3P2AA

Crystal structure of thioredoxin 2 from yersinia pestis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
NAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin-like protein
publication title Crystal Structure of Thioredoxin 2 from Yersinia pestis
rcsb
source organism Yersinia pestis
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3p2aA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3p2aA02
2P5QA 3HJMA 1WWJA 1THXA 5ECOB 4NV2A 5D73A 11GSA 2C0DA 3UARA 2DJ0A 5IMDA 1GSEA 5G30A 2NPBA 3ZIVA 3GRXA 2XPDA 1GNEA 5ECPB 2FD3A 5DCHA 4GXZA 5H5QA 2VLUA 4D73A 4WBJA 3IBHA 2WDUA 1S3CA 2GZPA 3CMIA 1XFLA 2C3TA 1QGVA 4IP6A 4O7HA 2LNSA 5KN0A 2WJUA 2FLSA 2NBSA 5INYA 2F3MA 1V2AA 1K0CA 5ABRA 1WE0A 1UN2A 3WT2A 1LBKA 3DMLA 1VF2A 4TR0A 1X9MB 2XBQA 2RM6A 3F9UA 3GKKA 3QDNA 10GSA 3TJGA 4EKZA 1T4ZA 2IMEA 2ON5A 3L0HA 4I97A 4OO5A 1FVKA 2VL9A 1HNAA 1I5GA 4TN8A 3UL3A 5CRWA 3VI5A 1ZCPA 4ZL9A 5F8BA 1V57A 5D8IA 1WRYA 3DIEA 4OO4A 2MZCA 3VFIA 4GQCA 4OCFA 1SL0B 3IAM2 1R4WA 4KSMA 1TW9A 4HOJA 1GSQA 5JCWA 2ZUPA 2WB9A 4MF6A 2PU9C 2DJ3A 3TKSE 3C8EA 1H4OA 1FO5A 3QPMA 3BCKA 5KEJA 4ACSA 5LNKe 2ZNMA 2DJJA 4QL7A 3IOSA 3WGDA 1OC3A 2J23A 2P31A 2JZTA 2IFQA 3TJKA 3UEMA 2CX4A 1EP8A 3FRCA 19GSA 3ZL5A 4F03A 5J5NA 3CYNA 2HLSA 2BJXA 4LLRA 4Q5QA 4ECCA 3TKSA 1X5CA 2YZUA 4MDCA 4MCUA 2YJHA 1RK4A 5A5KA 1NHOA 4ID0A 1HNCA 3F4SA 3EC3A 13GSA 3NOFA 1ZGNA 5DQSA 1A2JA 2LKUA 1ZOFA 1TU7A 5HFGA 4XS6A 5A4VA 5ECKB 4ML1A 5IO2A 2YPMA 1O6JA 1GSFA 3EU4A 1B48A 1EGOA 3NZNA 1YKAA 2B7KA 3CXGA 1B9YC 1YF1A 3D6IA 1IYIA 1V58A 3M8NA 3C73A 4FYCA 5KN3A 4PUAA 3S9FA 3GKMA 5B7CA 2VCQA 4V1Ap 2LNTA 5IMVA 5ECLB 2A4VA 1X5EA 4L5LA 1OE7A 3WYWA 2C0FA 1XOBA 4IQ1A 1JLWA 3GA4A 2B5YA 5CO3A 3GFKA 1ABAA 2R6KA 3IC4A 5IM9A 4DSSA 3DWVA 2MMOA 2H1DA 4OCEA 5CRDA 4PQHA 3CTGA 3HXSA 4NV5A 2GLRA 2J9UB 1R5PA 2C6AA 2IMDA 4MJEA 2BTOT 3TKRA 3QD9A 1OC9B 3FZAA 4K2DA 2YANA 1TRUA 1FB0A 4ZB8A 4EF0A 4G19A 4O5RA 2XC2A 3GTUB 2F51A 1VF4A 3LJRA 3TRQA 1XW9A 6GSUA 1URMA 2DJKA 3ME7A 5JWQB 4MABA 2V2GA 1A23A 2N5AA 5A4WA 4K7OA 4Q5FA 3LSZA 1PMTA 1ML6A 2WULA 3KP9A 1SKSB 3TDGA 2OE1A 1GULA 2IPAA 4G10A 1SU9A 1JHBA 1GP1A 5ENUA 3TCOA 3F0IA 1F9MA 3HHVA 4TXOA 2CVDA 1SKRB 2CA8A 4N10A 3CRUA 5DALA 1DBYA 2YN1A 2GSSA 4ZB6A 3KMNA 4MJCA 1TU8A 3CTFA 3UVTA 2XHFA 2LRCA 2WGRA 1OKTA 3FZ4A 2VOCA 3PGTA 2VCTA 5EPFA 1XZOA 3I43A 4K8MA 4XS1A 4ECJA 3ZRDA 2Z9SA 4TR3A 3E3EA 1O8XA 1XWAA 1YJ6A 1DE2A 1M9BA 1GNWA 1U88A 2V32A 5HR2A 4MJBA 2E2GA 2GSTA 3QOUA 2IMIA 2L4QA 2H8LA 4TKYA 3C1SA 1KBNA 2HZEB 5ID2B 2H75A 4PGTA 2JZSA 3LYPA 4PNGA 5KN1A 2D2ZA 2DIYA 3B08B 2RUFA 1U6TA 4ZILA 3QMXA 4OMVA 2MMAA 3EE2A 5DJLA 5AIXA 1A0FA 3I6AA 9GSSA 4FYBA 5B8BA 2PMTA 3B0AB 1ZZYA 3Q6OA 4BWSA 4RI6A 1MDJA 2FWGA 5HR0A 5ECHB 2B5EA 17GSA 4MLYA 3P8WA 1WIKA 1JZWA 2X99A 4HU7A 1Y25A 3H8QA 3HJPA 4EO3A 1FOVA 4HJ2A 5AN1A 3M9KA 1T8EB 1F3AA 3ZREA 4KSOA 4HS1A 5G1LA 3ERFA 3K8NA 1GTUA 6GSSA 5IIZA 3ZMKA 1S3AA 2B1KA 2MYGA 2BMXA 1B8XA 1QK8A 1ST9A 3F3RA 3A2XA 1T4YA 3M3MA 1T7PB 1AC1A 1AIUA 2WRTA 3H79A 2OADA 4J56E 3H93A 3IK9A 4L5OA 1XBSA 4D73B 3HJOA 2CAQA 2VO4A 4F0BA 3I9V2 3VLNA 1ERUA 2O87A 5J41A 3FR9A 4LL1B 1PD21 5GAND 2K8SA 2EIOA 4F82A 3US3A 1NW2A 2B5XA 1U87A 3G7IA 2G2QA 5ELAA 2DBCA 4I6XA 2DC5A 1M2AA 2YNXA 2C3NA 3D22A 2JSYA 2I3YA 2B1LA 3RHCA 3TUEA 1SJZA 2H0GA 4EL1A 4E8HA 5IMCA 4MP4A 3ZYWA 2HFDA 1K0AA 1XVWA 2GVPA 4OWYA 2RLIA 3FYGA 4IVFA 3L9VA 4KDXA 3D0ZA 5CAXA 1T00A 2E7PA 4HZ4A 1A2MA 2YCDA 3L9SA 3ERGA 2NDOA 1SL2B 3LORA 1QFNA 3Q74A 1EZKA 2H1AA 2HSYA 1JFUA 1GUHA 1X9SB 5HR3A 1WOUA 1V40A 4TVEA 3IPZA 1MDKA 1AQXA 1CQGA 2ZCTA 4KH7A 5DAKA 1C72A 5D93A 1YEXA 2IFQB 1G6YA 4IGJA 3HZ4A 4XCSA 4QL9A 3TB2A 3DGQA 3VPTA 3W8SA 1FVJA 3LYKA 1ACVA 2ON7A 2H6ZA 2H76A 2AUVA 4XXBB 2C8UA 2KOKA 3GNJA 2VL3A 2N5FA 2FGXA 4AJ8A 4JR4A 3FR3A 1SJ6A 4TRXA 3VWVA 3MSZA 3AY8A 1A2LA 2VLVA 2H30A 4L0WA 3KXOA 4N11A 2DIZA 1JLVA 5E59A 1MD4A 5G5EA 1Y6EA 2IL3A 1NHYA 3FHKA 2CZ3A 4ZL7A 2PVQA 3BJ5A 2DMLA 3D21A 2XBIA 4LMVA 2IJYA 4ZL8A 3A2VA 4HQZA 2IN3A 4PURA 2AV4A 4AF2A 2H72A 4N0VA 1BEDA 4TR1A 4IJIA 2I1UA 5G1KA 1GLPA 1NSWA 3EURA 1K3LA 4DSSB 2OA7A 4FO5A 4NHWA 2YP6A 4Z7XA 3UOMA 2H6XA 4MF5A 2VL2C 1JZRA 5ECSA 2VCWA 4G2EA 1J9BA 1Q4JA 3CSJA 3HDCA 2LQQA 1YDKA 3GHAA 3WT1A 2OE3A 4XS4A 5ECIB 2FNOA 4XHMA 4V2LA 3E9JB 4ZBAA 2LRTA 3TKQA 1Q98A 3DYRA 4I2UA 2I4AA 4WEYA 5DVBA 4MH2A 2LV3A 3H1NA 3QAVA 2B6MA 4ZBDA 5IOXA 2H0HA 2FHEA 2V6OA 3Q18A 5DBQA 3GL3A 2CVBA 4DVCA 2CX3A 2AAWA 4P3YB 5GZZB 1PN9A 2J9HA 3KH9A 3L4NA 3KM6A 4QQ7A 4OFTA 4RI7A 4MPFA 2OBKA 3JCML 1GTIA 2F8FA 2KUCA 3GX0A 4EDZA 2H66A 1XVQA 2H19A 4TXOB 2NTOA 1DE1A 3DKSA 4RQXA 4BL7A 5DALB 4WXTA 2CT6A 5CYYA 5ELGA 2YV9A 3IDVA 2OKAA 3ISOA 3IXRA 5DCGA 1HQOA 1V9WA 5AISA 2HSHA 2HRNA 1TK8B 2H73A 2MMZA 1TK0B 1XPVA 1O7UA 4E8EA 2GT6A 2C1YA 1EV4A 4MJAA 2X8CA 1R5AA 3ERWA 2ALBA 4YH2A 1GRXA 3LGCA 1GWCA 3RDWA 3BCIA 3ZZXA 3IE3A 1B4QA 2CV4A 2AJQB 1DSBA 2A2RA 2JL4A 1EOGA 3APSA 1KNGA 4I5QA 4EE0A 3VWXA 1GUMA 2QKEA 3VWWA 3HYPA 4OFNA 1O81A 5JCGA 5L71A 4BPYA 1B4PA 4XIHA 2LJRA 3G9BA 4L8EA 5F05A 4HQSA 3RPNA 22GSA 4IHUA 1I9DA 2DLXA 3QAWA 2L5OA 1FG4A 2GGTA 3ZMLA 1LU4A 4YQVA 3P90A 3LQ7A 3PR8A 3VWUA 1GTAA 3LFLA 3KH7A 3F3QA 4KUNA 5D9XA 1K0BA 4PQIA 4LA1A 3IK7A 4ECBA 2FUG2 2VUPA 2RM5A 1XCCA 1EV9A 3GKXA 1KEBA 1TRSA 3L9UA 3DXBA 4N30A 2QC7A 3LWAA 3SWLA 3APOA 4Q5NA 5J3RA 2OBIA 1X5DA 3KP8A 4IJ3A 4J57E 2L59A 3F6DA 4K0NA 2PERA 3UIWA 3P2AA 1AQVA 1BQ7A 5IOWA 4GTUA 2F8AA 4POMA 5DJMA 1GSDA 3A5WA 4GQFA 1JZDA 2YWNA 20GSA 3MDKA 1BAYA 3ZTLA 4NPBA 4NXIA 1F6MC 1K3YA 3FY7A 5AIVA 4IS0A 2P5RA 3UVHA 2REMA 2C6BA 14GSA 1A24A 3F63A 5FT3A 1OAZA 1WMJA 1K0NA 3PINA 3ME8A 4WKWA 2AB6A 1SKWB 4MH3A 3CRTA 4ILFA 4I2TA 5EY6A 1RW1A 1FW1A 2VCZA 1SYXA 4JEDA 3TRPA 1X0RA 4G9HA 1AQWA 4RQRA 4K7IA 4ISDA 1T3BA 4BA7A 1JZOA 1VF1A 4GRFA 1EP7A 4WR4A 1GL8A 1YF0A 4ZBBA 3FZ9A 3ZFLA 3SBCA 3P7XA 1PX7A 3EYTA 5D96A 4BVXA 2C80A 1YKCA 5DDLA 3WGEA 2DMMA 2E2MA 2FA4A 2LUSA 1PL1A 4F9ZA 4AGSA 2M80A 5G2ZA 1EWXA 5IMZA 18GSA 4N0ZA 1W4VA 5FWGA 3A2WA 5DAKB 3QFBC 1M2DA 1RQMA 4HZ2A 5HR1A 1USBA 2B7JA 3TJJA 3ZVJA 5H5SA 1F37A 3G7JA 1Z7RA 1XOAA 1R26A 6GSXA 2DJ1A 4POLA 4X0XA 5COHA 3GL5A 2JADA 4TOPA 4NWYA 2VIMA 3HCZA 2V41A 4JBBA 2XPEA 4KGIA 1BYEA 3KZQA 3GIXA 1FB6A 4CW9A 2OE0A 1TP9A 1EEMA 5D9TA 1ZMAA 1O85A 2DJ2A 1PRXA 5IMAA 3D4TA 1X9WB 3C71A 1TXXA 3G7YA 4Q5RA 3O3TA 1SJIA 2YZHA 1Z5YE 1OE8A 2X64A 3D5JA 3O76A 2YWIA 2WFCA 5A4UA 3O6TA 2VCXA 3QCPA 1QXHA 4EXJA 7GSSA 3RHBA 1IYHA 2C3QA 1PGTA 1TDIA 4ML6A 2H01A 3TJFA 3UMAA 2PVOC 3QAGA 2JSZA 2X8GA 2EC4A 4PNFA 2TRXA 4TW5A 4X43A 4RUVA 4EC0A 3M1GA 3GH9A 2K8VA 1CQHA 2O89A 8GSSA 4L0UA 2HE3A 3LG6A 1ILOA 2LJAA 2PWJA 1TRVA 2OACA 4EDYA 5D9VA 1PSQA 3HKRA 5B6MA 3APQA 2EIRA 5GAPD 5CRGA 2VLTA 2HZEA 2GZYA 1SL1B 2L6DA 3J7Yb 1QMVA 2KP1A 1HYUA 4FIWA 1BJXA 1ON4A 3F8UA 1PA3A 3CSIA 2H74A 3FZ5A 2CVKA 3GX8A 3C7MA 3GUSA 1PL2A 4HU9A 1WP0A 2GQLA 4K7NA 1F2EA 1MEKA 2RUEA 2R37A 1GTBA 3F4TA 3GSTA 4PUFC 5IO0A 3DD3A 2L5LA 1XW5A 1R7HA 1E6BA 1THOA 4JRRA 2L4CA 2VCVA 4JZQA 3UBKA 4AJ6A 3FK8A 2O8VB 3FKFA 3V1WA 4MA9A 1ZYEA 1G6WA 2LSTA 2PPTA 2JU5A 3HZ8A 1GH2A 3KD0A 5EL8A 4J2FA 4XTSA 4K1FA 2GSRA 4GSSA 4MZWA 1TRWA 3OR5A 3HVXA 5JWRB 3UJ1A 2HI7A 3TRXA 4EUYA 1ZYQB 5DQYA 2H0IA 3WD6A 4MK3A 2JACA 3EU3A 1NM3A 4NMUA 1SD9A 1SD8A 2MMNA 1H75A 1TKDB 4KAEA 3KEBA 3EMPA 4MMMA 5IPHA 3QFAC 2C0EA 4V1Ag 4V2MA 2FWHA 1V98A 2ES7A 3H4KA 1UVZA 2HYXA 4GSTA 5B8AA 1G7OA 1VGLA 1PKZA 2H71A 5CRHA 1VRSD 1ERTA 1J0FA 2N5BA 3CBUA 2WCIA 3ED3A 2PN8A 1OVNA 1Z3EA 4NAXA 2OJLA 3J7Yk 1M99A 6GSVA 2LS5A 1GSUA 2GSQA 3U6VA 1M9AA 4AJ7A 5CP1A 1AUCA 4JE1A 1W89A 1TOFA 2H70A 6GSYA 2VD0A 4V2NA 4HDEA 4O92A 4DSRA 1A8LA 5H5RA 3KCMA 5HFIA 4LMWA 5C00A 2L6CA 1EEJA 2FCHA 5HFKA 5IPGA 4I8BA 4KDUA 2MBSA 2PGTA 2GQKA 5G5FA 2CAIA 1HNBA 4XRDA 2MBTA 4ZB9A 4K6XA 1Z6MA 4WBRD 2TIRA 3VURA 1XW6A 2LEGA 2M46A 2X8HA 2B3SA 1EGRA 3FEUA 2FWFA 3TOTA 3ZVJD 5GSTA 2GQMA 2GZZA 2QGVA 4FH8A 2RIIA 12GSA 2IWTA 5B6NA 1GSYA 2HNLA 4BWQA 3EMXA 3ZITA 2PUKC 4WF5A 2HZFA 4LL4B 4DSQA 3IRAA 3BOAA 1MTCA 4WR5A 4K0GA 1DUGA 1YQ1A 2JZRA 1PKWA 4NHZA 3QR6A 1MD3A 2M72A 1Z9HA 2K6VA 2AYTA 2V1MA 3HVSA 4KA0A 1OKDA 1Z7PA 3RBTA 2HT9A 3D4MA 1TJDA 1KTEA 4JR6A 2GT5A 1VF3A 3TKPA 1U3IA 4KCEA 4ECIA 3GH6A 3VPQA 1HD2A 3IR4A 2AHEA 2C0GA 5J9BA 4H86A 1WPIA 4GLTA 4PXOA 5ECMB 3EWLA 4X1UA 2K9FA 2E0QA 1UC7A 4KB3A 1XXUA 3BD2A 5E4WA 3KJYA 2YOIA 3MWHA 2DSAA 3CSHA 3GN3A 1MDIA 3LEFA 1YY7A 4MF7A 3GYKA 5AGYA 5JCUA 4KDYA 4MPGA 4GWRA 3UAPA 2CQ9A 2IMKA 2FA8A 4IELA 2VL2A 3EINA 1WJKA 4PX1A 2I81A 1M7TA 3IAS2 3KTBA 4PQ1A 2H1BA 4ZIJA 2CZ2A 4GSNA 1OYJA 2NVLA 3A3TA 3NIVA 2H6YA 2L57A 3RAZA 1GUKA 1BG5A 16GSA 1QQ2A 3I69A 1O8WA 3DVWA 3LXTA 4IN0A 1FAAA 1TTZA 1XWCA 1AW9A 1XWBA 2VM1A 3F6FA 4WETA 3N5OA 5C04A 3DEXA 2G0FA 3R2QA 3Q19A 2KLXA 1B9XC 3C1RA 2O85A 4IP1A 5LD0A 6GSTA 3N9JA 5ECRB 2WS2A 4GF0A 4BVYA 4K9ZA 3M0FA 1K0MA 3MNGA 4DEJA 4ZXGA 3HY2A 5J9CA 2QSIA 1UA5A 2LQOA 4YAVA 4TR4A 2IMFA 2GDRA 2O7KA 4IBPA 4EVMA 4HI7A 1K0DA 2C4JA 4IQAA 1BX9A 4IKHA 2LRNA 2WZ9A 1FHEA 3EVIA 3HVVA 2KHPA 1TI3A 5G31A 1ERVA 5F07A 3TJBA 4O32A 4ULXA 3F4RA 3FW2A 4XRAA 3KGKA 5JWOB 3DRNA 2H1GA 1N2AA 1OC9A 2K18A 2KP2A 4POKA 1J08A 2EIQA 5GSSA 1A0RP 2I9HA 3DVXA 3GTUA 2VAFA 2HRFA 3FR6A 4GCIA 3GKNA 1EOHA 3ZLPA 4JU5A 4CDOA 1PQNA 3L78A 1T1VA 2PBJA 3HD5A 4F2IA 2YWMA 3KTLA 3M9JA 4HEA2 5IQYA 3ZIJA 1GLQA 1QUWA 2R2JA 1E2YA 2YJ7A 1Z6NA 4HUAA 4KW6A 1GSSA 3VK9A 3MAKA 1ERWA 1XWGA 2HXKA 5IMFA 3ZFBA 3UBLA 3IA1A 1M0UA 3IHQA 2LTKA 4OFMA 1AAZA 2F9SA 3KIJA 2V6KA 4YQUA 3GSSA 4YAPA 2GS3A 1PX6A 3GMFA 5CREA 3RPPA 3GURA 1YEPA 4TR1B 1SENA 1XIYA 1YZXA 3GV1A 1A8YA 4YQMA 4TXVA 5F0GA 4WF4A 5F06A 4OD7A 2P0GA 4CHSA 5CNWA 5D9WA 5FHIA 5J4UA 2YV7A 5EVOA 2VD1A 3LXZA 1SK2A 2VM2A 3WGXA 1ZL9A 4XS4B 4KNDA 2LJKA 2R3XA 3BBYA 3TKSC 1SK1A 1N8JA 3PH9A 4KX4A 5KN2A 1K0OA 1LJRA 4POBA 1G7EA 2R5GA 2A2SA 2R4VA 4MZCA 3VI7A 3TOUA 5ID2A 4KCAA 6GSWA 4F0CA 1XWKA 5ECNB 1S3DA 3HA9A 5ECQB 1TK5B 1SYRA 1O73A 3W6GA 2FY6A 2TRCP 4HJMA 2IIYA 3W8JA 5LCZA 2YWOA 1M2BA 3IV4A 4MZBA 4FYUA 4KE3A 1U3AA 3TGZA 1AXDA 2GTUA 1SK0A 3KMOA 1OC8A 5HQPA 3U5RE 1F3BA 1G0TA 4IW9A 2FWEA 1K3OA 3E0UA 1TI1A
chains in the Genus database with same CATH superfamily
2P5QA 3HJMA 1WWJA 1THXA 5ECOB 4NV2A 5D73A 11GSA 2C0DA 3UARA 1NXGA 2DJ0A 5IMDA 1GSEA 4LHLA 5G30A 2NPBA 3ZIVA 3GRXA 3S1ML 4TVMA 2XPDA 1GNEA 5ECPB 2FD3A 3LWVB 4AR4A 5DCHA 4GXZA 5H5QA 2VLUA 4D73A 2JA5L 4WBJA 3IBHA 2WDUA 1S3CA 2E2JL 1R0GA 2GZPA 3CMIA 1XFLA 2C3TA 1QGVA 3IU3I 4AI2A 4IP6A 4O7HA 2LNSA 2Z3QB 4YKGA 5KN0A 2WJUA 2NVTL 2FLSA 2X4AA 1RWDA 2NBSA 5INYA 2F3MA 5IYBL 1V2AA 1XG8A 1LKOA 1K0CA 5ABRA 1WE0A 1UN2A 3HAXC 1PFOA 3WT2A 2QA2A 1LBKA 3DMLA 1VF2A 4TR0A 2PVXA 1X9MB 5MLC3 2XBQA 5DM71 2RM6A 3F9UA 3GKKA 3QDNA 10GSA 3TJGA 4EKZA 1T4ZA 2IMEA 2ON5A 3L0HA 4I97A 4OO5A 1FVKA 2VL9A 1HNAA 1I5GA 4TN8A 3UL3A 5CRWA 3VI5A 1ZCPA 4ZL9A 4CY6A 5F8BA 1V57A 5D8IA 1WRYA 4V196 3DIEA 3JR7A 4OO4A 2MZCA 3VFIA 4KF9A 5GADc 4GQCA 3HOZL 4OCFA 1SL0B 3IAM2 1R4WA 4KSMA 1TW9A 4YWLA 3GTQL 1GSQA 4HOJA 5JCWA 2ZUPA 2WB9A 2M4YA 2PU9C 4MF6A 2M6PA 2DJ3A 3TKSE 3HKZP 3C8EA 1H4OA 1FO5A 3QPMA 3SS2A 3GTPL 3BCKA 5KEJA 4ACSA 5LNKe 4AR5A 2ZNMA 2DJJA 4QL7A 3IOSA 3WGDA 1OC3A 5C4JL 2J23A 1C09A 2P31A 2JZTA 2IFQA 3TJKA 3UEMA 2CX4A 1EP8A 3FRCA 1SFOL 1R0FA 19GSA 1CADA 3ZL5A 4F03A 5J5NA 3CYNA 2HLSA 2BJXA 4LLRA 4Q5QA 1T9QA 4ECCA 3TKSA 1X5CA 5M5YL 2YZUA 4MDCA 4MCUA 4HSCX 2YJHA 1RK4A 5A5KA 2M4VA 1NHOA 4ID0A 1HNCA 3F4SA 3EC3A 13GSA 3NOFA 1ZGNA 5DQSA 2CR8A 1A2JA 2LKUA 2B63L 1ZOFA 1TU7A 5HFGA 4XS6A 5A4VA 5ECKB 4ML1A 5IO2A 2YPMA 1O6JA 1B71A 1GSFA 4G6BA 3EU4A 1B48A 1EGOA 3NZNA 1YKAA 2B7KA 3CXGA 1B9YC 1YF1A 3D6IA 1IYIA 1V58A 3M8NA 3C73A 4FYCA 5KN3A 4PUAA 3S9FA 1BQ8A 5EIOC 3GKMA 3HJYB 5B7CA 2VCQA 4V1Ap 2LNTA 5IMVA 2KKDA 1X5EA 2A4VA 4L5LA 5ECLB 1OE7A 3WYWA 2C0FA 3HOVL 2MS3A 1XOBA 4IQ1A 1JLWA 3GA4A 2B5YA 5CO3A 3GFKA 1ABAA 2R6KA 3IC4A 5IM9A 1DX8A 3LW9A 4DSSA 2GMGA 3DWVA 2MMOA 2H1DA 4OCEA 5CRDA 4PQHA 3CTGA 5M5XL 3HXSA 1OWBA 4NV5A 2GLRA 2J9UB 1R5PA 2C6AA 2IMDA 4MJEA 2BTOT 4BBRL 3TKRA 3QQCE 3QD9A 2XJRA 3PO2L 4A3KL 1OC9B 3FZAA 4K2DA 2YANA 1TRUA 1FB0A 4ZB8A 4EF0A 4G19A 4O5RA 2XC2A 3LWQB 3GTUB 2F51A 1VF4A 3LJRA 3MYDA 3TRQA 1XW9A 6GSUA 5M3ML 1URMA 2DJKA 3ME7A 4A3EL 1PZXA 5JWQB 4MABA 2V2GA 1A23A 2N5AA 5A4WA 4K7OA 4Q5FA 3LSZA 1PMTA 1ML6A 2WULA 3KP9A 2AQCA 1SKSB 3TDGA 2ZIXA 2OE1A 1GULA 2IPAA 4G10A 1B2JA 1SU9A 1JHBA 1GP1A 5ENUA 3TCOA 3F0IA 1F9MA 3HHVA 4C3HL 3WWNB 4G0LA 4TXOA 2CVDA 1SKRB 2CA8A 1VZIA 4N10A 2JI2A 3CRUA 5DALA 4A3FL 1DBYA 2YN1A 3H3VM 3FKIL 2GSSA 4ZB6A 2NVQL 3KMNA 4MJCA 1TU8A 3CTFA 3PPUA 3UVTA 2XHFA 2WGRA 2LRCA 1OKTA 3FZ4A 2VOCA 1Z92B 3PGTA 2VCTA 5EPFA 1XZOA 3I43A 4K8MA 4XS1A 4ECJA 3ZRDA 2Z9SA 4BIKA 4TR3A 3E3EA 1YV1A 1O8XA 1XWAA 1YJ6A 1DE2A 1M9BA 1GNWA 1U88A 1SMUA 2QL0A 2V32A 3J7Z1 4BY1L 5HR2A 4MJBA 5K2ME 3S17L 2E2GA 3S16L 2GSTA 3QOUA 2IMIA 2L4QA 2H8LA 4TKYA 3C1SA 1IRNA 1KBNA 1BE7A 2HZEB 5ID2B 2H75A 4PGTA 2JZSA 3LYPA 4PNGA 5KN1A 1ZRPA 2D2ZA 2DIYA 3B08B 2RUFA 2PYAA 1U6TA 4ZILA 3HVNA 5JVH1 3QMXA 4OMVA 2MMAA 3H99A 3EE2A 5DJLA 5AIXA 1A0FA 2JA6L 3I6AA 4K9FA 9GSSA 4FYBA 5B8BA 2PMTA 3B0AB 4A3DL 1ZZYA 3Q6OA 2B5ID 4BWSA 4RI6A 1MDJA 2FWGA 5HR0A 5ECHB 2B5EA 17GSA 4MLYA 3P8WA 1WIKA 1JZWA 2X99A 4HU7A 1Y25A 3H8QA 1IROA 3HJPA 4EO3A 1FOVA 4HJ2A 5AN1A 3M9KA 1T8EB 1F3AA 4O5QA 3ZREA 4KSOA 4HS1A 1LKMA 5G1LA 3ERFA 3A5IA 3S15L 1S30A 3K8NA 1GTUA 4CY8A 6GSSA 5IIZA 3ZMKA 1S3AA 2B1KA 2MYGA 2BMXA 1B8XA 1QK8A 1ST9A 3F3RA 3A2XA 1T4YA 3M3MA 5KOWA 1T7PB 1AC1A 1AIUA 2WRTA 3H79A 2OADA 2WB1P 4J56E 3H93A 3IK9A 4L5OA 2XJTA 1XBSA 4D73B 3HJOA 1B13A 2HRAA 2CAQA 2VO4A 4F0BA 3I9V2 3VLNA 1ERUA 3PWFA 3LWRB 2O87A 5J41A 3FR9A 1T9OA 1R9TL 1I6HL 4LL1B 1PD21 5GAND 2K8SA 2R0CA 2EIOA 4F82A 3US3A 5BMUA 1NW2A 1YUXA 2B5XA 1U87A 3G7IA 2G2QA 5ELAA 2DBCA 2DC5A 1H7VA 1M2AA 2C3NA 2YNXA 3D22A 4I6XA 2JSYA 2I3YA 2B1LA 3MSUA 3RHCA 3TUEA 1SJZA 2H0GA 4EL1A 4E8HA 3HOWL 5IMCA 4MP4A 3ZYWA 2HFDA 1K0AA 1XVWA 2GVPA 1I3QL 2HR5A 2HVYC 4OWYA 2RLIA 3FYGA 4IVFA 3L9VA 4KDXA 3D0ZA 5CAXA 2RDVA 1T00A 2XJPA 2E7PA 4HZ4A 1A2MA 2YCDA 3L9SA 3S14L 3ERGA 2NDOA 1SL2B 3LORA 1QFNA 3Q74A 1EZKA 2H1AA 2HSYA 1JFUA 2KN9A 1GUHA 1X9SB 2YU9L 5HR3A 3RYGA 1WOUA 1V40A 2R0GA 2UZ8A 4TVEA 3IPZA 1MDKA 1AQXA 1CQGA 2ZCTA 4KH7A 5DAKA 1C72A 5D93A 1YEXA 2IFQB 1G6YA 4IGJA 3HZ4A 4XCSA 4QL9A 3TB2A 2VL6A 3DGQA 3VPTA 5MFPA 3W8SA 4AI1A 1FVJA 3LYKA 3PO3L 1ACVA 2ON7A 4B8CD 2H6ZA 2H76A 2AUVA 4XXBB 2C8UA 2KOKA 3GNJA 2VL3A 2N5FA 2FGXA 4Z2RA 4AJ8A 4JR4A 3FR3A 4PTSA 1SJ6A 3LWOB 4TRXA 4K5SA 3VWVA 3MSZA 3AY8A 1A2LA 2VUML 2VLVA 2H30A 4L0WA 3KXOA 4N11A 2DIZA 1JLVA 1PFUA 5E59A 1MD4A 5G5EA 1Y6EA 2IL3A 1NHYA 3FHKA 2CZ3A 3RZ6A 4C2M1 4ZL7A 2PVQA 3BJ5A 2DMLA 3D21A 2XBIA 4LMVA 2IJYA 4ZL8A 1SMWA 3A2VA 4HQZA 5GAHc 2IN3A 4PURA 2AV4A 4AF2A 2H72A 4N0VA 5FJ8L 1BEDA 4U671 4TR1A 4IJIA 3HOUL 2I1UA 5G1KA 1GLPA 1NSWA 3EURA 1TWHL 1R0IA 1K3LA 3PKIA 4DSSB 4POGA 2OA7A 4FO5A 4NHWA 2YP6A 4Z7XA 3UOMA 2H6XA 4MF5A 2VL2C 5AI3A 1JZRA 5ECSA 2VCWA 4G2EA 1J9BA 4JAFA 5H1Sc 1Q4JA 2AUSB 4A3GL 3CSJA 3HDCA 2LQQA 3K7AL 4EIQA 1YDKA 1VZGA 3GHAA 3WT1A 2OE3A 4XS4A 5ECIB 2FNOA 3S1RL 3HOYL 4XHMA 4V2LA 3E9JB 2A6HD 4ZBAA 2LRTA 3TKQA 1Q98A 3DYRA 4I2UA 2I4AA 4WEYA 3CQFA 5DVBA 4MH2A 2LV3A 3H1NA 3QAVA 2B6MA 4ZBDA 5IOXA 2H0HA 2FHEA 2V6OA 3Q18A 5DBQA 3GL3A 2CVBA 4DVCA 2CX3A 1RDGA 2AAWA 4P3YB 3H9BA 5GZZB 1PN9A 2A2PA 2J9HA 3KH9A 3L4NA 3KM6A 4QQ7A 4OFTA 4RI7A 4MPFA 2OBKA 3JCML 1GTIA 2F8FA 2KUCA 3GX0A 4EDZA 2H66A 1XVQA 2H19A 4TXOB 2NTOA 1DE1A 3DKSA 4RQXA 4BL7A 5DALB 4WXTA 2CT6A 5CYYA 5ELGA 2YV9A 3IDVA 2OKAA 3ISOA 3IXRA 5DCGA 1HQOA 1V9WA 5AISA 2HSHA 2HRNA 1TK8B 2H73A 1PFYA 2MMZA 3I4ML 1TK0B 1B2OA 1XPVA 1O7UA 4E8EA 2GT6A 1FHHA 2C1YA 1EV4A 4MJAA 2X8CA 1R5AA 3ERWA 2ALBA 4YH2A 1GRXA 3LGCA 1GWCA 4C3JL 3RDWA 4BVYB 3BCIA 4A93L 2EY4E 3ZZXA 3IE3A 1B4QA 2CV4A 2AJQB 1DSBA 3H97A 2A68D 2A2RA 2JL4A 1EOGA 1RDVA 3APSA 1KNGA 4I5QA 1M3JA 3VWXA 4EE0A 1GUMA 2QKEA 3VWWA 3HYPA 4OFNA 3S2HL 1O81A 1PFVA 5JCGA 5L71A 8RXNA 4BPYA 1B4PA 4XIHA 2LJRA 3G9BA 4L8EA 5F05A 4HQSA 3PZAA 3RPNA 22GSA 4IHUA 5M5WL 2APOB 1I9DA 1RB9A 2DLXA 3QAWA 2L5OA 1FG4A 2GGTA 3ZMLA 1LU4A 4YQVA 3P90A 3LQ7A 3PR8A 3VWUA 1GTAA 3LFLA 3KH7A 3A44A 3F3QA 4KUNA 4A3JL 5D9XA 1K0BA 4PQIA 4LA1A 2CKAA 3IK7A 2V0EA 4ECBA 2FUG2 2VUPA 2RM5A 1XCCA 1EV9A 5AI2A 3GKXA 1KEBA 1TRSA 3L9UA 3DXBA 5IYCL 4LHNA 4N30A 2QC7A 3LWAA 3SWLA 1YK5A 4Z2TA 3APOA 4Q5NA 5J3RA 2PSMC 1X5DA 2OBIA 3KP8A 4IJ3A 5EINC 4J57E 2L59A 3F6DA 4K0NA 2PERA 3UIWA 3P2AA 1AQVA 1BQ7A 5IOWA 4GTUA 2F8AA 4POMA 5DJMA 1GSDA 3A5WA 4GQFA 1JZDA 2YWNA 20GSA 3MDKA 1BAYA 2BE5D 3ZTLA 7RXNA 4NPBA 4NXIA 1F6MC 3HJWB 3R3EA 4AR6A 1K3YA 3KYXA 3FY7A 5AIVA 4IS0A 2P5RA 4ICYA 3UVHA 2REMA 2C6BA 14GSA 1A24A 3F63A 5FT3A 1OAZA 3VPBE 1WMJA 1K0NA 3PINA 3ME8A 4WKWA 2AB6A 1SKWB 4BBSL 4MH3A 3CRTA 4ILFA 2JA8L 4I2TA 1TWGL 5EY6A 4C3IL 1RW1A 1FW1A 2VCZA 1SYXA 4A3BL 4JEDA 3TRPA 2A4HA 1X0RA 4G9HA 1AQWA 4GS7D 4RQRA 4K7IA 4ISDA 1T3BA 1RYTA 1T9PA 4BA7A 1JZOA 1VF1A 4GRFA 1EP7A 4BY7L 4WR4A 3J7Y1 2HSMA 1GL8A 1YF0A 4ZBBA 3FZ9A 3ZFLA 3SBCA 3P7XA 1PX7A 1CAAA 3HOXL 3EYTA 5D96A 4BVXA 2C80A 3MPSA 3RZTA 1YKCA 5DDLA 3WGEA 5IP7L 3K35A 2DMMA 4BXXL 2E2MA 2FA4A 2LUSA 1PL1A 4F9ZA 4AGSA 2M80A 5G2ZA 1EWXA 5IMZA 5C3EL 4Y7NL 18GSA 4N0ZA 1W4VA 5FWGA 5JVG1 3A2WA 3NFPI 5DAKB 1IW7D 3QFBC 2LCQA 1M2DA 1RQMA 4HZ2A 5HR1A 3FMWA 1USBA 2B7JA 1P7PA 3TJJA 3ZVJA 5H5SA 1F37A 3H9CA 3G7JA 1Z7RA 1XOAA 1R26A 6GSXA 2NYDA 2DJ1A 2A6ED 1YK4A 4POLA 4X0XA 5COHA 3GL5A 2JADA 4TOPA 2E2HL 4NWYA 2VIMA 4AHXA 3HCZA 4AHZA 2V41A 4JBBA 2XPEA 4KGIA 1BYEA 1S24A 3IHGA 2NVXL 3KZQA 1R0HA 1FB6A 3GIXA 4CW9A 2OE0A 1TP9A 1EEMA 5D9TA 1ZMAA 1S3RA 2XJSA 1O85A 2DJ2A 3GTOL 1PRXA 5IMAA 3D4TA 1X9WB 3C71A 1TXXA 1QYBA 1TWCL 5GAEc 4YWMA 3G7YA 4Q5RA 3O3TA 2V3BB 1SJIA 2YZHA 1Z5YE 1OE8A 2X64A 3D5JA 3O76A 2YWIA 3H0GL 2WFCA 5FLML 5A4UA 3O6TA 2VCXA 3QCPA 1QXHA 4EXJA 7GSSA 3RHBA 1IYHA 2C3QA 4ZN3B 1PGTA 1TDIA 4ML6A 2H01A 2JI3A 3TJFA 2H12A 3UMAA 2PVOC 3QAGA 2JSZA 2X8GA 2EC4A 4PNFA 2TRXA 4TW5A 4X43A 4RUVA 4G0KA 4EC0A 4K5RA 4AHWA 4O5UA 3M1GA 3GH9A 2K8VA 1CQHA 3WWLA 2A69D 2O89A 3GTLL 8GSSA 4L0UA 2HE3A 3LG6A 1ILOA 1F4LA 2LJAA 2PWJA 1TRVA 5IY0A 2OACA 3KYVA 4EDYA 4AI3A 1FHMA 5D9VA 1PSQA 3HKRA 4JAEA 5B6MA 3APQA 2EIRA 5GAPD 5CRGA 2VLTA 6RXNA 2HZEA 1QQTA 2GZYA 1SL1B 2L6DA 3J7Yb 1QMVA 2KP1A 1HYUA 4FIWA 1BJXA 1ON4A 3F8UA 1PA3A 3CSIA 1PFWA 1SMMA 2H74A 2Z3RB 3FZ5A 2CVKA 3GX8A 3C7MA 3GUSA 2HRKA 1PL2A 4X4JA 4QIWP 4HU9A 1WP0A 2GQLA 2NVYL 5C4XL 4K7NA 1F2EA 4BL7B 1MEKA 2RUEA 2RFKB 2R37A 1GTBA 3F4TA 3GSTA 4PUFC 5IO0A 3DD3A 2CKCA 2L5LA 1XW5A 1R7HA 1E6BA 1THOA 4JRRA 2L4CA 2VCVA 4JZQA 3UBKA 4AJ6A 1ODHA 3FK8A 2O8VB 3FKFA 3V1WA 4MA9A 1ZYEA 1G6WA 2LSTA 2PPTA 4JADA 1Y1VL 2JU5A 3HZ8A 1GH2A 3KD0A 5EL8A 5MFZA 4J2FA 4XTSA 1JYBA 2XJVA 4K1FA 2GSRA 4GSSA 4MZWA 1TRWA 3OR5A 3HVXA 1VCXA 5JWRB 3UJ1A 2HI7A 3TRXA 4EUYA 2DKIA 2Y0SP 1ZYQB 5DQYA 3RZDL 2H0IA 3WD6A 2WAQP 3GTML 4MK3A 3KYUA 2JACA 3EU3A 4USSA 1NM3A 1M3IA 3LNLA 4NMUA 1SD9A 1SD8A 2MMNA 1H75A 5GAGc 1TKDB 4KAEA 3KEBA 3S1NL 3EMPA 1FOHA 4MMMA 3QFAC 5IPHA 4POFA 2C0EA 4V1Ag 4V2MA 3IC8A 4XGHA 2FWHA 1V98A 2ES7A 3H4KA 1UVZA 2HYXA 4GSTA 5B8AA 1G7OA 1VGLA 1PKZA 1WCML 2H71A 5CRHA 1VRSD 1ERTA 1J0FA 2N5BA 3CBUA 2WCIA 2JI1A 3ED3A 2PN8A 1QCVA 1OVNA 1Z3EA 4NAXA 2XJQA 2OJLA 4WFN1 3J7Yk 1M99A 6GSVA 1LTLA 2LS5A 1GSUA 2GSQA 4K2XA 3U6VA 1M9AA 4AJ7A 4UY81 5CP1A 1BFYA 1PN0A 1AUCA 3MQKB 1ZYPA 4JE1A 1W89A 1TOFA 2H70A 6GSYA 3CQZL 2VD0A 4V2NA 4HDEA 4O92A 1BQ9A 4DSRA 1A8LA 4RXNA 5H5RA 3KCMA 5HFIA 4LMWA 5C00A 2L6CA 1EEJA 2FCHA 5HFKA 5IPGA 4I8BA 4KDUA 2MBSA 2PGTA 2GQKA 5G5FA 5AN9H 3M4OL 2CAIA 2DKHA 1HNBA 2R93L 2DSXA 4XRDA 2MBTA 4ZB9A 4K6XA 1Z6MA 4WBRD 1TWFL 2TIRA 3VURA 1XW6A 2LEGA 2M46A 2X8HA 2B3SA 1R0JA 3S2DL 1EGRA 3FEUA 2FWFA 3TOTA 3ZVJD 1S2ZA 2M6OA 5GSTA 2GQMA 2GZZA 2QGVA 2R0PA 4FH8A 2RIIA 12GSA 2IWTA 5B6NA 1GSYA 2HNLA 4BWQA 3EMXA 3ZITA 2PUKC 2QA1A 4WF5A 4FQUA 2HZFA 4LL4B 4DSQA 3IRAA 3BOAA 1MTCA 4WR5A 4K0GA 1DUGA 1YQ1A 2JZRA 1PKWA 2O5JD 4NHZA 3QR6A 1MD3A 2M72A 1Z9HA 2K6VA 2AYTA 2V1MA 3HVSA 5MGNA 4KA0A 4JAGA 1OKDA 1Z7PA 3RBTA 4BVXB 2HT9A 3D4MA 1TJDA 1KTEA 4JR6A 1VZHA 2GT5A 1VF3A 3TKPA 1U3IA 4KCEA 4ECIA 1BRFA 3GH6A 3VPQA 1HD2A 5KOXA 1DVBA 3IR4A 2AHEA 2C0GA 5J9BA 1LKPA 3PL5A 4H86A 1WPIA 4GLTA 4PXOA 5ECMB 3EWLA 4X1UA 2K9FA 3GTGL 4Y52L 2E0QA 1UC7A 4KB3A 1XXUA 3BD2A 5E4WA 3KJYA 2YOIA 3MWHA 2DSAA 3CSHA 3GN3A 1MDIA 5M3FL 3LEFA 3P8BA 1YY7A 4MF7A 3GYKA 3M3YL 5AGYA 5JCUA 4KDYA 4MPGA 4GWRA 4Z2UA 3UAPA 2CQ9A 2PVEA 1YUZA 1RYQA 3QVDA 2IMKA 2FA8A 4IELA 2VL2A 3EINA 1WJKA 4PX1A 2I81A 1K83L 2JA7L 1ZYNA 1M7TA 3IAS2 3KTBA 4PQ1A 2H1BA 4ZIJA 2CZ2A 4GSNA 1OYJA 3S1QL 2NVLA 3A3TA 3NIVA 2H6YA 2L57A 2R7ZL 3RAZA 1GUKA 1BG5A 16GSA 1QQ2A 3I69A 1O8WA 3DVWA 2X49A 1WJVA 3LXTA 3GTJL 5IYDL 4IN0A 1FAAA 1TTZA 1XWCA 1AW9A 1XWBA 2VM1A 4G0IA 2AYJA 4X6AL 3F6FA 4WETA 3N5OA 5C04A 3DEXA 2G0FA 3R2QA 3Q19A 2KLXA 4MNNA 1B9XC 3C1RA 2O85A 4IP1A 5LD0A 6GSTA 3N9JA 5ECRB 2WS2A 4GF0A 4BVYA 4K9ZA 3M0FA 1K0MA 3MNGA 4DEJA 4ZXGA 3HY2A 5J9CA 2QSIA 1UA5A 2LQOA 1OWCA 4YAVA 4TR4A 2IMFA 2GDRA 2O7KA 4IBPA 1TWAL 3KYYA 4EVMA 4HI7A 1K0DA 3LPEB 2C4JA 4IQAA 1BX9A 4IKHA 2LRNA 2WZ9A 1FHEA 3EVIA 3HVVA 2KHPA 1TI3A 5G31A 1ERVA 5F07A 3TJBA 2PMZP 4O32A 4ULXA 3F4RA 3FW2A 3RZOL 4XRAA 3KGKA 5JWOB 3DRNA 1Y1WL 2H1GA 1N2AA 1OC9A 2K18A 3PIO1 4EIPA 4AHYA 2KP2A 4POKA 1J08A 1NXEA 2EIQA 5GSSA 1A0RP 4YKFA 2R92L 2I9HA 3DVXA 3GTUA 3I4NL 2VAFA 2HRFA 3FR6A 4GCIA 3GKNA 1EOHA 3ZLPA 4JU5A 4CDOA 3KYWA 3EPTA 5BRTA 1PQNA 3L78A 2ERJA 1T1VA 2PBJA 3HD5A 4F2IA 2YWMA 4ZN1B 3KTLA 3M9JA 4HEA2 5IQYA 3ZIJA 1GLQA 4TPUA 1QUWA 2R2JA 1E2YA 2YJ7A 1Z6NA 4HUAA 1GSSA 4KW6A 3VK9A 2E2IL 1E8JA 3MAKA 1ERWA 1XWGA 2HXKA 3PIP1 5IMFA 3ZFBA 3UBLA 5DM61 3IA1A 1M0UA 3IHQA 2LTKA 1I50L 4OFMA 1AAZA 2F9SA 3KIJA 4AI0A 5RXNA 1IU5A 2V6KA 4YQUA 4ME3A 3GSSA 4YAPA 2GS3A 1PX6A 3GMFA 5CREA 4A5PA 4A3LL 3RPPA 3GURA 4AR3A 1YEPA 4TR1B 1SENA 1XIYA 1YZXA 3GV1A 1A8YA 4YQMA 4AYBP 4TXVA 5F0GA 4WF4A 5F06A 4OD7A 2P0GA 4CHSA 5CNWA 5D9WA 3ZG6A 5FHIA 5J4UA 2YV7A 5EVOA 2VD1A 3LXZA 1SK2A 2VM2A 2K2DA 3WGXA 1ZL9A 4XS4B 4KNDA 2LJKA 2R3XA 3BBYA 3TKSC 1SK1A 1N8JA 3PH9A 4KX4A 5KN2A 1K0OA 1LJRA 4POBA 1G7EA 2R5GA 4E6YA 2A2SA 2R4VA 4MZCA 3VI7A 3TOUA 5ID2A 4A3CL 5C44L 4KCAA 1IU6A 6GSWA 5IP9L 4F0CA 1XWKA 3HA9A 1S3DA 5ECNB 5ECQB 4A3IL 1TK5B 1SYRA 1O73A 3W6GA 2FY6A 2TRCP 1NNQA 4HJMA 3PKJA 2IIYA 3W8JA 3MIXA 5LCZA 2ERSA 2YWOA 1M2BA 3IV4A 4MZBA 2L0ZA 4FYUA 4KE3A 1U3AA 3TGZA 1AXDA 2XJUA 2GTUA 1SK0A 3KMOA 1OC8A 5HQPA 3U5RE 5MF6A 1F3BA 1G0TA 2V0FA 3FDJA 4IW9A 2FWEA 4A3ML 1K3OA 3GTKL 3E0UA 1TI1A 3LWPB
chains in the Genus database with same CATH topology
2P5QA 3HJMA 1WWJA 1THXA 5ECOB 4NV2A 5D73A 11GSA 2C0DA 3UARA 1NXGA 2DJ0A 5IMDA 1GSEA 4LHLA 5G30A 2NPBA 3ZIVA 3GRXA 4TVMA 2XPDA 1GNEA 5ECPB 2FD3A 4AR4A 5DCHA 4GXZA 5H5QA 2VLUA 4D73A 4WBJA 3IBHA 2WDUA 1S3CA 1R0GA 2GZPA 3CMIA 1XFLA 2C3TA 1QGVA 3IU3I 4AI2A 4IP6A 4O7HA 2LNSA 2Z3QB 4YKGA 5KN0A 2WJUA 2FLSA 2X4AA 1RWDA 2NBSA 5INYA 2F3MA 1V2AA 1LKOA 1K0CA 5ABRA 1WE0A 1UN2A 3WT2A 2QA2A 1LBKA 3DMLA 1VF2A 4TR0A 2PVXA 1X9MB 5MLC3 2XBQA 5DM71 2RM6A 3F9UA 3GKKA 3QDNA 10GSA 3TJGA 4EKZA 1T4ZA 2IMEA 2ON5A 3L0HA 4I97A 4OO5A 1FVKA 2VL9A 1HNAA 1I5GA 4TN8A 3UL3A 5CRWA 3VI5A 1ZCPA 4ZL9A 4CY6A 5F8BA 1V57A 5D8IA 1WRYA 4V196 3DIEA 4OO4A 2MZCA 3VFIA 4KF9A 5GADc 4GQCA 4OCFA 1SL0B 3IAM2 1R4WA 4KSMA 1TW9A 4YWLA 4HOJA 1GSQA 5JCWA 2ZUPA 2WB9A 2M4YA 2PU9C 4MF6A 2M6PA 2DJ3A 3TKSE 3C8EA 1H4OA 1FO5A 3QPMA 3SS2A 3BCKA 5KEJA 4ACSA 5LNKe 4AR5A 2ZNMA 2DJJA 4QL7A 3IOSA 3WGDA 1OC3A 2J23A 1C09A 2P31A 2JZTA 2IFQA 3TJKA 3UEMA 2CX4A 1EP8A 3FRCA 1R0FA 19GSA 1CADA 3ZL5A 4F03A 5J5NA 3CYNA 2HLSA 2BJXA 4LLRA 4Q5QA 1T9QA 4ECCA 3TKSA 1X5CA 2YZUA 4MDCA 4MCUA 2YJHA 1RK4A 5A5KA 2M4VA 1NHOA 4ID0A 1HNCA 3F4SA 3EC3A 13GSA 3NOFA 1ZGNA 5DQSA 2CR8A 1A2JA 2LKUA 1ZOFA 1TU7A 5HFGA 4XS6A 5A4VA 5ECKB 4ML1A 5IO2A 2YPMA 1O6JA 1B71A 1GSFA 4G6BA 3EU4A 1B48A 1EGOA 3NZNA 1YKAA 2B7KA 3CXGA 1B9YC 1YF1A 3D6IA 1IYIA 1V58A 3M8NA 3C73A 4FYCA 5KN3A 4PUAA 3S9FA 1BQ8A 5EIOC 3GKMA 5B7CA 2VCQA 4V1Ap 2LNTA 5IMVA 2KKDA 1X5EA 2A4VA 4L5LA 5ECLB 1OE7A 3WYWA 2C0FA 2MS3A 1XOBA 4IQ1A 1JLWA 3GA4A 2B5YA 5CO3A 3GFKA 1ABAA 2R6KA 3IC4A 5IM9A 1DX8A 3LW9A 4DSSA 2GMGA 3DWVA 2MMOA 2H1DA 4OCEA 5CRDA 4PQHA 3CTGA 3HXSA 1OWBA 4NV5A 2GLRA 2J9UB 1R5PA 2C6AA 2IMDA 4MJEA 2BTOT 3TKRA 3QQCE 3QD9A 2XJRA 1OC9B 3FZAA 4K2DA 2YANA 1TRUA 1FB0A 4ZB8A 4EF0A 4G19A 4O5RA 2XC2A 3GTUB 2F51A 1VF4A 3LJRA 3MYDA 3TRQA 1XW9A 6GSUA 1URMA 2DJKA 3ME7A 5JWQB 4MABA 2V2GA 1A23A 2N5AA 5A4WA 4K7OA 4Q5FA 3LSZA 1PMTA 1ML6A 2WULA 3KP9A 1SKSB 3TDGA 2ZIXA 2OE1A 1GULA 2IPAA 4G10A 1B2JA 1SU9A 1JHBA 1GP1A 5ENUA 3TCOA 3F0IA 1F9MA 3HHVA 3WWNB 4G0LA 4TXOA 2CVDA 1SKRB 2CA8A 1VZIA 4N10A 2JI2A 3CRUA 5DALA 1DBYA 2YN1A 2GSSA 4ZB6A 3KMNA 4MJCA 1TU8A 3CTFA 3PPUA 3UVTA 2XHFA 2LRCA 2WGRA 1OKTA 3FZ4A 2VOCA 1Z92B 3PGTA 2VCTA 5EPFA 1XZOA 3I43A 4K8MA 4XS1A 4ECJA 3ZRDA 2Z9SA 4TR3A 3E3EA 1YV1A 1O8XA 1XWAA 1YJ6A 1DE2A 1M9BA 1GNWA 1U88A 1SMUA 2QL0A 2V32A 3J7Z1 5HR2A 4MJBA 5K2ME 2E2GA 2GSTA 3QOUA 2IMIA 2L4QA 2H8LA 4TKYA 3C1SA 1IRNA 1KBNA 1BE7A 2HZEB 5ID2B 2H75A 4PGTA 2JZSA 3LYPA 4PNGA 5KN1A 1ZRPA 2D2ZA 2DIYA 3B08B 2RUFA 2PYAA 1U6TA 4ZILA 5JVH1 3QMXA 4OMVA 2MMAA 3EE2A 5DJLA 5AIXA 1A0FA 3I6AA 4K9FA 9GSSA 4FYBA 5B8BA 2PMTA 3B0AB 1ZZYA 3Q6OA 2B5ID 4BWSA 4RI6A 1MDJA 2FWGA 5HR0A 5ECHB 2B5EA 17GSA 4MLYA 3P8WA 1WIKA 1JZWA 2X99A 4HU7A 1Y25A 3H8QA 1IROA 3HJPA 4EO3A 1FOVA 4HJ2A 5AN1A 3M9KA 1T8EB 1F3AA 4O5QA 3ZREA 4KSOA 4HS1A 1LKMA 5G1LA 3ERFA 3A5IA 1S30A 3K8NA 1GTUA 4CY8A 6GSSA 5IIZA 3ZMKA 1S3AA 2B1KA 2MYGA 2BMXA 1B8XA 1QK8A 1ST9A 3F3RA 3A2XA 1T4YA 3M3MA 5KOWA 1T7PB 1AC1A 1AIUA 2WRTA 3H79A 2OADA 4J56E 3H93A 3IK9A 4L5OA 2XJTA 1XBSA 4D73B 3HJOA 1B13A 2HRAA 2CAQA 2VO4A 4F0BA 3I9V2 3VLNA 1ERUA 3PWFA 2O87A 5J41A 3FR9A 1T9OA 4LL1B 1PD21 5GAND 2K8SA 2R0CA 2EIOA 4F82A 3US3A 5BMUA 1NW2A 1YUXA 2B5XA 1U87A 3G7IA 2G2QA 5ELAA 2DBCA 4I6XA 2DC5A 1H7VA 1M2AA 2C3NA 2YNXA 3D22A 2JSYA 2I3YA 2B1LA 3MSUA 3RHCA 3TUEA 1SJZA 2H0GA 4EL1A 4E8HA 5IMCA 4MP4A 3ZYWA 2HFDA 1K0AA 1XVWA 2GVPA 2HR5A 4OWYA 2RLIA 3FYGA 4IVFA 3L9VA 4KDXA 3D0ZA 5CAXA 2RDVA 1T00A 2XJPA 2E7PA 4HZ4A 1A2MA 2YCDA 3L9SA 3ERGA 2NDOA 1SL2B 3LORA 1QFNA 3Q74A 1EZKA 2H1AA 2HSYA 1JFUA 2KN9A 1GUHA 1X9SB 5HR3A 3RYGA 1WOUA 1V40A 2R0GA 2UZ8A 4TVEA 3IPZA 1MDKA 1AQXA 1CQGA 2ZCTA 4KH7A 5DAKA 1C72A 5D93A 1YEXA 2IFQB 1G6YA 4IGJA 3HZ4A 4XCSA 4QL9A 3TB2A 2VL6A 3DGQA 3VPTA 5MFPA 3W8SA 4AI1A 1FVJA 3LYKA 1ACVA 2ON7A 4B8CD 2H6ZA 2H76A 2AUVA 4XXBB 2C8UA 2KOKA 3GNJA 2VL3A 2N5FA 2FGXA 4Z2RA 4AJ8A 4JR4A 3FR3A 4PTSA 1SJ6A 4TRXA 4K5SA 3VWVA 3MSZA 3AY8A 1A2LA 2VLVA 2H30A 4L0WA 3KXOA 4N11A 2DIZA 1JLVA 5E59A 1MD4A 5G5EA 1Y6EA 2IL3A 1NHYA 3FHKA 2CZ3A 3RZ6A 4ZL7A 2PVQA 3BJ5A 2DMLA 3D21A 2XBIA 4LMVA 2IJYA 4ZL8A 1SMWA 3A2VA 4HQZA 5GAHc 2IN3A 4PURA 2AV4A 4AF2A 2H72A 4N0VA 1BEDA 4U671 4TR1A 4IJIA 2I1UA 5G1KA 1GLPA 1NSWA 3EURA 1R0IA 1K3LA 3PKIA 4DSSB 4POGA 2OA7A 4FO5A 4NHWA 2YP6A 4Z7XA 3UOMA 2H6XA 4MF5A 2VL2C 5AI3A 1JZRA 5ECSA 2VCWA 4G2EA 1J9BA 4JAFA 5H1Sc 1Q4JA 3CSJA 3HDCA 2LQQA 4EIQA 1YDKA 1VZGA 3GHAA 3WT1A 2OE3A 4XS4A 5ECIB 2FNOA 4XHMA 4V2LA 3E9JB 2A6HD 4ZBAA 2LRTA 3TKQA 1Q98A 3DYRA 4I2UA 2I4AA 4WEYA 5DVBA 4MH2A 2LV3A 3H1NA 3QAVA 2B6MA 4ZBDA 5IOXA 2H0HA 2FHEA 2V6OA 3Q18A 5DBQA 3GL3A 2CVBA 4DVCA 2CX3A 1RDGA 2AAWA 4P3YB 5GZZB 1PN9A 2A2PA 2J9HA 3KH9A 3L4NA 3KM6A 4QQ7A 4OFTA 4RI7A 4MPFA 2OBKA 3JCML 1GTIA 2F8FA 2KUCA 3GX0A 4EDZA 2H66A 1XVQA 2H19A 4TXOB 2NTOA 1DE1A 3DKSA 4RQXA 4BL7A 5DALB 4WXTA 2CT6A 5CYYA 5ELGA 2YV9A 3IDVA 2OKAA 3ISOA 3IXRA 5DCGA 1HQOA 1V9WA 5AISA 2HSHA 2HRNA 1TK8B 2H73A 2MMZA 1TK0B 1B2OA 1XPVA 1O7UA 4E8EA 2GT6A 1FHHA 2C1YA 1EV4A 4MJAA 2X8CA 1R5AA 3ERWA 2ALBA 4YH2A 1GRXA 3LGCA 1GWCA 3RDWA 4BVYB 3BCIA 3ZZXA 3IE3A 1B4QA 2CV4A 2AJQB 1DSBA 2A68D 2A2RA 2JL4A 1EOGA 1RDVA 3APSA 1KNGA 4I5QA 4EE0A 3VWXA 1GUMA 2QKEA 3VWWA 3HYPA 4OFNA 1O81A 5JCGA 5L71A 8RXNA 4BPYA 1B4PA 4XIHA 2LJRA 3G9BA 4L8EA 5F05A 4HQSA 3PZAA 3RPNA 22GSA 4IHUA 1I9DA 1RB9A 2DLXA 3QAWA 2L5OA 1FG4A 2GGTA 3ZMLA 1LU4A 4YQVA 3P90A 3LQ7A 3PR8A 3VWUA 1GTAA 3LFLA 3KH7A 3A44A 3F3QA 4KUNA 5D9XA 1K0BA 4PQIA 4LA1A 2CKAA 3IK7A 2V0EA 4ECBA 2FUG2 2VUPA 2RM5A 1XCCA 1EV9A 5AI2A 3GKXA 1KEBA 1TRSA 3L9UA 3DXBA 4LHNA 4N30A 2QC7A 3LWAA 3SWLA 1YK5A 4Z2TA 3APOA 4Q5NA 5J3RA 2PSMC 1X5DA 2OBIA 3KP8A 4IJ3A 5EINC 4J57E 2L59A 3F6DA 4K0NA 2PERA 3UIWA 3P2AA 1AQVA 1BQ7A 5IOWA 4GTUA 2F8AA 4POMA 5DJMA 1GSDA 3A5WA 4GQFA 1JZDA 2YWNA 20GSA 3MDKA 1BAYA 2BE5D 3ZTLA 7RXNA 4NPBA 4NXIA 1F6MC 3R3EA 4AR6A 1K3YA 3KYXA 3FY7A 5AIVA 4IS0A 2P5RA 4ICYA 3UVHA 2REMA 2C6BA 14GSA 1A24A 3F63A 5FT3A 1OAZA 3VPBE 1WMJA 1K0NA 3PINA 3ME8A 4WKWA 2AB6A 1SKWB 4MH3A 3CRTA 4ILFA 4I2TA 5EY6A 1RW1A 1FW1A 2VCZA 1SYXA 4JEDA 3TRPA 2A4HA 1X0RA 4G9HA 1AQWA 4GS7D 4RQRA 4K7IA 4ISDA 1T3BA 1RYTA 1T9PA 4BA7A 1JZOA 1VF1A 4GRFA 1EP7A 4WR4A 3J7Y1 2HSMA 1GL8A 1YF0A 4ZBBA 3FZ9A 3ZFLA 3SBCA 3P7XA 1PX7A 1CAAA 3EYTA 5D96A 4BVXA 2C80A 3MPSA 3RZTA 1YKCA 5DDLA 3WGEA 3K35A 2DMMA 2E2MA 2FA4A 2LUSA 1PL1A 4F9ZA 4AGSA 2M80A 5G2ZA 1EWXA 5IMZA 18GSA 4N0ZA 1W4VA 5FWGA 5JVG1 3A2WA 3NFPI 5DAKB 1IW7D 3QFBC 2LCQA 1M2DA 1RQMA 4HZ2A 5HR1A 3FMWA 1USBA 2B7JA 3TJJA 3ZVJA 5H5SA 1F37A 3G7JA 1Z7RA 1XOAA 1R26A 6GSXA 2NYDA 2DJ1A 2A6ED 1YK4A 4POLA 4X0XA 5COHA 3GL5A 2JADA 4TOPA 4NWYA 2VIMA 4AHXA 3HCZA 4AHZA 2V41A 4JBBA 2XPEA 4KGIA 1BYEA 1S24A 3IHGA 3KZQA 1R0HA 1FB6A 3GIXA 4CW9A 2OE0A 1TP9A 1EEMA 5D9TA 1ZMAA 2XJSA 1O85A 2DJ2A 1PRXA 5IMAA 3D4TA 1X9WB 3C71A 1TXXA 1QYBA 5GAEc 4YWMA 3G7YA 4Q5RA 3O3TA 2V3BB 1SJIA 2YZHA 1Z5YE 1OE8A 2X64A 3D5JA 3O76A 2YWIA 2WFCA 5A4UA 3O6TA 2VCXA 3QCPA 1QXHA 4EXJA 7GSSA 3RHBA 1IYHA 2C3QA 4ZN3B 1PGTA 1TDIA 4ML6A 2H01A 2JI3A 3TJFA 2H12A 3UMAA 2PVOC 3QAGA 2JSZA 2X8GA 2EC4A 4PNFA 2TRXA 4TW5A 4X43A 4RUVA 4G0KA 4EC0A 4K5RA 4AHWA 4O5UA 3M1GA 3GH9A 2K8VA 1CQHA 3WWLA 2A69D 2O89A 8GSSA 4L0UA 2HE3A 3LG6A 1ILOA 2LJAA 2PWJA 1TRVA 5IY0A 2OACA 3KYVA 4EDYA 4AI3A 1FHMA 5D9VA 1PSQA 3HKRA 4JAEA 5B6MA 3APQA 2EIRA 5GAPD 5CRGA 2VLTA 6RXNA 2HZEA 2GZYA 1SL1B 2L6DA 3J7Yb 1QMVA 2KP1A 1HYUA 4FIWA 1BJXA 1ON4A 3F8UA 1PA3A 3CSIA 1SMMA 2H74A 2Z3RB 3FZ5A 2CVKA 3GX8A 3C7MA 3GUSA 2HRKA 1PL2A 4X4JA 4HU9A 1WP0A 2GQLA 4K7NA 1F2EA 4BL7B 1MEKA 2RUEA 2R37A 1GTBA 3F4TA 3GSTA 4PUFC 5IO0A 3DD3A 2CKCA 2L5LA 1XW5A 1R7HA 1E6BA 1THOA 4JRRA 2L4CA 2VCVA 4JZQA 3UBKA 4AJ6A 1ODHA 3FK8A 2O8VB 3FKFA 3V1WA 4MA9A 1ZYEA 1G6WA 2LSTA 2PPTA 4JADA 2JU5A 3HZ8A 1GH2A 3KD0A 5EL8A 5MFZA 4J2FA 4XTSA 1JYBA 2XJVA 4K1FA 2GSRA 4GSSA 4MZWA 1TRWA 3OR5A 3HVXA 1VCXA 5JWRB 3UJ1A 2HI7A 3TRXA 4EUYA 2DKIA 1ZYQB 5DQYA 2H0IA 3WD6A 4MK3A 3KYUA 2JACA 3EU3A 4USSA 1NM3A 3LNLA 4NMUA 1SD9A 1SD8A 2MMNA 1H75A 5GAGc 1TKDB 4KAEA 3KEBA 3EMPA 1FOHA 4MMMA 3QFAC 5IPHA 4POFA 2C0EA 4V1Ag 4V2MA 3IC8A 4XGHA 2FWHA 1V98A 2ES7A 3H4KA 1UVZA 2HYXA 4GSTA 5B8AA 1G7OA 1VGLA 1PKZA 2H71A 5CRHA 1VRSD 1ERTA 1J0FA 2N5BA 3CBUA 2WCIA 2JI1A 3ED3A 2PN8A 1QCVA 1OVNA 1Z3EA 4NAXA 2XJQA 2OJLA 4WFN1 3J7Yk 1M99A 6GSVA 1LTLA 2LS5A 1GSUA 2GSQA 4K2XA 3U6VA 1M9AA 4AJ7A 4UY81 5CP1A 1BFYA 1PN0A 1AUCA 1ZYPA 4JE1A 1W89A 1TOFA 2H70A 6GSYA 2VD0A 4V2NA 4HDEA 4O92A 1BQ9A 4DSRA 1A8LA 4RXNA 5H5RA 3KCMA 5HFIA 4LMWA 5C00A 2L6CA 1EEJA 2FCHA 5HFKA 5IPGA 4I8BA 4KDUA 2MBSA 2PGTA 2GQKA 5G5FA 5AN9H 2CAIA 2DKHA 1HNBA 2DSXA 4XRDA 2MBTA 4ZB9A 4K6XA 1Z6MA 4WBRD 2TIRA 3VURA 1XW6A 2LEGA 2M46A 2X8HA 2B3SA 1R0JA 1EGRA 3FEUA 2FWFA 3TOTA 3ZVJD 1S2ZA 2M6OA 5GSTA 2GQMA 2GZZA 2QGVA 2R0PA 4FH8A 2RIIA 12GSA 2IWTA 5B6NA 1GSYA 2HNLA 4BWQA 3EMXA 3ZITA 2PUKC 2QA1A 4WF5A 4FQUA 2HZFA 4LL4B 4DSQA 3IRAA 3BOAA 1MTCA 4WR5A 4K0GA 1DUGA 1YQ1A 2JZRA 1PKWA 2O5JD 4NHZA 3QR6A 1MD3A 2M72A 1Z9HA 2K6VA 2AYTA 2V1MA 3HVSA 5MGNA 4KA0A 4JAGA 1OKDA 1Z7PA 3RBTA 4BVXB 2HT9A 3D4MA 1TJDA 1KTEA 4JR6A 1VZHA 2GT5A 1VF3A 3TKPA 1U3IA 4KCEA 4ECIA 1BRFA 3GH6A 3VPQA 1HD2A 5KOXA 1DVBA 3IR4A 2AHEA 2C0GA 5J9BA 1LKPA 4H86A 1WPIA 4GLTA 4PXOA 5ECMB 3EWLA 4X1UA 2K9FA 2E0QA 1UC7A 4KB3A 1XXUA 3BD2A 5E4WA 3KJYA 2YOIA 3MWHA 2DSAA 3CSHA 3GN3A 1MDIA 3LEFA 3P8BA 1YY7A 4MF7A 3GYKA 5AGYA 5JCUA 4KDYA 4MPGA 4GWRA 4Z2UA 3UAPA 2CQ9A 2PVEA 1YUZA 1RYQA 3QVDA 2IMKA 2FA8A 4IELA 2VL2A 3EINA 1WJKA 4PX1A 2I81A 1ZYNA 1M7TA 3IAS2 3KTBA 4PQ1A 2H1BA 4ZIJA 2CZ2A 4GSNA 1OYJA 2NVLA 3A3TA 3NIVA 2H6YA 2L57A 3RAZA 1GUKA 1BG5A 16GSA 1QQ2A 3I69A 1O8WA 3DVWA 2X49A 1WJVA 3LXTA 4IN0A 1FAAA 1TTZA 1XWCA 1AW9A 1XWBA 2VM1A 4G0IA 2AYJA 3F6FA 4WETA 3N5OA 5C04A 3DEXA 2G0FA 3R2QA 3Q19A 2KLXA 4MNNA 1B9XC 3C1RA 2O85A 4IP1A 5LD0A 6GSTA 3N9JA 5ECRB 2WS2A 4GF0A 4BVYA 4K9ZA 3M0FA 1K0MA 3MNGA 4DEJA 4ZXGA 3HY2A 5J9CA 2QSIA 1UA5A 2LQOA 1OWCA 4YAVA 4TR4A 2IMFA 2GDRA 2O7KA 4IBPA 3KYYA 4EVMA 4HI7A 1K0DA 3LPEB 2C4JA 4IQAA 1BX9A 4IKHA 2LRNA 2WZ9A 1FHEA 3EVIA 3HVVA 2KHPA 1TI3A 5G31A 1ERVA 5F07A 3TJBA 4O32A 4ULXA 3F4RA 3FW2A 4XRAA 3KGKA 5JWOB 3DRNA 2H1GA 1N2AA 1OC9A 2K18A 3PIO1 4EIPA 4AHYA 2KP2A 4POKA 1J08A 1NXEA 2EIQA 5GSSA 1A0RP 4YKFA 2I9HA 3DVXA 3GTUA 2VAFA 2HRFA 3FR6A 4GCIA 3GKNA 1EOHA 3ZLPA 4JU5A 4CDOA 3KYWA 3EPTA 5BRTA 1PQNA 3L78A 2ERJA 1T1VA 2PBJA 3HD5A 4F2IA 2YWMA 4ZN1B 3KTLA 3M9JA 4HEA2 5IQYA 3ZIJA 1GLQA 4TPUA 1QUWA 2R2JA 1E2YA 2YJ7A 1Z6NA 4HUAA 1GSSA 4KW6A 3VK9A 1E8JA 3MAKA 1ERWA 1XWGA 2HXKA 3PIP1 5IMFA 3ZFBA 3UBLA 5DM61 3IA1A 1M0UA 3IHQA 2LTKA 4OFMA 3KIJA 1AAZA 2F9SA 4AI0A 5RXNA 1IU5A 2V6KA 4YQUA 4ME3A 3GSSA 4YAPA 2GS3A 1PX6A 3GMFA 5CREA 4A5PA 3RPPA 3GURA 4AR3A 1YEPA 4TR1B 1SENA 1XIYA 1YZXA 3GV1A 1A8YA 4YQMA 4TXVA 5F0GA 4WF4A 5F06A 4OD7A 2P0GA 4CHSA 5CNWA 5D9WA 3ZG6A 5FHIA 5J4UA 2YV7A 5EVOA 2VD1A 3LXZA 1SK2A 2VM2A 2K2DA 3WGXA 1ZL9A 4XS4B 4KNDA 2LJKA 2R3XA 3BBYA 3TKSC 1SK1A 1N8JA 3PH9A 4KX4A 5KN2A 1K0OA 1LJRA 4POBA 1G7EA 2R5GA 4E6YA 2A2SA 2R4VA 4MZCA 3VI7A 3TOUA 5ID2A 4KCAA 1IU6A 6GSWA 4F0CA 1XWKA 3HA9A 1S3DA 5ECNB 5ECQB 1TK5B 1SYRA 1O73A 3W6GA 2FY6A 2TRCP 1NNQA 4HJMA 3PKJA 2IIYA 3W8JA 3MIXA 5LCZA 2ERSA 2YWOA 1M2BA 3IV4A 4MZBA 2L0ZA 4FYUA 4KE3A 1U3AA 3TGZA 1AXDA 2XJUA 2GTUA 1SK0A 3KMOA 1OC8A 5HQPA 3U5RE 5MF6A 1F3BA 1G0TA 2V0FA 4IW9A 2FWEA 1K3OA 3E0UA 1TI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5Q A;  3HJM A;  1WWJ A;  1THX A;  5ECO B;  4NV2 A;  5D73 A;  11GS A;  2C0D A;  3UAR A;  2DJ0 A;  5IMD A;  1GSE A;  5G30 A;  2NPB A;  3ZIV A;  3GRX A;  2XPD A;  1GNE A;  5ECP B;  2FD3 A;  5DCH A;  4GXZ A;  5H5Q A;  2VLU A;  4D73 A;  4WBJ A;  3IBH A;  2WDU A;  1S3C A;  2GZP A;  3CMI A;  1XFL A;  2C3T A;  1QGV A;  4IP6 A;  4O7H A;  2LNS A;  5KN0 A;  2WJU A;  2FLS A;  2NBS A;  5INY A;  2F3M A;  1V2A A;  1K0C A;  5ABR A;  1WE0 A;  1UN2 A;  3WT2 A;  1LBK A;  3DML A;  1VF2 A;  4TR0 A;  1X9M B;  2XBQ A;  2RM6 A;  3F9U A;  3GKK A;  3QDN A;  10GS A;  3TJG A;  4EKZ A;  1T4Z A;  2IME A;  2ON5 A;  3L0H A;  4I97 A;  4OO5 A;  1FVK A;  2VL9 A;  1HNA A;  1I5G A;  4TN8 A;  3UL3 A;  5CRW A;  3VI5 A;  1ZCP A;  4ZL9 A;  5F8B A;  1V57 A;  5D8I A;  1WRY A;  3DIE A;  4OO4 A;  2MZC A;  3VFI A;  4GQC A;  4OCF A;  1SL0 B;  3IAM 2;  1R4W A;  4KSM A;  1TW9 A;  4HOJ A;  1GSQ A;  5JCW A;  2ZUP A;  2WB9 A;  4MF6 A;  2PU9 C;  2DJ3 A;  3TKS E;  3C8E A;  1H4O A;  1FO5 A;  3QPM A;  3BCK A;  5KEJ A;  4ACS A;  5LNK e;  2ZNM A;  2DJJ A;  4QL7 A;  3IOS A;  3WGD A;  1OC3 A;  2J23 A;  2P31 A;  2JZT A;  2IFQ A;  3TJK A;  3UEM A;  2CX4 A;  1EP8 A;  3FRC A;  19GS A;  3ZL5 A;  4F03 A;  5J5N A;  3CYN A;  2HLS A;  2BJX A;  4LLR A;  4Q5Q A;  4ECC A;  3TKS A;  1X5C A;  2YZU A;  4MDC A;  4MCU A;  2YJH A;  1RK4 A;  5A5K A;  1NHO A;  4ID0 A;  1HNC A;  3F4S A;  3EC3 A;  13GS A;  3NOF A;  1ZGN A;  5DQS A;  1A2J A;  2LKU A;  1ZOF A;  1TU7 A;  5HFG A;  4XS6 A;  5A4V A;  5ECK B;  4ML1 A;  5IO2 A;  2YPM A;  1O6J A;  1GSF A;  3EU4 A;  1B48 A;  1EGO A;  3NZN A;  1YKA A;  2B7K A;  3CXG A;  1B9Y C;  1YF1 A;  3D6I A;  1IYI A;  1V58 A;  3M8N A;  3C73 A;  4FYC A;  5KN3 A;  4PUA A;  3S9F A;  3GKM A;  5B7C A;  2VCQ A;  4V1A p;  2LNT A;  5IMV A;  5ECL B;  2A4V A;  1X5E A;  4L5L A;  1OE7 A;  3WYW A;  2C0F A;  1XOB A;  4IQ1 A;  1JLW A;  3GA4 A;  2B5Y A;  5CO3 A;  3GFK A;  1ABA A;  2R6K A;  3IC4 A;  5IM9 A;  4DSS A;  3DWV A;  2MMO A;  2H1D A;  4OCE A;  5CRD A;  4PQH A;  3CTG A;  3HXS A;  4NV5 A;  2GLR A;  2J9U B;  1R5P A;  2C6A A;  2IMD A;  4MJE A;  2BTO T;  3TKR A;  3QD9 A;  1OC9 B;  3FZA A;  4K2D A;  2YAN A;  1TRU A;  1FB0 A;  4ZB8 A;  4EF0 A;  4G19 A;  4O5R A;  2XC2 A;  3GTU B;  2F51 A;  1VF4 A;  3LJR A;  3TRQ A;  1XW9 A;  6GSU A;  1URM A;  2DJK A;  3ME7 A;  5JWQ B;  4MAB A;  2V2G A;  1A23 A;  2N5A A;  5A4W A;  4K7O A;  4Q5F A;  3LSZ A;  1PMT A;  1ML6 A;  2WUL A;  3KP9 A;  1SKS B;  3TDG A;  2OE1 A;  1GUL A;  2IPA A;  4G10 A;  1SU9 A;  1JHB A;  1GP1 A;  5ENU A;  3TCO A;  3F0I A;  1F9M A;  3HHV A;  4TXO A;  2CVD A;  1SKR B;  2CA8 A;  4N10 A;  3CRU A;  5DAL A;  1DBY A;  2YN1 A;  2GSS A;  4ZB6 A;  3KMN A;  4MJC A;  1TU8 A;  3CTF A;  3UVT A;  2XHF A;  2LRC A;  2WGR A;  1OKT A;  3FZ4 A;  2VOC A;  3PGT A;  2VCT A;  5EPF A;  1XZO A;  3I43 A;  4K8M A;  4XS1 A;  4ECJ A;  3ZRD A;  2Z9S A;  4TR3 A;  3E3E A;  1O8X A;  1XWA A;  1YJ6 A;  1DE2 A;  1M9B A;  1GNW A;  1U88 A;  2V32 A;  5HR2 A;  4MJB A;  2E2G A;  2GST A;  3QOU A;  2IMI A;  2L4Q A;  2H8L A;  4TKY A;  3C1S A;  1KBN A;  2HZE B;  5ID2 B;  2H75 A;  4PGT A;  2JZS A;  3LYP A;  4PNG A;  5KN1 A;  2D2Z A;  2DIY A;  3B08 B;  2RUF A;  1U6T A;  4ZIL A;  3QMX A;  4OMV A;  2MMA A;  3EE2 A;  5DJL A;  5AIX A;  1A0F A;  3I6A A;  9GSS A;  4FYB A;  5B8B A;  2PMT A;  3B0A B;  1ZZY A;  3Q6O A;  4BWS A;  4RI6 A;  1MDJ A;  2FWG A;  5HR0 A;  5ECH B;  2B5E A;  17GS A;  4MLY A;  3P8W A;  1WIK A;  1JZW A;  2X99 A;  4HU7 A;  1Y25 A;  3H8Q A;  3HJP A;  4EO3 A;  1FOV A;  4HJ2 A;  5AN1 A;  3M9K A;  1T8E B;  1F3A A;  3ZRE A;  4KSO A;  4HS1 A;  5G1L A;  3ERF A;  3K8N A;  1GTU A;  6GSS A;  5IIZ A;  3ZMK A;  1S3A A;  2B1K A;  2MYG A;  2BMX A;  1B8X A;  1QK8 A;  1ST9 A;  3F3R A;  3A2X A;  1T4Y A;  3M3M A;  1T7P B;  1AC1 A;  1AIU A;  2WRT A;  3H79 A;  2OAD A;  4J56 E;  3H93 A;  3IK9 A;  4L5O A;  1XBS A;  4D73 B;  3HJO A;  2CAQ A;  2VO4 A;  4F0B A;  3I9V 2;  3VLN A;  1ERU A;  2O87 A;  5J41 A;  3FR9 A;  4LL1 B;  1PD2 1;  5GAN D;  2K8S A;  2EIO A;  4F82 A;  3US3 A;  1NW2 A;  2B5X A;  1U87 A;  3G7I A;  2G2Q A;  5ELA A;  2DBC A;  4I6X A;  2DC5 A;  1M2A A;  2YNX A;  2C3N A;  3D22 A;  2JSY A;  2I3Y A;  2B1L A;  3RHC A;  3TUE A;  1SJZ A;  2H0G A;  4EL1 A;  4E8H A;  5IMC A;  4MP4 A;  3ZYW A;  2HFD A;  1K0A A;  1XVW A;  2GVP A;  4OWY A;  2RLI A;  3FYG A;  4IVF A;  3L9V A;  4KDX A;  3D0Z A;  5CAX A;  1T00 A;  2E7P A;  4HZ4 A;  1A2M A;  2YCD A;  3L9S A;  3ERG A;  2NDO A;  1SL2 B;  3LOR A;  1QFN A;  3Q74 A;  1EZK A;  2H1A A;  2HSY A;  1JFU A;  1GUH A;  1X9S B;  5HR3 A;  1WOU A;  1V40 A;  4TVE A;  3IPZ A;  1MDK A;  1AQX A;  1CQG A;  2ZCT A;  4KH7 A;  5DAK A;  1C72 A;  5D93 A;  1YEX A;  2IFQ B;  1G6Y A;  4IGJ A;  3HZ4 A;  4XCS A;  4QL9 A;  3TB2 A;  3DGQ A;  3VPT A;  3W8S A;  1FVJ A;  3LYK A;  1ACV A;  2ON7 A;  2H6Z A;  2H76 A;  2AUV A;  4XXB B;  2C8U A;  2KOK A;  3GNJ A;  2VL3 A;  2N5F A;  2FGX A;  4AJ8 A;  4JR4 A;  3FR3 A;  1SJ6 A;  4TRX A;  3VWV A;  3MSZ A;  3AY8 A;  1A2L A;  2VLV A;  2H30 A;  4L0W A;  3KXO A;  4N11 A;  2DIZ A;  1JLV A;  5E59 A;  1MD4 A;  5G5E A;  1Y6E A;  2IL3 A;  1NHY A;  3FHK A;  2CZ3 A;  4ZL7 A;  2PVQ A;  3BJ5 A;  2DML A;  3D21 A;  2XBI A;  4LMV A;  2IJY A;  4ZL8 A;  3A2V A;  4HQZ A;  2IN3 A;  4PUR A;  2AV4 A;  4AF2 A;  2H72 A;  4N0V A;  1BED A;  4TR1 A;  4IJI A;  2I1U A;  5G1K A;  1GLP A;  1NSW A;  3EUR A;  1K3L A;  4DSS B;  2OA7 A;  4FO5 A;  4NHW A;  2YP6 A;  4Z7X A;  3UOM A;  2H6X A;  4MF5 A;  2VL2 C;  1JZR A;  5ECS A;  2VCW A;  4G2E A;  1J9B A;  1Q4J A;  3CSJ A;  3HDC A;  2LQQ A;  1YDK A;  3GHA A;  3WT1 A;  2OE3 A;  4XS4 A;  5ECI B;  2FNO A;  4XHM A;  4V2L A;  3E9J B;  4ZBA A;  2LRT A;  3TKQ A;  1Q98 A;  3DYR A;  4I2U A;  2I4A A;  4WEY A;  5DVB A;  4MH2 A;  2LV3 A;  3H1N A;  3QAV A;  2B6M A;  4ZBD A;  5IOX A;  2H0H A;  2FHE A;  2V6O A;  3Q18 A;  5DBQ A;  3GL3 A;  2CVB A;  4DVC A;  2CX3 A;  2AAW A;  4P3Y B;  5GZZ B;  1PN9 A;  2J9H A;  3KH9 A;  3L4N A;  3KM6 A;  4QQ7 A;  4OFT A;  4RI7 A;  4MPF A;  2OBK A;  3JCM L;  1GTI A;  2F8F A;  2KUC A;  3GX0 A;  4EDZ A;  2H66 A;  1XVQ A;  2H19 A;  4TXO B;  2NTO A;  1DE1 A;  3DKS A;  4RQX A;  4BL7 A;  5DAL B;  4WXT A;  2CT6 A;  5CYY A;  5ELG A;  2YV9 A;  3IDV A;  2OKA A;  3ISO A;  3IXR A;  5DCG A;  1HQO A;  1V9W A;  5AIS A;  2HSH A;  2HRN A;  1TK8 B;  2H73 A;  2MMZ A;  1TK0 B;  1XPV A;  1O7U A;  4E8E A;  2GT6 A;  2C1Y A;  1EV4 A;  4MJA A;  2X8C A;  1R5A A;  3ERW A;  2ALB A;  4YH2 A;  1GRX A;  3LGC A;  1GWC A;  3RDW A;  3BCI A;  3ZZX A;  3IE3 A;  1B4Q A;  2CV4 A;  2AJQ B;  1DSB A;  2A2R A;  2JL4 A;  1EOG A;  3APS A;  1KNG A;  4I5Q A;  4EE0 A;  3VWX A;  1GUM A;  2QKE A;  3VWW A;  3HYP A;  4OFN A;  1O81 A;  5JCG A;  5L71 A;  4BPY A;  1B4P A;  4XIH A;  2LJR A;  3G9B A;  4L8E A;  5F05 A;  4HQS A;  3RPN A;  22GS A;  4IHU A;  1I9D A;  2DLX A;  3QAW A;  2L5O A;  1FG4 A;  2GGT A;  3ZML A;  1LU4 A;  4YQV A;  3P90 A;  3LQ7 A;  3PR8 A;  3VWU A;  1GTA A;  3LFL A;  3KH7 A;  3F3Q A;  4KUN A;  5D9X A;  1K0B A;  4PQI A;  4LA1 A;  3IK7 A;  4ECB A;  2FUG 2;  2VUP A;  2RM5 A;  1XCC A;  1EV9 A;  3GKX A;  1KEB A;  1TRS A;  3L9U A;  3DXB A;  4N30 A;  2QC7 A;  3LWA A;  3SWL A;  3APO A;  4Q5N A;  5J3R A;  2OBI A;  1X5D A;  3KP8 A;  4IJ3 A;  4J57 E;  2L59 A;  3F6D A;  4K0N A;  2PER A;  3UIW A;  3P2A A;  1AQV A;  1BQ7 A;  5IOW A;  4GTU A;  2F8A A;  4POM A;  5DJM A;  1GSD A;  3A5W A;  4GQF A;  1JZD A;  2YWN A;  20GS A;  3MDK A;  1BAY A;  3ZTL A;  4NPB A;  4NXI A;  1F6M C;  1K3Y A;  3FY7 A;  5AIV A;  4IS0 A;  2P5R A;  3UVH A;  2REM A;  2C6B A;  14GS A;  1A24 A;  3F63 A;  5FT3 A;  1OAZ A;  1WMJ A;  1K0N A;  3PIN A;  3ME8 A;  4WKW A;  2AB6 A;  1SKW B;  4MH3 A;  3CRT A;  4ILF A;  4I2T A;  5EY6 A;  1RW1 A;  1FW1 A;  2VCZ A;  1SYX A;  4JED A;  3TRP A;  1X0R A;  4G9H A;  1AQW A;  4RQR A;  4K7I A;  4ISD A;  1T3B A;  4BA7 A;  1JZO A;  1VF1 A;  4GRF A;  1EP7 A;  4WR4 A;  1GL8 A;  1YF0 A;  4ZBB A;  3FZ9 A;  3ZFL A;  3SBC A;  3P7X A;  1PX7 A;  3EYT A;  5D96 A;  4BVX A;  2C80 A;  1YKC A;  5DDL A;  3WGE A;  2DMM A;  2E2M A;  2FA4 A;  2LUS A;  1PL1 A;  4F9Z A;  4AGS A;  2M80 A;  5G2Z A;  1EWX A;  5IMZ A;  18GS A;  4N0Z A;  1W4V A;  5FWG A;  3A2W A;  5DAK B;  3QFB C;  1M2D A;  1RQM A;  4HZ2 A;  5HR1 A;  1USB A;  2B7J A;  3TJJ A;  3ZVJ A;  5H5S A;  1F37 A;  3G7J A;  1Z7R A;  1XOA A;  1R26 A;  6GSX A;  2DJ1 A;  4POL A;  4X0X A;  5COH A;  3GL5 A;  2JAD A;  4TOP A;  4NWY A;  2VIM A;  3HCZ A;  2V41 A;  4JBB A;  2XPE A;  4KGI A;  1BYE A;  3KZQ A;  3GIX A;  1FB6 A;  4CW9 A;  2OE0 A;  1TP9 A;  1EEM A;  5D9T A;  1ZMA A;  1O85 A;  2DJ2 A;  1PRX A;  5IMA A;  3D4T A;  1X9W B;  3C71 A;  1TXX A;  3G7Y A;  4Q5R A;  3O3T A;  1SJI A;  2YZH A;  1Z5Y E;  1OE8 A;  2X64 A;  3D5J A;  3O76 A;  2YWI A;  2WFC A;  5A4U A;  3O6T A;  2VCX A;  3QCP A;  1QXH A;  4EXJ A;  7GSS A;  3RHB A;  1IYH A;  2C3Q A;  1PGT A;  1TDI A;  4ML6 A;  2H01 A;  3TJF A;  3UMA A;  2PVO C;  3QAG A;  2JSZ A;  2X8G A;  2EC4 A;  4PNF A;  2TRX A;  4TW5 A;  4X43 A;  4RUV A;  4EC0 A;  3M1G A;  3GH9 A;  2K8V A;  1CQH A;  2O89 A;  8GSS A;  4L0U A;  2HE3 A;  3LG6 A;  1ILO A;  2LJA A;  2PWJ A;  1TRV A;  2OAC A;  4EDY A;  5D9V A;  1PSQ A;  3HKR A;  5B6M A;  3APQ A;  2EIR A;  5GAP D;  5CRG A;  2VLT A;  2HZE A;  2GZY A;  1SL1 B;  2L6D A;  3J7Y b;  1QMV A;  2KP1 A;  1HYU A;  4FIW A;  1BJX A;  1ON4 A;  3F8U A;  1PA3 A;  3CSI A;  2H74 A;  3FZ5 A;  2CVK A;  3GX8 A;  3C7M A;  3GUS A;  1PL2 A;  4HU9 A;  1WP0 A;  2GQL A;  4K7N A;  1F2E A;  1MEK A;  2RUE A;  2R37 A;  1GTB A;  3F4T A;  3GST A;  4PUF C;  5IO0 A;  3DD3 A;  2L5L A;  1XW5 A;  1R7H A;  1E6B A;  1THO A;  4JRR A;  2L4C A;  2VCV A;  4JZQ A;  3UBK A;  4AJ6 A;  3FK8 A;  2O8V B;  3FKF A;  3V1W A;  4MA9 A;  1ZYE A;  1G6W A;  2LST A;  2PPT A;  2JU5 A;  3HZ8 A;  1GH2 A;  3KD0 A;  5EL8 A;  4J2F A;  4XTS A;  4K1F A;  2GSR A;  4GSS A;  4MZW A;  1TRW A;  3OR5 A;  3HVX A;  5JWR B;  3UJ1 A;  2HI7 A;  3TRX A;  4EUY A;  1ZYQ B;  5DQY A;  2H0I A;  3WD6 A;  4MK3 A;  2JAC A;  3EU3 A;  1NM3 A;  4NMU A;  1SD9 A;  1SD8 A;  2MMN A;  1H75 A;  1TKD B;  4KAE A;  3KEB A;  3EMP A;  4MMM A;  5IPH A;  3QFA C;  2C0E A;  4V1A g;  4V2M A;  2FWH A;  1V98 A;  2ES7 A;  3H4K A;  1UVZ A;  2HYX A;  4GST A;  5B8A A;  1G7O A;  1VGL A;  1PKZ A;  2H71 A;  5CRH A;  1VRS D;  1ERT A;  1J0F A;  2N5B A;  3CBU A;  2WCI A;  3ED3 A;  2PN8 A;  1OVN A;  1Z3E A;  4NAX A;  2OJL A;  3J7Y k;  1M99 A;  6GSV A;  2LS5 A;  1GSU A;  2GSQ A;  3U6V A;  1M9A A;  4AJ7 A;  5CP1 A;  1AUC A;  4JE1 A;  1W89 A;  1TOF A;  2H70 A;  6GSY A;  2VD0 A;  4V2N A;  4HDE A;  4O92 A;  4DSR A;  1A8L A;  5H5R A;  3KCM A;  5HFI A;  4LMW A;  5C00 A;  2L6C A;  1EEJ A;  2FCH A;  5HFK A;  5IPG A;  4I8B A;  4KDU A;  2MBS A;  2PGT A;  2GQK A;  5G5F A;  2CAI A;  1HNB A;  4XRD A;  2MBT A;  4ZB9 A;  4K6X A;  1Z6M A;  4WBR D;  2TIR A;  3VUR A;  1XW6 A;  2LEG A;  2M46 A;  2X8H A;  2B3S A;  1EGR A;  3FEU A;  2FWF A;  3TOT A;  3ZVJ D;  5GST A;  2GQM A;  2GZZ A;  2QGV A;  4FH8 A;  2RII A;  12GS A;  2IWT A;  5B6N A;  1GSY A;  2HNL A;  4BWQ A;  3EMX A;  3ZIT A;  2PUK C;  4WF5 A;  2HZF A;  4LL4 B;  4DSQ A;  3IRA A;  3BOA A;  1MTC A;  4WR5 A;  4K0G A;  1DUG A;  1YQ1 A;  2JZR A;  1PKW A;  4NHZ A;  3QR6 A;  1MD3 A;  2M72 A;  1Z9H A;  2K6V A;  2AYT A;  2V1M A;  3HVS A;  4KA0 A;  1OKD A;  1Z7P A;  3RBT A;  2HT9 A;  3D4M A;  1TJD A;  1KTE A;  4JR6 A;  2GT5 A;  1VF3 A;  3TKP A;  1U3I A;  4KCE A;  4ECI A;  3GH6 A;  3VPQ A;  1HD2 A;  3IR4 A;  2AHE A;  2C0G A;  5J9B A;  4H86 A;  1WPI A;  4GLT A;  4PXO A;  5ECM B;  3EWL A;  4X1U A;  2K9F A;  2E0Q A;  1UC7 A;  4KB3 A;  1XXU A;  3BD2 A;  5E4W A;  3KJY A;  2YOI A;  3MWH A;  2DSA A;  3CSH A;  3GN3 A;  1MDI A;  3LEF A;  1YY7 A;  4MF7 A;  3GYK A;  5AGY A;  5JCU A;  4KDY A;  4MPG A;  4GWR A;  3UAP A;  2CQ9 A;  2IMK A;  2FA8 A;  4IEL A;  2VL2 A;  3EIN A;  1WJK A;  4PX1 A;  2I81 A;  1M7T A;  3IAS 2;  3KTB A;  4PQ1 A;  2H1B A;  4ZIJ A;  2CZ2 A;  4GSN A;  1OYJ A;  2NVL A;  3A3T A;  3NIV A;  2H6Y A;  2L57 A;  3RAZ A;  1GUK A;  1BG5 A;  16GS A;  1QQ2 A;  3I69 A;  1O8W A;  3DVW A;  3LXT A;  4IN0 A;  1FAA A;  1TTZ A;  1XWC A;  1AW9 A;  1XWB A;  2VM1 A;  3F6F A;  4WET A;  3N5O A;  5C04 A;  3DEX A;  2G0F A;  3R2Q A;  3Q19 A;  2KLX A;  1B9X C;  3C1R A;  2O85 A;  4IP1 A;  5LD0 A;  6GST A;  3N9J A;  5ECR B;  2WS2 A;  4GF0 A;  4BVY A;  4K9Z A;  3M0F A;  1K0M A;  3MNG A;  4DEJ A;  4ZXG A;  3HY2 A;  5J9C A;  2QSI A;  1UA5 A;  2LQO A;  4YAV A;  4TR4 A;  2IMF A;  2GDR A;  2O7K A;  4IBP A;  4EVM A;  4HI7 A;  1K0D A;  2C4J A;  4IQA A;  1BX9 A;  4IKH A;  2LRN A;  2WZ9 A;  1FHE A;  3EVI A;  3HVV A;  2KHP A;  1TI3 A;  5G31 A;  1ERV A;  5F07 A;  3TJB A;  4O32 A;  4ULX A;  3F4R A;  3FW2 A;  4XRA A;  3KGK A;  5JWO B;  3DRN A;  2H1G A;  1N2A A;  1OC9 A;  2K18 A;  2KP2 A;  4POK A;  1J08 A;  2EIQ A;  5GSS A;  1A0R P;  2I9H A;  3DVX A;  3GTU A;  2VAF A;  2HRF A;  3FR6 A;  4GCI A;  3GKN A;  1EOH A;  3ZLP A;  4JU5 A;  4CDO A;  1PQN A;  3L78 A;  1T1V A;  2PBJ A;  3HD5 A;  4F2I A;  2YWM A;  3KTL A;  3M9J A;  4HEA 2;  5IQY A;  3ZIJ A;  1GLQ A;  1QUW A;  2R2J A;  1E2Y A;  2YJ7 A;  1Z6N A;  4HUA A;  4KW6 A;  1GSS A;  3VK9 A;  3MAK A;  1ERW A;  1XWG A;  2HXK A;  5IMF A;  3ZFB A;  3UBL A;  3IA1 A;  1M0U A;  3IHQ A;  2LTK A;  4OFM A;  1AAZ A;  2F9S A;  3KIJ A;  2V6K A;  4YQU A;  3GSS A;  4YAP A;  2GS3 A;  1PX6 A;  3GMF A;  5CRE A;  3RPP A;  3GUR A;  1YEP A;  4TR1 B;  1SEN A;  1XIY A;  1YZX A;  3GV1 A;  1A8Y A;  4YQM A;  4TXV A;  5F0G A;  4WF4 A;  5F06 A;  4OD7 A;  2P0G A;  4CHS A;  5CNW A;  5D9W A;  5FHI A;  5J4U A;  2YV7 A;  5EVO A;  2VD1 A;  3LXZ A;  1SK2 A;  2VM2 A;  3WGX A;  1ZL9 A;  4XS4 B;  4KND A;  2LJK A;  2R3X A;  3BBY A;  3TKS C;  1SK1 A;  1N8J A;  3PH9 A;  4KX4 A;  5KN2 A;  1K0O A;  1LJR A;  4POB A;  1G7E A;  2R5G A;  2A2S A;  2R4V A;  4MZC A;  3VI7 A;  3TOU A;  5ID2 A;  4KCA A;  6GSW A;  4F0C A;  1XWK A;  5ECN B;  1S3D A;  3HA9 A;  5ECQ B;  1TK5 B;  1SYR A;  1O73 A;  3W6G A;  2FY6 A;  2TRC P;  4HJM A;  2IIY A;  3W8J A;  5LCZ A;  2YWO A;  1M2B A;  3IV4 A;  4MZB A;  4FYU A;  4KE3 A;  1U3A A;  3TGZ A;  1AXD A;  2GTU A;  1SK0 A;  3KMO A;  1OC8 A;  5HQP A;  3U5R E;  1F3B A;  1G0T A;  4IW9 A;  2FWE A;  1K3O A;  3E0U A;  1TI1 A; 
#chains in the Genus database with same CATH topology
 2P5Q A;  3HJM A;  1WWJ A;  1THX A;  5ECO B;  4NV2 A;  5D73 A;  11GS A;  2C0D A;  3UAR A;  1NXG A;  2DJ0 A;  5IMD A;  1GSE A;  4LHL A;  5G30 A;  2NPB A;  3ZIV A;  3GRX A;  3S1M L;  4TVM A;  2XPD A;  1GNE A;  5ECP B;  2FD3 A;  3LWV B;  4AR4 A;  5DCH A;  4GXZ A;  5H5Q A;  2VLU A;  4D73 A;  2JA5 L;  4WBJ A;  3IBH A;  2WDU A;  1S3C A;  2E2J L;  1R0G A;  2GZP A;  3CMI A;  1XFL A;  2C3T A;  1QGV A;  3IU3 I;  4AI2 A;  4IP6 A;  4O7H A;  2LNS A;  2Z3Q B;  4YKG A;  5KN0 A;  2WJU A;  2NVT L;  2FLS A;  2X4A A;  1RWD A;  2NBS A;  5INY A;  2F3M A;  5IYB L;  1V2A A;  1XG8 A;  1LKO A;  1K0C A;  5ABR A;  1WE0 A;  1UN2 A;  3HAX C;  1PFO A;  3WT2 A;  2QA2 A;  1LBK A;  3DML A;  1VF2 A;  4TR0 A;  2PVX A;  1X9M B;  5MLC 3;  2XBQ A;  5DM7 1;  2RM6 A;  3F9U A;  3GKK A;  3QDN A;  10GS A;  3TJG A;  4EKZ A;  1T4Z A;  2IME A;  2ON5 A;  3L0H A;  4I97 A;  4OO5 A;  1FVK A;  2VL9 A;  1HNA A;  1I5G A;  4TN8 A;  3UL3 A;  5CRW A;  3VI5 A;  1ZCP A;  4ZL9 A;  4CY6 A;  5F8B A;  1V57 A;  5D8I A;  1WRY A;  4V19 6;  3DIE A;  3JR7 A;  4OO4 A;  2MZC A;  3VFI A;  4KF9 A;  5GAD c;  4GQC A;  3HOZ L;  4OCF A;  1SL0 B;  3IAM 2;  1R4W A;  4KSM A;  1TW9 A;  4YWL A;  3GTQ L;  1GSQ A;  4HOJ A;  5JCW A;  2ZUP A;  2WB9 A;  2M4Y A;  2PU9 C;  4MF6 A;  2M6P A;  2DJ3 A;  3TKS E;  3HKZ P;  3C8E A;  1H4O A;  1FO5 A;  3QPM A;  3SS2 A;  3GTP L;  3BCK A;  5KEJ A;  4ACS A;  5LNK e;  4AR5 A;  2ZNM A;  2DJJ A;  4QL7 A;  3IOS A;  3WGD A;  1OC3 A;  5C4J L;  2J23 A;  1C09 A;  2P31 A;  2JZT A;  2IFQ A;  3TJK A;  3UEM A;  2CX4 A;  1EP8 A;  3FRC A;  1SFO L;  1R0F A;  19GS A;  1CAD A;  3ZL5 A;  4F03 A;  5J5N A;  3CYN A;  2HLS A;  2BJX A;  4LLR A;  4Q5Q A;  1T9Q A;  4ECC A;  3TKS A;  1X5C A;  5M5Y L;  2YZU A;  4MDC A;  4MCU A;  4HSC X;  2YJH A;  1RK4 A;  5A5K A;  2M4V A;  1NHO A;  4ID0 A;  1HNC A;  3F4S A;  3EC3 A;  13GS A;  3NOF A;  1ZGN A;  5DQS A;  2CR8 A;  1A2J A;  2LKU A;  2B63 L;  1ZOF A;  1TU7 A;  5HFG A;  4XS6 A;  5A4V A;  5ECK B;  4ML1 A;  5IO2 A;  2YPM A;  1O6J A;  1B71 A;  1GSF A;  4G6B A;  3EU4 A;  1B48 A;  1EGO A;  3NZN A;  1YKA A;  2B7K A;  3CXG A;  1B9Y C;  1YF1 A;  3D6I A;  1IYI A;  1V58 A;  3M8N A;  3C73 A;  4FYC A;  5KN3 A;  4PUA A;  3S9F A;  1BQ8 A;  5EIO C;  3GKM A;  3HJY B;  5B7C A;  2VCQ A;  4V1A p;  2LNT A;  5IMV A;  2KKD A;  1X5E A;  2A4V A;  4L5L A;  5ECL B;  1OE7 A;  3WYW A;  2C0F A;  3HOV L;  2MS3 A;  1XOB A;  4IQ1 A;  1JLW A;  3GA4 A;  2B5Y A;  5CO3 A;  3GFK A;  1ABA A;  2R6K A;  3IC4 A;  5IM9 A;  1DX8 A;  3LW9 A;  4DSS A;  2GMG A;  3DWV A;  2MMO A;  2H1D A;  4OCE A;  5CRD A;  4PQH A;  3CTG A;  5M5X L;  3HXS A;  1OWB A;  4NV5 A;  2GLR A;  2J9U B;  1R5P A;  2C6A A;  2IMD A;  4MJE A;  2BTO T;  4BBR L;  3TKR A;  3QQC E;  3QD9 A;  2XJR A;  3PO2 L;  4A3K L;  1OC9 B;  3FZA A;  4K2D A;  2YAN A;  1TRU A;  1FB0 A;  4ZB8 A;  4EF0 A;  4G19 A;  4O5R A;  2XC2 A;  3LWQ B;  3GTU B;  2F51 A;  1VF4 A;  3LJR A;  3MYD A;  3TRQ A;  1XW9 A;  6GSU A;  5M3M L;  1URM A;  2DJK A;  3ME7 A;  4A3E L;  1PZX A;  5JWQ B;  4MAB A;  2V2G A;  1A23 A;  2N5A A;  5A4W A;  4K7O A;  4Q5F A;  3LSZ A;  1PMT A;  1ML6 A;  2WUL A;  3KP9 A;  2AQC A;  1SKS B;  3TDG A;  2ZIX A;  2OE1 A;  1GUL A;  2IPA A;  4G10 A;  1B2J A;  1SU9 A;  1JHB A;  1GP1 A;  5ENU A;  3TCO A;  3F0I A;  1F9M A;  3HHV A;  4C3H L;  3WWN B;  4G0L A;  4TXO A;  2CVD A;  1SKR B;  2CA8 A;  1VZI A;  4N10 A;  2JI2 A;  3CRU A;  5DAL A;  4A3F L;  1DBY A;  2YN1 A;  3H3V M;  3FKI L;  2GSS A;  4ZB6 A;  2NVQ L;  3KMN A;  4MJC A;  1TU8 A;  3CTF A;  3PPU A;  3UVT A;  2XHF A;  2WGR A;  2LRC A;  1OKT A;  3FZ4 A;  2VOC A;  1Z92 B;  3PGT A;  2VCT A;  5EPF A;  1XZO A;  3I43 A;  4K8M A;  4XS1 A;  4ECJ A;  3ZRD A;  2Z9S A;  4BIK A;  4TR3 A;  3E3E A;  1YV1 A;  1O8X A;  1XWA A;  1YJ6 A;  1DE2 A;  1M9B A;  1GNW A;  1U88 A;  1SMU A;  2QL0 A;  2V32 A;  3J7Z 1;  4BY1 L;  5HR2 A;  4MJB A;  5K2M E;  3S17 L;  2E2G A;  3S16 L;  2GST A;  3QOU A;  2IMI A;  2L4Q A;  2H8L A;  4TKY A;  3C1S A;  1IRN A;  1KBN A;  1BE7 A;  2HZE B;  5ID2 B;  2H75 A;  4PGT A;  2JZS A;  3LYP A;  4PNG A;  5KN1 A;  1ZRP A;  2D2Z A;  2DIY A;  3B08 B;  2RUF A;  2PYA A;  1U6T A;  4ZIL A;  3HVN A;  5JVH 1;  3QMX A;  4OMV A;  2MMA A;  3H99 A;  3EE2 A;  5DJL A;  5AIX A;  1A0F A;  2JA6 L;  3I6A A;  4K9F A;  9GSS A;  4FYB A;  5B8B A;  2PMT A;  3B0A B;  4A3D L;  1ZZY A;  3Q6O A;  2B5I D;  4BWS A;  4RI6 A;  1MDJ A;  2FWG A;  5HR0 A;  5ECH B;  2B5E A;  17GS A;  4MLY A;  3P8W A;  1WIK A;  1JZW A;  2X99 A;  4HU7 A;  1Y25 A;  3H8Q A;  1IRO A;  3HJP A;  4EO3 A;  1FOV A;  4HJ2 A;  5AN1 A;  3M9K A;  1T8E B;  1F3A A;  4O5Q A;  3ZRE A;  4KSO A;  4HS1 A;  1LKM A;  5G1L A;  3ERF A;  3A5I A;  3S15 L;  1S30 A;  3K8N A;  1GTU A;  4CY8 A;  6GSS A;  5IIZ A;  3ZMK A;  1S3A A;  2B1K A;  2MYG A;  2BMX A;  1B8X A;  1QK8 A;  1ST9 A;  3F3R A;  3A2X A;  1T4Y A;  3M3M A;  5KOW A;  1T7P B;  1AC1 A;  1AIU A;  2WRT A;  3H79 A;  2OAD A;  2WB1 P;  4J56 E;  3H93 A;  3IK9 A;  4L5O A;  2XJT A;  1XBS A;  4D73 B;  3HJO A;  1B13 A;  2HRA A;  2CAQ A;  2VO4 A;  4F0B A;  3I9V 2;  3VLN A;  1ERU A;  3PWF A;  3LWR B;  2O87 A;  5J41 A;  3FR9 A;  1T9O A;  1R9T L;  1I6H L;  4LL1 B;  1PD2 1;  5GAN D;  2K8S A;  2R0C A;  2EIO A;  4F82 A;  3US3 A;  5BMU A;  1NW2 A;  1YUX A;  2B5X A;  1U87 A;  3G7I A;  2G2Q A;  5ELA A;  2DBC A;  2DC5 A;  1H7V A;  1M2A A;  2C3N A;  2YNX A;  3D22 A;  4I6X A;  2JSY A;  2I3Y A;  2B1L A;  3MSU A;  3RHC A;  3TUE A;  1SJZ A;  2H0G A;  4EL1 A;  4E8H A;  3HOW L;  5IMC A;  4MP4 A;  3ZYW A;  2HFD A;  1K0A A;  1XVW A;  2GVP A;  1I3Q L;  2HR5 A;  2HVY C;  4OWY A;  2RLI A;  3FYG A;  4IVF A;  3L9V A;  4KDX A;  3D0Z A;  5CAX A;  2RDV A;  1T00 A;  2XJP A;  2E7P A;  4HZ4 A;  1A2M A;  2YCD A;  3L9S A;  3S14 L;  3ERG A;  2NDO A;  1SL2 B;  3LOR A;  1QFN A;  3Q74 A;  1EZK A;  2H1A A;  2HSY A;  1JFU A;  2KN9 A;  1GUH A;  1X9S B;  2YU9 L;  5HR3 A;  3RYG A;  1WOU A;  1V40 A;  2R0G A;  2UZ8 A;  4TVE A;  3IPZ A;  1MDK A;  1AQX A;  1CQG A;  2ZCT A;  4KH7 A;  5DAK A;  1C72 A;  5D93 A;  1YEX A;  2IFQ B;  1G6Y A;  4IGJ A;  3HZ4 A;  4XCS A;  4QL9 A;  3TB2 A;  2VL6 A;  3DGQ A;  3VPT A;  5MFP A;  3W8S A;  4AI1 A;  1FVJ A;  3LYK A;  3PO3 L;  1ACV A;  2ON7 A;  4B8C D;  2H6Z A;  2H76 A;  2AUV A;  4XXB B;  2C8U A;  2KOK A;  3GNJ A;  2VL3 A;  2N5F A;  2FGX A;  4Z2R A;  4AJ8 A;  4JR4 A;  3FR3 A;  4PTS A;  1SJ6 A;  3LWO B;  4TRX A;  4K5S A;  3VWV A;  3MSZ A;  3AY8 A;  1A2L A;  2VUM L;  2VLV A;  2H30 A;  4L0W A;  3KXO A;  4N11 A;  2DIZ A;  1JLV A;  1PFU A;  5E59 A;  1MD4 A;  5G5E A;  1Y6E A;  2IL3 A;  1NHY A;  3FHK A;  2CZ3 A;  3RZ6 A;  4C2M 1;  4ZL7 A;  2PVQ A;  3BJ5 A;  2DML A;  3D21 A;  2XBI A;  4LMV A;  2IJY A;  4ZL8 A;  1SMW A;  3A2V A;  4HQZ A;  5GAH c;  2IN3 A;  4PUR A;  2AV4 A;  4AF2 A;  2H72 A;  4N0V A;  5FJ8 L;  1BED A;  4U67 1;  4TR1 A;  4IJI A;  3HOU L;  2I1U A;  5G1K A;  1GLP A;  1NSW A;  3EUR A;  1TWH L;  1R0I A;  1K3L A;  3PKI A;  4DSS B;  4POG A;  2OA7 A;  4FO5 A;  4NHW A;  2YP6 A;  4Z7X A;  3UOM A;  2H6X A;  4MF5 A;  2VL2 C;  5AI3 A;  1JZR A;  5ECS A;  2VCW A;  4G2E A;  1J9B A;  4JAF A;  5H1S c;  1Q4J A;  2AUS B;  4A3G L;  3CSJ A;  3HDC A;  2LQQ A;  3K7A L;  4EIQ A;  1YDK A;  1VZG A;  3GHA A;  3WT1 A;  2OE3 A;  4XS4 A;  5ECI B;  2FNO A;  3S1R L;  3HOY L;  4XHM A;  4V2L A;  3E9J B;  2A6H D;  4ZBA A;  2LRT A;  3TKQ A;  1Q98 A;  3DYR A;  4I2U A;  2I4A A;  4WEY A;  3CQF A;  5DVB A;  4MH2 A;  2LV3 A;  3H1N A;  3QAV A;  2B6M A;  4ZBD A;  5IOX A;  2H0H A;  2FHE A;  2V6O A;  3Q18 A;  5DBQ A;  3GL3 A;  2CVB A;  4DVC A;  2CX3 A;  1RDG A;  2AAW A;  4P3Y B;  3H9B A;  5GZZ B;  1PN9 A;  2A2P A;  2J9H A;  3KH9 A;  3L4N A;  3KM6 A;  4QQ7 A;  4OFT A;  4RI7 A;  4MPF A;  2OBK A;  3JCM L;  1GTI A;  2F8F A;  2KUC A;  3GX0 A;  4EDZ A;  2H66 A;  1XVQ A;  2H19 A;  4TXO B;  2NTO A;  1DE1 A;  3DKS A;  4RQX A;  4BL7 A;  5DAL B;  4WXT A;  2CT6 A;  5CYY A;  5ELG A;  2YV9 A;  3IDV A;  2OKA A;  3ISO A;  3IXR A;  5DCG A;  1HQO A;  1V9W A;  5AIS A;  2HSH A;  2HRN A;  1TK8 B;  2H73 A;  1PFY A;  2MMZ A;  3I4M L;  1TK0 B;  1B2O A;  1XPV A;  1O7U A;  4E8E A;  2GT6 A;  1FHH A;  2C1Y A;  1EV4 A;  4MJA A;  2X8C A;  1R5A A;  3ERW A;  2ALB A;  4YH2 A;  1GRX A;  3LGC A;  1GWC A;  4C3J L;  3RDW A;  4BVY B;  3BCI A;  4A93 L;  2EY4 E;  3ZZX A;  3IE3 A;  1B4Q A;  2CV4 A;  2AJQ B;  1DSB A;  3H97 A;  2A68 D;  2A2R A;  2JL4 A;  1EOG A;  1RDV A;  3APS A;  1KNG A;  4I5Q A;  1M3J A;  3VWX A;  4EE0 A;  1GUM A;  2QKE A;  3VWW A;  3HYP A;  4OFN A;  3S2H L;  1O81 A;  1PFV A;  5JCG A;  5L71 A;  8RXN A;  4BPY A;  1B4P A;  4XIH A;  2LJR A;  3G9B A;  4L8E A;  5F05 A;  4HQS A;  3PZA A;  3RPN A;  22GS A;  4IHU A;  5M5W L;  2APO B;  1I9D A;  1RB9 A;  2DLX A;  3QAW A;  2L5O A;  1FG4 A;  2GGT A;  3ZML A;  1LU4 A;  4YQV A;  3P90 A;  3LQ7 A;  3PR8 A;  3VWU A;  1GTA A;  3LFL A;  3KH7 A;  3A44 A;  3F3Q A;  4KUN A;  4A3J L;  5D9X A;  1K0B A;  4PQI A;  4LA1 A;  2CKA A;  3IK7 A;  2V0E A;  4ECB A;  2FUG 2;  2VUP A;  2RM5 A;  1XCC A;  1EV9 A;  5AI2 A;  3GKX A;  1KEB A;  1TRS A;  3L9U A;  3DXB A;  5IYC L;  4LHN A;  4N30 A;  2QC7 A;  3LWA A;  3SWL A;  1YK5 A;  4Z2T A;  3APO A;  4Q5N A;  5J3R A;  2PSM C;  1X5D A;  2OBI A;  3KP8 A;  4IJ3 A;  5EIN C;  4J57 E;  2L59 A;  3F6D A;  4K0N A;  2PER A;  3UIW A;  3P2A A;  1AQV A;  1BQ7 A;  5IOW A;  4GTU A;  2F8A A;  4POM A;  5DJM A;  1GSD A;  3A5W A;  4GQF A;  1JZD A;  2YWN A;  20GS A;  3MDK A;  1BAY A;  2BE5 D;  3ZTL A;  7RXN A;  4NPB A;  4NXI A;  1F6M C;  3HJW B;  3R3E A;  4AR6 A;  1K3Y A;  3KYX A;  3FY7 A;  5AIV A;  4IS0 A;  2P5R A;  4ICY A;  3UVH A;  2REM A;  2C6B A;  14GS A;  1A24 A;  3F63 A;  5FT3 A;  1OAZ A;  3VPB E;  1WMJ A;  1K0N A;  3PIN A;  3ME8 A;  4WKW A;  2AB6 A;  1SKW B;  4BBS L;  4MH3 A;  3CRT A;  4ILF A;  2JA8 L;  4I2T A;  1TWG L;  5EY6 A;  4C3I L;  1RW1 A;  1FW1 A;  2VCZ A;  1SYX A;  4A3B L;  4JED A;  3TRP A;  2A4H A;  1X0R A;  4G9H A;  1AQW A;  4GS7 D;  4RQR A;  4K7I A;  4ISD A;  1T3B A;  1RYT A;  1T9P A;  4BA7 A;  1JZO A;  1VF1 A;  4GRF A;  1EP7 A;  4BY7 L;  4WR4 A;  3J7Y 1;  2HSM A;  1GL8 A;  1YF0 A;  4ZBB A;  3FZ9 A;  3ZFL A;  3SBC A;  3P7X A;  1PX7 A;  1CAA A;  3HOX L;  3EYT A;  5D96 A;  4BVX A;  2C80 A;  3MPS A;  3RZT A;  1YKC A;  5DDL A;  3WGE A;  5IP7 L;  3K35 A;  2DMM A;  4BXX L;  2E2M A;  2FA4 A;  2LUS A;  1PL1 A;  4F9Z A;  4AGS A;  2M80 A;  5G2Z A;  1EWX A;  5IMZ A;  5C3E L;  4Y7N L;  18GS A;  4N0Z A;  1W4V A;  5FWG A;  5JVG 1;  3A2W A;  3NFP I;  5DAK B;  1IW7 D;  3QFB C;  2LCQ A;  1M2D A;  1RQM A;  4HZ2 A;  5HR1 A;  3FMW A;  1USB A;  2B7J A;  1P7P A;  3TJJ A;  3ZVJ A;  5H5S A;  1F37 A;  3H9C A;  3G7J A;  1Z7R A;  1XOA A;  1R26 A;  6GSX A;  2NYD A;  2DJ1 A;  2A6E D;  1YK4 A;  4POL A;  4X0X A;  5COH A;  3GL5 A;  2JAD A;  4TOP A;  2E2H L;  4NWY A;  2VIM A;  4AHX A;  3HCZ A;  4AHZ A;  2V41 A;  4JBB A;  2XPE A;  4KGI A;  1BYE A;  1S24 A;  3IHG A;  2NVX L;  3KZQ A;  1R0H A;  1FB6 A;  3GIX A;  4CW9 A;  2OE0 A;  1TP9 A;  1EEM A;  5D9T A;  1ZMA A;  1S3R A;  2XJS A;  1O85 A;  2DJ2 A;  3GTO L;  1PRX A;  5IMA A;  3D4T A;  1X9W B;  3C71 A;  1TXX A;  1QYB A;  1TWC L;  5GAE c;  4YWM A;  3G7Y A;  4Q5R A;  3O3T A;  2V3B B;  1SJI A;  2YZH A;  1Z5Y E;  1OE8 A;  2X64 A;  3D5J A;  3O76 A;  2YWI A;  3H0G L;  2WFC A;  5FLM L;  5A4U A;  3O6T A;  2VCX A;  3QCP A;  1QXH A;  4EXJ A;  7GSS A;  3RHB A;  1IYH A;  2C3Q A;  4ZN3 B;  1PGT A;  1TDI A;  4ML6 A;  2H01 A;  2JI3 A;  3TJF A;  2H12 A;  3UMA A;  2PVO C;  3QAG A;  2JSZ A;  2X8G A;  2EC4 A;  4PNF A;  2TRX A;  4TW5 A;  4X43 A;  4RUV A;  4G0K A;  4EC0 A;  4K5R A;  4AHW A;  4O5U A;  3M1G A;  3GH9 A;  2K8V A;  1CQH A;  3WWL A;  2A69 D;  2O89 A;  3GTL L;  8GSS A;  4L0U A;  2HE3 A;  3LG6 A;  1ILO A;  1F4L A;  2LJA A;  2PWJ A;  1TRV A;  5IY0 A;  2OAC A;  3KYV A;  4EDY A;  4AI3 A;  1FHM A;  5D9V A;  1PSQ A;  3HKR A;  4JAE A;  5B6M A;  3APQ A;  2EIR A;  5GAP D;  5CRG A;  2VLT A;  6RXN A;  2HZE A;  1QQT A;  2GZY A;  1SL1 B;  2L6D A;  3J7Y b;  1QMV A;  2KP1 A;  1HYU A;  4FIW A;  1BJX A;  1ON4 A;  3F8U A;  1PA3 A;  3CSI A;  1PFW A;  1SMM A;  2H74 A;  2Z3R B;  3FZ5 A;  2CVK A;  3GX8 A;  3C7M A;  3GUS A;  2HRK A;  1PL2 A;  4X4J A;  4QIW P;  4HU9 A;  1WP0 A;  2GQL A;  2NVY L;  5C4X L;  4K7N A;  1F2E A;  4BL7 B;  1MEK A;  2RUE A;  2RFK B;  2R37 A;  1GTB A;  3F4T A;  3GST A;  4PUF C;  5IO0 A;  3DD3 A;  2CKC A;  2L5L A;  1XW5 A;  1R7H A;  1E6B A;  1THO A;  4JRR A;  2L4C A;  2VCV A;  4JZQ A;  3UBK A;  4AJ6 A;  1ODH A;  3FK8 A;  2O8V B;  3FKF A;  3V1W A;  4MA9 A;  1ZYE A;  1G6W A;  2LST A;  2PPT A;  4JAD A;  1Y1V L;  2JU5 A;  3HZ8 A;  1GH2 A;  3KD0 A;  5EL8 A;  5MFZ A;  4J2F A;  4XTS A;  1JYB A;  2XJV A;  4K1F A;  2GSR A;  4GSS A;  4MZW A;  1TRW A;  3OR5 A;  3HVX A;  1VCX A;  5JWR B;  3UJ1 A;  2HI7 A;  3TRX A;  4EUY A;  2DKI A;  2Y0S P;  1ZYQ B;  5DQY A;  3RZD L;  2H0I A;  3WD6 A;  2WAQ P;  3GTM L;  4MK3 A;  3KYU A;  2JAC A;  3EU3 A;  4USS A;  1NM3 A;  1M3I A;  3LNL A;  4NMU A;  1SD9 A;  1SD8 A;  2MMN A;  1H75 A;  5GAG c;  1TKD B;  4KAE A;  3KEB A;  3S1N L;  3EMP A;  1FOH A;  4MMM A;  3QFA C;  5IPH A;  4POF A;  2C0E A;  4V1A g;  4V2M A;  3IC8 A;  4XGH A;  2FWH A;  1V98 A;  2ES7 A;  3H4K A;  1UVZ A;  2HYX A;  4GST A;  5B8A A;  1G7O A;  1VGL A;  1PKZ A;  1WCM L;  2H71 A;  5CRH A;  1VRS D;  1ERT A;  1J0F A;  2N5B A;  3CBU A;  2WCI A;  2JI1 A;  3ED3 A;  2PN8 A;  1QCV A;  1OVN A;  1Z3E A;  4NAX A;  2XJQ A;  2OJL A;  4WFN 1;  3J7Y k;  1M99 A;  6GSV A;  1LTL A;  2LS5 A;  1GSU A;  2GSQ A;  4K2X A;  3U6V A;  1M9A A;  4AJ7 A;  4UY8 1;  5CP1 A;  1BFY A;  1PN0 A;  1AUC A;  3MQK B;  1ZYP A;  4JE1 A;  1W89 A;  1TOF A;  2H70 A;  6GSY A;  3CQZ L;  2VD0 A;  4V2N A;  4HDE A;  4O92 A;  1BQ9 A;  4DSR A;  1A8L A;  4RXN A;  5H5R A;  3KCM A;  5HFI A;  4LMW A;  5C00 A;  2L6C A;  1EEJ A;  2FCH A;  5HFK A;  5IPG A;  4I8B A;  4KDU A;  2MBS A;  2PGT A;  2GQK A;  5G5F A;  5AN9 H;  3M4O L;  2CAI A;  2DKH A;  1HNB A;  2R93 L;  2DSX A;  4XRD A;  2MBT A;  4ZB9 A;  4K6X A;  1Z6M A;  4WBR D;  1TWF L;  2TIR A;  3VUR A;  1XW6 A;  2LEG A;  2M46 A;  2X8H A;  2B3S A;  1R0J A;  3S2D L;  1EGR A;  3FEU A;  2FWF A;  3TOT A;  3ZVJ D;  1S2Z A;  2M6O A;  5GST A;  2GQM A;  2GZZ A;  2QGV A;  2R0P A;  4FH8 A;  2RII A;  12GS A;  2IWT A;  5B6N A;  1GSY A;  2HNL A;  4BWQ A;  3EMX A;  3ZIT A;  2PUK C;  2QA1 A;  4WF5 A;  4FQU A;  2HZF A;  4LL4 B;  4DSQ A;  3IRA A;  3BOA A;  1MTC A;  4WR5 A;  4K0G A;  1DUG A;  1YQ1 A;  2JZR A;  1PKW A;  2O5J D;  4NHZ A;  3QR6 A;  1MD3 A;  2M72 A;  1Z9H A;  2K6V A;  2AYT A;  2V1M A;  3HVS A;  5MGN A;  4KA0 A;  4JAG A;  1OKD A;  1Z7P A;  3RBT A;  4BVX B;  2HT9 A;  3D4M A;  1TJD A;  1KTE A;  4JR6 A;  1VZH A;  2GT5 A;  1VF3 A;  3TKP A;  1U3I A;  4KCE A;  4ECI A;  1BRF A;  3GH6 A;  3VPQ A;  1HD2 A;  5KOX A;  1DVB A;  3IR4 A;  2AHE A;  2C0G A;  5J9B A;  1LKP A;  3PL5 A;  4H86 A;  1WPI A;  4GLT A;  4PXO A;  5ECM B;  3EWL A;  4X1U A;  2K9F A;  3GTG L;  4Y52 L;  2E0Q A;  1UC7 A;  4KB3 A;  1XXU A;  3BD2 A;  5E4W A;  3KJY A;  2YOI A;  3MWH A;  2DSA A;  3CSH A;  3GN3 A;  1MDI A;  5M3F L;  3LEF A;  3P8B A;  1YY7 A;  4MF7 A;  3GYK A;  3M3Y L;  5AGY A;  5JCU A;  4KDY A;  4MPG A;  4GWR A;  4Z2U A;  3UAP A;  2CQ9 A;  2PVE A;  1YUZ A;  1RYQ A;  3QVD A;  2IMK A;  2FA8 A;  4IEL A;  2VL2 A;  3EIN A;  1WJK A;  4PX1 A;  2I81 A;  1K83 L;  2JA7 L;  1ZYN A;  1M7T A;  3IAS 2;  3KTB A;  4PQ1 A;  2H1B A;  4ZIJ A;  2CZ2 A;  4GSN A;  1OYJ A;  3S1Q L;  2NVL A;  3A3T A;  3NIV A;  2H6Y A;  2L57 A;  2R7Z L;  3RAZ A;  1GUK A;  1BG5 A;  16GS A;  1QQ2 A;  3I69 A;  1O8W A;  3DVW A;  2X49 A;  1WJV A;  3LXT A;  3GTJ L;  5IYD L;  4IN0 A;  1FAA A;  1TTZ A;  1XWC A;  1AW9 A;  1XWB A;  2VM1 A;  4G0I A;  2AYJ A;  4X6A L;  3F6F A;  4WET A;  3N5O A;  5C04 A;  3DEX A;  2G0F A;  3R2Q A;  3Q19 A;  2KLX A;  4MNN A;  1B9X C;  3C1R A;  2O85 A;  4IP1 A;  5LD0 A;  6GST A;  3N9J A;  5ECR B;  2WS2 A;  4GF0 A;  4BVY A;  4K9Z A;  3M0F A;  1K0M A;  3MNG A;  4DEJ A;  4ZXG A;  3HY2 A;  5J9C A;  2QSI A;  1UA5 A;  2LQO A;  1OWC A;  4YAV A;  4TR4 A;  2IMF A;  2GDR A;  2O7K A;  4IBP A;  1TWA L;  3KYY A;  4EVM A;  4HI7 A;  1K0D A;  3LPE B;  2C4J A;  4IQA A;  1BX9 A;  4IKH A;  2LRN A;  2WZ9 A;  1FHE A;  3EVI A;  3HVV A;  2KHP A;  1TI3 A;  5G31 A;  1ERV A;  5F07 A;  3TJB A;  2PMZ P;  4O32 A;  4ULX A;  3F4R A;  3FW2 A;  3RZO L;  4XRA A;  3KGK A;  5JWO B;  3DRN A;  1Y1W L;  2H1G A;  1N2A A;  1OC9 A;  2K18 A;  3PIO 1;  4EIP A;  4AHY A;  2KP2 A;  4POK A;  1J08 A;  1NXE A;  2EIQ A;  5GSS A;  1A0R P;  4YKF A;  2R92 L;  2I9H A;  3DVX A;  3GTU A;  3I4N L;  2VAF A;  2HRF A;  3FR6 A;  4GCI A;  3GKN A;  1EOH A;  3ZLP A;  4JU5 A;  4CDO A;  3KYW A;  3EPT A;  5BRT A;  1PQN A;  3L78 A;  2ERJ A;  1T1V A;  2PBJ A;  3HD5 A;  4F2I A;  2YWM A;  4ZN1 B;  3KTL A;  3M9J A;  4HEA 2;  5IQY A;  3ZIJ A;  1GLQ A;  4TPU A;  1QUW A;  2R2J A;  1E2Y A;  2YJ7 A;  1Z6N A;  4HUA A;  1GSS A;  4KW6 A;  3VK9 A;  2E2I L;  1E8J A;  3MAK A;  1ERW A;  1XWG A;  2HXK A;  3PIP 1;  5IMF A;  3ZFB A;  3UBL A;  5DM6 1;  3IA1 A;  1M0U A;  3IHQ A;  2LTK A;  1I50 L;  4OFM A;  1AAZ A;  2F9S A;  3KIJ A;  4AI0 A;  5RXN A;  1IU5 A;  2V6K A;  4YQU A;  4ME3 A;  3GSS A;  4YAP A;  2GS3 A;  1PX6 A;  3GMF A;  5CRE A;  4A5P A;  4A3L L;  3RPP A;  3GUR A;  4AR3 A;  1YEP A;  4TR1 B;  1SEN A;  1XIY A;  1YZX A;  3GV1 A;  1A8Y A;  4YQM A;  4AYB P;  4TXV A;  5F0G A;  4WF4 A;  5F06 A;  4OD7 A;  2P0G A;  4CHS A;  5CNW A;  5D9W A;  3ZG6 A;  5FHI A;  5J4U A;  2YV7 A;  5EVO A;  2VD1 A;  3LXZ A;  1SK2 A;  2VM2 A;  2K2D A;  3WGX A;  1ZL9 A;  4XS4 B;  4KND A;  2LJK A;  2R3X A;  3BBY A;  3TKS C;  1SK1 A;  1N8J A;  3PH9 A;  4KX4 A;  5KN2 A;  1K0O A;  1LJR A;  4POB A;  1G7E A;  2R5G A;  4E6Y A;  2A2S A;  2R4V A;  4MZC A;  3VI7 A;  3TOU A;  5ID2 A;  4A3C L;  5C44 L;  4KCA A;  1IU6 A;  6GSW A;  5IP9 L;  4F0C A;  1XWK A;  3HA9 A;  1S3D A;  5ECN B;  5ECQ B;  4A3I L;  1TK5 B;  1SYR A;  1O73 A;  3W6G A;  2FY6 A;  2TRC P;  1NNQ A;  4HJM A;  3PKJ A;  2IIY A;  3W8J A;  3MIX A;  5LCZ A;  2ERS A;  2YWO A;  1M2B A;  3IV4 A;  4MZB A;  2L0Z A;  4FYU A;  4KE3 A;  1U3A A;  3TGZ A;  1AXD A;  2XJU A;  2GTU A;  1SK0 A;  3KMO A;  1OC8 A;  5HQP A;  3U5R E;  5MF6 A;  1F3B A;  1G0T A;  2V0F A;  3FDJ A;  4IW9 A;  2FWE A;  4A3M L;  1K3O A;  3GTK L;  3E0U A;  1TI1 A;  3LWP B; 
#chains in the Genus database with same CATH homology
 2P5Q A;  3HJM A;  1WWJ A;  1THX A;  5ECO B;  4NV2 A;  5D73 A;  11GS A;  2C0D A;  3UAR A;  1NXG A;  2DJ0 A;  5IMD A;  1GSE A;  4LHL A;  5G30 A;  2NPB A;  3ZIV A;  3GRX A;  4TVM A;  2XPD A;  1GNE A;  5ECP B;  2FD3 A;  4AR4 A;  5DCH A;  4GXZ A;  5H5Q A;  2VLU A;  4D73 A;  4WBJ A;  3IBH A;  2WDU A;  1S3C A;  1R0G A;  2GZP A;  3CMI A;  1XFL A;  2C3T A;  1QGV A;  3IU3 I;  4AI2 A;  4IP6 A;  4O7H A;  2LNS A;  2Z3Q B;  4YKG A;  5KN0 A;  2WJU A;  2FLS A;  2X4A A;  1RWD A;  2NBS A;  5INY A;  2F3M A;  1V2A A;  1LKO A;  1K0C A;  5ABR A;  1WE0 A;  1UN2 A;  3WT2 A;  2QA2 A;  1LBK A;  3DML A;  1VF2 A;  4TR0 A;  2PVX A;  1X9M B;  5MLC 3;  2XBQ A;  5DM7 1;  2RM6 A;  3F9U A;  3GKK A;  3QDN A;  10GS A;  3TJG A;  4EKZ A;  1T4Z A;  2IME A;  2ON5 A;  3L0H A;  4I97 A;  4OO5 A;  1FVK A;  2VL9 A;  1HNA A;  1I5G A;  4TN8 A;  3UL3 A;  5CRW A;  3VI5 A;  1ZCP A;  4ZL9 A;  4CY6 A;  5F8B A;  1V57 A;  5D8I A;  1WRY A;  4V19 6;  3DIE A;  4OO4 A;  2MZC A;  3VFI A;  4KF9 A;  5GAD c;  4GQC A;  4OCF A;  1SL0 B;  3IAM 2;  1R4W A;  4KSM A;  1TW9 A;  4YWL A;  4HOJ A;  1GSQ A;  5JCW A;  2ZUP A;  2WB9 A;  2M4Y A;  2PU9 C;  4MF6 A;  2M6P A;  2DJ3 A;  3TKS E;  3C8E A;  1H4O A;  1FO5 A;  3QPM A;  3SS2 A;  3BCK A;  5KEJ A;  4ACS A;  5LNK e;  4AR5 A;  2ZNM A;  2DJJ A;  4QL7 A;  3IOS A;  3WGD A;  1OC3 A;  2J23 A;  1C09 A;  2P31 A;  2JZT A;  2IFQ A;  3TJK A;  3UEM A;  2CX4 A;  1EP8 A;  3FRC A;  1R0F A;  19GS A;  1CAD A;  3ZL5 A;  4F03 A;  5J5N A;  3CYN A;  2HLS A;  2BJX A;  4LLR A;  4Q5Q A;  1T9Q A;  4ECC A;  3TKS A;  1X5C A;  2YZU A;  4MDC A;  4MCU A;  2YJH A;  1RK4 A;  5A5K A;  2M4V A;  1NHO A;  4ID0 A;  1HNC A;  3F4S A;  3EC3 A;  13GS A;  3NOF A;  1ZGN A;  5DQS A;  2CR8 A;  1A2J A;  2LKU A;  1ZOF A;  1TU7 A;  5HFG A;  4XS6 A;  5A4V A;  5ECK B;  4ML1 A;  5IO2 A;  2YPM A;  1O6J A;  1B71 A;  1GSF A;  4G6B A;  3EU4 A;  1B48 A;  1EGO A;  3NZN A;  1YKA A;  2B7K A;  3CXG A;  1B9Y C;  1YF1 A;  3D6I A;  1IYI A;  1V58 A;  3M8N A;  3C73 A;  4FYC A;  5KN3 A;  4PUA A;  3S9F A;  1BQ8 A;  5EIO C;  3GKM A;  5B7C A;  2VCQ A;  4V1A p;  2LNT A;  5IMV A;  2KKD A;  1X5E A;  2A4V A;  4L5L A;  5ECL B;  1OE7 A;  3WYW A;  2C0F A;  2MS3 A;  1XOB A;  4IQ1 A;  1JLW A;  3GA4 A;  2B5Y A;  5CO3 A;  3GFK A;  1ABA A;  2R6K A;  3IC4 A;  5IM9 A;  1DX8 A;  3LW9 A;  4DSS A;  2GMG A;  3DWV A;  2MMO A;  2H1D A;  4OCE A;  5CRD A;  4PQH A;  3CTG A;  3HXS A;  1OWB A;  4NV5 A;  2GLR A;  2J9U B;  1R5P A;  2C6A A;  2IMD A;  4MJE A;  2BTO T;  3TKR A;  3QQC E;  3QD9 A;  2XJR A;  1OC9 B;  3FZA A;  4K2D A;  2YAN A;  1TRU A;  1FB0 A;  4ZB8 A;  4EF0 A;  4G19 A;  4O5R A;  2XC2 A;  3GTU B;  2F51 A;  1VF4 A;  3LJR A;  3MYD A;  3TRQ A;  1XW9 A;  6GSU A;  1URM A;  2DJK A;  3ME7 A;  5JWQ B;  4MAB A;  2V2G A;  1A23 A;  2N5A A;  5A4W A;  4K7O A;  4Q5F A;  3LSZ A;  1PMT A;  1ML6 A;  2WUL A;  3KP9 A;  1SKS B;  3TDG A;  2ZIX A;  2OE1 A;  1GUL A;  2IPA A;  4G10 A;  1B2J A;  1SU9 A;  1JHB A;  1GP1 A;  5ENU A;  3TCO A;  3F0I A;  1F9M A;  3HHV A;  3WWN B;  4G0L A;  4TXO A;  2CVD A;  1SKR B;  2CA8 A;  1VZI A;  4N10 A;  2JI2 A;  3CRU A;  5DAL A;  1DBY A;  2YN1 A;  2GSS A;  4ZB6 A;  3KMN A;  4MJC A;  1TU8 A;  3CTF A;  3PPU A;  3UVT A;  2XHF A;  2LRC A;  2WGR A;  1OKT A;  3FZ4 A;  2VOC A;  1Z92 B;  3PGT A;  2VCT A;  5EPF A;  1XZO A;  3I43 A;  4K8M A;  4XS1 A;  4ECJ A;  3ZRD A;  2Z9S A;  4TR3 A;  3E3E A;  1YV1 A;  1O8X A;  1XWA A;  1YJ6 A;  1DE2 A;  1M9B A;  1GNW A;  1U88 A;  1SMU A;  2QL0 A;  2V32 A;  3J7Z 1;  5HR2 A;  4MJB A;  5K2M E;  2E2G A;  2GST A;  3QOU A;  2IMI A;  2L4Q A;  2H8L A;  4TKY A;  3C1S A;  1IRN A;  1KBN A;  1BE7 A;  2HZE B;  5ID2 B;  2H75 A;  4PGT A;  2JZS A;  3LYP A;  4PNG A;  5KN1 A;  1ZRP A;  2D2Z A;  2DIY A;  3B08 B;  2RUF A;  2PYA A;  1U6T A;  4ZIL A;  5JVH 1;  3QMX A;  4OMV A;  2MMA A;  3EE2 A;  5DJL A;  5AIX A;  1A0F A;  3I6A A;  4K9F A;  9GSS A;  4FYB A;  5B8B A;  2PMT A;  3B0A B;  1ZZY A;  3Q6O A;  2B5I D;  4BWS A;  4RI6 A;  1MDJ A;  2FWG A;  5HR0 A;  5ECH B;  2B5E A;  17GS A;  4MLY A;  3P8W A;  1WIK A;  1JZW A;  2X99 A;  4HU7 A;  1Y25 A;  3H8Q A;  1IRO A;  3HJP A;  4EO3 A;  1FOV A;  4HJ2 A;  5AN1 A;  3M9K A;  1T8E B;  1F3A A;  4O5Q A;  3ZRE A;  4KSO A;  4HS1 A;  1LKM A;  5G1L A;  3ERF A;  3A5I A;  1S30 A;  3K8N A;  1GTU A;  4CY8 A;  6GSS A;  5IIZ A;  3ZMK A;  1S3A A;  2B1K A;  2MYG A;  2BMX A;  1B8X A;  1QK8 A;  1ST9 A;  3F3R A;  3A2X A;  1T4Y A;  3M3M A;  5KOW A;  1T7P B;  1AC1 A;  1AIU A;  2WRT A;  3H79 A;  2OAD A;  4J56 E;  3H93 A;  3IK9 A;  4L5O A;  2XJT A;  1XBS A;  4D73 B;  3HJO A;  1B13 A;  2HRA A;  2CAQ A;  2VO4 A;  4F0B A;  3I9V 2;  3VLN A;  1ERU A;  3PWF A;  2O87 A;  5J41 A;  3FR9 A;  1T9O A;  4LL1 B;  1PD2 1;  5GAN D;  2K8S A;  2R0C A;  2EIO A;  4F82 A;  3US3 A;  5BMU A;  1NW2 A;  1YUX A;  2B5X A;  1U87 A;  3G7I A;  2G2Q A;  5ELA A;  2DBC A;  4I6X A;  2DC5 A;  1H7V A;  1M2A A;  2C3N A;  2YNX A;  3D22 A;  2JSY A;  2I3Y A;  2B1L A;  3MSU A;  3RHC A;  3TUE A;  1SJZ A;  2H0G A;  4EL1 A;  4E8H A;  5IMC A;  4MP4 A;  3ZYW A;  2HFD A;  1K0A A;  1XVW A;  2GVP A;  2HR5 A;  4OWY A;  2RLI A;  3FYG A;  4IVF A;  3L9V A;  4KDX A;  3D0Z A;  5CAX A;  2RDV A;  1T00 A;  2XJP A;  2E7P A;  4HZ4 A;  1A2M A;  2YCD A;  3L9S A;  3ERG A;  2NDO A;  1SL2 B;  3LOR A;  1QFN A;  3Q74 A;  1EZK A;  2H1A A;  2HSY A;  1JFU A;  2KN9 A;  1GUH A;  1X9S B;  5HR3 A;  3RYG A;  1WOU A;  1V40 A;  2R0G A;  2UZ8 A;  4TVE A;  3IPZ A;  1MDK A;  1AQX A;  1CQG A;  2ZCT A;  4KH7 A;  5DAK A;  1C72 A;  5D93 A;  1YEX A;  2IFQ B;  1G6Y A;  4IGJ A;  3HZ4 A;  4XCS A;  4QL9 A;  3TB2 A;  2VL6 A;  3DGQ A;  3VPT A;  5MFP A;  3W8S A;  4AI1 A;  1FVJ A;  3LYK A;  1ACV A;  2ON7 A;  4B8C D;  2H6Z A;  2H76 A;  2AUV A;  4XXB B;  2C8U A;  2KOK A;  3GNJ A;  2VL3 A;  2N5F A;  2FGX A;  4Z2R A;  4AJ8 A;  4JR4 A;  3FR3 A;  4PTS A;  1SJ6 A;  4TRX A;  4K5S A;  3VWV A;  3MSZ A;  3AY8 A;  1A2L A;  2VLV A;  2H30 A;  4L0W A;  3KXO A;  4N11 A;  2DIZ A;  1JLV A;  5E59 A;  1MD4 A;  5G5E A;  1Y6E A;  2IL3 A;  1NHY A;  3FHK A;  2CZ3 A;  3RZ6 A;  4ZL7 A;  2PVQ A;  3BJ5 A;  2DML A;  3D21 A;  2XBI A;  4LMV A;  2IJY A;  4ZL8 A;  1SMW A;  3A2V A;  4HQZ A;  5GAH c;  2IN3 A;  4PUR A;  2AV4 A;  4AF2 A;  2H72 A;  4N0V A;  1BED A;  4U67 1;  4TR1 A;  4IJI A;  2I1U A;  5G1K A;  1GLP A;  1NSW A;  3EUR A;  1R0I A;  1K3L A;  3PKI A;  4DSS B;  4POG A;  2OA7 A;  4FO5 A;  4NHW A;  2YP6 A;  4Z7X A;  3UOM A;  2H6X A;  4MF5 A;  2VL2 C;  5AI3 A;  1JZR A;  5ECS A;  2VCW A;  4G2E A;  1J9B A;  4JAF A;  5H1S c;  1Q4J A;  3CSJ A;  3HDC A;  2LQQ A;  4EIQ A;  1YDK A;  1VZG A;  3GHA A;  3WT1 A;  2OE3 A;  4XS4 A;  5ECI B;  2FNO A;  4XHM A;  4V2L A;  3E9J B;  2A6H D;  4ZBA A;  2LRT A;  3TKQ A;  1Q98 A;  3DYR A;  4I2U A;  2I4A A;  4WEY A;  5DVB A;  4MH2 A;  2LV3 A;  3H1N A;  3QAV A;  2B6M A;  4ZBD A;  5IOX A;  2H0H A;  2FHE A;  2V6O A;  3Q18 A;  5DBQ A;  3GL3 A;  2CVB A;  4DVC A;  2CX3 A;  1RDG A;  2AAW A;  4P3Y B;  5GZZ B;  1PN9 A;  2A2P A;  2J9H A;  3KH9 A;  3L4N A;  3KM6 A;  4QQ7 A;  4OFT A;  4RI7 A;  4MPF A;  2OBK A;  3JCM L;  1GTI A;  2F8F A;  2KUC A;  3GX0 A;  4EDZ A;  2H66 A;  1XVQ A;  2H19 A;  4TXO B;  2NTO A;  1DE1 A;  3DKS A;  4RQX A;  4BL7 A;  5DAL B;  4WXT A;  2CT6 A;  5CYY A;  5ELG A;  2YV9 A;  3IDV A;  2OKA A;  3ISO A;  3IXR A;  5DCG A;  1HQO A;  1V9W A;  5AIS A;  2HSH A;  2HRN A;  1TK8 B;  2H73 A;  2MMZ A;  1TK0 B;  1B2O A;  1XPV A;  1O7U A;  4E8E A;  2GT6 A;  1FHH A;  2C1Y A;  1EV4 A;  4MJA A;  2X8C A;  1R5A A;  3ERW A;  2ALB A;  4YH2 A;  1GRX A;  3LGC A;  1GWC A;  3RDW A;  4BVY B;  3BCI A;  3ZZX A;  3IE3 A;  1B4Q A;  2CV4 A;  2AJQ B;  1DSB A;  2A68 D;  2A2R A;  2JL4 A;  1EOG A;  1RDV A;  3APS A;  1KNG A;  4I5Q A;  4EE0 A;  3VWX A;  1GUM A;  2QKE A;  3VWW A;  3HYP A;  4OFN A;  1O81 A;  5JCG A;  5L71 A;  8RXN A;  4BPY A;  1B4P A;  4XIH A;  2LJR A;  3G9B A;  4L8E A;  5F05 A;  4HQS A;  3PZA A;  3RPN A;  22GS A;  4IHU A;  1I9D A;  1RB9 A;  2DLX A;  3QAW A;  2L5O A;  1FG4 A;  2GGT A;  3ZML A;  1LU4 A;  4YQV A;  3P90 A;  3LQ7 A;  3PR8 A;  3VWU A;  1GTA A;  3LFL A;  3KH7 A;  3A44 A;  3F3Q A;  4KUN A;  5D9X A;  1K0B A;  4PQI A;  4LA1 A;  2CKA A;  3IK7 A;  2V0E A;  4ECB A;  2FUG 2;  2VUP A;  2RM5 A;  1XCC A;  1EV9 A;  5AI2 A;  3GKX A;  1KEB A;  1TRS A;  3L9U A;  3DXB A;  4LHN A;  4N30 A;  2QC7 A;  3LWA A;  3SWL A;  1YK5 A;  4Z2T A;  3APO A;  4Q5N A;  5J3R A;  2PSM C;  1X5D A;  2OBI A;  3KP8 A;  4IJ3 A;  5EIN C;  4J57 E;  2L59 A;  3F6D A;  4K0N A;  2PER A;  3UIW A;  3P2A A;  1AQV A;  1BQ7 A;  5IOW A;  4GTU A;  2F8A A;  4POM A;  5DJM A;  1GSD A;  3A5W A;  4GQF A;  1JZD A;  2YWN A;  20GS A;  3MDK A;  1BAY A;  2BE5 D;  3ZTL A;  7RXN A;  4NPB A;  4NXI A;  1F6M C;  3R3E A;  4AR6 A;  1K3Y A;  3KYX A;  3FY7 A;  5AIV A;  4IS0 A;  2P5R A;  4ICY A;  3UVH A;  2REM A;  2C6B A;  14GS A;  1A24 A;  3F63 A;  5FT3 A;  1OAZ A;  3VPB E;  1WMJ A;  1K0N A;  3PIN A;  3ME8 A;  4WKW A;  2AB6 A;  1SKW B;  4MH3 A;  3CRT A;  4ILF A;  4I2T A;  5EY6 A;  1RW1 A;  1FW1 A;  2VCZ A;  1SYX A;  4JED A;  3TRP A;  2A4H A;  1X0R A;  4G9H A;  1AQW A;  4GS7 D;  4RQR A;  4K7I A;  4ISD A;  1T3B A;  1RYT A;  1T9P A;  4BA7 A;  1JZO A;  1VF1 A;  4GRF A;  1EP7 A;  4WR4 A;  3J7Y 1;  2HSM A;  1GL8 A;  1YF0 A;  4ZBB A;  3FZ9 A;  3ZFL A;  3SBC A;  3P7X A;  1PX7 A;  1CAA A;  3EYT A;  5D96 A;  4BVX A;  2C80 A;  3MPS A;  3RZT A;  1YKC A;  5DDL A;  3WGE A;  3K35 A;  2DMM A;  2E2M A;  2FA4 A;  2LUS A;  1PL1 A;  4F9Z A;  4AGS A;  2M80 A;  5G2Z A;  1EWX A;  5IMZ A;  18GS A;  4N0Z A;  1W4V A;  5FWG A;  5JVG 1;  3A2W A;  3NFP I;  5DAK B;  1IW7 D;  3QFB C;  2LCQ A;  1M2D A;  1RQM A;  4HZ2 A;  5HR1 A;  3FMW A;  1USB A;  2B7J A;  3TJJ A;  3ZVJ A;  5H5S A;  1F37 A;  3G7J A;  1Z7R A;  1XOA A;  1R26 A;  6GSX A;  2NYD A;  2DJ1 A;  2A6E D;  1YK4 A;  4POL A;  4X0X A;  5COH A;  3GL5 A;  2JAD A;  4TOP A;  4NWY A;  2VIM A;  4AHX A;  3HCZ A;  4AHZ A;  2V41 A;  4JBB A;  2XPE A;  4KGI A;  1BYE A;  1S24 A;  3IHG A;  3KZQ A;  1R0H A;  1FB6 A;  3GIX A;  4CW9 A;  2OE0 A;  1TP9 A;  1EEM A;  5D9T A;  1ZMA A;  2XJS A;  1O85 A;  2DJ2 A;  1PRX A;  5IMA A;  3D4T A;  1X9W B;  3C71 A;  1TXX A;  1QYB A;  5GAE c;  4YWM A;  3G7Y A;  4Q5R A;  3O3T A;  2V3B B;  1SJI A;  2YZH A;  1Z5Y E;  1OE8 A;  2X64 A;  3D5J A;  3O76 A;  2YWI A;  2WFC A;  5A4U A;  3O6T A;  2VCX A;  3QCP A;  1QXH A;  4EXJ A;  7GSS A;  3RHB A;  1IYH A;  2C3Q A;  4ZN3 B;  1PGT A;  1TDI A;  4ML6 A;  2H01 A;  2JI3 A;  3TJF A;  2H12 A;  3UMA A;  2PVO C;  3QAG A;  2JSZ A;  2X8G A;  2EC4 A;  4PNF A;  2TRX A;  4TW5 A;  4X43 A;  4RUV A;  4G0K A;  4EC0 A;  4K5R A;  4AHW A;  4O5U A;  3M1G A;  3GH9 A;  2K8V A;  1CQH A;  3WWL A;  2A69 D;  2O89 A;  8GSS A;  4L0U A;  2HE3 A;  3LG6 A;  1ILO A;  2LJA A;  2PWJ A;  1TRV A;  5IY0 A;  2OAC A;  3KYV A;  4EDY A;  4AI3 A;  1FHM A;  5D9V A;  1PSQ A;  3HKR A;  4JAE A;  5B6M A;  3APQ A;  2EIR A;  5GAP D;  5CRG A;  2VLT A;  6RXN A;  2HZE A;  2GZY A;  1SL1 B;  2L6D A;  3J7Y b;  1QMV A;  2KP1 A;  1HYU A;  4FIW A;  1BJX A;  1ON4 A;  3F8U A;  1PA3 A;  3CSI A;  1SMM A;  2H74 A;  2Z3R B;  3FZ5 A;  2CVK A;  3GX8 A;  3C7M A;  3GUS A;  2HRK A;  1PL2 A;  4X4J A;  4HU9 A;  1WP0 A;  2GQL A;  4K7N A;  1F2E A;  4BL7 B;  1MEK A;  2RUE A;  2R37 A;  1GTB A;  3F4T A;  3GST A;  4PUF C;  5IO0 A;  3DD3 A;  2CKC A;  2L5L A;  1XW5 A;  1R7H A;  1E6B A;  1THO A;  4JRR A;  2L4C A;  2VCV A;  4JZQ A;  3UBK A;  4AJ6 A;  1ODH A;  3FK8 A;  2O8V B;  3FKF A;  3V1W A;  4MA9 A;  1ZYE A;  1G6W A;  2LST A;  2PPT A;  4JAD A;  2JU5 A;  3HZ8 A;  1GH2 A;  3KD0 A;  5EL8 A;  5MFZ A;  4J2F A;  4XTS A;  1JYB A;  2XJV A;  4K1F A;  2GSR A;  4GSS A;  4MZW A;  1TRW A;  3OR5 A;  3HVX A;  1VCX A;  5JWR B;  3UJ1 A;  2HI7 A;  3TRX A;  4EUY A;  2DKI A;  1ZYQ B;  5DQY A;  2H0I A;  3WD6 A;  4MK3 A;  3KYU A;  2JAC A;  3EU3 A;  4USS A;  1NM3 A;  3LNL A;  4NMU A;  1SD9 A;  1SD8 A;  2MMN A;  1H75 A;  5GAG c;  1TKD B;  4KAE A;  3KEB A;  3EMP A;  1FOH A;  4MMM A;  3QFA C;  5IPH A;  4POF A;  2C0E A;  4V1A g;  4V2M A;  3IC8 A;  4XGH A;  2FWH A;  1V98 A;  2ES7 A;  3H4K A;  1UVZ A;  2HYX A;  4GST A;  5B8A A;  1G7O A;  1VGL A;  1PKZ A;  2H71 A;  5CRH A;  1VRS D;  1ERT A;  1J0F A;  2N5B A;  3CBU A;  2WCI A;  2JI1 A;  3ED3 A;  2PN8 A;  1QCV A;  1OVN A;  1Z3E A;  4NAX A;  2XJQ A;  2OJL A;  4WFN 1;  3J7Y k;  1M99 A;  6GSV A;  1LTL A;  2LS5 A;  1GSU A;  2GSQ A;  4K2X A;  3U6V A;  1M9A A;  4AJ7 A;  4UY8 1;  5CP1 A;  1BFY A;  1PN0 A;  1AUC A;  1ZYP A;  4JE1 A;  1W89 A;  1TOF A;  2H70 A;  6GSY A;  2VD0 A;  4V2N A;  4HDE A;  4O92 A;  1BQ9 A;  4DSR A;  1A8L A;  4RXN A;  5H5R A;  3KCM A;  5HFI A;  4LMW A;  5C00 A;  2L6C A;  1EEJ A;  2FCH A;  5HFK A;  5IPG A;  4I8B A;  4KDU A;  2MBS A;  2PGT A;  2GQK A;  5G5F A;  5AN9 H;  2CAI A;  2DKH A;  1HNB A;  2DSX A;  4XRD A;  2MBT A;  4ZB9 A;  4K6X A;  1Z6M A;  4WBR D;  2TIR A;  3VUR A;  1XW6 A;  2LEG A;  2M46 A;  2X8H A;  2B3S A;  1R0J A;  1EGR A;  3FEU A;  2FWF A;  3TOT A;  3ZVJ D;  1S2Z A;  2M6O A;  5GST A;  2GQM A;  2GZZ A;  2QGV A;  2R0P A;  4FH8 A;  2RII A;  12GS A;  2IWT A;  5B6N A;  1GSY A;  2HNL A;  4BWQ A;  3EMX A;  3ZIT A;  2PUK C;  2QA1 A;  4WF5 A;  4FQU A;  2HZF A;  4LL4 B;  4DSQ A;  3IRA A;  3BOA A;  1MTC A;  4WR5 A;  4K0G A;  1DUG A;  1YQ1 A;  2JZR A;  1PKW A;  2O5J D;  4NHZ A;  3QR6 A;  1MD3 A;  2M72 A;  1Z9H A;  2K6V A;  2AYT A;  2V1M A;  3HVS A;  5MGN A;  4KA0 A;  4JAG A;  1OKD A;  1Z7P A;  3RBT A;  4BVX B;  2HT9 A;  3D4M A;  1TJD A;  1KTE A;  4JR6 A;  1VZH A;  2GT5 A;  1VF3 A;  3TKP A;  1U3I A;  4KCE A;  4ECI A;  1BRF A;  3GH6 A;  3VPQ A;  1HD2 A;  5KOX A;  1DVB A;  3IR4 A;  2AHE A;  2C0G A;  5J9B A;  1LKP A;  4H86 A;  1WPI A;  4GLT A;  4PXO A;  5ECM B;  3EWL A;  4X1U A;  2K9F A;  2E0Q A;  1UC7 A;  4KB3 A;  1XXU A;  3BD2 A;  5E4W A;  3KJY A;  2YOI A;  3MWH A;  2DSA A;  3CSH A;  3GN3 A;  1MDI A;  3LEF A;  3P8B A;  1YY7 A;  4MF7 A;  3GYK A;  5AGY A;  5JCU A;  4KDY A;  4MPG A;  4GWR A;  4Z2U A;  3UAP A;  2CQ9 A;  2PVE A;  1YUZ A;  1RYQ A;  3QVD A;  2IMK A;  2FA8 A;  4IEL A;  2VL2 A;  3EIN A;  1WJK A;  4PX1 A;  2I81 A;  1ZYN A;  1M7T A;  3IAS 2;  3KTB A;  4PQ1 A;  2H1B A;  4ZIJ A;  2CZ2 A;  4GSN A;  1OYJ A;  2NVL A;  3A3T A;  3NIV A;  2H6Y A;  2L57 A;  3RAZ A;  1GUK A;  1BG5 A;  16GS A;  1QQ2 A;  3I69 A;  1O8W A;  3DVW A;  2X49 A;  1WJV A;  3LXT A;  4IN0 A;  1FAA A;  1TTZ A;  1XWC A;  1AW9 A;  1XWB A;  2VM1 A;  4G0I A;  2AYJ A;  3F6F A;  4WET A;  3N5O A;  5C04 A;  3DEX A;  2G0F A;  3R2Q A;  3Q19 A;  2KLX A;  4MNN A;  1B9X C;  3C1R A;  2O85 A;  4IP1 A;  5LD0 A;  6GST A;  3N9J A;  5ECR B;  2WS2 A;  4GF0 A;  4BVY A;  4K9Z A;  3M0F A;  1K0M A;  3MNG A;  4DEJ A;  4ZXG A;  3HY2 A;  5J9C A;  2QSI A;  1UA5 A;  2LQO A;  1OWC A;  4YAV A;  4TR4 A;  2IMF A;  2GDR A;  2O7K A;  4IBP A;  3KYY A;  4EVM A;  4HI7 A;  1K0D A;  3LPE B;  2C4J A;  4IQA A;  1BX9 A;  4IKH A;  2LRN A;  2WZ9 A;  1FHE A;  3EVI A;  3HVV A;  2KHP A;  1TI3 A;  5G31 A;  1ERV A;  5F07 A;  3TJB A;  4O32 A;  4ULX A;  3F4R A;  3FW2 A;  4XRA A;  3KGK A;  5JWO B;  3DRN A;  2H1G A;  1N2A A;  1OC9 A;  2K18 A;  3PIO 1;  4EIP A;  4AHY A;  2KP2 A;  4POK A;  1J08 A;  1NXE A;  2EIQ A;  5GSS A;  1A0R P;  4YKF A;  2I9H A;  3DVX A;  3GTU A;  2VAF A;  2HRF A;  3FR6 A;  4GCI A;  3GKN A;  1EOH A;  3ZLP A;  4JU5 A;  4CDO A;  3KYW A;  3EPT A;  5BRT A;  1PQN A;  3L78 A;  2ERJ A;  1T1V A;  2PBJ A;  3HD5 A;  4F2I A;  2YWM A;  4ZN1 B;  3KTL A;  3M9J A;  4HEA 2;  5IQY A;  3ZIJ A;  1GLQ A;  4TPU A;  1QUW A;  2R2J A;  1E2Y A;  2YJ7 A;  1Z6N A;  4HUA A;  1GSS A;  4KW6 A;  3VK9 A;  1E8J A;  3MAK A;  1ERW A;  1XWG A;  2HXK A;  3PIP 1;  5IMF A;  3ZFB A;  3UBL A;  5DM6 1;  3IA1 A;  1M0U A;  3IHQ A;  2LTK A;  4OFM A;  3KIJ A;  1AAZ A;  2F9S A;  4AI0 A;  5RXN A;  1IU5 A;  2V6K A;  4YQU A;  4ME3 A;  3GSS A;  4YAP A;  2GS3 A;  1PX6 A;  3GMF A;  5CRE A;  4A5P A;  3RPP A;  3GUR A;  4AR3 A;  1YEP A;  4TR1 B;  1SEN A;  1XIY A;  1YZX A;  3GV1 A;  1A8Y A;  4YQM A;  4TXV A;  5F0G A;  4WF4 A;  5F06 A;  4OD7 A;  2P0G A;  4CHS A;  5CNW A;  5D9W A;  3ZG6 A;  5FHI A;  5J4U A;  2YV7 A;  5EVO A;  2VD1 A;  3LXZ A;  1SK2 A;  2VM2 A;  2K2D A;  3WGX A;  1ZL9 A;  4XS4 B;  4KND A;  2LJK A;  2R3X A;  3BBY A;  3TKS C;  1SK1 A;  1N8J A;  3PH9 A;  4KX4 A;  5KN2 A;  1K0O A;  1LJR A;  4POB A;  1G7E A;  2R5G A;  4E6Y A;  2A2S A;  2R4V A;  4MZC A;  3VI7 A;  3TOU A;  5ID2 A;  4KCA A;  1IU6 A;  6GSW A;  4F0C A;  1XWK A;  3HA9 A;  1S3D A;  5ECN B;  5ECQ B;  1TK5 B;  1SYR A;  1O73 A;  3W6G A;  2FY6 A;  2TRC P;  1NNQ A;  4HJM A;  3PKJ A;  2IIY A;  3W8J A;  3MIX A;  5LCZ A;  2ERS A;  2YWO A;  1M2B A;  3IV4 A;  4MZB A;  2L0Z A;  4FYU A;  4KE3 A;  1U3A A;  3TGZ A;  1AXD A;  2XJU A;  2GTU A;  1SK0 A;  3KMO A;  1OC8 A;  5HQP A;  3U5R E;  5MF6 A;  1F3B A;  1G0T A;  2V0F A;  4IW9 A;  2FWE A;  1K3O A;  3E0U A;  1TI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...