2XJRA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and man5(d2-d3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
257
structure length
257
Chain Sequence
LVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 62
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjrA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjrA01
2XJPA 4COVA 4AHZA 4CP2A 5A3MA 4AFAA 2XJQA 4LHNA 4AHYA 4COYA 4AI0A 4A3XA 4AFBA 4CP1A 4COUA 2XJUA 4AI1A 4AI2A 4AF9A 4AI3A 4LHKA 4AFCA 2XJTA 4GQ7A 4CP0A 4COWA 4ASLA 4AHWA 2XJRA 4D3WA 2XJSA 5A3LA 4AHXA 4LHLA 2XJVA 4COZA
chains in the Genus database with same CATH superfamily
2RS31 2VOXA 2ZZJA 4ZPIA 1C1LA 3FLPA 4AEMA 1MEC1 1ULFA 1KGYA 3K77A 5FO7B 1GLHA 4XQ4A 3GZEA 1PGL1 2ZTNA 1V6MA 3X29B 1QOOA 2QQNA 2ZEWA 5CIRA 2GP3A 4JDOA 5BNNA 3FZ3A 4GWJA 3VBHC 1VALA 2WNUC 3IWZA 3OGVA 3R0RA 1CVNA 4Q0PA 4XYXA 1UN1A 1GZ9A 2JDKA 4IEUA 1GNHA 2YFZA 1C28A 4AI3A 1DGLA 1IU6A 2BGPA 1AYM3 2ZS6B 3DKQA 3I3EA 3LKJA 1W0PA 4QU2A 1ZYBA 4ME3A 1AYN3 1MQTC 5I0DA 2V09A 4YW5A 1JYXA 4XFAA 4OMDA 5F32A 4AEDC 1G9CA 5DPNA 3DGTA 1EAH3 2VZ3A 4GULA 1HN0A 1JOBA 5AC93 2HLEA 4JCKA 4RL7A 5FMOL 1R083 2A3WA 4UW6A 3A23A 4BB3A 3RZOL 3PKJA 3LE0A 3LEKA 4NRQA 5GLUA 4XXPA 4CYDA 3TEYA 1TWHL 2HWF3 3BCWA 2LCQA 1GOFA 1ND2A 1H8TB 2VQUA 1PZXA 1JU3A 1SBEA 2WYFA 3WEZA 4L11A 3ZXLA 4DEQA 1N1VA 3PHMA 3T2TA 1DG6A 1L7RA 4AVAA 1G6NA 3ZYHA 5F5IA 1ULGA 1XE7A 1R0JA 2C6SA 5GM0A 3WDUA 3ZXGA 1H2LA 4L8QA 4UI9L 3BB6A 3GHMA 3HBZA 1WCML 4YW1A 3ZMNA 2RS52 4CPBA 2VZOA 3VN4A 1FX5A 5LB6A 4K1YA 1SLLA 3LQCA 1QJX3 3CBNA 4WFN1 5FMCA 2ID4A 5FY5A 1TWGL 1YNAA 1KJLA 5CFDA 3H8XA 1JUIA 4NHLA 1GZTA 5BNPA 4K9SA 4NN0A 1F31A 1MZ6A 3I2FA 3EO6A 2TBVA 1OLRA 5D2AA 5AFBA 1M4WA 2XQRA 1HQLA 2CY6A 5A7WB 1BQ9A 5DAQA 1LOBA 2XHKA 3U1XA 5IT6A 4QKDA 3PVEA 4JRAA 3WR0A 1VAMA 3LFMA 1N3PA 2G9ZA 1W9SA 4H3WA 2I74A 3TYJA 5LATA 4JAFA 1PGSA 3Q8EA 5KHKA 2D6NA 2KD7A 1LAJA 4FXGB 2D6OX 3K48A 4ISQA 3ZKYA 3QD6A 3I4IA 1SDDB 1XQNA 1ZA7A 3I54A 4H7LA 1F15A 1CAVA 3DYPA 3OEAA 4DS0A 2Y6FA 1W3XA 1P7PA 1DLCA 1KS5A 1LGCA 1ODMA 2HEYF 3B9CA 3GNEA 5EJZB 1IROA 3DF0A 3FN9A 2EXJA 2EAAA 5D8AB 2PAMA 5I0RA 2WFF1 4FVVA 1EP0A 2RR12 3FBMA 2AUSB 1DQ5A 1N3QA 1HXS2 1ND2C 2LROA 1H8TC 3ZXKA 1VBD3 5FYVA 2W1UA 2XKPA 1MS3A 2D98A 4XFBA 3POJA 5FPXA 2OX0A 1UMZA 3BIEA 4OI0A 2EAKA 2J1UA 1S55A 2C6AA 3PVOA 1YQ8A 2E7TA 4CCJA 5LA0A 3NQHA 2VMFA 1KS4A 5I0TA 1JZ5A 3RZJA 3DV8A 4W65A 4CU7A 1X50A 2JJ6A 1DCSA 3K4DA 5AI2A 3P3NA 4ISRA 3LB9A 3VHRA 3AK0A 2JI3A 5T3NA 1ZA4A 1UOFA 2X8KA 2X53S 5L73A 4HKOA 3HT2A 5F39A 2E9QA 3ZYBA 5FY4A 2BE5D 3VGIA 3M4FA 1S0DA 1GNZA 1FPN1 5FIXA 3TBDA 3WSOA 4Y52L 5BNPC 1PGW1 5K0UB 1UU6A 1H1AA 1X9PA 2TEPA 1IGOA 1LU1A 4R4XA 1W8OA 4PDWA 4G4FA 3MDPA 3RGBA 1W6PB 2MNGA 3WV6A 4EJRA 4OCTA 3AYAA 2GNMA 3PUHA 3SLIA 2E7AA 1KJRA 3CU7A 3MIEA 2AR6A 1WW7A 4XE9A 4HMZA 5FYCA 3ZXFA 1VJ2A 2JG8B 3GTQL 1EV11 3MIBA 2IXLA 1HQWA 1RMU1 3ZN6B 4S2FA 2DCYA 4GJYA 2LS6A 4B4QA 5L7OC 1LEDA 2FQPA 2R042 4I3GA 1JHJA 5D8AC 3ZN5A 4A42A 4OFGA 3IMMA 3HOYL 4HKLA 4KWKA 5F5AA 1VRH1 5A7PA 4XQWA 1UYXA 4LNVA 1JYBA 2XLAA 3LPFA 1AL23 3A22A 1Q5OA 2V5DA 1ODHA 2VVEA 4V2VA 5EP9A 1QY4A 4ASMB 2QDRA 5BUVA 4YM2A 3NWKA 1NY72 2YGMA 2WT2A 2EA7A 1DDLA 4O9EA 2NPIA 4BZ4A 2JDUA 3VD7A 2XONA 1H1MA 2ZKLA 3LEIA 1S24A 1MEC2 1HJGA 2NMNA 4RD7A 5AFEA 4KBBA 2K46A 2VL4A 3U10A 2P3JA 3PMSA 4N9HA 1PGL2 2Y6LA 3FE5A 5FY8A 4J1WA 2Z2SB 1LECA 4POGA 2VZ1A 1GV9A 1MS0A 1RUOA 3HNYM 3N9QA 4XOGA 2FDHA 3AYDA 4UFJA 3VPBE 4Q4W3 1G9DA 5FCCA 4AVBA 1W2NA 1RVF3 3ZIXA 3N4MA 3S1ML 4Q2FA 3WP5A 4BMEA 1QXJA 2V72A 3IN9A 5JIUA 2M6PA 1JTZX 2ARXA 3H1YA 2NLRA 2CV6A 4R52A 3MPSA 1C3HA 3P5BA 1V6IA 4HXCA 1PZ9A 5ANNA 4C1XA 5IFPA 1GP6A 1VPHA 5FZAA 2ZGQA 3NNJA 4AW7A 5MFPA 1AR81 1SCRA 1NUKA 1SLAA 1N1TA 2Y6GA 4AYUA 1JZ7A 4AOCA 2WAAA 4Y24A 2MPFA 3O5SA 4FQZA 3WG4A 5FO9B 5KBFA 2WT0A 5IVYA 3WW4A 1NE4A 1CZSA 1RUH1 3AX4A 3POIA 1NA1B 4Q0UA 4YW2A 4A45A 4JAAA 3THTA 4AAXA 1XU2A 2PSMC 4TWTA 4MGQA 3KYYA 3GXUA 1AHSA 4JHZA 2DTWA 3G7DA 4CDXB 1SMVA 4CCOA 5LBCA 1ZM1A 2EIEA 3W21A 3RJRA 2QNKA 3BPZA 3CZUA 1GMMA 4BWOA 4EYUA 2P4EA 4QT6A 3VBOB 2ZX4A 1X8MA 1KDMA 4MXVA 4Q5OA 1JYVA 5ACA1 2K9ZA 2E26A 2GMMA 4IEZA 1SACA 1NCQA 3NJVA 4HL0A 4W6WA 4M00A 5F3GA 4DIQA 3RZGA 4WM7B 1XU1A 5J7MA 3ST7A 1RUI3 1W6NB 2G9FA 1ONAA 3ACGA 3AP9A 2ZHKA 1PX3A 1C57A 3FWEA 4IXLA 3ZPOA 5ABJB 3VBFA 3APBA 1IU5A 3PUSA 1HB3A 1ENXA 1W6MB 1OF4A 4N43B 5A3WA 4IE0A 1Y1WL 1Z92B 3VDDA 1URXA 3GGLA 5FK7A 5D1IA 4RR3A 5FBJA 4R9CA 5FZGA 2RM23 3VDBA 4GH4C 2GDFA 1D4VB 5FZMA 3T0BA 5BYNA 1NXMA 2JDZA 2ET7A 1YFWA 3E6BA 1BKZA 1O8PA 2WQZC 1FT9A 3EBRA 4S2GA 4Y22A 5JLVA 5KHIA 1PK6A 3TRSB 4CDUA 1A78A 4MH0E 3TN93 5RXNA 1AR61 2O14A 2PAEA 5FP4A 2VL6A 4CDQB 3ZFEA 4A6OA 3FUOA 3V56A 2WFF2 2WT1A 4X8NA 1JYCA 2G1MA 2LTNA 2QJVA 3TNQA 3UJOA 1BBT3 4W6XA 1ZBE3 4Y33A 4H55A 1UD1A 3UV9A 4AFMA 4PI2A 1RJ7A 2VG9A 4CEWB 4C2M1 2WWJA 4NO4A 3GCXA 3HNBM 3MQKB 4EZ4A 5JSRA 2L9LA 2R30A 2VZVA 3OJBA 4AFBA 4BQ1A 1V9U2 3D5OA 4FTSA 2H0VA 2WB1P 2J1AA 5EV7A 4WM8B 5FPLA 3VL9A 1E5SA 2W3JA 2VXRA 2FDJA 1OPMA 2XMLA 2VZQA 4KG0A 3ETQA 1YQ2A 4LEJA 4HK8A 1E8JA 3VBOC 3E1F1 2XJRA 4FOVA 1Z7S1 4LQRA 1SZBA 3LWQB 3RFRA 3U75A 1PGW2 3BTYA 2DWRA 5GZEA 1RUF3 3R4UA 2WWUA 4INDA 1QJZA 1W90A 1JOPA 1W8ZA 4GMP0 1EUUA 2A6XA 3S1QL 3V64A 5KHJA 3POYA 4F83A 5DUWA 1IS5A 1LENA 4QQ2A 5FZ1A 3T2OA 5IVCA 1MS8A 2ZX1A 1Q8SA 2VMHA 3POWA 4MGIE 4P5HA 4LO8A 3RSJA 5IK5A 3MO4A 4YLZA 3SH3A 3ZYIB 4XUPA 2ZJCA 1SQ4A 4A3KL 2JG9A 2Y60A 2HWC1 2JI2A 3H3UA 5B2GB 1RUG3 4XBNA 4A3BL 3AVSA 2BNNA 4K8RB 3LDBA 1EV12 4NE9A 4EZHA 2XR4A 1LJ7A 5A70A 1DQ4A 1PX4A 1RMU2 2VJXA 1PK6C 1UY3A 4LK7A 2WWSA 4D7SA 2C1FA 1DYKA 1KD7A 4MADA 4Y1YA 3WNPA 3RYPA 1H2KA 3TEWA 3IIIA 5L36A 2VBBA 3ZFEC 3S30A 2OIIA 1VRH2 1JYTA 3OBAA 3AFGA 4LKSA 5HXVA 4AHZA 3OYWB 4YVSC 3TWIA 4EN9B 2VQAA 2H12A 2GNDA 2I45A 3AP4A 3AP5A 3FX3A 5FFOC 5I8SA 4PHZA 3BU0A 2XBO1 2WA3A 2Q1MA 1PO23 3KV9A 1K42A 5C8WA 5JOZA 3ZYRA 3UKVA 3WNMA 4UFIA 2KA3A 2Y26A 4XCAA 5C4WA 3S2DL 3MSUA 1YIPA 2J42A 1RB8G 4HN1A 4LIVA 4WM8C 3WQBA 3RI9A 4DY5A 4QD2A 5JZGA 4CU6A 1O4ZA 2JDHA 5CNAA 4RHV1 3I2OA 1FMD1 3IKWA 3I2KA 1QWRA 4O65A 4AG4A 2PHTA 4GWIA 1O59A 2QQKA 2QQWA 4ET7A 3JBG3 1COV1 5FOBB 4F3JA 4BOWA 1C8M1 4A6SA 3HJWB 1Y4WA 3HVDA 3HBKA 3ENRA 4N9IA 5LRSA 3CJIA 2VCBA 4IV3C 2D6MA 1POV3 3IAQA 2PMZP 2D5FA 3VKLA 2Z69A 4XW3A 2JIGA 1PHMA 1R0HA 2CNAA 4LBQD 1AXYA 1AR82 3ZOIA 4UFMA 1Q8VA 1WLDA 2YPJA 1VBC1 4Y20B 1BFYA 3OB8A 4AHWA 4BQYA 1RUH2 2FMYA 1POQA 4CP9A 4HT1T 2PVEA 3GTGL 4XIOA 2YG0A 3OTFA 1S4CA 4DXSA 1W99A 1CQ9A 3R4DB 3H9AA 1YIFA 5FP8A 4YG6A 5CYYA 4Q0SA 5FYZA 1QU0A 5FZKA 3QVDA 5DDJ3 3EYPA 2JENA 3S14L 2YZ4A 5FYIA 4CU8A 1WD4A 3UKNA 5I8YA 3L9JT 4RA0A 5FP9A 5DZGA 1B35A 3P2AA 3U37A 3AKRA 1JMUB 5ACA2 1DP0A 1W06A 5CKNA 4YVWB 5M5XL 2VNRA 1RXGA 4DRVA 3KQRA 4HPKB 4KWLA 1YC61 2R063 4L9BA 3WNNA 3KGZA 4AFCA 4E9KA 1IOAA 1C09A 1QDCA 4KMQA 5KC6A 4XJZA 4XCBA 5C3EL 5C8CA 2R16A 3ZDSA 4PF1A 1XSQA 2M6OA 1ASJ1 3VBSA 3UGFA 4E2GA 1FI2A 2RDQA 5FRAA 3ZX7A 3KT1A 4BXFA 4QGNA 1YUXA 2H6CA 3MHZA 1CX4A 4RGGA 4BXSV 3J7HA 4NHYA 1UNBA 1UZVA 2K2SA 3USUA 1V00A 4OI2A 4JADA 5FV3A 2BOIA 2CGPA 2ADDA 1UMIA 1R64A 2B4KA 3WW2A 4CVUA 3ATGA 3IT8A 2WAOA 1IS6A 1OOPB 3K35A 1ULDA 2DU0A 1RL3A 2I07B 3CJIC 3H3LA 3H9CA 4I09A 3ZXAC 3SHRA 2YB7A 3I2HA 5HPOA 5DQ0A 2B5HA 4XJAA 1AR62 2W2IA 2BVVA 4GALA 4JGYB 4W50A 4ZY9A 2E63A 2XVKA 3QQCE 4QWNA 5JOWA 1LKPA 1OA2A 2B63L 2ET1A 2JDMA 2JB8A 3BU7A 3LA7A 3OBTA 3Q8CA 1O5UA 4LHLA 2XJVA 1QXRA 2BEOA 1NG0A 2LM3A 2YC0A 1DQ2A 5FTTC 3H42B 4QHZA 2AZ5A 5F3CA 4BU2A 2DCTA 1K5MB 4IEQA 1QJU3 2YU2A 3NKGA 4JTOA 5F3EA 4NPRA 5KWRA 3AYCA 1FATA 2GALA 5MGNA 4XGHA 2BNMA 3KCXA 4JKKA 5IW0A 3OPZA 1LCLA 2B5ID 4OHWA 4TZDA 3N9MA 5FZIA 1T6BX 2G19A 3VKOA 4CU9A 2RS53 2LRPA 2D6PA 1VZGA 8RXNA 2RS11 2PA7A 1FHMA 4IUGA 2ZAAA 3NO8A 3ZSEA 1Z7S2 4M01A 1DYOA 4XUTA 2Q8DA 3ASIA 4AFDA 4CEYB 2VOKA 3SH4A 1WA6X 5HCBA 4C3HL 2Q8OA 5M5YL 4XACA 5L9VA 5C3PA 3VZOA 4OI1A 4NIIA 4EROA 2E33A 4RS5C 4POFA 1V6KA 2PHDA 3LWPB 1TMF1 2HH9A 2X5IB 5T5OA 3T30A 5C8CC 3VBSC 1PVXA 1F4AA 1QJFA 2OZ6A 3LCPA 1MPXA 1YQCA 4CXWA 2EIBA 2BRTA 3F95A 4B3NA 3IBMA 3IIAA 1XB9A 2VOTA 4Q29A 3JU9A 2ZHLA 3GF6A 2HWC2 1RDGA 2WLQA 3V0BB 4FP3A 3B0AB 1S2EA 2HWB1 3IPVA 5E1RA 1CESA 3MBWA 3S2HL 1XYOA 2DUQA 4E4ZA 5GADc 4MV2A 3SC7X 2ZX0A 4Y4RA 1NCRC 3N9OA 2W94A 3MW3A 2JDNA 2BPA2 3RYRA 1TQ5A 2B9VA 2FCUA 4OZXA 4KNCA 2QKDA 2O5JD 4L0PA 4PF5A 5T55A 4Q0QA 2JI1A 3B3QE 3J4UH 5A7NA 4IE4A 3ZFGB 5FZ0A 1LOGA 2WKKA 4BIOA 4D6SA 3GTML 1CIYA 2AEYA 2WSUA 1J83A 2VCAA 1HRI1 3SQOA 1GZCA 5GAGc 1H4HA 2RR13 1RC6A 2XBO2 2JD9A 4IEXA 3DN7A 3ZR5A 1HXS3 4NHKA 3AKTA 1VBA1 4H14A 2VM9A 3VBUB 2J9UB 3I2DA 5M3FL 3I59B 3KYUA 1D4M1 1SFNA 2DVGA 4L97A 3KF5A 2WQ8A 3CO2A 2W1WA 5IYDL 1QH7A 4CTEA 5IVVA 4D8MA 5CFCB 1OUXA 4RHV2 4ZS2A 4FTBA 5LBEA 2W39A 4NROA 1FMD2 5IWFA 2DU1A 2H6BA 3BTXA 5FYYA 1COV2 5JOYA 1EY2A 2YMZA 1C8M2 2WNOA 5K4LA 5F9TA 5FZ3A 3QCWA 1VMJA 1RUC1 5FJKA 3NV2A 4MG2A 2WNVB 2X5IC 5DABA 1W03A 5FY0A 4QDSA 3WZ1A 2GNBA 2RDRA 2VUML 4E27A 4QPIB 2NVYL 1R0FA 2D6LX 3O0WA 5FZOA 3JUUA 2QL0A 4M3CE 1Y9MA 2Y0OA 1NQJA 1ODNA 2BFUS 1VBC2 3DPRA 3N9NA 1IG0A 2CHHA 1I5ZA 4UWDA 5FKBA 4ZN3B 2F17A 2PYAA 2YBPA 3WDVA 1OWCA 3AZVA 5J1XA 1MS5A 2FHRA 2E32A 2WSVA 1WCDJ 5JVH1 3H8UA 3E97A 5CU1A 5H1Sc 4ATFA 3KCCA 3IDCB 5A3TA 3M4OL 1H0BA 3ITQA 2R043 5JI7A 3VKFC 3MPPG 3MF6A 5IP7L 1TWCL 1W9TA 4WZFA 2X09A 1J1TA 2CL2A 1CJDA 1CADA 3H7YA 4HKWA 4ES9A 3LOBA 3SS2A 3LEGA 4QB1A 3HEIA 4FPCA 1IQAA 3PIO1 4ITCA 3FFQA 5F6LB 3P1IA 5JIAA 3VBHB 2EXHA 2WNUB 3HNMA 4QXCA 3O1UA 4HFSA 3K3NA 3M7AA 5K9YA 4HVRA 2RS33 2EY4E 1ULEA 4K1ZA 1ASJ2 4JC1A 4OZOA 4UF0B 1MEC3 5FO8B 1TEIA 2R7ZL 1HN1A 1YXWA 1QJY1 1MQTB 3LEMA 4FPJA 4IE7A 4AEDB 2R93L 3WF1A 1W2OA 2ZIXA 4N7IA 3RMXA 4MXWA 1EYBA 4AHXA 3G6JB 3OF1A 2YBSA 4B8CD 3DEMA 4QPGC 3OOXA 1JYNA 4ORFA 2AYJA 1J3QA 4J6GA 3ZFFC 4D7TA 4TLGA 1NT0A 1IKQA 4FFHA 5HCHA 1ND3C 2R49A 2NVQL 1H2MA 3WWNB 2WO3A 1GZWB 2XOMA 2XQXA 3L2HA 3PIGA 4I01A 3J8F2 2FDKA 4FFIA 1GOGA 2Z79A 4BLIA 2YGLA 3DPRC 4OULA 2VW1A 5FPUA 2VZSA 2ZHMA 5C9AB 2VU9A 3H1MA 3AC0A 4NWWA 2O1QA 3P8BA 3NFPI 3CLPA 3HAGA 1LTEA 1QF3A 3MW2A 4E8CA 4P00B 1UOBA 1WD3A 4EQVA 1QKQA 1YLLA 2GH8A 1PNGA 5IUQA 2XGXA 4R8HA 3K7AL 1UF2C 5C3SA 1F35A 4SLIA 3J7Y1 1BRFA 1DZQA 1UY0A 3B7MA 4QQLA 3MIHA 3U11A 4UW4A 2OS2A 5M0TA 4P9XA 5B4XA 2RS12 2ZPXA 1XNDA 5BNOA 4N8MA 2VBPA 5IVBA 4CUGA 2Y38A 1HDKA 5GKAC 4LA2A 3I97A 1QXPA 2CSGA 3ZSLA 5CG8A 1QQTA 3M2MA 3RNSA 4COUA 4Y1XA 3ZO0B 5F2WA 2NM1A 1OH4A 1TMF2 2NQYA 1UYYA 3NAPC 4PIYA 4HVOA 1JU4A 1AZDA 1WGPA 3KGLA 4QB6A 1ZRPA 4JHTA 4LPLA 5L9RA 2IFWA 3N35A 3WINE 1SBFA 4EWDA 2FDFA 3J7Z1 3EMRA 1MZEA 3UGHA 1CAXA 4IV1A 2FCVA 2HWB2 3DYMA 1CIWA 3UJQA 3WDTA 4TTGA 3WHTA 2O8QA 2ARCA 2YXSA 2D44A 1DHKB 2B7YA 3POFA 1SLTA 4AL9A 4ZZ5A 5F7UA 3S0MA 5K8SA 5IHRA 1ND2B 4MHUA 3HD8B 4X6QB 1G9FA 5ANQA 5BY5A 4JTNA 4MSVA 3Q8AA 1WCSA 1VE0A 4BA6A 1WLCA 4FPLA 4MGYE 2WO1A 1OKOA 1VIWB 4IEWA 4QQPA 4RGKA 2ZBJA 1HRI2 1CPNA 3AZYA 2WFF3 4JZRA 3KVBA 5FPBA 1GFF2 1WCUA 3H50A 3I3BA 4XQDA 2N7GA 4C1WA 5C9AC 1UWWA 5FYSA 2Y8KA 2YU9L 1E57A 5LBBA 3B08B 4ZU5A 5J37A 1R1A2 1VBA2 3D6EA 4TVMA 3H3VM 3NNMA 1D4M2 3R4SA 5A1AA 4GB31 3OGRA 5CB7A 1F5JA 4B8EA 1NOVA 1JZ3A 4UFKA 2V4AA 3H99A 5CKQA 4CP2A 3KSCA 5E8AA 1V9U3 5BNPB 1ZZ9A 2WDBA 2YBKA 5CBLA 4LHNA 3U78A 5BV6A 2VD7A 5LRRA 4XF0A 2J1VA 4QX5A 5EQUA 2LW8A 2Z42A 4CPBD 2YV8A 1O6UA 2Y34A 3OY8B 1KEXA 1S0EA 2D97A 3GHNA 4BK5A 1BEV1 5C7GA 5BNNC 3WXPA 5HXMA 4F7ZA 3POEA 1FPN3 4LR4A 3VD9A 3ORJA 1RUC2 4LKDA 3W20A 1UKRA 5DM61 1H4GA 3AL5A 4W4ZA 4MGTA 2DVDA 1ENRA 3INAA 4B7EA 2QTWB 2WZEA 1PZ7A 3Q8BA 4L99A 1UPIA 4QDRA 1GUIA 2ZGPA 4YRDA 4ATEA 5C4JL 4CCCA 2P5BA 5GZGA 3O14A 4HSLA 1J58A 3NV1A 1S1AA 2PYTA 5L7OB 1X8EA 1J3RA 1Y9QA 1GOHA 4YG0A 5A7WA 2WS91 3LWOB 4XURA 3WNOA 2ZMNA 4BCUA 3HT1A 1EV13 4XDOA 2FDGA 3JB8A 5MLC3 1HX6A 3CQZL 1RMU3 2VUJA 3OBZA 1PFYA 3WDXA 2X05A 3HOZL 3T2QA 1LKMA 2VZTA 1C1FA 2XL7A 2EF6A 1H9WA 4YGDA 2OW4A 1RUJ1 4AR3A 3GBGA 1VRH3 3V0AA 5GAHc 1V9U1 1OF3A 1O7FA 5AVAA 1T9QA 1SCSA 2HKXA 4KQ7A 1S0CA 3R05A 4AYBP 2IXIA 2W46A 2HWE1 4URAA 2VXJA 1YO8A 2H0BA 3THPA 1LHWA 3RS6A 4P9LA 1H9PA 1GQPA 4GMP1 3H7JA 5CFDC 1ENSA 1MS9A 4COYA 3MUY1 1LB2A 3I3QA 2CAVA 2OPKA 1QJY2 4OVEA 1NZCA 2HBUA 4DNYA 2OZJA 1CR7A 3MIFA 4EN0A 3VLBB 1HRV1 3J7NA 2ERSA 1N1SA 1DQ0A 5IYBL 2GH2A 4UBGA 3HOUL 5JOXA 1ZRFA 1XOYA 1UX7A 2Y0SP 3O0VA 5JAXA 2PHRA 2EXIA 4LHSA 5HV4A 2QQIA 3VKMA 2UWBA 3O12A 2A5ZA 3RYGA 2VOVA 3AL6A 5I91A 1IW7D 1PVC1 1IS4A 3RWKX 4WVZA 2JA6L 2GSYA 4UFHA 5F6KA 2EALA 3H97A 1QOTA 3NRUA 2AENA 2IVJA 4OLLA 5K0UA 3BIWE 4CSWA 2XHNA 1LOFA 3MV01 3N7JA 3IMNA 1I9RA 2DSXA 2B8MA 1AR83 3AMMA 1W6PA 5A6YA 2FBEA 2BGOA 2WN3A 4K3UA 3U4XA 2Y6KA 5AN9H 3A21A 2JE8A 4YZ2A 3IDAA 3POBA 1Z78A 1X82A 1RUH3 1MS1A 4AVTA 5LEKA 1IQDC 1LEMA 3M3EA 4XHXA 3KZ4C 1OQ1A 1CWPA 5FZ9A 3ZXEA 4AGRA 2QVSB 3FLTA 4KBZA 2OUHA 2P34A 2JG8A 4ZU4A 1Q8OA 3EXUA 3ETPA 4OHXA 3ZN6A 4TPUA 1DGRA 4Y5TA 1AR91 1KDKA 1WMEA 4BYYA 3IZOA 5A6QA 5IK8A 3VBRA 2V0FA 2E2JL 3HOWL 4YPJA 5ACA3 4C91A 1VBE1 1GICA 3Q8FA 3AFKA 1SLIA 2W9XA 3AKQA 5T52A 1J1LA 3ZXDA 3D8CA 2XB6C 3ES4A 4XIKA 4GH4B 5EYXA 1D2QA 4M0HA 4AGGA 4WVWA 1ZRIA 1DF0A 2AUYA 4B4RA 2GC3A 1OLME 2YY1A 4PDWC 5I8TA 4A4AA 2HEWF 4JDMA 2C0ZA 4LHKA 4A3ZA 2APOB 5A6ZA 2BWAA 4LO6B 5A32B 2PHUA 1XE0A 3JQXA 1W39A 2QQVA 1E5HA 1HIXA 1I6XA 1VB2A 5ERLA 4MVTA 1NLQA 1W8HA 2V5YA 2X29A 1LR5A 3PURA 4CDWA 2DUPA 4MYEA 5FZBA 1UYPA 4UW3A 3DCQA 2ZEXA 2XJQA 1AR63 4Q4X1 4L2NA 3AB0A 3LSEA 4QKFA 4JAEA 1UY2A 2VY0A 3PTYA 2PLV1 3CEWA 4NIDA 5I93A 3THCA 4IERA 3LD8A 1UPSA 3IU3I 4XTMA 3O7OA 1GBGA 2W1SA 2WZPP 4QIWP 4XVHA 1ZREA 4GB32 1N1YA 2VQTA 4P9YA 3WQ0A 3EQEA 1FNYA 1UMHA 1K45A 1VBB1 1Q56A 2E7QA 2JKXA 3ILNA 3OUJA 3RJ2X 2CKAA 3KS7A 4XJUA 2D3RA 1XNBA 3AZXA 2MEV1 3ZSJA 2JA5L 1A3KA 1XNKA 3URFA 2PHLA 1UOGA 2DBNA 3PIJA 2QQUA 3NV4A 1GYKA 2SLIA 3RZLA 2GMGA 1BEV2 5T5LA 1Z7S3 1DBNA 3RZKA 3BTZA 2W1QA 5BXXA 3KQ4B 1AJOA 5J36A 2OYZA 2WZR1 4M3CB 4PQ9A 4CP1A 3M70A 3DKWA 3LZZA 3R6SA 4HN0A 4A7KA 1PZ8A 1WA4A 1OI6A 3PJYA 3KYWA 1PK6B 3A0NA 1O3QA 1FNZA 4CDUB 5JSOA 5EZWA 5LWBA 1W6NA 2HWC3 2RDVA 2C26A 4GXLA 2WS92 3ZFEB 5KXBA 1NLSA 2ARAA 4QKNA 2B42B 3WDYA 3H1WA 5A7OA 1JUHA 1W6MA 1PM4A 4N43A 1PIV1 4LBJA 4UXAA 3ILFA 4YVSB 5FZ6A 4A3CL 3UYJA 4YGCA 3WF2A 5C33A 3S57A 3FMGA 4CDWC 2KKDA 1YFUA 3AMQA 3VL8A 4LXLA 5GALA 1OMIA 1JH5A 1WKYA 1RUJ2 3LSDA 5IJRA 1DU3D 2WR9A 3S7EA 3UNPA 2YU1A 2TUNA 1SPPA 5CADA 2ZX3A 1Q3EA 3S17L 2A75A 1W6OA 3O1TA 3HJRA 3RZ6A 2FD8A 2XBO3 2BV4A 2G9GA 5JDBA 2HWE2 1YK5A 1RUE1 1JW6A 4LKFA 4CDQA 1DGWA 1FXZA 5JXJA 3TEZA 1WJVA 1ST8A 2Z3RB 2B39A 2XLGA 1YYNA 3NNGA 3PMEA 2R92L 3JD71 4A3FL 1NCQC 4FPHA 4GJZA 3HN3A 1LHUA 5EIOC 5A1LA 3BYWA 5M5WL 3N7MA 3JXSA 1ZRRA 3LIHA 1HRV2 4CEWA 1BJQA 1CZVA 4IV3B 4ZN1B 4G3YC 4OMCA 1IRNA 3VBFC 4RHV3 2P1BA 1FMD3 1OVSA 5GLZA 4PIZA 4DMIA 5DAVA 1AVBA 3VDDC 1TNRA 5FY1A 4OUSA 4NPLA 1SFOL 1COV3 4NJ4A 4XF3A 4AI1A 1C8M3 2VO5A 3OPWA 4RR3C 5T54A 1PVC2 4OQ9A 4GWNA 4YGEA 4UBHA 4C90A 1E5RA 2A1XA 2JWPA 5F37A 4IEPA 2A3YA 3AZZA 1JN2P 4PLNA 5F5QA 1VR3A 2VPVA 2VVDA 4U2AA 1LRHA 3VHPA 5JCTA 1CZTA 2ZEZA 3W9AA 1CAUB 4CDUC 4YZ1A 3T0DA 1VZIA 2V73A 1W2TA 3B9IA 3W59A 1X33A 4Q4V1 1CAWA 5FPAA 1VBC3 5F1RA 1GANA 4DO0A 3BOWA 3MW4A 5JMOA 4RXNA 4BMBA 4GKXA 4E2SA 1LTLA 2W87A 3W58A 1W8TA 3I3DA 2PHWA 1W8UA 3NJYA 1WW5A 1GSLA 2P37A 4JV4A 5F8PA 2YPDA 4QPWA 3GM8A 1OWBA 2ETEA 4LOSA 4I30A 4A7YA 2W47A 2WC2A 5L9BA 1ZBA1 5FXXA 5C4WB 2WNEA 3NVCA 5FBZA 2ENRA 2BFUL 3WP4A 1AR92 4BE3A 5FR3A 5FQ0B 2ES3A 5JZGB 2A6WA 1S2ZA 1VBE2 3HPNA 2CKCA 2VNGA 3N7LA 4LBQB 3OYWA 1KRIA 1OD5A 3M1HA 3WF3A 3ZM8A 1Y7BA 4X8PA 5JPMB 4LT5A 1ASJ3 4R4ZA 4XAAA 3LA2A 3AM2A 2A70A 2CGNA 3CJIB 4AGVA 1D2SA 5FZEA 3I2JA 4MZUA 5FJ8L 1GP5A 1JYWA 1R091 4AI9A 4IESA 4LBKA 3BTAA 3BVCA 3UK9A 5ABJA 2XJUA 4QX1A 1RHI1 3HR9A 3S6PA 5TSWA 1OD3A 2Z4FA 4QQOA 2O8OA 2JG9C 3KVAA 3MF9A 4NIHA 4BHPA 1WLTA 1ZNPA 2BUKA 4Y7NL 4YWLA 4AE2A 1GWKA 1G8WA 4NR1A 2E2HL 4A93L 1H7VA 3ES1A 3FHQA 3OD0A 4Q4X2 3C3VA 1N47A 5CG9A 3LPEB 4WV8A 4V2WA 2MS3A 4XAEA 2PLV2 2JDPA 3S15L 3J8F3 4NRMA 3PZAA 3HIFA 4Q0VA 5IFTA 4MUVA 1JZ8A 3RZHA 3NJXA 2NVXL 1P8JA 2P3YA 2XKOA 4YW3A 3NNFA 2IWGB 2IUWA 4JAGA 3AMNA 1SMUA 4EE2A 1I1EA 1MZFA 5DAPA 1VBB2 2VAUA 5FZDA 4A3IL 4AI2A 1CD3G 1GQHA 1LOCA 3S1RL 1NQDA 4FPYA 4LJHA 2J1RA 1AL0G 2MEV2 2V4VA 3P3PA 3RQ0A 5C4WC 2A6YA 4RS5B 5IK4A 5KR7A 1RWDA 4XDPA 5LZ6A 5C8CB 4RSUA 1JXNA 3USSA 2ZGOA 3WHUA 4YSFA 5LEJA 3VBSB 1QQP1 2RS13 4FQ4A 3SMHA 2QUOA 2NP0A 4IGQA 5JZGC 3AVRA 1B09A 3CL1A 3MFAA 1LODA 4GA9A 4M3CF 1YJLA 5G05L 2Z5WA 3WUDA 1SBDA 2WZR2 2VC9A 1F4HA 5LK5A 2JA8L 3E5UA 3K3OA 1XNAA 4H7MA 3NSTA 1TMF3 1F2NA 2ZABA 1W04A 1NCRB 3MLLA 4WVMB 1V0AA 3E6DA 3T08A 2A6ED 4YVWA 1JOJA 2NN8A 4MLOA 4DUXA 3SCGA 2IXCA 4HPKA 1YQ6A 1HLCA 1A8DA 2KR2A 3CZJA 2CWMA 4Y1VA 3GTPL 4BK4A 2ZKNA 2ZHNA 5ABJC 4XTPA 5FZ4A 3VZKA 4BQWA 2HWB3 3LF7A 3PIP1 2Q4SA 3S5QA 4YZ4A 1PIV2 1RYYA 3J8F1 1F5FA 4XILA 1TE1B 1UU5A 1VMHA 5FZCA 4UOJA 2ZGTA 1YFYA 3AJZA 5K2ME 1I5PA 5H9PA 4N53A 3MPBA 1FV3A 1PO11 1RB9A 2HWD1 2M4YA 3C8XA 3DUIA 4LTAA 4TYSA 3KYXA 4JGZA 4Q1RA 1HW5A 3OGJA 1S30A 1OOPA 5IP9L 4YZ3A 2VGDA 1HRI3 5KHGA 5CZKA 4BQ4A 1YUDA 1RUE2 3AXDA 4MGKE 4JGYA 2AH2A 2ZGRA 4NOTA 3J26N 1B35C 3PUAA 1R1A3 5DUXA 1VBA3 1B2OA 1Y43B 4BPZA 3JD72 1D4M3 4AEJA 3N36A 5FMDA 3BPSA 4IETA 1JZ4A 4C0HA 4B29A 3CJXA 5DMYA 4QPYA 4QGLA 2OQ6A 5FUNA 4EN8B 1NXD1 1PNFA 4BQ3A 3VKNA 3ZLIA 4W6YA 1XRUA 1K5MA 2BP6A 3T3YA 3C7GA 1OXCA 1SHWB 4P02B 1DYPA 1X9TA 3LOIA 2DCZA 4AQ2A 4DEVA 2B9UA 3KYVA 2DDUA 3FUQA 4UY81 3K46A 2ZMLA 4JX0A 4AVVA 1RDVA 4DQAA 1LESA 2BJSA 3MGUA 3IPVB 1BCXA 1RUC3 3GJBA 5LA9A 3VV1A 4AVSA 4CRQA 4XJ9A 2GAUA 2BU9A 3AYEA 2ZEYA 3K2OA 2CDOA 4GWMA 4XJWA 3RG0A 3VUOA 3RZTA 3RZDL 1O5LA 2XPJA 1S2KA 1H1IA 4XZUG 2WN2A 2JE9A 3ACIA 4Q4V2 3VD4A 4YM3A 2P2KA 1BZWA 1HV0A 4Q8LA 2UWAA 3ZMOA 5A33B 4PBPA 2R071 2ZCWA 1ZZCA 1A6CA 3OUHA 2VMGA 3O1RA 2A6ZA 4C3JL 5A3MA 3V0BA 2ZOEB 2JDAA 2R1BA 5IYCL 4M0NA 1R1A1 3I3MA 1X7NA 1J3PA 3MZHA 4JGZC 1ZBA2 4Y5SA 4KH9A 4LBOA 2Z3QB 1V6LA 3HWJA 3VZMA 4OHVA 2K0GA 3PVBB 4Q1PA 5EPAA 5LCWL 3ECQA 4UYBA 4D6RA 2AREA 2Y64A 1LOAA 3OCPA 3RYKA 1R1ZA 3ZFGA 3H8RA 3WY6A 1HQNA 1S0GA 1JODA 2VZUA 4B1LA 4DUVA 1VZHA 2OA2A 1OKQA 4RN5A 4QX0A 3ON7A 5LBFA 3WP6A 5MFZA 2RJ2A 1S0BA 3WX5A 2PMWB 4Q8KA 5A3LA 1I3QL 3OD4A 4QPGB 3QH7A 3BOPA 3WNLA 2O0OA 5HCAA 4OUMA 1TME1 1XYPA 3JCIA 4E4SA 2KN9A 3DYOA 1QJY3 3VBUA 1RYQA 2VMDA 1US3A 3ZFFB 4BJ0A 4BBSL 5C71A 1R092 2WIIB 5LASA 3POSA 4A3GL 2DFBA 3W5MA 2ZXQA 1RHI2 5EYYA 1ND3B 1FOD1 3AJYA 1ZZ7A 2QDNA 2ZGUA 3QBQA 3O1MA 3NJZA 2GP5A 2P17A 5C70A 4YG3A 3DPRB 5CFCA 2VMIA 1UL9A 3HOVL 5JPNB 1IS3A 5JUVA 2JX9A 4KL1A 4NAOA 1BMV1 2VTXA 1PFWA 2VECA 1W8FA 3LDRA 4HOOA 4JDNA 4PLOA 1L3JA 2QQOA 2WRAA 4LOTA 5JXHA 2RDSA 2NZ9A 3PLQA 4ZONA 3I49A 4FOYA 5A3UA 2E31A 1FV2A 3VZNA 2WNVA 2WL1A 1XE8A 1UXZA 1YJKA 4QPIA 4YW4A 3KF3A 5KXEA 4GD4A 4QM8A 4WZCA 1HV1A 1YFXA 4HK9A 4ONUA 4QGMA 3SISA 4ARXA 5LK7B 3KCYA 1XPWA 3CIHA 3VB9A 1OHFA 3C7FA 3CF6E 3AP7A 1KFUL 1VRBA 3OG2A 1JZ2A 1BXHA 2PN5A 2DCKA 1IG3A 2DVBA 4RFRB 1U12A 3MYXA 3NAPB 4N90A 4E4HA 3LFIA 1QQP2 4B1MA 2WYSA 4A3LL 1C5IA 5GZDA 2A73B 3DXTA 4K21A 3O1SA 3WW1A 4FFGA 5DM71 3UT0A 2VVFA 1W3VA 5J98B 1PFUA 5IY0A 1J84A 4I0WB 1FHHA 1Y9GA 1ENQA 3WW3A 2D7FA 2I2SA 4UFLA 3E6CC 2DYCA 3UETA 5FK8A 3FBYA 2ZGNA 4IEYA 1WUVA 1OT5A 4PBOA 5EXOA 5JR7B 3VBHA 2WNUA 3VDAA 4D69A 3W5NA 1YHFA 1QMJA 4O7XA 2YC2A 3J9SA 2WQ4A 4XPVA 4UF0A 3RPQA 5JI9A 1AUYA 1G9BA 1I6HL 3HOBA 1IHMA 1OUSA 2JXAA 4PI0A 4FOWA 1DGRN 2VR4A 4MHRA 5FXVA 4AEDA 2WZ8A 4CUCA 1STMA 3B02A 2AQCA 3KV6A 4LULA 1JBCA 1PO12 3WVJA 2HWD2 2WUHA 3M3YL 3GTKL 1DVBA 4LORA 1POV0 4MO3M 4NPMA 4CXYA 5GLWA 5GZFA 4RGAA 3WWLA 2RMU1 5BPXA 1UCXA 1WCKA 3NNLA 2JEMA 5T5PA 4CUAA 1R0GA 4LBLA 5JVVA 3BKZA 2QQMA 4FP2A 1W6QB 4Z2WA 4A3EL 3KLSA 4HLTA 1NZIA 1REEA 3UESA 1VAVA 3EB7A 4KWJA 2PHFA 2W68A 1WWYA 1RUD1 1XXNA 1GZWA 1HB2A 2PTMA 3ACHA 3B69A 4M4RA 3ZYJB 4AEKA 5SV5A 5BNOB 5FXZA 2Q1ZB 1QIQA 4GB33 4AXOA 4CCEA 1US2A 4RQPA 1BQPA 2KXLA 3J7LA 5BNNB 1RXFA 2XVGA 4Y3OA 3VHOA 4LKEA 4AAPA 1NE6A 1UQXA 4AQ6A 1IPJA 3MLKA 1AR71 2XJTA 1GU3A 4FPEA 4BY7L 2JIJA 2UYAA 3O0XA 3PU8A 3MIDA 4N7UA 4QXKA 1LU2A 2VNVA 5FZ8A 1DFQA 2C4XA 3PJQA 4LUMA 4V196 1BEV3 2BBAA 3S5AA 4COZA 1W8NA 2XDVA 3MEPA 4AWDA 3WG1A 5DG2A 1S0FA 4C0BA 2VMCA 2K2DA 1KQRA 4CUBA 3H0GL 4AHYA 3WG3A 4EN6B 2HBTA 2ZMKA 4FI9A 4PQQA 2BBVA 4Q4Y1 3BN6A 4NRPA 1AX1A 4Q26A 1LHVA 3A7QA 1WW4A 5FYUA 4DPNA 2CAUA 6RXNA 3WCSA 2IXHA 4DXRA 4PLMA 3M3OA 1AJKA 1MS4A 2OUJA 2GMPA 2R072 2WS93 3OEBA 1XNTA 4XUQA 3AXEA 2HYKA 4XF4A 3WNXA 4COWA 2OXBA 1QHDA 2JD4A 2C9KA 3B5LB 4LO4B 4NAMA 2Y6HA 3TEXA 2OQ7A 3N9LA 4WBBA 5FPVA 5GLVA 1W0NA 2YDEA 4D7YA 4DXZA 5JMCA 3PDQA 1ZZBA 5CFDB 1OQEA 1RUJ3 4EV0A 2P6HA 3T1LA 4AFAA 1H8TA 1CONA 1IPSA 1YCIA 1R9TL 1JHNA 4R9BA 5A3OA 3HKZP 3RMYA 5CAZA 4GZ9A 4IE6A 2UURA 4FFFA 1UZYA 1QJU2 1WZXA 3GZAA 3T2PA 3NKTA 2HWE3 2ZGMA 3MLJA 2OKXA 5BNOC 3C2UA 2FZ2A 4NUBA 2M4VA 4XF1A 3POGA 3AKSA 4RQPC 4GMP3 4FOQA 1L7QA 2FCTA 2W95A 3ZXJA 1LOEA 1TME2 4GQ7A 3M3CA 1YI7A 3NV3A 3CHXA 4PT6A 3B93A 1C5HA 1IKPA 1HRV3 2Q5TA 5A6XA 5A3PA 3ZIWA 1L7LA 4A44A 1VLNA 1ZRCA 2UY8A 1FOD2 2L0ZA 2DV9A 2ZACA 5A80A 2ERJA 1CAVB 5G04L 4Y26A 5F3IA 1BE7A 4IV1C 1UY4A 4CA9A 3M3QA 3MICA 4BQ5A 1BMV2 1AYM1 1RGSA 3KMHA 3AP6A 1PVC3 1AYN1 2OT7A 1H6XA 3FKIL 2QQJA 3OY8A 4QU1A 4SBVA 2RJKA 2YYOA 4X6AL 1EAH1 5AC91 2W08A 3GBWA 2WBKA 1R081 3P6BA 3KWVA 4QM9A 4DY3A 2ZGSA 4TLFA 1UZZA 2IXKA 5CVRA 2HWF1 3BALA 4IEOA 4LLOA 2ORXA 4XFIA 3V0AB 2PAKA 5GAEc 3PWFA 2NYYA 3HOXL 4BBRL 1N3OA 4K7JA 4UAPA 5EWSA 4BH9A 1YK4A 1EUTA 5LA2A 5L7OA 4GKYA 5D8AA 2E6VA 2RV9A 3DXUA 4UW5A 5MF6A 4XUOA 3VZLA 2YUEA 5EHDA 5JR2A 1A34A 1VMFA 5IAVA 4AR4A 4XFHA 4IGOA 5J09A 1XJAA 5C3RA 3HAXC 5JXIA 4K20A 4YYOA 1T9OA 3H8OA 1Z0HA 1AR93 3N7KA 2KM2A 4R9DA 1QJX1 1QNYA 4PDWB 4YWAA 1GWMA 1NNQA 1NXGA 1H30A 2IC1A 1VBE3 4Y4YA 4YFZA 1O3TA 4D94A 3JR7A 2Q0AA 4QXHA 4P5YA 2R6QA 4NIAA 3D82A 3PO2L 1AX2A 3M8LA 4XZPA 3I7DA 1KXGA 4GIQA 2F6BA 2R32A 4W8JA 4H2AA 1WCQA 3KHBA 1ZRDA 3WNKA 1VP6A 2EICA 4AQTA 1CPMA 2CYFA 2RVAA 3S7IA 5FP3A 2PPTA 5FPZA 1X36A 1GWLA 2A71A 3WQ1A 3ZSMA 3DL3A 1Y1VL 1S0IA 2VCCA 1YEWA 1RIRA 2AGSA 2HEVF 1OVPA 2RMU2 4Q4X3 3UKTA 2TNFA 4DXTA 1UXXX 1BVP1 1W0OA 4O61A 1QH6A 4XFCA 5JVG1 2PLV3 1W28A 1JI6A 1MVEA 1S2BA 3EJKA 3MI8A 5E6HA 4YW7A 4ZXEA 5JSPA 2P6CA 1C4RA 3IB3A 1RUD2 4QKBA 3D0JA 5FLHA 1VBD1 5IYYA 3RZZA 2DVFA 1SDWA 3ZR6A 2XUEA 3WLUA 3T4HB 4KU7A 3HQUA 4B7KA 3VBRB 1HKDA 1VBB3 4FPGA 4CCNA 1ZZ8A 3AZWA 4A2UA 4LBMA 5ISLA 4Z92B 2NMOA 2VQ0A 4LK6A 4AQSA 3HQXA 1AR72 2UWCA 2W91A 1PMHX 1HJFA 3IDEA 5KXDA 2MEV3 5FYBA 4LLFA 2A6VA 2WINB 2BVBA 3KT7A 1HB4A 2BW8A 3FLRA 1RITA 4FPOB 5DAXA 2R1DA 2XWJB 1LULA 1DLLA 3S1NL 2AEZA 4HSJA 4L92A 2ZGKA 1JZ6A 1O3SA 2JA7L 2RE9A 4YNIA 4IDZA 2RS32 1OSGA 3PUIA 3B00A 3WCRA 4Y5Z0 1D7PM 5D21A 3WF4A 2W92A 2WZR3 4ZKTB 3KV4A 5IVFA 5A1FA 2WO7A 2PQQA 2RG4A 1U0AA 1V6OA 2VUCA 1BQ8A 2D5HA 2V3BB 3K4AA 4AI8A 4MGZE 1D0HA 3K75B 4Q4Y2 4CDWB 2EXKA 2Y6JA 2JE7A 2ARBA 2WABA 3EHKA 2DCJA 2QQLA 2BQPA 3LNLA 4GH4A 1LHOA 5K0UC 2IXJA 1T6GC 3A44A 1LOFC 2C9AA 4JKMA 2W0XA 1PIV3 1W9FA 2GN3A 3I8TA 4OYUA 3D0SA 3L2YA 1BK0A 1SMWA 4EWAA 3ALQA 4TXWA 2VUAA 5A32A 3J7MA 2XVLA 4YZ5A 5I0SA 3IDBB 4HANA 1EPWA 4P08A 3THDA 2AYHA 3V65A 3WUCA 4LA3A 4D0QA 1NCQB 5EIYB 1SLCA 2JG8C 1XYNA 2DFCA 1AL21 5JXGA 5J96B 2BZDA 4BISA 1J59A 3RI8A 1RUE3 1AXZA 1NA1A 4IW3A 4EN7B 3VBFB 2BOJA 1TVGA 3VBRC 3PKIA 3VDDB 3N9PA 4KGGA 3JD73 4LBNA 3T09A 2ORZA 3O1PA 1UYZA 4CDXA 1RTVA 5GLTA 4QDQA 2Q8EA 2E2IL 2GMEA 2XH6A 4RR3B 4ASKA 4X6RB 1OH3A 2VULA 5FMOS 3RRDA 2VOWA 2VUDA 3VBOA 2SBAA 1QYBA 3CQOA 4Y22B 1SEFA 3GYDA 1ZX5A 4OUEA 4DB5A 3QOPA 5BNQA 3WOGA 2C5DA 4ASLA 2RFKB 1Q8QA 1ULOA 4QX2A 5SV8A 3LWRB 3MIGA 4WM7A 4Q4W1 3BI3A 3I4ML 1RVF1 1AYM2 2ILMA 4I3PA 4YM1A 5DAWA 1AYN2 3M3IA 5IATA 3ACLA 4XXAA 2Y33A 5FZHA 5FAXA 3PO3L 2QZ3A 2XLFA 4LITA 1EAH2 3U4SA 5AC92 5J48A 1OFNA 2DF7A 4ARYA 2BWCA 2XL9A 1R082 2ZAHA 1LGBA 5E88A 3ZYPA 1UO9A 4Z82A 3GALA 4U36A 1NYWA 4M3CA 3U14A 2QQPA 2HWF2 1I3HA 3B94A 5H9SA 4Q4V3 1ULPA 4C8DA 1LHNA 4E6YA 5GJ6A 3CNAA 1SPPB 3FHIB 4HZFA 1W6OB 4G9SB 4JQTA 1OPOA 3T0AA 3U0ZA 4XHBA 1JS9A 3VD3A 4ZXKA 3HMYA 4A3DL 3C7HA 2P3KA 5FYTA 1BYHA 4YVSA 1CGPA 4DOUA 2YC4A 4J1XA 4TN7A 2ATFA 1ZBA3 2LUWA 3I2IA 5C3QA 5FOJB 4U671 2BDRA 5A3NA 1QJX2 4FSJA 4OQ8A 1NA1C 3KV5A 1U5XA 1YRZA 3HQRA 3PUQA 2LALA 3OUIA 4UT5A 1NXEA 3LA3A 3GTOL 5IAXA 3O1VA 3WD5A 3KB5A 2EVXA 5DXDA 5C6CA 5DG1A 1ZZ6A 2J1TA 5EFUA 1MR5A 4IE5A 5C4XL 1GR3A 1ULCA 4LO7A 1WMDA 4WM8A 2JG9B 1W05A 4CDXC 1RUI1 2Q8CA 4DINB 4XMAA 2J1EA 5E16A 2XWBB 2FDIA 4P9GA 5FUIA 4WVVA 3QACA 1FPN2 1R093 3ROUA 1UIKA 1YI9A 3PNAA 4YM0A 1DZRA 1RHI3 4WM7C 3SKJE 2RM21 3TOJA 2GC1A 2R0FA 2J22A 1CAWB 4IV3A 4O9GA 5FP7A 4YWMA 2XXZA 5CISA 4N43C 5FWEA 3JQWA 3PU3A 1WMXA 2RDNA 1DGWX 2D43A 4R9AA 3TN91 1IZ3A 3E5XA 4HG6B 4QX7A 3D4KA 4I2OA 2DTYA 4OHZA 4S2HA 4AR2A 1ALYA 4AZZA 2VH9A 4NWVA 2A6HD 1BBT1 1VBD2 1ZBE1 2EIDA 3JZVA 1OLQA 4FPFA 4E2QA 4DZGA 2D3SA 1F8VA 2VZPA 3GZTB 4BLJA 1OQDA 1CAUA 4ZU7A 5F5CA 4CDQC 1QEXA 1AF9A 4CZSA 2UY9A 2GC2A 3NL1A 2BERA 4YGBA 4BM8A 4BY1L 5F2SA 1DX8A 3AMPA 1DIWA 3OGGA 4COVA 2PELA 2C6BA 3ILRA 2XUMA 3LGRA 5KHHA 5H9QA 3UGGA 1TWAL 1W9YA 2VE1A 1LKNA 4CEWC 1QQP3 1OBNA 2D40A 2OPWA 1OURA 2ZA9A 4XEZA 3RVHA 4P9JA 4FPKA 5DUUA 2HYXA 2WLPA 1UIJA 3SXWA 1XC6A 2UU8A 1OC1A 1RUF1 2J1SA 4URTA 5EJ1B 3WF0A 3SITA 4LIUA 5FY9A 4NMIA 1W2UA 4FXKB 4PCRA 5FQ0A 4XFFA 4META 1DQ6A 5FYMA 3WP3A 3LPGA 3VHNA 1WMFA 5FYHA 4LBQA 1SLBA 4YARA 2HJIA 4CP9B 5IVJA 3LWVB 4ZHNA 2VCMA 3SKVA 4C3IL 1RUG1 3T4VA 1LNSA 2XG3A 2IVIB 4RYDA 4I0BA 3H0OA 3QH6A 4KU8A 5FLJA 4FAHA 3S16L 1AX0A 3BODA 1JYIA 4A3ML 2WA4A 3NW4A 2ADEA 1CAAA 5DN2A 1SFPA 3I4NL 1GP4A 1B35B 1PO13 2ZZQA 4PJYA 2HWD3 4ZS3A 4CCLA 3KT4A 1UU4A 4FO9A 2CR8A 1PM7A 5EINC 1CJPA 4Y20A 3RZMA 4ZZ8A 5AVPA 1A8MA 3ELNA 1AL22 4CP0A 1K5JA 5C3OA 4QX8A 2WFPA 2XJSA 2CTVA 4MGSA 1T2XA 1SMMA 1PO21 2JKBA 3H9BA 3AKPA 3DECA 5KXCA 2D6KA 4JQRA 2VW0A 1U5YA 1R0IA 1U5ZA 3USUB 1UOJA 2CGOA 1K12A 5HBAA 1V6NA 2BYVE 1D0GA 3CKHA 5APAA 1YUZA 5FDBA 4NVPA 3RWNA 5LA1A 3GDBA 3O1OA 4S2DA 4KWUA 5FMBA 2B46X 3PL0A 5KC5A 3QLQA 5FZ7A 1QDOA 4K6BA 1EPZA 1LGNA 1MACA 2A3XA 2X10A 2DUOA 2D3PA 2WJSA 4MX3A 4GAZA 1VB4A 1PMJX 4Q4W2 4AF9A 2Q1FA 4P9WA 4CE8A 1RVF2 3JBG1 4RS5A 1SFYA 1VCXA 2JDYA 3WQ7A 1B71A 1Q8PA 1GNYA 1U5IA 2VBDA 5LY2A 4Y1ZA 1POV1 2V0EA 2BGCA 5T5JA 2D93A 3ACFA 4N53B 4XFGA 3GZUC 5FZLA 2VW2A 1UW8A 1HB1A 1NKGA 2F4PA 3HN1A 4Y1UA 3SEEA 1H2NA 1UY1A 2BNOA 3FHAA 4JGZB 3WG2A 1NLRA 1T9PA 1NCRA 2AACA 3ZSKA 4WVMA 1B2JA 5HCFA 1YWKA 2R073 1DZTA 5CA6A 2NVTL 4M4PA 4HETA 3WT3A 4DFSA 1G9AA 3FDJA 2QZ2A 4HBNA 3F2ZA 1O4TA 1DQ1A 3C7OA 4LE3A 4FBFA 5J3UA 1E5IA 3PVNA 1KITA 2C24A 1XNCA 4CCKA 2GZWA 5DDJ1 1WLWA 1BK1A 3ZN4A 5HV0A 3ZVXA 1QCVA 4EWEA 1O4YA 1K83L 1PFVA 1BVVA 4K9FA 2HR5A 3ABZA 3IM0A 5C5UA 5FJHA 2R7EB 5A7QA 1OA4A 2MHFA 2R061 3AMHA 4QXBA 4AK3A 4BQ2A 1RUI2 3ZYFA 2VTFA 3ZPYA 3NMBA 1TME3 4FT8A 2Y0IA 4CXXA 3C7EA 4NHMA 4KGQA 4CEYA 2OVUA 4QX3A 2J7MA 4XDQA 4YVWC 5I0UA 2DURA 3SH5A 4DUWA 5JWPA 5H9RA 2VMEA 1FOD3 1SG3A 2VNOA 5E89A 3IAPA 3VZJA 2RM22 1XSRA 4HONA 4J25A 2HVYC 2QFEA 2ZGLA 2IFRA 2X5IA 4XUNA 4Z1VA 5FXWA 5B4NA 4E4DX 1YV1A 2ERFA 5GZCA 1YQ5A 4LO5B 1GQGA 1QOSA 5C5TA 5LW9A 2DVAA 4AR6A 4A41A 2BTVC 3TN92 3TNPB 4QHOA 5DZFA 1RJ8A 4N53C 3KHCA 1W2AX 1GKBA 1G7YA 2RHPA 2DBIA 1VAKA 2JICA 3ZDVA 3KM5A 1M06G 4NIGA 1BBT2 1ZBE2 4IEVA 5FREA 4A3XA 1OOPC 4ES8A 4F8AA 2CWSA 3BUCA 3B01A 1REDA 4KG8A 5FLIA 2ZX2A 4XETA 3A0KA 1REFA 1WBLA 4MOAA 1RUNA 4QMAA 2QBXA 3CDZB 4JGYC 4JKLA 5FUPA 1BHGA 3FC0A 1OA3A 1QJU1 5AI3A 1O91A 5L19A 1IPKA 4XBLA 4YW6A 2Q30A 3OGSA 2P3IA 5A33A 2A69D 1O3RA 1S0JA 2GNTA 4Z07A 2PFWA 1KFXL 3H3ZA 4LE4A 2RS51 4QB2A 7RXNA 4XABA 1K5MC 3I59A 1F9KA 2A68D 1AXKA 4XJ8A 3UL2A 4D6QA 1RUF2 5FZOB 4PIXA 1UKGA 4AI0A 2UYBA 3K51A 2G4IA 1Q43A 1QGLA 1FAYA 4IGPA 1OFSA 1H6YA 4OI4A 3ZKUA 3JB4C 3LIGA 4BQXA 4DRRA 3GBFA 2WO2A 2RJLA 3OPTA 2B45X 1K3IA 1OLMA 4CEYC 3MUZ1 2FMDA 5DUVA 4CCMA 4AR5A 1LKOA 2NYDA 4QPGA 1XBFA 3OBRA 5EJ3A 1RUG2 4CCDA 4V1PA 5FWJA 1TNFA 1W9WA 5CKMA 3ZFFA 1BLZA 4FCAA 2EIGA 3FL7A 4BXXL 2AC1A 3HJYB 3LWCA 2E53A 1ND3A 2FZ1A 1MVQA 4K8FA 4XXBB 3A4UA 3WDWA 3E5QA 4A3JL 2RMU3 2JB4A 4JVAA 5FLML 4JRLA 4K40A 3SCHA 2GU9A 2QE3A 1MZ5A 4P14A 2E51A 2RR11 3VD5A 5HI0A 1PO22 5T50A 1HXS1 1RUD3 1W8WA 3PL5A 4QHBA 4B4PA 5CEHA 1V6JA 4QAWA 4XMIA 4IL7A 2YHJA 3ZFGC 2PVXA 3CMGA 1I50L 4GS7D 1UX6A 1B13A 3LAGA 3U07A 2JECA 4HVQA 4MXWB 1WW6A 4XC9A 4FAGA 4OHYA 3TAYA 2QCSB 4KI5M 4QQHA 1AR73 4XBQA 5IVEA 1H8VA 1TG7A 1ACCA 2IZWA 1QJEA 4NHXA 1TWFL 3GTJL 2YFUA 1ZVFA 3GCWA 3VBUC 3BGAA 3SEPA 4BIFA 4Z2AA 3JBG2 3K4ZA 2GN7A 3ME2A 1APNA 2YROA 5FZFA 4G6BA 3NAPA 5A7SA 3SCFA 3ZYGA 3N3HA 2F4LA 5CFCC 1MQTA 3T1MA 3MV11 4AVCA 1CN1A 3PTRB 2WAQP 4Q4Y3 4LMFA 1Y3TA 3FJSA 3RDIA 3TB0A 4P9IA 2PQSA 3GJAA 5LY1A 3GTLL 2WNVC 1CX1A 2XJPA 4FTEA 2A7AA 1V70A 1G86A 1F4LA 2GC0A 2W52A 4I02A 1RINA 2CU5A 4QPIC 4TSVA 4A7ZA 4XF9A 1UAIA 3OSDA 1WBFA 5IK7A 5FKCA 4I0AA 4LUKA 5FY7A 1QNWA 5C44L 5M3ML 4YFWA 3I2GA 3FFZA 2PXJA 3KD4A 5DDJ2 3VDCA 4BDVB 2R041 2VZRA 4RQPB 5C9AA 4Q27A 1PMIA 4E8DA 3SNMA 1FYUA 2VTXJ 3MFCA 1O8SA 1TZOA 1C8NA 3ZG6A 1RYTA 3D3AA 1NAEA 2W5FA 5DZEA 1NX9A 4D3WA 2R0HA 5K7PA 3Q9OA 1UZWA 2R062 3LDKA 1NY71 1UZ0A 2PHXA 4IQPA 1W6QA 1CAXB 4Z8BA 4IV1B 2CDPA 4RFT0
chains in the Genus database with same CATH topology
2RS31 2VOXA 2ZZJA 1C1LA 3FLPA 4AEMA 1MEC1 1ULFA 5FO7B 1GLHA 4XQ4A 1PGL1 2ZTNA 1V6MA 3X29B 1QOOA 5CIRA 4JDOA 5BNNA 3FZ3A 3VBHC 1VALA 2WNUC 3IWZA 3R0RA 1CVNA 4Q0PA 4XYXA 1UN1A 1GZ9A 4IEUA 1GNHA 1C28A 4AI3A 1DGLA 1IU6A 2ZS6B 1AYM3 4QU2A 3LKJA 1W0PA 1ZYBA 4ME3A 1AYN3 1MQTC 2V09A 4YW5A 4XFAA 4AEDC 1G9CA 3DGTA 1EAH3 5AC93 4GULA 4JCKA 4RL7A 5FMOL 1R083 2A3WA 4UW6A 5GLUA 3PKJA 4XXPA 4CYDA 2HWF3 3BCWA 2LCQA 1ND2A 1H8TB 1SBEA 3ZXLA 4L11A 1N1VA 3PHMA 3T2TA 1DG6A 4AVAA 1G6NA 1ULGA 1XE7A 1R0JA 5GM0A 3WDUA 3ZXGA 1H2LA 4L8QA 3BB6A 3GHMA 3HBZA 4YW1A 3ZMNA 2RS52 3VN4A 1FX5A 4K1YA 1SLLA 1QJX3 4WFN1 1YNAA 1KJLA 5CFDA 1JUIA 4NHLA 5BNPA 4K9SA 4NN0A 1F31A 1MZ6A 3EO6A 2TBVA 1OLRA 5AFBA 1M4WA 1HQLA 2CY6A 1BQ9A 1LOBA 2XHKA 5IT6A 3PVEA 4JRAA 3WR0A 1VAMA 1N3PA 4H3WA 2I74A 3TYJA 4JAFA 1PGSA 5KHKA 2D6NA 4FXGB 2D6OX 3K48A 4ISQA 3QD6A 3I4IA 4H7LA 1XQNA 3I54A 1CAVA 4DS0A 3B9CA 1KS5A 1LGCA 2HEYF 3GNEA 1IROA 3DF0A 2EXJA 2EAAA 5D8AB 2PAMA 5I0RA 2WFF1 4FVVA 1EP0A 2RR12 3FBMA 1DQ5A 1N3QA 1HXS2 1ND2C 3ZXKA 1H8TC 1VBD3 2XKPA 1MS3A 2D98A 4XFBA 5FPXA 1UMZA 4OI0A 2EAKA 1S55A 2C6AA 3PVOA 2E7TA 1KS4A 5I0TA 3DV8A 4W65A 1X50A 2JJ6A 5AI2A 3P3NA 4ISRA 3LB9A 3VHRA 3AK0A 2JI3A 5T3NA 1ZA4A 2X8KA 2X53S 5L73A 4HKOA 3HT2A 2E9QA 3VGIA 2BE5D 3M4FA 1S0DA 1GNZA 1FPN1 3TBDA 5BNPC 5K0UB 1PGW1 1UU6A 1H1AA 2TEPA 1IGOA 1LU1A 4R4XA 4PDWA 4G4FA 3MDPA 1W6PB 2MNGA 3WV6A 4EJRA 3AYAA 2GNMA 3SLIA 2E7AA 1KJRA 3CU7A 3MIEA 2AR6A 1WW7A 4XE9A 4HMZA 3ZXFA 1VJ2A 2JG8B 1EV11 3MIBA 2IXLA 1HQWA 1RMU1 3ZN6B 4S2FA 2DCYA 4B4QA 5L7OC 1LEDA 2FQPA 2R042 4I3GA 3ZN5A 5D8AC 4OFGA 4HKLA 4KWKA 1VRH1 4XQWA 4LNVA 1JYBA 2XLAA 1AL23 1Q5OA 1ODHA 2VVEA 5BUVA 1QY4A 4ASMB 2QDRA 4YM2A 3NWKA 1NY72 2YGMA 2WT2A 2EA7A 1DDLA 4O9EA 2NPIA 4BZ4A 1H1MA 2ZKLA 1S24A 1MEC2 2NMNA 4RD7A 5AFEA 4KBBA 3U10A 2P3JA 3PMSA 4N9HA 1PGL2 3FE5A 4J1WA 2Z2SB 1LECA 4POGA 1RUOA 1GV9A 1MS0A 4XOGA 3AYDA 3VPBE 4Q4W3 1G9DA 5FCCA 4AVBA 1RVF3 3ZIXA 3N4MA 4Q2FA 3WP5A 4BMEA 1QXJA 3IN9A 2M6PA 1JTZX 2ARXA 3H1YA 2NLRA 2CV6A 4R52A 3MPSA 1C3HA 1V6IA 1PZ9A 4C1XA 2ZGQA 4AW7A 5MFPA 1AR81 1SCRA 1SLAA 4AYUA 1N1TA 4Y24A 2MPFA 3O5SA 4FQZA 3WG4A 5FO9B 5KBFA 2WT0A 3WW4A 1NE4A 1RUH1 3AX4A 4Q0UA 1NA1B 4YW2A 4JAAA 3THTA 1XU2A 2PSMC 4TWTA 3KYYA 1AHSA 2DTWA 3G7DA 4CDXB 1SMVA 1ZM1A 3RJRA 2QNKA 3BPZA 4BWOA 4QT6A 3VBOB 2ZX4A 1X8MA 1KDMA 4MXVA 5ACA1 2K9ZA 2GMMA 4IEZA 1SACA 1NCQA 4HL0A 4W6WA 4M00A 4WM7B 1XU1A 5J7MA 3ST7A 1RUI3 1W6NB 2G9FA 1ONAA 3AP9A 2ZHKA 3FWEA 1C57A 4IXLA 3VBFA 3APBA 1IU5A 1ENXA 1W6MB 4N43B 1Z92B 3VDDA 1URXA 5D1IA 4RR3A 4R9CA 2RM23 4GH4C 2GDFA 1D4VB 5BYNA 1NXMA 2JDZA 2ET7A 1YFWA 3E6BA 1BKZA 2WQZC 3EBRA 1FT9A 4S2GA 4Y22A 5JLVA 5KHIA 1PK6A 3TRSB 4CDUA 1A78A 4MH0E 3TN93 5RXNA 1AR61 2PAEA 4CDQB 2VL6A 3ZFEA 3FUOA 3V56A 2WFF2 2WT1A 4X8NA 1JYCA 2LTNA 2QJVA 3TNQA 3UJOA 1BBT3 4W6XA 1ZBE3 4H55A 1UD1A 3UV9A 4AFMA 1RJ7A 2VG9A 4CEWB 4NO4A 5JSRA 2R30A 3OJBA 4AFBA 4BQ1A 1V9U2 3D5OA 4FTSA 2H0VA 5EV7A 4WM8B 3VL9A 2VXRA 1OPMA 4KG0A 3ETQA 4LEJA 4HK8A 1E8JA 3VBOC 2XJRA 4FOVA 1Z7S1 1PGW2 2DWRA 5GZEA 1RUF3 3R4UA 4INDA 1QJZA 5KHJA 4GMP0 2A6XA 3V64A 3POYA 4F83A 5DUWA 1IS5A 1LENA 4QQ2A 1MS8A 2ZX1A 1Q8SA 2VMHA 3POWA 4MGIE 4P5HA 4LO8A 3RSJA 5IK5A 4YLZA 3SH3A 2ZJCA 1SQ4A 2JG9A 2HWC1 2JI2A 3H3UA 5B2GB 1RUG3 4XBNA 2BNNA 1EV12 1LJ7A 1DQ4A 1RMU2 1PK6C 4D7SA 2WWSA 2C1FA 1DYKA 1KD7A 4Y1YA 3RYPA 1H2KA 5L36A 3ZFEC 3S30A 2OIIA 1VRH2 3AFGA 5HXVA 4AHZA 3OYWB 4YVSC 3TWIA 4EN9B 2VQAA 2H12A 2GNDA 2I45A 3AP4A 3AP5A 3FX3A 5FFOC 5I8SA 2XBO1 2WA3A 2Q1MA 1PO23 5C8WA 5JOZA 3ZYRA 3UKVA 2KA3A 2Y26A 5C4WA 3MSUA 1YIPA 1RB8G 4HN1A 4WM8C 3RI9A 4DY5A 4QD2A 5JZGA 1O4ZA 5CNAA 4RHV1 1FMD1 3IKWA 1QWRA 4AG4A 2PHTA 3JBG3 1COV1 5FOBB 4F3JA 4BOWA 1C8M1 5LRSA 4N9IA 3ENRA 3CJIA 4IV3C 2D6MA 1POV3 3VKLA 2D5FA 2Z69A 4XW3A 1PHMA 1R0HA 2CNAA 4LBQD 1AXYA 1AR82 1Q8VA 1WLDA 2YPJA 1VBC1 4Y20B 1BFYA 4AHWA 1RUH2 2FMYA 4HT1T 2PVEA 4XIOA 3OTFA 3R4DB 1CQ9A 3H9AA 1YIFA 4YG6A 4Q0SA 1QU0A 3QVDA 5DDJ3 2JENA 2YZ4A 1WD4A 3UKNA 5I8YA 3L9JT 4RA0A 5DZGA 1B35A 3P2AA 3AKRA 5ACA2 4YVWB 2VNRA 4DRVA 3KQRA 4HPKB 4KWLA 2R063 4L9BA 4AFCA 3KGZA 4E9KA 5KC6A 1IOAA 1C09A 1QDCA 4XJZA 5C8CA 2R16A 3ZDSA 2M6OA 1ASJ1 3VBSA 4E2GA 1FI2A 5FRAA 3ZX7A 3KT1A 4QGNA 1YUXA 2H6CA 1CX4A 4RGGA 2K2SA 3USUA 1V00A 4OI2A 4JADA 2CGPA 3WW2A 3ATGA 3IT8A 4HANA 1IS6A 1OOPB 3K35A 1ULDA 2DU0A 1RL3A 2I07B 3CJIC 4I09A 3ZXAC 4CZSA 3SHRA 2B5HA 4XJAA 1AR62 2BVVA 4GALA 4JGYB 2E63A 2XVKA 3QQCE 5JOWA 1LKPA 1OA2A 2ET1A 3BU7A 3OBTA 3LA7A 1O5UA 4LHLA 2XJVA 1QXRA 2BEOA 1NG0A 2LM3A 2YC0A 1DQ2A 5FTTC 2AZ5A 2DCTA 1K5MB 4IEQA 1QJU3 3NKGA 4JTOA 5KWRA 4NPRA 3AYCA 1FATA 2GALA 5MGNA 4XGHA 2BNMA 3KCXA 3OPZA 1LCLA 2B5ID 4OHWA 4TZDA 3VKOA 2RS53 2D6PA 1VZGA 8RXNA 2RS11 2PA7A 1FHMA 2ZAAA 3NO8A 3ZSEA 1Z7S2 4M01A 4CEYB 3ASIA 4AFDA 2VOKA 3SH4A 5HCBA 2Q8OA 3VZOA 4OI1A 4EROA 4RS5C 4POFA 1V6KA 2PHDA 2X5IB 1TMF1 5T5OA 5C8CC 3VBSC 1PVXA 2OZ6A 3LCPA 4B3NA 3IBMA 3IIAA 5LEJA 4Q29A 3JU9A 2ZHLA 3GF6A 2HWC2 1RDGA 2WLQA 3V0BB 4FP3A 3B0AB 2HWB1 3IPVA 5E1RA 1CESA 1XYOA 2DUQA 4E4ZA 5GADc 4MV2A 2ZX0A 1NCRC 3MW3A 2BPA2 3RYRA 1TQ5A 4OZXA 4KNCA 2QKDA 2O5JD 4PF5A 5T55A 4Q0QA 2JI1A 3B3QE 3J4UH 3ZFGB 1LOGA 2WKKA 4BIOA 2WSUA 1HRI1 1GZCA 5GAGc 1H4HA 2RR13 1RC6A 2XBO2 4IEXA 3DN7A 1HXS3 4NHKA 3AKTA 1VBA1 4H14A 3VBUB 2J9UB 3I2DA 3I59B 3KYUA 1D4M1 1SFNA 2DVGA 4L97A 3CO2A 1QH7A 4CTEA 5CFCB 4RHV2 4FTBA 2W39A 1FMD2 2DU1A 2H6BA 1COV2 5JOYA 1EY2A 2YMZA 1C8M2 5F9TA 3QCWA 1RUC1 3NV2A 2WNVB 2X5IC 3WZ1A 2GNBA 4E27A 4QPIB 3O0WA 1R0FA 2D6LX 3JUUA 2QL0A 4M3CE 2Y0OA 1NQJA 2BFUS 1VBC2 3DPRA 1I5ZA 4ZN3B 2PYAA 3WDVA 1OWCA 3AZVA 1MS5A 2FHRA 2WSVA 1WCDJ 5JVH1 3H8UA 3E97A 5CU1A 5H1Sc 4ATFA 3KCCA 3IDCB 1H0BA 2R043 5JI7A 3VKFC 3MPPG 3MF6A 4WZFA 1J1TA 2CL2A 1CJDA 1CADA 3H7YA 4HKWA 4ES9A 3LOBA 3SS2A 4FPCA 1IQAA 3PIO1 4ITCA 3FFQA 5F6LB 5JIAA 3VBHB 2EXHA 2WNUB 4HFSA 3M7AA 5K9YA 4HVRA 2RS33 1ULEA 4K1ZA 1ASJ2 4JC1A 1MEC3 5FO8B 1TEIA 1YXWA 1QJY1 1MQTB 4FPJA 4AEDB 2ZIXA 4N7IA 3RMXA 4MXWA 1EYBA 4AHXA 3G6JB 3OF1A 4B8CD 4QPGC 4ORFA 2AYJA 1J3QA 4J6GA 3ZFFC 4D7TA 1IKQA 1ND3C 2R49A 1H2MA 3L2HA 3WWNB 4I01A 1GZWB 3J8F2 4BLIA 2Z79A 2YGLA 3DPRC 4OULA 2VW1A 2ZHMA 5C9AB 2VU9A 3H1MA 4NWWA 2O1QA 3P8BA 3NFPI 3CLPA 3HAGA 1LTEA 1QF3A 3MW2A 1WD3A 1QKQA 1YLLA 2GH8A 1PNGA 5IUQA 2XGXA 4R8HA 1UF2C 4SLIA 3J7Y1 1BRFA 1DZQA 4QQLA 3B7MA 3U11A 3MIHA 4UW4A 4P9XA 2RS12 2ZPXA 1XNDA 5BNOA 2Y38A 1HDKA 5GKAC 4LA2A 1QXPA 3ZSLA 5CG8A 3M2MA 4COUA 3RNSA 4Y1XA 3ZO0B 2NM1A 1TMF2 2NQYA 4PIYA 3NAPC 4HVOA 1AZDA 1WGPA 3KGLA 1ZRPA 3WINE 4EWDA 2IFWA 3N35A 1SBFA 3J7Z1 1MZEA 1CAXA 4IV1A 2HWB2 1CIWA 3UJQA 3WDTA 3WHTA 2O8QA 2YXSA 2D44A 1DHKB 2B7YA 1SLTA 3S0MA 5K8SA 1ND2B 3HD8B 4X6QB 1G9FA 5BY5A 4JTNA 4MSVA 1WCSA 4BA6A 1WLCA 4FPLA 4MGYE 1VIWB 4IEWA 4QQPA 2ZBJA 1HRI2 1CPNA 3AZYA 2WFF3 1GFF2 3H50A 4XQDA 4C1WA 5C9AC 2N7GA 1E57A 3B08B 4ZU5A 5J37A 1R1A2 1VBA2 3D6EA 4TVMA 1D4M2 3R4SA 4GB31 5CB7A 1F5JA 4B8EA 1NOVA 4CP2A 5BNPB 3KSCA 5E8AA 1V9U3 1ZZ9A 5CBLA 4LHNA 5BV6A 5LRRA 4XF0A 4QX5A 2Z42A 2YV8A 3OY8B 1S0EA 2D97A 3GHNA 1BEV1 5BNNC 3WXPA 4F7ZA 4LR4A 1FPN3 1RUC2 1UKRA 5DM61 1H4GA 2DVDA 1ENRA 3INAA 4B7EA 4L99A 1PZ7A 4YRDA 4ATEA 1UPIA 2ZGPA 5GZGA 3O14A 4HSLA 1J58A 3NV1A 1S1AA 2PYTA 5L7OB 1X8EA 1J3RA 1Y9QA 4YG0A 2WS91 2ZMNA 4BCUA 3HT1A 1EV13 3JB8A 5MLC3 1HX6A 1RMU3 2VUJA 3WDXA 1LKMA 2XL7A 1C1FA 2EF6A 1H9WA 4YGDA 2OW4A 1RUJ1 4AR3A 3GBGA 1VRH3 3V0AA 5GAHc 1V9U1 1O7FA 5AVAA 1T9QA 1SCSA 2HKXA 4KQ7A 1S0CA 3R05A 2IXIA 2HWE1 1YO8A 2H0BA 3THPA 1LHWA 3RS6A 4P9LA 1H9PA 5CFDC 4GMP1 3H7JA 1ENSA 1MS9A 4COYA 1LB2A 2CAVA 2OPKA 1QJY2 4OVEA 1NZCA 4DNYA 2OZJA 1CR7A 3MIFA 4EN0A 3VLBB 1HRV1 2ERSA 1N1SA 1DQ0A 2GH2A 4UBGA 5JOXA 1ZRFA 3O0VA 5JAXA 2PHRA 2EXIA 3VKMA 2UWBA 3O12A 2A5ZA 3RYGA 2VOVA 5I91A 1IW7D 1PVC1 1IS4A 4WVZA 2GSYA 5F6KA 2EALA 1QOTA 2AENA 4OLLA 5K0UA 3BIWE 1LOFA 3N7JA 3IMNA 1I9RA 2DSXA 2B8MA 1AR83 3AMMA 1W6PA 2FBEA 4K3UA 3U4XA 5AN9H 4YZ2A 1Z78A 1X82A 1RUH3 1MS1A 4AVTA 5LEKA 1LEMA 3M3EA 4XHXA 3KZ4C 1OQ1A 3ZXEA 4AGRA 2QVSB 3FLTA 2OUHA 2P34A 2JG8A 4ZU4A 1Q8OA 3EXUA 4OHXA 3ZN6A 4TPUA 1DGRA 1AR91 1KDKA 1WMEA 4BYYA 5IK8A 3VBRA 2V0FA 5ACA3 4C91A 1VBE1 1GICA 3AFKA 1SLIA 3AKQA 5T52A 1J1LA 3ZXDA 3D8CA 2XB6C 3ES4A 4XIKA 4GH4B 5EYXA 1D2QA 4M0HA 4AGGA 4WVWA 1DF0A 2AUYA 4B4RA 2GC3A 2YY1A 4PDWC 5I8TA 2HEWF 4JDMA 2C0ZA 4LHKA 2BWAA 4LO6B 5A32B 2PHUA 3JQXA 1W39A 1HIXA 1I6XA 1VB2A 4MVTA 2V5YA 2X29A 1LR5A 4CDWA 2DUPA 4MYEA 4UW3A 2XJQA 1AR63 4Q4X1 4L2NA 3AB0A 3LSEA 4JAEA 2VY0A 3PTYA 2PLV1 3CEWA 5I93A 4IERA 1UPSA 3IU3I 4XTMA 3O7OA 1GBGA 2WZPP 1ZREA 4GB32 1N1YA 4P9YA 3WQ0A 3EQEA 1FNYA 3ZYIB 2E7QA 1Q56A 1VBB1 3RJ2X 5JIUA 3ILNA 2CKAA 3KS7A 4XJUA 2D3RA 1XNBA 3AZXA 2MEV1 3ZSJA 1A3KA 3URFA 1XNKA 2PHLA 3NV4A 1GYKA 2SLIA 2GMGA 1BEV2 5T5LA 1Z7S3 1DBNA 5BXXA 1AJOA 5J36A 2OYZA 2WZR1 4M3CB 4PQ9A 4CP1A 3M70A 3DKWA 3LZZA 3R6SA 4HN0A 4A7KA 1PZ8A 1WA4A 1OI6A 3PJYA 3KYWA 1PK6B 3A0NA 1O3QA 1FNZA 4CDUB 5JSOA 5EZWA 1W6NA 2HWC3 2RDVA 4GXLA 3ZFEB 2WS92 5KXBA 1NLSA 2B42B 3WDYA 3H1WA 1JUHA 1W6MA 4N43A 4YVSB 1PIV1 4LBJA 4UXAA 3ILFA 5C33A 4YGCA 3FMGA 4CDWC 2KKDA 1YFUA 3AMQA 3VL8A 5GALA 1OMIA 1JH5A 1RUJ2 3LSDA 1DU3D 3S7EA 2TUNA 5CADA 2ZX3A 1Q3EA 2A75A 1W6OA 3RZ6A 2XBO3 5JDBA 2G9GA 2HWE2 1YK5A 1RUE1 1JW6A 4CDQA 1DGWA 1FXZA 1WJVA 2Z3RB 2B39A 2XLGA 1YYNA 3PMEA 3JD71 1NCQC 4FPHA 1LHUA 5EIOC 3N7MA 1ZRRA 4CEWA 1HRV2 1BJQA 4IV3B 4ZN1B 4G3YC 1IRNA 3VBFC 4RHV3 1FMD3 4DMIA 5GLZA 4PIZA 1AVBA 3VDDC 1TNRA 4OUSA 1COV3 4XF3A 4AI1A 1C8M3 4RR3C 5T54A 1PVC2 4GWNA 4YGEA 4UBHA 4C90A 4IEPA 2A3YA 3AZZA 1JN2P 4PLNA 5F5QA 1VR3A 2VPVA 2VVDA 4U2AA 1LRHA 3VHPA 5JCTA 3W9AA 1CAUB 4CDUC 4YZ1A 1VZIA 2V73A 3B9IA 3W59A 1X33A 4Q4V1 1CAWA 5F1RA 1VBC3 1GANA 3BOWA 3MW4A 4RXNA 4BMBA 4GKXA 4E2SA 1LTLA 3W58A 2PHWA 1WW5A 1GSLA 2P37A 4JV4A 1OWBA 2ETEA 4A7YA 4I30A 2WC2A 1ZBA1 5C4WB 2WNEA 3NVCA 5FBZA 2ENRA 2BFUL 3WP4A 1AR92 4BE3A 5FQ0B 2ES3A 5JZGB 2A6WA 1S2ZA 1VBE2 2CKCA 2VNGA 3N7LA 4LBQB 3OYWA 1KRIA 1OD5A 3M1HA 1Y7BA 4X8PA 5JPMB 4LT5A 1ASJ3 4R4ZA 3LA2A 3AM2A 2A70A 2CGNA 3CJIB 4AGVA 1D2SA 4MZUA 1R091 4IESA 4LBKA 3BTAA 3UK9A 5ABJA 2XJUA 1RHI1 3HR9A 3S6PA 5TSWA 4QQOA 2O8OA 2JG9C 3MF9A 4BHPA 1WLTA 1ZNPA 2BUKA 4YWLA 4AE2A 1G8WA 4NR1A 1H7VA 3ES1A 3OD0A 4Q4X2 3C3VA 1N47A 5CG9A 3LPEB 4WV8A 2MS3A 2PLV2 3J8F3 3PZAA 3HIFA 4Q0VA 4MUVA 2XKOA 4YW3A 2IWGB 4JAGA 3AMNA 1SMUA 1I1EA 1MZFA 1VBB2 1CD3G 4AI2A 1GQHA 1LOCA 1NQDA 4FPYA 1AL0G 2MEV2 3P3PA 3RQ0A 5C4WC 2A6YA 4RS5B 5IK4A 1RWDA 5C8CB 4RSUA 1JXNA 3USSA 2ZGOA 3WHUA 4YSFA 3VBSB 1QQP1 2RS13 4FQ4A 3SMHA 2QUOA 2NP0A 5JZGC 1B09A 3CL1A 3MFAA 1LODA 4GA9A 4M3CF 1YJLA 3WUDA 2Z5WA 1SBDA 2WZR2 5LK5A 3E5UA 4H7MA 3NSTA 1TMF3 1F2NA 2ZABA 1NCRB 3MLLA 4WVMB 3E6DA 2A6ED 4YVWA 1JOJA 2NN8A 4MLOA 3SCGA 2IXCA 4HPKA 1HLCA 1A8DA 4Y1VA 2CWMA 2ZKNA 2ZHNA 5ABJC 4XTPA 3VZKA 2HWB3 3PIP1 2Q4SA 4YZ4A 1PIV2 3J8F1 1F5FA 4XILA 1TE1B 1UU5A 2ZGTA 1YFYA 3AJZA 5K2ME 5H9PA 4N53A 3MPBA 1FV3A 1PO11 1RB9A 2HWD1 2M4YA 3DUIA 4LTAA 4TYSA 3KYXA 4JGZA 4Q1RA 1HW5A 3OGJA 1S30A 1OOPA 4YZ3A 5KHGA 2VGDA 1HRI3 1YUDA 1RUE2 3AXDA 4MGKE 4JGYA 2AH2A 2ZGRA 4NOTA 3J26N 1B35C 1R1A3 5DUXA 1VBA3 1B2OA 1Y43B 4BPZA 3JD72 1D4M3 4AEJA 3N36A 4IETA 4C0HA 4B29A 3CJXA 4QPYA 4QGLA 4EN8B 1NXD1 1PNFA 3VKNA 4W6YA 1XRUA 1K5MA 1DYPA 3LOIA 4AQ2A 2DCZA 2B9UA 3KYVA 3FUQA 4UY81 2ZMLA 4AVVA 1RDVA 4DQAA 1LESA 3MGUA 3VV1A 3IPVB 1BCXA 1RUC3 4AVSA 4CRQA 1G9AA 4XJ9A 2GAUA 3AYEA 4GWMA 4XJWA 3RG0A 3VUOA 3RZTA 1O5LA 2XPJA 1S2KA 1H1IA 2JE9A 4Q4V2 4YM3A 2P2KA