JA 1NZIA 3SH4A 4QPIB 2XDVA 4FPCA 1VBB1 1H8TA 1PVC2 3KS7A 3QH6A 5JDBA 1NA1A 2VZUA 4AGVA 1RUJ1 5C8CB 2PTMA 4Q29A 4YWLA 1CQ9A 2ADEA 3WW2A 5BNQA 1YUXA 4NHXA 1OSGA 3ST7A 2QUOA 3MUZ1 1MZ6A 1XNBA 4EZHA 3JB4C 1VALA 3NJYA 1GUIA 4FPFA 2KM2A 3POIA 4BIFA 2PHWA 3ZMNA 1E5SA 2HEVF 2DCYA 2P3IA 1CIWA 3VZOA 4AAXA 4WV8A 1DP0A 4LBQA 1RWDA 1MVQA 2ZACA 3E97A 1DHKB 2ZGTA 3BPSA 3J7HA 4WVMB 1LAJA 4ZPIA 4DO0A 1KRIA 2JIGA 1SFNA 2X10A 3BOWA 3EB7A 5E89A 3ZYFA 4B29A 4UF0A 3AXDA 2L0ZA 2EXKA 2R1DA 1OKQA 1LKPA 1EV11 2JA5L 2GNDA 2JDKA 2QJVA 5AC92 2R0FA 3FWEA 3JXSA 5FYTA 5AFEA 4YGBA 4XPVA 1SFOL 3RZTA 1OPOA 2BV4A 2JDNA 4XFBA 3VHRA 1DQ4A 1D0GA 1YV1A 1QF3A 5FY8A 3WEZA 3POJA 3THTA 3O1PA 2Q8OA 3OGJA 2WNUC 5GALA 3U0ZA 2BU9A 4LK7A 4ZS2A 1W6OA 5JXJA 1ZZCA 2E9QA 2ZGLA 3VDBA 2FD8A 1XNTA 1AR73 1CAAA 2WQZC 4NHMA 1CX1A 5DM71 2QFEA 3NL1A 4L0PA 3IT8A 3OUIA 1QH6A 1RUG2 2A5ZA 2R063 1B35B 1BJQA 3J7NA 2OUHA 1C5IA 1N3OA 1E5RA 4K40A 4QKDA 1F2NA 1RUI2 4QXKA 1OF4A 4JAGA 1O4ZA 4OUSA 1ND2C 1OOPC 2A1XA 4A7ZA 3EO6A 4A93L 3KMHA 1O3QA 2BPA2 2B9UA 5HV0A 1U5XA 2Z4FA 4W6XA 2XWJB 2HYKA 1MZFA 2R041 4N53B 4MGSA 4WZCA 5BPXA 5M0TA 3UESA 1UL9A 4EYUA 4Y3OA 3AMMA 4LKEA 2RJKA 1Q8QA 4IEZA 1KFUL 4H7MA 4AHXA 4LKSA 1RUH1 3TAYA 5FZLA 4YWAA 2ZCWA 5BNOB 5J37A 1QJEA 4GULA 1Y43B
chains in the Genus database with same CATH topology
1HRV3 2A3WA 3J9SA 1B2OA 1YI9A 2XL9A 3H50A 3EHKA 4NPRA 1GQGA 1H9WA 1OFSA 1RVF1 2EIGA 3AKPA 4OUMA 4XTPA 3UJQA 4AR3A 2NMNA 1E8JA 5FPXA 1Q56A 2PHTA 3M8LA 1PO22 3A4UA 1LHVA 3DV8A 1UIKA 5SV5A 5T5PA 1DU3D 4GMP1 1BKZA 4CRQA 2GSYA 2Z2SB 3CJXA 1DVBA 3ILFA 4R9BA 4HT1T 1RUC2 4D7TA 1CAUA 4NOTA 3U07A 5C9AC 1RDGA 1S0BA 4YM1A 3TN91 4DFSA 4E4SA 4JGZC 2FZ2A 4H14A 1WGPA 1C8M2 1A78A 1VBD3 1BQPA 5JPMB 5I0UA 5JZGC 3MI8A 4KQ7A 2OPKA 1HRI1 5BNNA 4RS5C 4Q1RA 4HFSA 3RRDA 1IKPA 3HIFA 4AXOA 1W0OA 3IIAA 4FPKA 3E5UA 4XF9A 4AEDB 4GA9A 1W6QA 3HD8B 5CFDA 4FOWA 1CAVB 3ZG6A 2R49A 4GQ7A 2V0FA 2CYFA 2ZX3A 4KWLA 2VG9A 5AC93 1FOD1 3BODA 5C6CA 5KHGA 3RYPA 1R1A1 3FJSA 5CG8A 1VZIA 1XNCA 3WT3A 3EJKA 1Q8PA 2ZJCA 3KCCA 1DYKA 2XKOA 1SLIA 1BBT1 2B5ID 3QBQA 4AVBA 1MQTC 2ZGOA 2VU9A 4DY3A 1W6MB 3O0XA 3PJYA 1RMU2 4ZN1B 4N43C 4WM8C 2PLV1 2Z5WA 4XHBA 1RUI3 2ZAHA 4KU7A 4YVWC 5JIAA 3WG4A 2V3BB 5MGNA 4Q0UA 3LGRA 4FVVA 4IESA 1Z7S3 4CP2A 1QNWA 2RM21 2F4PA 2WT2A 4PBPA 3H7YA 4S2DA 5I0RA 4JGYC 4K8FA 4AK3A 4XJUA 3VBFB 3WY6A 1ASJ2 5EIOC 4N7IA 3NAPC 4CDUB 5JCTA 1NCQB 1AJKA 3C3VA 2OA2A 3TNPB 2A69D 1ENSA 1OLRA 2P3KA 2E7AA 1S24A 1YFXA 2VQAA 3DKWA 1GZCA 2CGOA 2RS11 3GZAA 4YRDA 5E8AA 3MGUA 1V9U2 2I2SA 5JOXA 1O3SA 3MLKA 1DGWX 4PCRA 2B45X 1RHI2 2BFUS 5CB7A 3ZDSA 1GQHA 2PSMC 1PO23 2IXLA 4IEQA 2B46X 3M3CA 5KXCA 3J7Z1 4K1YA 4K9SA 4MYEA 2VVFA 3V0BB 3N7JA 4YVSA 2AH2A 4M0HA 1T9QA 1S2BA 2JE9A 1N3QA 2QE3A 4V1PA 3I59B 3WWNB 1TMF2 3AB0A 3WDXA 3AYCA 2P17A 2JENA 2BTVC 2OUJA 3NV1A 2QQPA 5F5QA 4KH9A 1IS3A 4INDA 4HK8A 1V6JA 4J1XA 4LLOA 2YYOA 2XLFA 3POWA 2X5IB 4W6YA 2HWB1 1GNHA 4X6RB 1U5ZA 1IRNA 2ARXA 4ASMB 5JOYA 4Y5Z0 5KWRA 1RUNA 5KXEA 4D94A 3QD6A 4Y20B 3WCRA 3MF6A 1YFUA 2XUMA 1S30A 2DU1A 1ALYA 2ZHMA 3VKMA 1LOFC 1ULGA 4AGRA 1XQNA 1UZYA 2WQ4A 4R9CA 3HN1A 3MIGA 1TME1 4SLIA 4F83A 1IROA 1CAWA 3ZIXA 5CFCA 4JC1A 1W6PB 2WSVA 4XMAA 4MVTA 3BU7A 1BZWA 3ZFEA 3ROUA 2A70A 3HAGA 3BIWE 3WX5A 4C0HA 2C6AA 2FBEA 2XG3A 3J8F1 1FMD1 3ZFFC 4Q8KA 1D4M1 1H2NA 3IWZA 1ENXA 5CG9A 5FOBB 5KHJA 1RMU3 1DLLA 3AZZA 2AZ5A 1PGSA 1R0GA 2V5YA 2GU9A 2WLPA 1NXEA 1G9FA 4GH4B 2C0ZA 3TRSB 5JSRA 2I74A 3H1WA 2ATFA 5KHIA 3MIDA 4COVA 1LKOA 2RS32 3V56A 3AKQA 3GHMA 2XBO1 5SV8A 2B39A 4M3CA 5L7OC 2UWAA 2G4IA 4WFN1 2K2SA 2ZZJA 4A7KA 1FT9A 2XLAA 3AMQA 1AL22 3B08B 1VIWB 1BVP1 2VNRA 4LUKA 3AP7A 4RA0A 4C90A 4HK9A 3JBG1 1VBC1 1HQLA 4IEUA 4ATFA 2UURA 1AR62 2DCZA 2W68A 5AVPA 3PKIA 5AFBA 5IY0A 1MS3A 1SCSA 3AZWA 5CU1A 4IV3C 1HX6A 2MHFA 3MW2A 1PNGA 1WLWA 3OY8A 4FQ4A 1R083 3GBGA 3WG3A 2LM3A 4Q4Y2 1TMF3 3ATGA 5AI3A 1HIXA 1YFWA 1Y3TA 2RS51 2DV9A 2EAKA 2CAUA 2P34A 1RUF2 3P3NA 2ZGSA 3I8TA 4LBQD 1U5YA 4CDWC 1VB2A 4PLMA 2VOVA 4A7YA 3DPRC 4MGIE 4QT6A 5DZFA 4XXPA 5H9QA 2DCJA 3AYEA 4WM7C 3JD71 5EV7A 4QU2A 2K0GA 2NYYA 2B8MA 4KG8A 2YDEA 4Q4X2 4AR4A 1FXZA 4Q4V2 3ZPYA 3L2HA 1IQAA 2XJVA 1PK6A 3WQ0A 3PZAA 2VNOA 1ZRPA 4OI1A 1QJX1 2ILMA 4AQ6A 2W0XA 1LJ7A 4RL7A 1AYN1 2RMU1 3POSA 4B7EA 1ND3B 5ABJB 1UMZA 4ITCA 1NCRB 3BALA 2WZPP 4EV0A 3UKTA 1OA4A 1ZREA 1V00A 2Z69A 4OHZA 2ZX4A 4AQSA 1MEC3 3USUB 5IK5A 3SHRA 1UPIA 3FLRA 4MGZE 3FBYA 3JUUA 3RG0A 2VOKA 5J09A 1IHMA 2XVLA 2WKKA 2DSXA 1PO11 5D8AC 5T5LA 1VBE3 5DG1A 3SLIA 5ACA2 4Z2WA 3THPA 5JIUA 1AR82 4UXAA 4A2UA 1EPZA 3CF6E 2YGLA 4Q1PA 3CJIC 2AYJA 4JRAA 5J98B 3M4FA 3WDYA 3A0NA 4MGYE 2HWC1 2E6VA 2IXHA 3LOIA 5A3LA 3RPQA 2D6PA 3O12A 4L92A 1QJU2 2WNUA 4FOYA 1W6NA 1O91A 1AL23 1QJY1 1SBFA 2D43A 1OWCA 2JICA 4QPIC 4CDQB 5KXBA 1DGLA 4DS0A 1BVVA 1C28A 1HKDA 5C8CC 1DGRA 3WINE 2GC2A 1R0HA 1RYTA 5RXNA 2IZWA 1SLBA 4XJ9A 2DVAA 4CDXB 2VY0A 5CIRA 3GHNA 4TYSA 1F5JA 3W59A 2QL0A 1OOPA 5LK7B 2WWSA 3WP4A 3BTAA 2OZ6A 4AR5A 4CEWA 4JQRA 5EWSA 1OLQA 3V0AA 4AGGA 1J59A 1WMFA 5FMOL 1DGRN 1UU5A 4YGDA 4CP0A 5DUWA 4CYDA 1REEA 3NFPI 4PF5A 4XFAA 4BHPA 3AZXA 1ZM1A 3KYYA 4XEZA 1ZNPA 4ASLA 1IS4A 4IV1B 1RITA 3VHNA 1CJDA 2DVBA 2O1QA 4O9GA 1R091 2HWF1 2XH6A 4COWA 2BNNA 3K48A 5GZCA 1H8TB 3ZN4A 4IERA 4LBNA 1QY4A 2A73B 3MW3A 4XZPA 4Q4X3 1Z92B 1C4RA 4AFBA 2ZBJA 4L2NA 2PVXA 2GMGA 1B35C 4LE4A 1FATA 4LT5A 2D5HA 4WBBA 3B7MA 2A6VA 2VGDA 5JVG1 4C1WA 4DRVA 4DY5A 2WJSA 4LBQB 1GNZA 1RUE2 1SEFA 1S1AA 1LCLA 1V6LA 2R30A 3KYVA 4N53C 3QQCE 4RHV2 4M3CF 2HWE1 1M4WA 1OFNA 4IQPA 5BNOC 4RS5A 4BH9A 3MICA 4XDQA 1YK5A 3FFQA 3OCPA 1BQ8A 4LTAA 2XJPA 1H4GA 4YW4A 3JCIA 5BNPA 5LRSA 5JWPA 3WW4A 3HWJA 2FZ1A 4Y1UA 2VL6A 1JHNA 1QU0A 1W6OB 4R52A 2WFF3 2WA3A 1ZBA2 3GYDA 2WT1A 5ACA3 2RR13 1Z78A 2WLQA 1APNA 2OYZA 1DGWA 3MLLA 1O3TA 5A32A 2D3SA 3E6DA 5C8WA 1AR92 3R4UA 4K9FA 4TVMA 1AUYA 4DZGA 1HW5A 1J58A 2KN9A 1NLSA 2QCSB 5HCAA 3VGIA 1MQTA 2ERSA 1AR71 1KS4A 3DN7A 4PDWB 3LCPA 2BNMA 4JV4A 2R061 3LZZA 1S2KA 1O5UA 1G6NA 3OJBA 4FPHA 4N43A 4M0NA 4YVWA 1W39A 5H9SA 2WA4A 5CBLA 5HI0A 3N35A 3ECQA 4I01A 1UU4A 2PHLA 1COV3 3KCXA 2HEYF 3LSDA 4K1ZA 4AF9A 1DZRA 1UIJA 3ASIA 4NHLA 5FDBA 2YV8A 5I8SA 1HXS2 4QQLA 3IMNA 4AEDC 1B2JA 1FPN1 4JGYA 2EF6A 2ZABA 3WG2A 4B8EA 5AVAA 3WD5A 4D69A 3M3OA 4NN0A 3TOJA 3RWNA 3VBHA 1HRV1 3IDCB 4AHYA 3Q9OA 1NG0A 3JB8A 4XF0A 4EN8B 3D8CA 5EZWA 1KS5A 3V64A 3ZYRA 1FNZA 1NY71 4K20A 2DUOA 5DUVA 4FTSA 3IM0A 4OVEA 2E63A 4TLFA 4ZU7A 1PIV1 1Y9QA 3VHOA 3U4XA 2JE7A 4YG3A 4XJZA 5MFPA 1E57A 5BNNB 4Z82A 4XXAA 2BGCA 1LODA 1JH5A 3SCFA 1RUE3 1DQ2A 3T2TA 4MLOA 5CFDB 4RHV3 4R4ZA 4ZKTB 1VBD1 4LA2A 4Z1VA 1ODHA 5FQ0A 2Y26A 4JTOA 7RXNA 2Q0AA 3M3IA 1OWBA 1CESA 3VBFC 4CDUC 1NCQC 2Q5TA 2TBVA 3IPVA 2ET7A 3AP9A 3WLUA 4COUA 3P3PA 4C0BA 4E2GA 1LGCA 1VZHA 1S0GA 1ONAA 2D7FA 4KGGA 4AR6A 4ZU5A 1ZBA3 1QQP3 5J96B 1LOFA 2ZX1A 4UW6A 3D5OA 1QJZA 2RE9A 2ZX0A 3AFGA 4FBFA 2TUNA 1RB8G 4HL0A 4FQZA 4Q0VA 1DQ1A 1F5FA 1VBA3 3IDEA 2GNMA 3N7KA 3B0AB 2WZR2 4EWAA 1XYNA 1HDKA 1RUD3 1YXWA 4QX5A 2XVKA 2YPJA 1BEV3 2HWD2 2JG9C 4LO7A 4QPGA 2A75A 3OPZA 3ZFFA 2ZGNA 1M06G 3PVOA 1AYM2 4OHVA 2SBAA 3RI8A 2A6ED 1YO8A 1QYBA 2DUQA 4Q4W3 1KDKA 3NW4A 1NLRA 1PZ8A 3D0SA 2CGNA 2OVUA 3GNEA 5J7MA 3KT7A 1X50A 4DQAA 2X5IC 2MEV3 3MIBA 1VBB2 1QDOA 1N47A 3OBTA 4LHNA 1RUJ2 1OMIA 4JDNA 1Z7S1 4Q0SA 4IETA 4GB31 4E9KA 3KCYA 2HEWF 4Y22A 1W2UA 3VV1A 3ZYIB 2EXHA 2AUYA 1SLLA 5DDJ3 2ZGKA 2ZHLA 4BOWA 3UV9A 4MXWA 4V196 4S2GA 3QLQA 4XJWA 4YVSB 3A44A 4P9XA 2BYVE 4RXNA 4BM8A 4Q26A 1EV12 4HVQA 3MPSA 3VPBE 3PNAA 4YW2A 2QNKA 4PBOA 3GALA 3PMSA 4LO4B 1XE8A 4YFWA 4IV3A 3OD4A 2DVGA 4DNYA 1WCDJ 3AYAA 4QPYA 5GADc 3C2UA 1RTVA 4XE9A 3ZXDA 5GLUA 1GZWA 4GH4C 1ZRRA 4LO5B 4NWWA 3KZ4C 4FP3A 4UBHA 1IU6A 4GIQA 3INAA 2CY6A 4PLOA 5L19A 3G7DA 3GBFA 4KNCA 3KGZA 1UAIA 2Q1ZB 2UY8A 3LWCA 2QVSB 4GALA 3SCHA 5HXVA 4BLJA 4L11A 1CAWB 3B00A 3DPRA 1BQ9A 5CFCB 4FTEA 1PVC3 1DFQA 3AMNA 4H3WA 4RQPB 1C1FA 2R042 3VBUA 3VZJA 3ZFEB 3SNMA 2C1FA 3B9IA 1BXHA 2VMIA 1RUH2 1AHSA 1LU2A 4FP2A 5KHKA 1G9CA 1AL0G 4N7UA 4HLTA 2ZGQA 3E5QA 4SBVA 4AWDA 4NWVA 2YMZA 3PHMA 1RVF2 5GAHc 3MFCA 1Z0HA 1YNAA 2WZR3 1O3RA 5FREA 3DGTA 2ZS6B 4OZXA 3VBRA 3UK9A 3NKGA 2O5JD 4DINB 3WZ1A 3VBSA 1AYM3 3SITA 1TNFA 1NQDA 1GZ9A 2VH9A 3NV3A 5CNAA 5GZFA 4AVVA 4QMAA 2RJLA 4M3CB 1D2QA 3B69A 4YW1A 5K7PA 2PN5A 2ZZQA 1VBB3 1JBCA 1RUJ3 3TN92 1ZA4A 4M01A 5FAXA 3WVJA 3S30A 1C09A 3RS6A 1RUG3 4LHLA 3APBA 3P2AA 2VXRA 1HRI2 1JYCA 4QQOA 4UBGA 5JAXA 4K3UA 2VULA 4N9IA 3OY8B 4L99A 1U12A 3ZSEA 5E16A 4XOGA 2GMPA 4E4ZA 5C8CA 3SCGA 1ND3C 4BMBA 5ABJC 5GM0A 1EV13 2D6NA 1NCRC 3MIFA 1FOD2 4RFT0 4PJYA 3CU7A 2ZMLA 4IEWA 1R1A2 5GLZA 2XHKA 4NO4A 5JOZA 3AP5A 1CR7A 3USSA 1YHFA 5I0TA 4FAHA 3WXPA 3WW1A 1BBT2 5CADA 1R081 3AKSA 2QDNA 4N9HA 2ERFA 1GKBA 2D97A 4FT8A 2ET1A 4X8PA 4HN1A 1AXKA 1KDMA 5AN9H 1WLTA 1PGL1 2PLV2 1PK6B 1DIWA 4OHXA 2E7TA 2WIIB 1DF0A 3D82A 1G9DA 1RUC3 1C1LA 3H0OA 2A6XA 1ZBE1 4ONUA 1G86A 2RM22 2HR5A 3GZTB 4CDQC 4K7JA 3ETQA 2ZAAA 5GZDA 5LEKA 5C4WC 2KXLA 1K5MA 2ZHNA 1C8M3 3B01A 1MACA 1RUH3 1B35A 3V65A 3JQXA 5FO9B 1Q8VA 4CDXC 5MF6A 2PAKA 2M4VA 1S0EA 3PIP1 3AK0A 4FXGB 2RS12 3ZN6B 3JU9A 4OI4A 1RVF3 3U10A 3TYJA 4CEYC 4GMP0 2P3JA 4HPKA 1AXZA 4LO6B 1VCXA 4XFIA 1WBFA 3RI9A 2WNVA 3KSCA 1PZ9A 4L9BA 3SMHA 4AEJA 1YJKA 3SS2A 5J3UA 1C3HA 1YCIA 4OI0A 1NXMA 3WDWA 1LOEA 4IV1C 2VNGA 1GR3A 4Y24A 2CKAA 1MEC1 3PWFA 5BXXA 1H30A 2TNFA 2GAUA 1W6NB 1AX1A 4QM9A 2UYBA 2XJQA 2F6BA 3HT1A 4LE3A 2N7GA 1H8TC 4J1WA 2H12A 1H1AA 1VBE1 3TN93 1C5HA 1JN2P 2VVDA 3KLSA 2DURA 2SLIA 2R071 4LO8A 3ZXEA 4GWMA 1G7YA 1WUVA 5JVVA 5K0UA 2AYHA 1J1LA 1X82A 3AX4A 1CD3G 1LEMA 2ZX2A 1HRI3 2HWB2 2WS91 1MS5A 1OOPB 2IXIA 4LBOA 3RZZA 2BVVA 1WLDA 5IK7A 4CEWB 4JCKA 1LHOA 3V0AB 3ILNA 1DYPA 3B02A 2V09A 1VLNA 4L8QA 4YGEA 2FMYA 3FLTA 4EN0A 2NYDA 1VP6A 5LRRA 5JOWA 3SH5A 3AJZA 2D5FA 5T50A 4I30A 1BRFA 2EXJA 1FOD3 3AJYA 1ASJ3 1TME2 4JAAA 3LPEB 4E2SA 1O4TA 2XVGA 3S7EA 5GZGA 1EAH1 1V9U3 4AEDA 3SH3A 4GKXA 3M3QA 3G6JB 3H9AA 3J8F2 1FMD2 5LK5A 1D4M2 1RHI3 1TQ5A 2ZGRA 3FMGA 3PJQA 4EWEA 5I8YA 4JAFA 2JG8B 5GKAC 2PELA 2PLV3 1BMV1 3VZMA 4LR4A 2ZMNA 3N7LA 3ZO0B 2DTYA 4HBNA 3I54A 2GC1A 2K2DA 1F31A 1QDCA 2JI1A 2D93A 1T9PA 2EAAA 2JECA 3AM2A 4Z8BA 4PDWC 1W6MA 2BFUL 3KB5A 3AZVA 5HBAA 3TB0A 2XBO2 4XF3A 1OA2A 4MGKE 1VRH1 4RR3C 4BLIA 4WVVA 3VL9A 3WCSA 3FLPA 3KYUA 1EP0A 3VDDB 3P8BA 4MUVA 5BNPB 3GF6A 4R9AA 3JBG2 1VBC2 4HVRA 3AFKA 5FTTC 2PAMA 2YUEA 3M70A 3K51A 2D3RA 5GAGc 3B93A 1DDLA 4MH0E 2D98A 1O5LA 4UW4A 1IW7D 2CR8A 1DBNA 2DCTA 3ZFGC 4JTNA 2PHUA 4BQ1A 4I0WB 4WVZA 4I0AA 2ZKNA 1C57A 4K6BA 3S7IA 2E51A 1MQTB 2X53S 2WFF1 1S55A 2DTWA 1REDA 2RS52 2RR11 4QD2A 2DF7A 1WA4A 1J1TA 4AI1A 1IGOA 2OW4A 5HCBA 4N43B 4Q8LA 1OI6A 4ZU4A 1MVEA 2HWB3 4YSFA 5EYYA 2A6ZA 4AFAA 1HLCA 5BNNC 3E5XA 5GLWA 4BIOA 2WNEA 2DFCA 2JG9A 1RINA 2MNGA 1PM7A 3JD72 1ZYBA 5CAZA 1YJLA 1G9AA 1JW6A 3POYA 1X8EA 1FX5A 2D6KA 5CFDC 2RS33 1ZX5A 2EA7A 2HJIA 2BEOA 4BA6A 1XU2A 1QJX2 2X5IA 3KM5A 3VBHB 1R1ZA 1I3HA 1SQ4A 4QGLA 1COV1 3WP5A 4ATEA 1WBLA 1AYN2 3VBOB 2RMU2 2CV6A 4I3PA 1SBEA 2Q30A 4MXVA 1FNYA 4HKOA 3R4DB 1FI2A 1CX4A 1WW4A 4AG4A 3URFA 2PYTA 1A6CA 3J8F3 1FMD3 3ZYGA 4AQ2A 1AR63 2XJTA 1D4M3 1GV9A 1R0FA 1WLCA 1ND2A 4XBNA 1NNQA 2VMHA 5JPNB 1HV1A 3FE5A 2P2KA 4JAEA 2XKPA 3ENRA 1PO12 1W6PA 3LSEA 1LECA 4LNVA 4Q4Y3 1AXYA 3WNXA 1IZ3A 4Y1YA 1J3QA 2HWC2 1FHMA 2CTVA 4BYYA 1QHDA 1JOJA 4XJ8A 1RUF3 2VW1A 1T9OA 2Y0IA 1KJRA 4QGMA 3D0JA 3HMYA 4OHYA 1QJY2 3FZ3A 3OF1A 1XYOA 3ZXFA 2NPIA 3IPVB 4DMIA 1NA1B 1XRUA 3JBG3 4LBKA 3H7JA 5KC6A 1POV0 1SACA 3J26N 4Q4V3 2R32A 1WW5A 2NN8A 4P5HA 2G9FA 4FSJA 4AHWA 2ZA9A 4D3WA 5IK4A 2GNTA 3R05A 1UKRA 1PHMA 1IU5A 1O7FA 4TSVA 1POV3 5C9AA 4JGZA 2Q1MA 1Q8OA 1ZZ7A 4AFDA 1ZZBA 1QQP1 4QPGB 2E7QA 5JZGA 2CWSA 2X29A 4OULA 1XNKA 2BUKA 1XYPA 2YC0A 3BB6A 3H1MA 1QNYA 2PQQA 4U671 1XNDA 4K21A 1PGW1 4YWMA 2V73A 1R092 2HWF2 2O8QA 4YM3A 1A8MA 1VBA1 3RNSA 1CONA 3LKJA 1RUD1 3WQ1A 2QDRA 2VOWA 1BEV1 2W52A 1AR83 2UY9A 2G9GA 3MFAA 4Y22B 4YG6A 3N36A 5GLTA 4LULA 4Q4W1 3EBRA 2M4YA 2C6BA 3OYWA 4URTA 2WT0A 4BZ4A 1QJU3 2AGSA 3OBRA 2MEV1 1QCVA 3S0MA 1W0PA 4HSLA 5CFCC 3R4SA 4RQPC 5FO8B 1MR5A 1MS4A 4KWKA 4AVAA 1J3PA 3ZFEC 1B71A 2HWE2 2MPFA 4EN7B 1X36A 5F6LB 5FCCA 1WMEA 4WM8A 1YUDA 1GICA 4IV3B 5DDJ1 1HQNA 2BWAA 2VVEA 1QMJA 5EYXA 4F3JA 4RGGA 3FX3A 3RJRA 3VKLA 1GZWB 1ND3A 1TE1B 3H3UA 5ABJA 2UYAA 2BNOA 4YZ2A 5D1IA 1SLCA 3AMHA 4YW5A 4ZN3B 4CTEA 4XFFA 3NAPA 3WV6A 4R9DA 2GZWA 2XJSA 1NXD1 2EVXA 4PQ9A 3USUA 1Q3EA 3KYWA 2I07B 3AMPA 4AEKA 3ALQA 1QJY3 1R0JA 1UPSA 4AFMA 2ZPXA 2ZIXA 1CAUB 1MZ5A 1AR72 3VBUB 3LB9A 3AYDA 1BK1A 1G8WA 1WJVA 1D4VB 2LTNA 1QWRA 2PHRA 2R062 4KWJA 4KL1A 4YG0A 1CADA 2D6LX 3CEWA 1HQWA 2VOXA 1WD3A 1GFF2 5F1RA 4UW5A 3RSJA 2XPJA 4XILA 4YZ5A 4CDQA 1J3RA 5DZGA 1PVC1 5C4WA 3VBRB 5A33A 1FPN2 4L97A 2Q4SA 3RYGA 1W6QB 3VBSB 1BYHA 4FCAA 1SMUA