3P2AA

Crystal structure of thioredoxin 2 from yersinia pestis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
NAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thioredoxin-like protein
publication title Crystal Structure of Thioredoxin 2 from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3p2aA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3p2aA02
1SJ6A 4PQ1A 3DVWA 20GSA 4LLRA 2H19A 2LS5A 4MCUA 2PUKC 4ECBA 3DWVA 1XOAA 4EVMA 2OKAA 3JCML 3EYTA 2GQKA 1AUCA 4RI7A 5JWOB 3FR6A 2PBJA 5IMZA 1XBSA 2YV7A 2H6XA 1XWAA 1THXA 2GSTA 3GTUB 2DMMA 2X8GA 11GSA 4YQMA 1FHEA 2WULA 1Y6EA 1I9DA 2VIMA 3ZLPA 1K3YA 3ZL5A 1TDIA 4KE3A 3KCMA 2D2ZA 2CVKA 2DIZA 4QL7A 4ZB9A 1Y25A 2AYTA 2OJLA 4ID0A 5J9BA 2OBKA 4ML1A 1FVKA 5J3RA 3FZAA 3EVIA 3ME7A 3HVVA 1GSUA 2YZHA 1X9SB 3I69A 2YOIA 5HFGA 1FG4A 3CRUA 4MZBA 3B0AB 2VUPA 1EZKA 2IFQA 1XXUA 1MDJA 4NHWA 2VLTA 3HCZA 3IR4A 4XS6A 3ZIJA 2B1LA 2LV3A 4DVCA 2PVOC 1JHBA 4GQCA 2VL9A 1YZXA 2F3MA 2GQMA 5IO0A 9GSSA 4KH7A 2GDRA 4P3YB 4GXZA 3WGEA 2OE0A 1XW9A 2E0QA 2DJ3A 3TOTA 1EV9A 2QKEA 1DE2A 1MDKA 3O76A 1GUKA 3QDNA 4K7NA 2H1BA 2EIQA 2RM5A 4ZILA 1AQXA 2IMIA 2C0EA 4YH2A 1B4QA 4IGJA 4KW6A 2H72A 4ZL8A 3KZQA 1M99A 2E7PA 4TRXA 3G9BA 4KCEA 3RAZA 4V1Ap 3TRQA 5D9TA 1X9WB 3L78A 3G7JA 3GL5A 4MLYA 4X43A 1SL2B 1ZYEA 1TKDB 3ME8A 4OFNA 2LRCA 3CXGA 2XHFA 1F3AA 2WJUA 3EINA 2JU5A 5ECOB 1NHOA 1IYHA 1XWCA 1T4ZA 1Q4JA 3KMNA 4EO3A 3DYRA 3ZFLA 3A5WA 5F05A 1RW1A 3TKSA 4NPBA 4E8EA 2JSZA 1MEKA 2EIOA 5IM9A 3BBYA 3R2QA 2FCHA 5F0GA 3KM6A 1HD2A 2VL2A 1GL8A 3BCKA 2CX4A 1PGTA 3LYKA 1ZYQB 1EP8A 4POKA 3SWLA 1CQGA 5IIZA 1ZCPA 2FA8A 4O7HA 2DJ2A 3KXOA 2DMLA 1PX6A 2HFDA 1MDIA 2VLVA 2VCQA 2CAQA 1G0TA 2VD0A 2C8UA 3GNJA 2AAWA 5LD0A 3UEMA 4JRRA 3CRTA 2H0GA 2O8VB 4TW5A 2Z9SA 2XBQA 1S3CA 4AGSA 2LUSA 4PURA 1OE7A 4KNDA 5B7CA 1NW2A 3NOFA 1BQ7A 2MMOA 2QC7A 1K0MA 3GKXA 1ZZYA 1TI3A 1F3BA 2XPEA 3E0UA 3LXTA 1AC1A 3TKSC 3GURA 4OCFA 3H1NA 3G7YA 3J7Yk 2H0HA 3F4SA 3KMOA 4POMA 4N11A 5D8IA 4FIWA 3FKFA 1GUMA 2CT6A 1ZL9A 2VL2C 1OVNA 5G31A 3UOMA 3V1WA 1BYEA 2P0GA 2RUEA 3IV4A 1PD21 4EE0A 4OO4A 3O3TA 1GLPA 2GZYA 1WOUA 2N5AA 1M7TA 3N9JA 2F8AA 4F0CA 4V1Ag 4TR3A 6GSUA 1THOA 1UVZA 1QXHA 3QAVA 3D21A 1ERWA 3GUSA 1SYXA 2EIRA 3HHVA 4MPFA 3ZZXA 1BG5A 1NHYA 2EC4A 2M80A 2PGTA 3FW2A 3QD9A 2DJ1A 3C1RA 3A2XA 4I8BA 4OFMA 1ST9A 2WFCA 4IKHA 3TJKA 3GTUA 5J5NA 7GSSA 3RBTA 4TR4A 1JZRA 4I6XA 5KEJA 1AQVA 4BVXA 3D6IA 3HXSA 3UBLA 1LU4A 5B8AA 4GF0A 1SK1A 2HT9A 1NM3A 2L59A 3MAKA 4PUAA 4ZBAA 3K8NA 2CVDA 2VCZA 4XIHA 2KOKA 4X0XA 2FWGA 1A2JA 1GTUA 2FLSA 1ON4A 4MZWA 2FWHA 5F8BA 2LRNA 4WXTA 1XVWA 2GZZA 5FWGA 1FAAA 1R5AA 3W8JA 4GSTA 1Q98A 4LMWA 3QCPA 3D22A 3FYGA 2JADA 4LA1A 3UL3A 2RUFA 2B6MA 1G6WA 2K9FA 2LNTA 2QSIA 5A5KA 1SKRB 2O87A 1FB0A 1SD9A 3F6FA 3LSZA 5DJMA 2O85A 3IBHA 3UVTA 2MMAA 3HVXA 1EOHA 2VM1A 3FR3A 5IOWA 5J4UA 5HFKA 2K18A 2FWFA 5IOXA 2NDOA 2I81A 4E8HA 3ZMLA 3QMXA 3CYNA 5IMFA 4KDYA 4NMUA 5EVOA 1PN9A 3WYWA 1O81A 3Q19A 2MBTA 3N5OA 2PWJA 3MWHA 5HR3A 4RQXA 2TIRA 2C0DA 2YZUA 1XOBA 3KTBA 2GZPA 1ZOFA 2B5XA 3VWXA 3MSZA 1M0UA 1OKDA 4TXOA 3ZIVA 2R2JA 4Q5FA 2YWNA 2XPDA 2CV4A 2P31A 1BX9A 3FZ9A 3A3TA 4D73B 5GAND 1OC9B 2PERA 1H4OA 3A2VA 1U6TA 6GSVA 3F3QA 3ZRDA 3ZVJD 2CVBA 2HSHA 1ERUA 4EUYA 4AJ6A 3VPQA 4WBJA 3EWLA 3FY7A 2GLRA 1ACVA 2LRTA 5AIXA 5J41A 5HFIA 4NWYA 4GLTA 4HUAA 3HKRA 2K8VA 5CRHA 1UC7A 5IPHA 4TR0A 2WS2A 3GIXA 5B6MA 2B3SA 2OE1A 4HI7A 2WDUA 1ML6A 2L4QA 1V57A 1R4WA 2C0GA 3HA9A 2NTOA 1LJRA 5B8BA 4ILFA 3W8SA 3VWVA 4AJ7A 3IPZA 5EPFA 2GT6A 1XW6A 3LYPA 1PA3A 2H01A 4FYBA 2L5LA 3RHBA 4OMVA 2FNOA 1Z7PA 2V6OA 3M8NA 2IL3A 5IQYA 5CP1A 3L0HA 3A2WA 1A2LA 2LJAA 4XRDA 2DJKA 3DVXA 2RIIA 22GSA 5G30A 4TXVA 1GULA 3KTLA 1TRVA 5ABRA 1TK0B 3IRAA 2RLIA 2B5EA 1QMVA 3IAM2 2PN8A 2DBCA 1U87A 1AQWA 4KB3A 4Z7XA 1F2EA 1TP9A 1JZOA 5CRGA 4PQIA 2NPBA 3VWUA 3WT1A 4HS1A 3IK9A 3DGQA 4MDCA 1VGLA 1VF3A 3GKMA 3W6GA 1K0OA 3CSIA 3RPNA 5ECQB 3IXRA 4NXIA 3BCIA 1UN2A 2HE3A 10GSA 3MNGA 3MDKA 5H5SA 4YQUA 1GRXA 6GSSA 5ECNB 1U3IA 4XRAA 3EURA 5INYA 4KCAA 3UVHA 2L5OA 5LCZA 4RQRA 2R6KA 4CDOA 2L4CA 4PGTA 1GSEA 2I9HA 3EMPA 1PX7A 1XCCA 1XZOA 2LJKA 4NHZA 4OD7A 1OAZA 2KUCA 2YWIA 4HEA2 4X1UA 1EV4A 1O85A 1GSQA 3TKSE 5HR0A 4ZIJA 4AJ8A 3HZ4A 4TKYA 4ECJA 5ECSA 3GYKA 2IPAA 1F6MC 3F6DA 3HYPA 4KUNA 3VK9A 5DQYA 4IELA 1OE8A 2GGTA 3Q6OA 2FUG2 3Q18A 1QUWA 3GSSA 1J08A 1Z7RA 4ECCA 3FRCA 2QGVA 3GRXA 1T1VA 4MJEA 1HNAA 2DLXA 4HJ2A 2A4VA 2PU9C 5C00A 5DDLA 1X0RA 4N30A 3GH6A 4OWYA 1WWJA 3DD3A 2IWTA 5JCGA 1SJZA 1QFNA 1TU8A 3TJBA 4KX4A 1PQNA 4LL4B 1A24A 4MJBA 3ERFA 1AW9A 5HQPA 3S9FA 2VO4A 3IE3A 1R5PA 2FY6A 1QK8A 1K0NA 3E9JB 4OFTA 2OA7A 3G7IA 5AGYA 3H79A 2IN3A 1IYIA 1JZDA 4IS0A 3EU4A 2H66A 5CRDA 2M46A 1HYUA 5DBQA 12GSA 2YANA 1SENA 3FZ4A 5H5RA 1SD8A 2LJRA 4G9HA 4MF7A 3HDCA 1A2MA 1AXDA 2ES7A 2YWMA 4IVFA 1TW9A 4XHMA 4K7OA 3O6TA 1OKTA 3P7XA 5GSSA 2GTUA 4K9ZA 5DQSA 1M9BA 3PR8A 5D96A 5G1LA 5IMVA 4PXOA 2AUVA 2H6YA 5LNKe 3KGKA 1AAZA 1M2AA 2WRTA 6GSTA 5DJLA 3CTGA 5IPGA 3OR5A 2KP1A 1GTIA 2ON5A 4D73A 1TRWA 1OC9A 1WE0A 1WP0A 3GV1A 3HJOA 5CREA 4EC0A 2YWOA 3HZ8A 1ILOA 1PSQA 4F0BA 3GL3A 1TK8B 4MA9A 3ZREA 1XWGA 3GN3A 2KHPA 1TXXA 4ZBDA 2PMTA 4OCEA 1RK4A 3CSHA 1JZWA 3GKKA 2HNLA 1R7HA 4L8EA 2I4AA 4K7IA 3FK8A 2R4VA 4MPGA 1SYRA 1QGVA 4JBBA 1V40A 5DALA 3APOA 8GSSA 2JSYA 4L5OA 4G10A 17GSA 3KH7A 3NIVA 3VI7A 3GSTA 1W4VA 1GUHA 3WGXA 1K0DA 1V98A 6GSYA 14GSA 4TR1B 1M9AA 4LMVA 1ABAA 4JR6A 3M0FA 3TJJA 5B6NA 4EDZA 3PINA 3EU3A 5ECIB 2GT5A 1XW5A 2WB9A 2CX3A 3IK7A 5ENUA 1URMA 2FA4A 3GFKA 4BL7A 2F51A 4NV2A 4YAPA 1J9BA 1B8XA 1M2BA 3EMXA 4ACSA 3QAGA 5ECPB 2VCWA 5JCWA 3J7Yb 3GX8A 1M2DA 4ZBBA 4J2FA 1K3OA 3I43A 4NV5A 4IQAA 1OC8A 2PVQA 2LKUA 1GWCA 1PRXA 2O7KA 3F0IA 3ZMKA 13GSA 3FHKA 5DCHA 4L0UA 2YPMA 1G6YA 2CZ2A 1BEDA 2B7JA 3M9KA 1E2YA 3LJRA 2C3TA 2IMFA 4JEDA 5IMDA 2BJXA 2P5RA 4DEJA 3F3RA 1PL2A 3M1GA 3UARA 2XC2A 4O32A 1PL1A 3BOAA 2ALBA 3RHCA 3HD5A 1OYJA 4WKWA 5AN1A 2DC5A 3C73A 5IMAA 2F9SA 4BVYA 1EOGA 1FW1A 1USBA 3DIEA 4GCIA 4I5QA 1WPIA 3F4RA 3TUEA 4ZB6A 2G0FA 5EY6A 4MABA 4FO5A 1EGOA 2L57A 2C3QA 2FWEA 1Z6MA 4V2NA 4H86A 2H71A 1WIKA 1J0FA 4I97A 2LTKA 2MMNA 2VCVA 1YY7A 2VLUA 5CAXA 3CBUA 1W89A 1A8LA 2I1UA 4IP1A 1TI1A 2VOCA 2L6DA 1GLQA 3C1SA 4WR4A 5ECHB 4DSSB 3H8QA 5D9XA 1LBKA 5E4WA 2ZCTA 1GNWA 3TJFA 5ID2B 4JE1A 4JU5A 2B5YA 4RI6A 1O73A 1VRSD 2GSRA 4J57E 1EEMA 3IOSA 2VM2A 3D4MA 4OO5A 1A0RP 1H75A 1GP1A 1DBYA 2H0IA 2HRFA 4F82A 5GSTA 3HJMA 4K6XA 1O6JA 3GHAA 2MYGA 2MZCA 4WBRD 4IJ3A 1XIYA 4O92A 4WETA 1SKWB 2H8LA 2HRNA 3U5RE 5KN2A 4XTSA 3D0ZA 3VPTA 5G2ZA 4L5LA 3U6VA 1G7OA 5CYYA 3CMIA 5H5QA 1EP7A 3BJ5A 4ML6A 3UAPA 2IIYA 2REMA 5GAPD 5JWRB 1XPVA 2H1AA 3QPMA 5ELAA 1YF0A 4HQZA 1N2AA 4ISDA 2V6KA 5DAKB 3UJ1A 4GRFA 2BMXA 4ZL7A 2WZ9A 1HQOA 6GSXA 3C71A 3H4KA 5GZZB 2GSQA 5F07A 2LQOA 4QQ7A 4L0WA 2VL3A 2V2GA 4YQVA 3QFBC 2V41A 3LG6A 1FB6A 3ZVJA 4AF2A 1T7PB 4XS4B 3PGTA 3IHQA 1YQ1A 2AJQB 1JLWA 2BTOT 1T4YA 2NVLA 1Z3EA 1UA5A 1OC3A 2K6VA 3F63A 2VD1A 2C4JA 1ERTA 3KD0A 1GTBA 4POLA 2N5BA 1Z6NA 4MH2A 3TRXA 1A8YA 2H73A 4KDXA 1MD4A 5EL8A 2DIYA 4PNFA 1S3DA 4JZQA 1SU9A 4BPYA 3TKQA 3I6AA 3P2AA 3LEFA 4MZCA 1BAYA 3F8UA 5D73A 4GSNA 4LL1B 5E59A 3IDVA 2YJHA 2CQ9A 1I5GA 1GSDA 4KGIA 2CA8A 1GH2A 4ECIA 3RPPA 4XXBB 2R37A 4EKZA 3ZYWA 4ZL9A 3UBKA 3RDWA 3ERWA 2G2QA 3WT2A 2OE3A 1KEBA 1KTEA 3EC3A 4V2LA 2X8HA 2H70A 3HY2A 3AY8A 4TR1A 1DUGA 2H30A 1KBNA 3NZNA 4TOPA 2DSAA 3GMFA 4I2TA 1VF4A 4KSOA 1E6BA 5FHIA 4IHUA 2PPTA 2F8FA 2OBIA 5DCGA 2CZ3A 2HZEB 3ISOA 2AV4A 4Q5QA 2L6CA 3VI5A 2WCIA 4HQSA 1U88A 2JL4A 3DRNA 3DKSA 4POBA 3SBCA 4I2UA 4NAXA 1XVQA 1S3AA 1SJIA 4MMMA 3CTFA 2H1DA 2H75A 5C04A 1ZMAA 3I9V2 5A4VA 3BD2A 1Z5YE 3KJYA 4K8MA 2H6ZA 1JFUA 4MK3A 2LEGA 2B7KA 3TRPA 2HZFA 4G19A 2HLSA 1XFLA 3M3MA 3KIJA 2HI7A 2E2GA 3TB2A 1TRUA 2VCTA 1GSFA 5CRWA 1A23A 2AHEA 4TXOB 1HNCA 1FOVA 3DXBA 3GH9A 4BWQA 1YF1A 4MF6A 4N0VA 2V32A 4MH3A 3TJGA 1K3LA 4K0GA 3HVSA 4K1FA 2IMDA 3VFIA 1GSSA 4EF0A 1BJXA 1VF2A 2HXKA 3VURA 4GQFA 5HR1A 2DJ0A 2JZSA 4IN0A 2HSYA 3L4NA 4HU7A 2C0FA 2YV9A 3LXZA 5G5EA 1QQ2A 2TRXA 2VAFA 3QAWA 2GQLA 3FZ5A 1TK5B 5IMCA 1YJ6A 3TOUA 5A4WA 5A4UA 1ZGNA 1DSBA 3KEBA 1FVJA 4EL1A 3D5JA 4DSSA 1GNEA 2M72A 3QFAC 3UMAA 3B08B 2OADA 2DJJA 4KDUA 1Z9HA 4KA0A 5D9VA 5ID2A 4MJCA 4EDYA 5D9WA 5ECKB 1B48A 2KP2A 3C7MA 3EE2A 3TDGA 1K0BA 3APSA 3IA1A 1U3AA 5ECRB 1EGRA 1TTZA 4PUFC 2IMKA 1XWKA 2IJYA 1RQMA 3LORA 3DMLA 4CHSA 3KP9A 3QOUA 1B9YC 4YAVA 1HNBA 5G1KA 2J9HA 4DSQA 2ZUPA 1F37A 1K0AA 1SK2A 1SL1B 4GTUA 1K0CA 3L9SA 3TKPA 5HR2A 5AISA 2R3XA 5COHA 4HZ2A 2C1YA 2MMZA 5D93A 3VWWA 4V2MA 4WEYA 2X8CA 3D4TA 1SL0B 4ZB8A 2JZRA 3VLNA 2H74A 4G2EA 2K8SA 5FT3A 1TRSA 4F03A 5DAKA 2YCDA 4HU9A 1C72A 4K0NA 3M9JA 4IJIA 1X9MB 3HJPA 2V1MA 4WR5A 1GTAA 4QL9A 1YKCA 1YEXA 3TCOA 5ECLB 1B4PA 4GWRA 1NSWA 2OACA 1YDKA 1SKSB 4GSSA 5JCUA 2IFQB 4CW9A 4EXJA 4XS4A 1O8WA 2LQQA 2E2MA 4MP4A 3ZTLA 3WD6A 4KAEA 1V2AA 4KSMA 3ERGA 2B1KA 2RM6A 1R26A 1XWBA 2ON7A 1PKWA 2YNXA 4HZ4A 2H1GA 4F2IA 5F06A 1FO5A 2FD3A 1YKAA 4MJAA 4WF4A 5ECMB 2NBSA 3L9UA 3IC4A 2IMEA 2I3YA 2GSSA 1CQHA 16GSA 1G7EA 2A2SA 3GX0A 4HJMA 1TOFA 1MTCA 4ZXGA 5DVBA 4K2DA 3F9UA 3ZFBA 4FH8A 4XS1A 2C6AA 3FR9A 3L9VA 3C8EA 1JLVA 2XBIA 3GA4A 3P8WA 4PQHA 4F9ZA 4HDEA 1WRYA 4RUVA 3KH9A 18GSA 1T8EB 2C3NA 5J9CA 3QR6A 1PMTA 1EWXA 1YEPA 1KNGA 1DE1A 3LFLA 3TGZA 5L71A 2X99A 3US3A 1TJDA 1TU7A 4FYCA 2JZTA 4IQ1A 4TVEA 3P90A 1SK0A 4N0ZA 3WGDA 3LWAA 2FHEA 1F9MA 2X64A 4HOJA 1O7UA 2TRCP 4IBPA 2A2RA 2HZEA 4J56E 3TKRA 1WJKA 2O89A 5JWQB 4DSRA 5IO2A 6GSWA 1V58A 3KP8A 1V9WA 3IAS2 1B9XC 5G5FA 4ULXA 19GSA 4BA7A 5AIVA 3FEUA 2GVPA 1PKZA 2YP6A 4O5RA 2JACA 2N5FA 1T00A 2H76A 3H93A 3CSJA 4JR4A 3ZITA 1O8XA 4FYUA 4TN8A 3F4TA 4IW9A 2YJ7A 1T3BA 2J23A 2ZNMA 3LQ7A 1VF1A 1ERVA 5KN3A 5CNWA 1A0FA 1X5DA 5ELGA 4XCSA 2J9UB 2R5GA 2LSTA 1AIUA 1X5CA 1X5EA 2LNSA 4BWSA 2MBSA 4N10A 2P5QA 1GSYA 2AB6A 1MD3A 3LGCA 4IP6A 1N8JA 3PH9A 5CO3A 3APQA 3GKNA 2C80A 2KLXA 3ED3A 2C6BA 3Q74A 2YN1A 2HYXA 1EEJA 2VCXA 5KN0A 2WGRA 3E3EA 3DEXA 2CAIA 3UIWA 5DALB 4PNGA 5KN1A 4WF5A 2FGXA 4Q5NA 4MF5A 1WMJA 4Q5RA 2GS3A 4PX1A
chains in the Genus database with same CATH superfamily
4G0LA 1SJ6A 4PQ1A 1CADA 3DVWA 20GSA 4LLRA 2H19A 2LS5A 4MCUA 2PUKC 4ECBA 1R9TL 3DWVA 1XOAA 5JVH1 4EVMA 2OKAA 3JCML 4A3DL 3EYTA 2GQKA 4C2M1 3J7Z1 1AUCA 4RI7A 1B2OA 5JWOB 4YWLA 3FR6A 2PBJA 5IMZA 1XBSA 2YV7A 2H6XA 1XWAA 1THXA 2GSTA 3GTUB 2AYJA 4BIKA 2DMMA 2X8GA 11GSA 4YQMA 1FHEA 2WULA 1Y6EA 1I9DA 2VIMA 3ZLPA 4BVXB 1K3YA 3ZL5A 1TDIA 4KE3A 3KCMA 2D2ZA 2CVKA 2DIZA 4QL7A 4ZB9A 4C3HL 1Y25A 2AYTA 5KOXA 2OJLA 4ID0A 5DM71 5J9BA 2OBKA 4ML1A 1FVKA 2PVEA 3FZAA 5J3RA 3EVIA 3ME7A 3HVVA 1GSUA 2YZHA 4RXNA 1X9SB 3I69A 2YOIA 5HFGA 1FG4A 3CRUA 4MZBA 3B0AB 2VUPA 1EZKA 2IFQA 2XJTA 1XXUA 1MDJA 3S1NL 4PTSA 2RDVA 4NHWA 2VLTA 3HCZA 3IR4A 4XS6A 3ZIJA 2B1LA 2LV3A 4DVCA 2PVOC 2ZIXA 1JHBA 4GQCA 2VL9A 1YZXA 2F3MA 2GQMA 5IO0A 9GSSA 4KH7A 2ERSA 2GDRA 3LW9A 2B63L 4P3YB 4GXZA 3HJWB 5K2ME 3WGEA 2OE0A 1XW9A 2E0QA 2DJ3A 3TOTA 1EV9A 1PFOA 3RYGA 2QKEA 1DE2A 3H3VM 1MDKA 3O76A 1GUKA 3QDNA 4K7NA 3H9BA 2H1BA 4ZN3B 2EIQA 2RM5A 4ZILA 1AQXA 4ZN1B 2IMIA 2C0EA 1F4LA 4YH2A 1B4QA 2JI3A 4IGJA 4KW6A 2H72A 4ZL8A 3KZQA 1M99A 2E7PA 4TRXA 2PSMC 3G9BA 4KCEA 3GTKL 3RAZA 2R0CA 4V1Ap 3TRQA 5D9TA 1QYBA 1TWHL 2UZ8A 1X9WB 3L78A 1NXGA 3G7JA 2R0GA 3GL5A 4MLYA 4X43A 5DM61 4O5UA 3K35A 1SL2B 1FHMA 1ZYEA 1TKDB 3ME8A 4OFNA 2LRCA 3CXGA 2XHFA 1F3AA 2WJUA 3EINA 3WWNB 2JU5A 5ECOB 1NHOA 1IYHA 2PYAA 1XWCA 1T4ZA 1Q4JA 3KMNA 4EO3A 3DYRA 3ZFLA 3A5WA 1RDVA 5F05A 1RW1A 3TKSA 3MIXA 4NPBA 4E8EA 2JSZA 5H1Sc 1MEKA 2EIOA 4AHXA 4YWMA 5IM9A 3BBYA 3R2QA 2FCHA 1M3IA 5F0GA 3KM6A 4JAFA 1HD2A 2VL2A 1GL8A 3BCKA 2CX4A 1PGTA 3LYKA 1ZYQB 3S15L 1EP8A 4POKA 3SWLA 1CQGA 4XGHA 5IIZA 1ZCPA 2FA8A 4O7HA 2DJ2A 3KXOA 2DMLA 1NNQA 1PX6A 1TWGL 2HFDA 1MDIA 3SS2A 2VLVA 2VCQA 2CAQA 1G0TA 2VD0A 2C8UA 3GNJA 3S2HL 2AAWA 5LD0A 3UEMA 4JRRA 3CRTA 1T9OA 2H0GA 2O8VB 4TW5A 2Z9SA 2XBQA 1S3CA 4AGSA 2LUSA 4PURA 1OE7A 4KNDA 5B7CA 1NW2A 3NOFA 1BQ7A 2MMOA 2QC7A 1K0MA 3GKXA 3GTML 1ZZYA 4U671 1TI3A 1S24A 1F3BA 2XPEA 3E0UA 3LXTA 4K5RA 3KYWA 1AC1A 3TKSC 3GURA 5C44L 4OCFA 3H1NA 3G7YA 3J7Yk 1ZYNA 2H0HA 3HJYB 3F4SA 3KMOA 4POMA 4N11A 5D8IA 4FIWA 3PIP1 3R3EA 3H99A 3FKFA 1GUMA 2CT6A 1ZL9A 2VL2C 1OVNA 5G31A 2HVYC 3UOMA 2MS3A 1CAAA 1DX8A 3V1WA 1BYEA 2P0GA 2RUEA 3IV4A 2V0FA 5BRTA 1PD21 4EE0A 4OO4A 2B5ID 2O5JD 3O3TA 1GLPA 2GZYA 1WOUA 2N5AA 1M7TA 3N9JA 2F8AA 4JADA 4F0CA 4V1Ag 1R0JA 3M4OL 4TR3A 6GSUA 1THOA 1UVZA 1QXHA 3QAVA 3D21A 3RZDL 1ERWA 3GUSA 1SYXA 2EIRA 3HHVA 4MPFA 3ZZXA 2QL0A 1BG5A 1NHYA 2EC4A 1FOHA 2M80A 2PGTA 3FW2A 3QD9A 3JR7A 4B8CD 2DJ1A 3C1RA 3A2XA 4I8BA 4OFMA 1ST9A 2WFCA 4IKHA 3TJKA 3GTUA 5J5NA 7GSSA 3RBTA 4TR4A 1JZRA 4I6XA 5KEJA 1AQVA 2A4HA 4BVXA 3D6IA 3HXSA 3UBLA 1LU4A 5B8AA 4GF0A 1SK1A 2HT9A 1NM3A 2L59A 3MAKA 4PUAA 4ZBAA 3K8NA 5EINC 2CVDA 2VCZA 4XIHA 2KOKA 4AR3A 4X0XA 2Z3RB 2FWGA 1A2JA 1GTUA 4E6YA 2FLSA 1ON4A 4MZWA 2FWHA 5F8BA 2R92L 2LRNA 4WXTA 1XVWA 2GZZA 4Y7NL 1I3QL 5FWGA 1FAAA 4AR6A 1R5AA 3W8JA 4GSTA 1Q98A 4LMWA 3J7Y1 3QCPA 1TWAL 3D22A 3FYGA 2JADA 2WAQP 4LA1A 3UL3A 2RUFA 2B6MA 1G6WA 2K9FA 2LNTA 3LWRB 2QSIA 5A5KA 1SKRB 2O87A 1FB0A 1SD9A 3F6FA 3LSZA 5DJMA 2O85A 4Z2TA 3LWQB 3IBHA 3UVTA 2MMAA 3HVXA 1EOHA 2VM1A 3FR3A 5IOWA 5J4UA 5HFKA 2K18A 2FWFA 4A3BL 5IOXA 2NDOA 1WJVA 2I81A 4E8HA 3ZMLA 3QMXA 3CYNA 5IMFA 1IU6A 4KDYA 4NMUA 5EVOA 3RZTA 1PN9A 3WYWA 1O81A 5M3ML 3Q19A 2MBTA 3N5OA 5AN9H 2PWJA 3MWHA 5HR3A 2A6HD 2A68D 4C3IL 4AHZA 4RQXA 1IRNA 2TIRA 2C0DA 2YZUA 1XOBA 3KTBA 2GZPA 1BQ9A 1ZOFA 2B5XA 3VWXA 3MSZA 1M0UA 4A3JL 1OKDA 4TXOA 3ZIVA 2CKAA 2R2JA 2VL6A 4Q5FA 2HRAA 2YWNA 2XPDA 2CV4A 2P31A 1BX9A 3FZ9A 3A3TA 4D73B 5GAND 1OC9B 2PERA 1H4OA 5IYCL 3A2VA 1U6TA 6GSVA 3F3QA 3ZRDA 3ZVJD 2CVBA 3H0GL 2HSHA 1ERUA 4EUYA 4AJ6A 3VPQA 3EPTA 2NVYL 1T9PA 4WBJA 2H12A 3EWLA 2GLRA 3FY7A 1ACVA 2LRTA 5AIXA 5J41A 3I4ML 5HFIA 4NWYA 3WWLA 4GLTA 4JAEA 4HUAA 3HKRA 5GADc 2K8VA 5CRHA 1UC7A 5IPHA 4TR0A 2WS2A 3GIXA 5B6MA 2B3SA 4LHNA 2OE1A 4HI7A 1E8JA 2WDUA 1ML6A 2L4QA 1V57A 1H7VA 1R4WA 2C0GA 3HA9A 2NTOA 1LJRA 5B8BA 4ILFA 3W8SA 3VWVA 3S16L 4AJ7A 3IPZA 5EPFA 2GT6A 1XW6A 3LYPA 1PA3A 2H01A 4FYBA 2L5LA 3RHBA 4OMVA 2FNOA 1Z7PA 3K7AL 2V6OA 3M8NA 2IL3A 3PPUA 5IQYA 5CP1A 3L0HA 4YKGA 3VPBE 3A2WA 4MNNA 1A2LA 1BRFA 2LJAA 4XRDA 2DJKA 3DVXA 2RIIA 22GSA 5G30A 4BL7B 4TXVA 2JA8L 1GULA 3KTLA 1TRVA 4A93L 5ABRA 1TK0B 1M3JA 2APOB 2E2HL 3IRAA 2RLIA 2B5EA 1QMVA 3IAM2 2PN8A 2HR5A 2DBCA 2E2JL 1U87A 1AQWA 4AR5A 4KB3A 4Z7XA 1YV1A 1F2EA 1TP9A 1JZOA 5CRGA 4PQIA 2NPBA 2JA5L 3VWUA 3WT1A 4HS1A 3IK9A 3DGQA 4MDCA 1VGLA 3MYDA 1VF3A 3GKMA 3W6GA 1K0OA 3CSIA 3RPNA 5ECQB 3IXRA 4NXIA 3BCIA 1R0HA 1IW7D 1UN2A 2HE3A 1I6HL 10GSA 3MNGA 4K2XA 3MDKA 5H5SA 4YQUA 4G0KA 1Y1WL 1VZIA 1GRXA 6GSSA 5ECNB 4BVYB 1U3IA 2JI1A 4XRAA 3EURA 5INYA 4KCAA 3QVDA 3UVHA 2L5OA 5LCZA 3PKJA 4RQRA 2R6KA 3A5IA 4CDOA 2L4CA 4PGTA 4AHWA 1GSEA 2I9HA 4BBRL 3EMPA 5MF6A 1PFYA 1PX7A 1XCCA 1XZOA 2LJKA 3S2DL 4NHZA 4OD7A 4USSA 5M5XL 1OAZA 2KUCA 2YWIA 4HEA2 4X1UA 1EV4A 1O85A 1GSQA 3TKSE 5HR0A 1SFOL 4ZIJA 4AJ8A 3HZ4A 4TKYA 3LWPB 4ECJA 5ECSA 3GYKA 2IPAA 4O5QA 1F6MC 3F6DA 3HYPA 4KUNA 5IY0A 1K83L 3VK9A 5DQYA 4LHLA 4IELA 1OE8A 2GGTA 3Q6OA 1OWCA 2FUG2 3Q18A 4KF9A 1QUWA 3GSSA 1J08A 4HSCX 1Z7RA 3FMWA 4ECCA 3FRCA 3FKIL 2QGVA 3GRXA 1T1VA 4MJEA 1HNAA 2DLXA 4HJ2A 4POGA 3HOYL 2A4VA 5MFPA 2PU9C 5C00A 3HOVL 5DDLA 1X0RA 1PZXA 4N30A 3GH6A 4OWYA 1WWJA 3DD3A 2IWTA 5JCGA 1SJZA 1QFNA 1TU8A 3TJBA 4KX4A 1PQNA 4LL4B 1A24A 3LNLA 4MJBA 3ERFA 1AW9A 5HQPA 3S9FA 2VO4A 3KYVA 3IE3A 4G6BA 1R5PA 2FY6A 1QK8A 1K0NA 2JI2A 3E9JB 5IP9L 4OFTA 2OA7A 3G7IA 5AGYA 3H79A 2IN3A 1IYIA 1JZDA 4IS0A 3EU4A 2H66A 5CRDA 2M46A 1HYUA 5DBQA 3CQFA 12GSA 2YANA 1SENA 5IP7L 3FZ4A 5H5RA 1SD8A 4JAGA 2LJRA 4G9HA 4MF7A 4A3GL 4G0IA 3HDCA 1A2MA 1AXDA 2ES7A 2YWMA 1VCXA 4IVFA 1TW9A 4XHMA 4K7OA 3O6TA 1LTLA 3IC8A 1OKTA 2NVXL 3P7XA 5GSSA 2GTUA 4K9ZA 5DQSA 1M9BA 3PR8A 5D96A 5G1LA 5IMVA 4PXOA 2AUVA 2H6YA 4EIPA 5LNKe 5C3EL 3KGKA 3HOUL 1AAZA 1M2AA 2WRTA 6GSTA 4BY7L 5DJLA 3CTGA 5IPGA 3OR5A 2KP1A 1GTIA 2ON5A 4D73A 1TRWA 1OC9A 1RDGA 1WE0A 1WP0A 3GV1A 3HJOA 5CREA 4EC0A 2YWOA 3HZ8A 2CKCA 1ILOA 1RYQA 1PSQA 4F0BA 3GL3A 1TK8B 4MA9A 3ZREA 1XWGA 3GN3A 2KHPA 1TXXA 4ZBDA 2PMTA 4OCEA 1RK4A 3CSHA 1JZWA 3RZOL 3GKKA 2Y0SP 2HNLA 1R7HA 4A3CL 1YK4A 4L8EA 2I4AA 4K7IA 3FK8A 2R4VA 4UY81 1OWBA 4AI3A 4MPGA 1SYRA 1QGVA 4JBBA 1V40A 5DALA 1PFWA 1SMWA 4A5PA 3APOA 8GSSA 2JSYA 1C09A 5GAGc 4L5OA 4G10A 17GSA 2NVQL 3KH7A 3NIVA 3VI7A 1ODHA 3GSTA 2K2DA 1W4VA 1GUHA 3WGXA 1K0DA 1V98A 6GSYA 14GSA 4TR1B 1M9AA 4LMVA 1ABAA 4JR6A 3M0FA 3TJJA 5B6NA 4EDZA 3PINA 3EU3A 5ECIB 2GT5A 3S1RL 1XW5A 2CX3A 2WB9A 3IK7A 5ENUA 3GTGL 1FHHA 5IYBL 1URMA 2FA4A 3GFKA 4BL7A 2F51A 3P8BA 4NV2A 4YAPA 1J9BA 1B8XA 1M2BA 3EMXA 4ACSA 3QAGA 5ECPB 2VCWA 5JCWA 3J7Yb 3GX8A 1M2DA 4AHYA 4ZBBA 4J2FA 1K3OA 2XJSA 3I43A 4NV5A 4IQAA 1OC8A 2R0PA 1NXEA 2PVQA 2LKUA 1GWCA 1PRXA 2O7KA 3F0IA 3ZMKA 13GSA 3GTOL 3FHKA 5DCHA 4L0UA 2YPMA 1G6YA 3PKIA 2CZ2A 1BEDA 2XJPA 2B7JA 3M9KA 1E2YA 3LJRA 2C3TA 2IMFA 4JEDA 2M4VA 3PWFA 5IMDA 2BJXA 2P5RA 1QQTA 4DEJA 3GTPL 3F3RA 6RXNA 1PL2A 3M1GA 3UARA 2XC2A 4O32A 1PL1A 3BOAA 2ALBA 3RHCA 3HD5A 5RXNA 1OYJA 1PFVA 4WKWA 5AN1A 2DC5A 3C73A 5IMAA 2F9SA 4BVYA 1EOGA 1FW1A 1USBA 3DIEA 4Z2RA 4GCIA 3GTQL 4I5QA 1WPIA 4V196 3F4RA 3TUEA 4ZB6A 2G0FA 5EY6A 4MABA 4FO5A 1EGOA 2NVTL 2L57A 2C3QA 2FWEA 1Z6MA 4V2NA 4H86A 2H71A 1WIKA 1J0FA 4I97A 4X6AL 2LTKA 2MMNA 2VCVA 1YY7A 2VLUA 5CAXA 3CBUA 1W89A 1A8LA 2I1UA 4IP1A 1TI1A 2DSXA 2VOCA 1T9QA 2L6DA 1GLQA 5MFZA 3C1SA 2PVXA 5FLML 4WR4A 5ECHB 1ZRPA 4DSSB 4GS7D 3H8QA 5D9XA 4AYBP 1PFUA 1LBKA 5E4WA 2ZCTA 1GNWA 3TJFA 3NFPI 2KN9A 5ID2B 4JE1A 4JU5A 2B5YA 4RI6A 1O73A 5C4JL 1VRSD 2GSRA 4BXXL 4J57E 1EEMA 3IOSA 8RXNA 2VM2A 3D4MA 4OO5A 1A0RP 1H75A 1GP1A 1DBYA 2H0IA 2HRFA 4F82A 5GSTA 3HJMA 4K6XA 2VUML 1O6JA 3GHAA 2MYGA 1LKOA 5BMUA 2Z3QB 2MZCA 2ERJA 4WBRD 4IJ3A 1ZYPA 1XIYA 4O92A 4WETA 2PMZP 1SKWB 2H8LA 2HRNA 1BFYA 3HKZP 3U5RE 4AR4A 5KN2A 4XTSA 3D0ZA 3VPTA 5G2ZA 1TWCL 4L5LA 3U6VA 1G7OA 5CYYA 3CMIA 5H5QA 1EP7A 3BJ5A 4ML6A 3UAPA 2IIYA 2REMA 5GAPD 7RXNA 5C4XL 5JWRB 1XPVA 2H1AA 3QPMA 5ELAA 1YF0A 1Y1VL 4HQZA 2E2IL 1N2AA 4ISDA 2V6KA 5DAKB 3UJ1A 4GRFA 2BMXA 3I4NL 4ZL7A 2WZ9A 1HQOA 6GSXA 3C71A 1I50L 3H4KA 5GZZB 2GSQA 5F07A 2LQOA 4QQ7A 4L0WA 2VL3A 3KYYA 3S1ML 2V2GA 4YQVA 3QFBC 2V41A 3LG6A 1FB6A 3ZVJA 4AF2A 4WFN1 3LWVB 1T7PB 4XS4B 3PGTA 3IHQA 1YQ1A 2AJQB 1JLWA 2BTOT 2NVLA 1T4YA 1Z3EA 1UA5A 1OC3A 2K6VA 3F63A 2VD1A 2C4JA 1ERTA 3KD0A 1GTBA 4YKFA 4POLA 2N5BA 1B13A 1Z6NA 4MH2A 3TRXA 1A8YA 2H73A 4AI1A 3KYXA 4KDXA 1MD4A 2QA2A 5EL8A 2A69D 2DIYA 4PNFA 1S3DA 4JZQA 1SU9A 4BPYA 3TKQA 3I6AA 1IU5A 3P2AA 3LEFA 4MZCA 1BAYA 3F8UA 3HOXL 5D73A 1YUZA 4GSNA 4LL1B 5E59A 3IDVA 2YJHA 2CQ9A 1I5GA 1GSDA 4KGIA 2CA8A 1GH2A 4ECIA 3RPPA 4XXBB 2R37A 3LPEB 3HAXC 4EKZA 3ZYWA 4ZL9A 3UBKA 3IHGA 3RDWA 3ERWA 4A3LL 2G2QA 3WT2A 2OE3A 1KEBA 1KTEA 3EC3A 4V2LA 2X8HA 1Z92B 2H70A 3HY2A 3AY8A 2A6ED 1DUGA 2H30A 2JA7L 1KBNA 3NZNA 4TR1A 4TOPA 2DSAA 3GMFA 4I2TA 1VF4A 4KSOA 1E6BA 5FHIA 4IHUA 3H97A 2PPTA 1LKMA 2F8FA 2OBIA 5DCGA 2R7ZL 2CZ3A 2HZEB 3ISOA 2AV4A 4Q5QA 2L6CA 3VI5A 2HRKA 2WCIA 4HQSA 1U88A 2L0ZA 2JL4A 4A3ML 2V0EA 3FDJA 3DRNA 3DKSA 4POBA 3SBCA 4I2UA 2KKDA 4NAXA 3GTLL 1XVQA 1S3AA 2YU9L 1WCML 1SJIA 4MMMA 3CTFA 2H1DA 2H75A 5C04A 1ZMAA 1B2JA 2DKIA 3I9V2 2X4AA 5A4VA 5M3FL 3BD2A 1TWFL 1Z5YE 3KJYA 4K8MA 2H6ZA 2M6OA 1JFUA 3PO2L 4QIWP 4MK3A 3A44A 2LEGA 2B7KA 3TRPA 2HZFA 4G19A 2HLSA 1XFLA 2GMGA 3M3MA 2M6PA 3QQCE 3KIJA 2HI7A 2E2GA 3TB2A 1TRUA 2VCTA 1GSFA 4FQUA 5CRWA 1A23A 2AHEA 4TXOB 1HNCA 1FOVA 3DXBA 3GH9A 4BWQA 1YF1A 1YUXA 4MF6A 4N0VA 1B71A 2V32A 5MGNA 4MH3A 4A3IL 3TJGA 1K3LA 4K0GA 3HVSA 2WB1P 4K1FA 2IMDA 3VFIA 1GSSA 4EF0A 1BJXA 1R0IA 1VF2A 1SMMA 1PN0A 2HXKA 3VURA 2HSMA 4GQFA 1DVBA 2DJ0A 2JZSA 4IN0A 5HR1A 2HSYA 3L4NA 4HU7A 2C0FA 2YV9A 3MPSA 3LXZA 5G5EA 4A3KL 1QQ2A 2TRXA 2VAFA 3QAWA 2GQLA 3FZ5A 1TK5B 4K9FA 5IMCA 1YJ6A 3TOUA 3PO3L 5A4WA 5A4UA 1ZGNA 1DSBA 3KEBA 1FVJA 4EL1A 3D5JA 4DSSA 1GNEA 2M72A 3QFAC 3UMAA 3B08B 2OADA 2DJJA 4KDUA 1Z9HA 4KA0A 5D9VA 5ID2A 4MJCA 4EDYA 5D9WA 5ECKB 1B48A 1VZHA 1R0GA 1BQ8A 2KP2A 3C7MA 3EE2A 3TDGA 1K0BA 3APSA 3IA1A 1IROA 1U3AA 5ECRB 3GTJL 1EGRA 1TTZA 4PUFC 2IMKA 1XWKA 2IJYA 1RQMA 3LORA 3DMLA 4CHSA 3KP9A 3QOUA 1B9YC 4YAVA 1HNBA 5G1KA 2J9HA 4DSQA 2ZUPA 1F37A 1K0AA 1SK2A 1SL1B 4GTUA 1K0CA 3RZ6A 3L9SA 3TKPA 5HR2A 5AISA 2R3XA 5COHA 5IYDL 4HZ2A 2C1YA 2MMZA 5D93A 3VWWA 3S17L 4V2MA 4WEYA 2X8CA 3D4TA 4POFA 5JVG1 4BY1L 1SL0B 4ZB8A 2JZRA 3VLNA 2H74A 1RB9A 4G2EA 2K8SA 5FT3A 3PIO1 1TRSA 4F03A 5DAKA 2YCDA 4HU9A 4ICYA 1C72A 4K0NA 1LKPA 3M9JA 4IJIA 1X9MB 2RFKB 3HJPA 2XJRA 2V1MA 4WR5A 1GTAA 4QL9A 2CR8A 5GAEc 1YKCA 1YEXA 3TCOA 5ECLB 2X49A 1B4PA 5AI2A 4GWRA 1NSWA 2OACA 1YDKA 1SKSB 4EIQA 4GSSA 5M5YL 5JCUA 2IFQB 4CW9A 4EXJA 3S1QL 4XS4A 1O8WA 2LQQA 5M5WL 2E2MA 4MP4A 3ZTLA 3WD6A 4KAEA 1V2AA 4KSMA 3ERGA 2B1KA 2RM6A 1R26A 1XWBA 2ON7A 1PKWA 2YNXA 4HZ4A 4Z2UA 4ME3A 4A3FL 2H1GA 4F2IA 5F06A 1FO5A 4X4JA 2XJQA 2FD3A 1YKAA 4MJAA 4WF4A 5ECMB 4C3JL 2NBSA 3MSUA 1R0FA 3L9UA 5EIOC 2NYDA 3MQKB 2AUSB 3IC4A 2V3BB 2IMEA 1JYBA 2I3YA 2GSSA 1CQHA 1VZGA 16GSA 1G7EA 2A2SA 3GX0A 4HJMA 1TOFA 1MTCA 4ZXGA 5DVBA 4K2DA 4AI0A 3F9UA 3ZFBA 4FH8A 3ZG6A 4XS1A 2C6AA 3PL5A 3FR9A 3LWOB 3L9VA 1XG8A 1BE7A 1SMUA 3C8EA 1JLVA 2XBIA 3GA4A 3P8WA 4PQHA 4F9ZA 4HDEA 3HOZL 1WRYA 4RUVA 3KH9A 18GSA 3HOWL 2C3NA 1T8EB 5J9CA 3QR6A 1PMTA 1EWXA 1YEPA 1KNGA 1DE1A 2BE5D 3PZAA 3LFLA 3TGZA 5L71A 2X99A 5AI3A 3US3A 1TJDA 1TU7A 1RYTA 4FYCA 2XJVA 4BBSL 2JZTA 4IQ1A 4TVEA 3P90A 1SK0A 4N0ZA 3WGDA 3LWAA 2FHEA 1F9MA 2X64A 4HOJA 1O7UA 2TRCP 4IBPA 2A2RA 2HZEA 4J56E 3TKRA 4TPUA 1WJKA 2O89A 5JWQB 4DSRA 5IO2A 6GSWA 1V58A 2QA1A 1V9WA 2R93L 1QCVA 3KP8A 5FJ8L 3IAS2 1B9XC 5G5FA 4ULXA 19GSA 4BA7A 4Y52L 5AIVA 3FEUA 2GVPA 5MLC3 1YK5A 1PKZA 4CY6A 2YP6A 4TVMA 4O5RA 2JACA 2N5FA 1RWDA 2A2PA 1T00A 2H76A 3H93A 2LCQA 3CSJA 3S14L 4JR4A 1S2ZA 3ZITA 1O8XA 4FYUA 4TN8A 3F4TA 4IW9A 2YJ7A 1T3BA 2J23A 2ZNMA 3LQ7A 1VF1A 1ERVA 5KN3A 5CNWA 1A0FA 1X5DA 5ELGA 4XCSA 2J9UB 2R5GA 2LSTA 1AIUA 4A3EL 1X5CA 1S3RA 3KYUA 1X5EA 2JA6L 2LNSA 4BWSA 2EY4E 2MBSA 2M4YA 2P5QA 4N10A 5GAHc 4CY8A 4AI2A 1GSYA 2AB6A 1MD3A 3LGCA 4IP6A 1N8JA 3PH9A 5CO3A 3APQA 2DKHA 3GKNA 3HVNA 2C80A 2KLXA 3ED3A 2C6BA 3Q74A 2YN1A 2HYXA 1EEJA 2VCXA 5KN0A 2WGRA 3E3EA 3DEXA 2CAIA 2XJUA 3UIWA 5DALB 4PNGA 5KN1A 4WF5A 3H9CA 3IU3I 3M3YL 5KOWA 1S30A 2FGXA 3CQZL 4Q5NA 4K5SA 1P7PA 4MF5A 1WMJA 4Q5RA 2GS3A 4PX1A 2AQCA
chains in the Genus database with same CATH topology
4G0LA 1SJ6A 4PQ1A 1CADA 3DVWA 20GSA 4LLRA 2H19A 2LS5A 4MCUA 2PUKC 4ECBA 3DWVA 1XOAA 5JVH1 4EVMA 2OKAA 3JCML 3EYTA 2GQKA 3J7Z1 1AUCA 4RI7A 1B2OA 5JWOB 4YWLA 3FR6A 2PBJA 5IMZA 1XBSA 2YV7A 2H6XA 1XWAA 1THXA 2GSTA 3GTUB 2AYJA 2DMMA 2X8GA 11GSA 4YQMA 1FHEA 2WULA 1Y6EA 1I9DA 2VIMA 3ZLPA 4BVXB 1K3YA 3ZL5A 1TDIA 4KE3A 3KCMA 2D2ZA 2CVKA 2DIZA 4QL7A 4ZB9A 1Y25A 2AYTA 5KOXA 2OJLA 4ID0A 5DM71 5J9BA 2OBKA 4ML1A 1FVKA 2PVEA 3FZAA 5J3RA 3EVIA 3ME7A 3HVVA 1GSUA 2YZHA 4RXNA 1X9SB 3I69A 2YOIA 5HFGA 1FG4A 3CRUA 4MZBA 3B0AB 2VUPA 1EZKA 2IFQA 2XJTA 1XXUA 1MDJA 4PTSA 2RDVA 4NHWA 2VLTA 3HCZA 3IR4A 4XS6A 3ZIJA 2B1LA 2LV3A 4DVCA 2PVOC 2ZIXA 1JHBA 4GQCA 2VL9A 1YZXA 2F3MA 2GQMA 5IO0A 9GSSA 4KH7A 2ERSA 2GDRA 3LW9A 4P3YB 4GXZA 5K2ME 3WGEA 2OE0A 1XW9A 2E0QA 2DJ3A 3TOTA 1EV9A 3RYGA 2QKEA 1DE2A 1MDKA 3O76A 1GUKA 3QDNA 4K7NA 2H1BA 4ZN3B 2EIQA 2RM5A 4ZILA 1AQXA 4ZN1B 2IMIA 2C0EA 4YH2A 1B4QA 2JI3A 4IGJA 4KW6A 2H72A 4ZL8A 3KZQA 1M99A 2E7PA 4TRXA 2PSMC 3G9BA 4KCEA 3RAZA 2R0CA 4V1Ap 3TRQA 5D9TA 1QYBA 2UZ8A 1X9WB 3L78A 1NXGA 3G7JA 2R0GA 3GL5A 4MLYA 4X43A 5DM61 4O5UA 3K35A 1SL2B 1FHMA 1ZYEA 1TKDB 3ME8A 4OFNA 2LRCA 3CXGA 2XHFA 1F3AA 2WJUA 3EINA 3WWNB 2JU5A 5ECOB 1NHOA 1IYHA 2PYAA 1XWCA 1T4ZA 1Q4JA 3KMNA 4EO3A 3DYRA 3ZFLA 3A5WA 1RDVA 5F05A 1RW1A 3TKSA 3MIXA 4NPBA 4E8EA 2JSZA 5H1Sc 1MEKA 2EIOA 4AHXA 4YWMA 5IM9A 3BBYA 3R2QA 2FCHA 5F0GA 3KM6A 4JAFA 1HD2A 2VL2A 1GL8A 3BCKA 2CX4A 1PGTA 3LYKA 1ZYQB 1EP8A 4POKA 3SWLA 1CQGA 4XGHA 5IIZA 1ZCPA 2FA8A 4O7HA 2DJ2A 3KXOA 2DMLA 1NNQA 1PX6A 2HFDA 1MDIA 3SS2A 2VLVA 2VCQA 2CAQA 1G0TA 2VD0A 2C8UA 3GNJA 2AAWA 5LD0A 3UEMA 4JRRA 3CRTA 1T9OA 2H0GA 2O8VB 4TW5A 2Z9SA 2XBQA 1S3CA 4AGSA 2LUSA 4PURA 1OE7A 4KNDA 5B7CA 1NW2A 3NOFA 1BQ7A 2MMOA 2QC7A 1K0MA 3GKXA 1ZZYA 4U671 1TI3A 1S24A 1F3BA 2XPEA 3E0UA 3LXTA 4K5RA 3KYWA 1AC1A 3TKSC 3GURA 4OCFA 3H1NA 3G7YA 3J7Yk 1ZYNA 2H0HA 3F4SA 3KMOA 4POMA 4N11A 5D8IA 4FIWA 3PIP1 3R3EA 3FKFA 1GUMA 2CT6A 1ZL9A 2VL2C 1OVNA 5G31A 3UOMA 2MS3A 1CAAA 1DX8A 3V1WA 1BYEA 2P0GA 2RUEA 3IV4A 2V0FA 5BRTA 1PD21 4EE0A 4OO4A 2B5ID 2O5JD 3O3TA 1GLPA 2GZYA 1WOUA 2N5AA 1M7TA 3N9JA 2F8AA 4JADA 4F0CA 4V1Ag 1R0JA 4TR3A 6GSUA 1THOA 1UVZA 1QXHA 3QAVA 3D21A 1ERWA 3GUSA 1SYXA 2EIRA 3HHVA 4MPFA 3ZZXA 2QL0A 1BG5A 1NHYA 2EC4A 1FOHA 2M80A 2PGTA 3FW2A 3QD9A 4B8CD 2DJ1A 3C1RA 3A2XA 4I8BA 4OFMA 1ST9A 2WFCA 4IKHA 3TJKA 3GTUA 5J5NA 7GSSA 3RBTA 4TR4A 1JZRA 4I6XA 5KEJA 1AQVA 2A4HA 4BVXA 3D6IA 3HXSA 3UBLA 1LU4A 5B8AA 4GF0A 1SK1A 2HT9A 1NM3A 2L59A 3MAKA 4PUAA 4ZBAA 3K8NA 5EINC 2CVDA 2VCZA 4XIHA 2KOKA 4AR3A 4X0XA 2Z3RB 2FWGA 1A2JA 1GTUA 4E6YA 2FLSA 1ON4A 4MZWA 2FWHA 5F8BA 2LRNA 4WXTA 1XVWA 2GZZA 5FWGA 1FAAA 4AR6A 1R5AA 3W8JA 4GSTA 1Q98A 4LMWA 3J7Y1 3QCPA 3D22A 3FYGA 2JADA 4LA1A 3UL3A 2RUFA 2B6MA 1G6WA 2K9FA 2LNTA 2QSIA 5A5KA 1SKRB 2O87A 1FB0A 1SD9A 3F6FA 3LSZA 5DJMA 2O85A 4Z2TA 3IBHA 3UVTA 2MMAA 3HVXA 1EOHA 2VM1A 3FR3A 5IOWA 5J4UA 5HFKA 2K18A 2FWFA 5IOXA 2NDOA 1WJVA 2I81A 4E8HA 3ZMLA 3QMXA 3CYNA 5IMFA 1IU6A 4KDYA 4NMUA 5EVOA 3RZTA 1PN9A 3WYWA 1O81A 3Q19A 2MBTA 3N5OA 5AN9H 2PWJA 3MWHA 5HR3A 2A6HD 2A68D 4AHZA 4RQXA 1IRNA 2TIRA 2C0DA 2YZUA 1XOBA 3KTBA 2GZPA 1BQ9A 1ZOFA 2B5XA 3VWXA 3MSZA 1M0UA 1OKDA 4TXOA 3ZIVA 2CKAA 2R2JA 2VL6A 4Q5FA 2HRAA 2YWNA 2XPDA 2CV4A 2P31A 1BX9A 3FZ9A 3A3TA 4D73B 5GAND 1OC9B 2PERA 1H4OA 3A2VA 1U6TA 6GSVA 3F3QA 3ZRDA 3ZVJD 2CVBA 2HSHA 1ERUA 4EUYA 4AJ6A 3VPQA 3EPTA 1T9PA 4WBJA 2H12A 3FY7A 2GLRA 3EWLA 1ACVA 2LRTA 5AIXA 5J41A 5HFIA 4NWYA 3WWLA 4GLTA 4JAEA 4HUAA 3HKRA 5GADc 2K8VA 5CRHA 1UC7A 5IPHA 4TR0A 2WS2A 3GIXA 5B6MA 2B3SA 4LHNA 2OE1A 4HI7A 1E8JA 2WDUA 1ML6A 2L4QA 1V57A 1H7VA 1R4WA 2C0GA 3HA9A 2NTOA 1LJRA 5B8BA 4ILFA 3W8SA 3VWVA 4AJ7A 3IPZA 5EPFA 2GT6A 1XW6A 3LYPA 1PA3A 2H01A 4FYBA 2L5LA 3RHBA 4OMVA 2FNOA 1Z7PA 2V6OA 3M8NA 2IL3A 3PPUA 5IQYA 5CP1A 3L0HA 4YKGA 3VPBE 3A2WA 4MNNA 1A2LA 1BRFA 2LJAA 4XRDA 2DJKA 3DVXA 2RIIA 22GSA 5G30A 4BL7B 4TXVA 1GULA 3KTLA 1TRVA 5ABRA 1TK0B 3IRAA 2RLIA 2B5EA 1QMVA 3IAM2 2PN8A 2HR5A 2DBCA 1U87A 1AQWA 4AR5A 4KB3A 4Z7XA 1YV1A 1F2EA 1TP9A 1JZOA 5CRGA 4PQIA 2NPBA 3VWUA 3WT1A 4HS1A 3IK9A 3DGQA 4MDCA 1VGLA 3MYDA 1VF3A 3GKMA 3W6GA 1K0OA 3CSIA 3RPNA 5ECQB 3IXRA 4NXIA 3BCIA 1R0HA 1IW7D 1UN2A 2HE3A 10GSA 3MNGA 4K2XA 3MDKA 5H5SA 4YQUA 4G0KA 1VZIA 1GRXA 6GSSA 5ECNB 4BVYB 1U3IA 2JI1A 4XRAA 3EURA 5INYA 4KCAA 3QVDA 3UVHA 2L5OA 5LCZA 3PKJA 4RQRA 2R6KA 3A5IA 4CDOA 2L4CA 4PGTA 4AHWA 1GSEA 2I9HA 3EMPA 5MF6A 1PX7A 1XCCA 1XZOA 2LJKA 4NHZA 4OD7A 4USSA 1OAZA 2KUCA 2YWIA 4HEA2 4X1UA 1EV4A 1O85A 1GSQA 3TKSE 5HR0A 4ZIJA 4AJ8A 3HZ4A 4TKYA 4ECJA 5ECSA 3GYKA 2IPAA 4O5QA 1F6MC 3F6DA 3HYPA 4KUNA 5IY0A 3VK9A 5DQYA 4LHLA 4IELA 1OE8A 2GGTA 3Q6OA 1OWCA 2FUG2 3Q18A 4KF9A 1QUWA 3GSSA 1J08A 1Z7RA 3FMWA 4ECCA 3FRCA 2QGVA 3GRXA 1T1VA 4MJEA 1HNAA 2DLXA 4HJ2A 4POGA 2A4VA 5MFPA 2PU9C 5C00A 5DDLA 1X0RA 4N30A 3GH6A 4OWYA 1WWJA 3DD3A 2IWTA 5JCGA 1SJZA 1QFNA 1TU8A 3TJBA 4KX4A 1PQNA 4LL4B 1A24A 3LNLA 4MJBA 3ERFA 1AW9A 5HQPA 3S9FA 2VO4A 3KYVA 3IE3A 4G6BA 1R5PA 2FY6A 1QK8A 1K0NA 2JI2A 3E9JB 4OFTA 2OA7A 3G7IA 5AGYA 3H79A 2IN3A 1IYIA 1JZDA 4IS0A 3EU4A 2H66A 5CRDA 2M46A 1HYUA 5DBQA 12GSA 2YANA 1SENA 3FZ4A 5H5RA 1SD8A 4JAGA 2LJRA 4G9HA 4MF7A 4G0IA 3HDCA 1A2MA 1AXDA 2ES7A 2YWMA 1VCXA 4IVFA 1TW9A 4XHMA 4K7OA 3O6TA 1LTLA 3IC8A 1OKTA 3P7XA 5GSSA 2GTUA 4K9ZA 5DQSA 1M9BA 3PR8A 5D96A 5G1LA 5IMVA 4PXOA 2AUVA 2H6YA 4EIPA 5LNKe 3KGKA 1AAZA 1M2AA 2WRTA 6GSTA 5DJLA 3CTGA 5IPGA 3OR5A 2KP1A 1GTIA 2ON5A 4D73A 1TRWA 1OC9A 1RDGA 1WE0A 1WP0A 3GV1A 3HJOA 5CREA 4EC0A 2YWOA 2CKCA 3HZ8A 1ILOA 1RYQA 1PSQA 4F0BA 3GL3A 1TK8B 4MA9A 3ZREA 1XWGA 3GN3A 2KHPA 1TXXA 4ZBDA 2PMTA 4OCEA 1RK4A 3CSHA 1JZWA 3GKKA 2HNLA 1R7HA 1YK4A 4L8EA 2I4AA 4K7IA 3FK8A 2R4VA 4UY81 1OWBA 4AI3A 4MPGA 1SYRA 1QGVA 4JBBA 1V40A 5DALA 1SMWA 4A5PA 3APOA 8GSSA 2JSYA 1C09A 5GAGc 4L5OA 4G10A 17GSA 3KH7A 3NIVA 3VI7A 1ODHA 3GSTA 2K2DA 1W4VA 1GUHA 3WGXA 1K0DA 1V98A 6GSYA 14GSA 4TR1B 1M9AA 4LMVA 1ABAA 4JR6A 3M0FA 3TJJA 5B6NA 4EDZA 3PINA 3EU3A 5ECIB 2GT5A 1XW5A 2WB9A 2CX3A 3IK7A 5ENUA 1FHHA 1URMA 2FA4A 3GFKA 4BL7A 2F51A 3P8BA 4NV2A 4YAPA 1J9BA 1B8XA 1M2BA 3EMXA 4ACSA 3QAGA 5ECPB 2VCWA 5JCWA 3J7Yb 3GX8A 1M2DA 4AHYA 4ZBBA 4J2FA 1K3OA 2XJSA 3I43A 4NV5A 4IQAA 1OC8A 2R0PA 1NXEA 2PVQA 2LKUA 1GWCA 1PRXA 2O7KA 3F0IA 3ZMKA 13GSA 3FHKA 5DCHA 4L0UA 2YPMA 1G6YA 3PKIA 2CZ2A 1BEDA 2XJPA 2B7JA 3M9KA 1E2YA 3LJRA 2C3TA 2IMFA 4JEDA 2M4VA 3PWFA 5IMDA 2BJXA 2P5RA 4DEJA 3F3RA 6RXNA 1PL2A 3M1GA 3UARA 2XC2A 4O32A 1PL1A 3BOAA 2ALBA 3RHCA 3HD5A 5RXNA 1OYJA 4WKWA 5AN1A 2DC5A 3C73A 5IMAA 2F9SA 4BVYA 1EOGA 1FW1A 1USBA 3DIEA 4Z2RA 4GCIA 4I5QA 1WPIA 4V196 3F4RA 3TUEA 4ZB6A 2G0FA 5EY6A 4MABA 4FO5A 1EGOA 2L57A 2C3QA 2FWEA 1Z6MA 4V2NA 4H86A 2H71A 1WIKA 1J0FA 4I97A 2LTKA 2MMNA 2VCVA 1YY7A 2VLUA 5CAXA 3CBUA 1W89A 1A8LA 2I1UA 4IP1A 1TI1A 2DSXA 2VOCA 1T9QA 2L6DA 1GLQA 5MFZA 3C1SA 2PVXA 4WR4A 5ECHB 1ZRPA 4DSSB 4GS7D 3H8QA 5D9XA 1LBKA 5E4WA 2ZCTA 1GNWA 3TJFA 3NFPI 2KN9A 5ID2B 4JE1A 4JU5A 2B5YA 4RI6A 1O73A 1VRSD 2GSRA 4J57E 1EEMA 3IOSA 8RXNA 2VM2A 3D4MA 4OO5A 1A0RP 1H75A 1GP1A 1DBYA 2H0IA 2HRFA 4F82A 5GSTA 3HJMA 4K6XA 1O6JA 3GHAA 2MYGA 1LKOA 5BMUA 2Z3QB 2MZCA 2ERJA 4WBRD 4IJ3A 1ZYPA 1XIYA 4O92A 4WETA 1SKWB 2H8LA 2HRNA 1BFYA 3U5RE 4AR4A 5KN2A 4XTSA 3D0ZA 3VPTA 5G2ZA 4L5LA 3U6VA 1G7OA 5CYYA 3CMIA 5H5QA 1EP7A 3BJ5A 4ML6A 3UAPA 2IIYA 2REMA 5GAPD 7RXNA 5JWRB 1XPVA 2H1AA 3QPMA 5ELAA 1YF0A 4HQZA 1N2AA 4ISDA 2V6KA 5DAKB 3UJ1A 4GRFA 2BMXA 4ZL7A 2WZ9A 1HQOA 6GSXA 3C71A 3H4KA 5GZZB 2GSQA 5F07A 2LQOA 4QQ7A 4L0WA 3KYYA 2VL3A 2V2GA 4YQVA 3QFBC 2V41A 3LG6A 1FB6A 3ZVJA 4AF2A 4WFN1 1T7PB 4XS4B 3PGTA 3IHQA 1YQ1A 2AJQB 1JLWA 2BTOT 2NVLA 1T4YA 1Z3EA 1UA5A 1OC3A 2K6VA 3F63A 2VD1A 2C4JA 1ERTA 3KD0A 1GTBA 4YKFA 4POLA 2N5BA 1B13A 1Z6NA 4MH2A 3TRXA 1A8YA 2H73A 4AI1A 3KYXA 4KDXA 1MD4A 2QA2A 5EL8A 2A69D 2DIYA 4PNFA 1S3DA 4JZQA 1SU9A 4BPYA 3TKQA 3I6AA 1IU5A 3P2AA 3LEFA 4MZCA 1BAYA 3F8UA 5D73A 1YUZA 4GSNA 4LL1B 5E59A 3IDVA 2YJHA 2CQ9A 1I5GA 1GSDA 4KGIA 2CA8A 1GH2A 4ECIA 3RPPA 4XXBB 2R37A 3LPEB 4EKZA 3ZYWA 4ZL9A 3UBKA 3IHGA 3RDWA 3ERWA 2G2QA 3WT2A 2OE3A 1KEBA 1KTEA 3EC3A 4V2LA 2X8HA 1Z92B 2H70A 3HY2A 3AY8A 2A6ED 1DUGA 2H30A 1KBNA 4TR1A 3NZNA 4TOPA 2DSAA 3GMFA 4I2TA 1VF4A 4KSOA 1E6BA 5FHIA 4IHUA 2PPTA 1LKMA 2F8FA 2OBIA 5DCGA 2CZ3A 2HZEB 3ISOA 2AV4A 4Q5QA 2L6CA 3VI5A 2HRKA 2WCIA 4HQSA 1U88A 2L0ZA 2JL4A 2V0EA 3DRNA 3DKSA 4POBA 3SBCA 4I2UA 2KKDA 4NAXA 1XVQA 1S3AA 1SJIA 4MMMA 3CTFA 2H1DA 2H75A 5C04A 1ZMAA 1B2JA 2DKIA 3I9V2 2X4AA 5A4VA 3BD2A 1Z5YE 3KJYA 4K8MA 2H6ZA 2M6OA 1JFUA 4MK3A 3A44A 2LEGA 2B7KA 3TRPA 2HZFA 4G19A 2HLSA 1XFLA 2GMGA 3M3MA 2M6PA 3QQCE 3KIJA 2HI7A 2E2GA 3TB2A 1TRUA 2VCTA 1GSFA 4FQUA 5CRWA 1A23A 2AHEA 4TXOB 1HNCA 1FOVA 3DXBA 3GH9A 4BWQA 1YF1A 1YUXA 4MF6A 4N0VA 1B71A 2V32A 5MGNA 4MH3A 3TJGA 1K3LA 4K0GA 3HVSA 4K1FA 2IMDA 3VFIA 1GSSA 4EF0A 1BJXA 1R0IA 1VF2A 1SMMA 1PN0A 2HXKA 3VURA 2HSMA 4GQFA 1DVBA 2DJ0A 2JZSA 4IN0A 5HR1A 2HSYA 3L4NA 4HU7A 2C0FA 2YV9A 3MPSA 3LXZA 5G5EA 1QQ2A 2TRXA 2VAFA 3QAWA 2GQLA 3FZ5A 1TK5B 4K9FA 5IMCA 1YJ6A 3TOUA 5A4WA 5A4UA 1ZGNA 1DSBA 3KEBA 1FVJA 4EL1A 3D5JA 4DSSA 1GNEA 2M72A 3QFAC 3UMAA 3B08B 2OADA 2DJJA 4KDUA 1Z9HA 4KA0A 5D9VA 5ID2A 4MJCA 4EDYA 5D9WA 5ECKB 1B48A 1VZHA 1R0GA 1BQ8A 2KP2A 3C7MA 3EE2A 3TDGA 1K0BA 3APSA 3IA1A 1IROA 1U3AA 5ECRB 1EGRA 1TTZA 4PUFC 2IMKA 1XWKA 2IJYA 1RQMA 3LORA 3DMLA 4CHSA 3KP9A 3QOUA 1B9YC 4YAVA 1HNBA 5G1KA 2J9HA 4DSQA 2ZUPA 1F37A 1K0AA 1SK2A 1SL1B 4GTUA 1K0CA 3RZ6A 3L9SA 3TKPA 5HR2A 5AISA 2R3XA 5COHA 4HZ2A 2C1YA 2MMZA 5D93A 3VWWA 4V2MA 4WEYA 2X8CA 3D4TA 4POFA 5JVG1 1SL0B 4ZB8A 2JZRA 3VLNA 2H74A 1RB9A 4G2EA 2K8SA 5FT3A 3PIO1 1TRSA 4F03A 5DAKA 2YCDA 4HU9A 4ICYA 1C72A 4K0NA 1LKPA 3M9JA 4IJIA 1X9MB 3HJPA 2XJRA 2V1MA 4WR5A 1GTAA 4QL9A 2CR8A 5GAEc 1YKCA 1YEXA 3TCOA 5ECLB 2X49A 1B4PA 5AI2A 4GWRA 1NSWA 2OACA 1YDKA 1SKSB 4EIQA 4GSSA 5JCUA 2IFQB 4CW9A 4EXJA 4XS4A 1O8WA 2LQQA 2E2MA 4MP4A 3ZTLA 3WD6A 4KAEA 1V2AA 4KSMA 3ERGA 2B1KA 2RM6A 1R26A 1XWBA 2ON7A 1PKWA 2YNXA 4HZ4A 4Z2UA 4ME3A 2H1GA 4F2IA 5F06A 1FO5A 4X4JA 2XJQA 2FD3A 1YKAA 4MJAA 4WF4A 5ECMB 2NBSA 3MSUA 1R0FA 3L9UA 5EIOC 2NYDA 3IC4A 2V3BB 2IMEA 1JYBA 2I3YA 2GSSA 1CQHA 1VZGA 16GSA 1G7EA 2A2SA 3GX0A 4HJMA 1TOFA 1MTCA 4ZXGA 5DVBA 4K2DA 4AI0A 3F9UA 3ZFBA 4FH8A 3ZG6A 4XS1A 2C6AA 3FR9A 3L9VA 1BE7A 1SMUA 3C8EA 1JLVA 2XBIA 3GA4A 3P8WA 4PQHA 4F9ZA 4HDEA 1WRYA 4RUVA 3KH9A 18GSA 1T8EB 2C3NA 5J9CA 3QR6A 1PMTA 1EWXA 1YEPA 1KNGA 1DE1A 2BE5D 3PZAA 3LFLA 3TGZA 5L71A 2X99A 5AI3A 3US3A 1TJDA 1TU7A 1RYTA 4FYCA 2XJVA 2JZTA 4IQ1A 4TVEA 3P90A 1SK0A 4N0ZA 3WGDA 3LWAA 2FHEA 1F9MA 2X64A 4HOJA 1O7UA 2TRCP 4IBPA 2A2RA 2HZEA 4J56E 3TKRA 4TPUA 1WJKA 2O89A 5JWQB 4DSRA 5IO2A 6GSWA 1V58A 2QA1A 3KP8A 1V9WA 1QCVA 3IAS2 1B9XC 5G5FA 4ULXA 19GSA 4BA7A 5AIVA 3FEUA 2GVPA 5MLC3 1YK5A 1PKZA 4CY6A 2YP6A 4TVMA 4O5RA 2JACA 2N5FA 1RWDA 2A2PA 1T00A 2H76A 3H93A 2LCQA 3CSJA 4JR4A 1S2ZA 3ZITA 1O8XA 4FYUA 4TN8A 3F4TA 4IW9A 2YJ7A 1T3BA 2J23A 2ZNMA 3LQ7A 1VF1A 1ERVA 5KN3A 5CNWA 1A0FA 1X5DA 5ELGA 4XCSA 2J9UB 2R5GA 2LSTA 1AIUA 1X5CA 3KYUA 1X5EA 2LNSA 4BWSA 2MBSA 2M4YA 2P5QA 4N10A 5GAHc 4CY8A 4AI2A 1GSYA 2AB6A 1MD3A 3LGCA 4IP6A 1N8JA 3PH9A 5CO3A 3APQA 2DKHA 3GKNA 2C80A 2KLXA 3ED3A 2C6BA 3Q74A 2YN1A 2HYXA 1EEJA 2VCXA 5KN0A 2WGRA 3E3EA 3DEXA 2CAIA 2XJUA 3UIWA 5DALB 4PNGA 5KN1A 4WF5A 3IU3I 5KOWA 1S30A 2FGXA 4Q5NA 4K5SA 4MF5A 1WMJA 4Q5RA 2GS3A 4PX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJ6 A;  4PQ1 A;  3DVW A;  20GS A;  4LLR A;  2H19 A;  2LS5 A;  4MCU A;  2PUK C;  4ECB A;  3DWV A;  1XOA A;  4EVM A;  2OKA A;  3JCM L;  3EYT A;  2GQK A;  1AUC A;  4RI7 A;  5JWO B;  3FR6 A;  2PBJ A;  5IMZ A;  1XBS A;  2YV7 A;  2H6X A;  1XWA A;  1THX A;  2GST A;  3GTU B;  2DMM A;  2X8G A;  11GS A;  4YQM A;  1FHE A;  2WUL A;  1Y6E A;  1I9D A;  2VIM A;  3ZLP A;  1K3Y A;  3ZL5 A;  1TDI A;  4KE3 A;  3KCM A;  2D2Z A;  2CVK A;  2DIZ A;  4QL7 A;  4ZB9 A;  1Y25 A;  2AYT A;  2OJL A;  4ID0 A;  5J9B A;  2OBK A;  4ML1 A;  1FVK A;  5J3R A;  3FZA A;  3EVI A;  3ME7 A;  3HVV A;  1GSU A;  2YZH A;  1X9S B;  3I69 A;  2YOI A;  5HFG A;  1FG4 A;  3CRU A;  4MZB A;  3B0A B;  2VUP A;  1EZK A;  2IFQ A;  1XXU A;  1MDJ A;  4NHW A;  2VLT A;  3HCZ A;  3IR4 A;  4XS6 A;  3ZIJ A;  2B1L A;  2LV3 A;  4DVC A;  2PVO C;  1JHB A;  4GQC A;  2VL9 A;  1YZX A;  2F3M A;  2GQM A;  5IO0 A;  9GSS A;  4KH7 A;  2GDR A;  4P3Y B;  4GXZ A;  3WGE A;  2OE0 A;  1XW9 A;  2E0Q A;  2DJ3 A;  3TOT A;  1EV9 A;  2QKE A;  1DE2 A;  1MDK A;  3O76 A;  1GUK A;  3QDN A;  4K7N A;  2H1B A;  2EIQ A;  2RM5 A;  4ZIL A;  1AQX A;  2IMI A;  2C0E A;  4YH2 A;  1B4Q A;  4IGJ A;  4KW6 A;  2H72 A;  4ZL8 A;  3KZQ A;  1M99 A;  2E7P A;  4TRX A;  3G9B A;  4KCE A;  3RAZ A;  4V1A p;  3TRQ A;  5D9T A;  1X9W B;  3L78 A;  3G7J A;  3GL5 A;  4MLY A;  4X43 A;  1SL2 B;  1ZYE A;  1TKD B;  3ME8 A;  4OFN A;  2LRC A;  3CXG A;  2XHF A;  1F3A A;  2WJU A;  3EIN A;  2JU5 A;  5ECO B;  1NHO A;  1IYH A;  1XWC A;  1T4Z A;  1Q4J A;  3KMN A;  4EO3 A;  3DYR A;  3ZFL A;  3A5W A;  5F05 A;  1RW1 A;  3TKS A;  4NPB A;  4E8E A;  2JSZ A;  1MEK A;  2EIO A;  5IM9 A;  3BBY A;  3R2Q A;  2FCH A;  5F0G A;  3KM6 A;  1HD2 A;  2VL2 A;  1GL8 A;  3BCK A;  2CX4 A;  1PGT A;  3LYK A;  1ZYQ B;  1EP8 A;  4POK A;  3SWL A;  1CQG A;  5IIZ A;  1ZCP A;  2FA8 A;  4O7H A;  2DJ2 A;  3KXO A;  2DML A;  1PX6 A;  2HFD A;  1MDI A;  2VLV A;  2VCQ A;  2CAQ A;  1G0T A;  2VD0 A;  2C8U A;  3GNJ A;  2AAW A;  5LD0 A;  3UEM A;  4JRR A;  3CRT A;  2H0G A;  2O8V B;  4TW5 A;  2Z9S A;  2XBQ A;  1S3C A;  4AGS A;  2LUS A;  4PUR A;  1OE7 A;  4KND A;  5B7C A;  1NW2 A;  3NOF A;  1BQ7 A;  2MMO A;  2QC7 A;  1K0M A;  3GKX A;  1ZZY A;  1TI3 A;  1F3B A;  2XPE A;  3E0U A;  3LXT A;  1AC1 A;  3TKS C;  3GUR A;  4OCF A;  3H1N A;  3G7Y A;  3J7Y k;  2H0H A;  3F4S A;  3KMO A;  4POM A;  4N11 A;  5D8I A;  4FIW A;  3FKF A;  1GUM A;  2CT6 A;  1ZL9 A;  2VL2 C;  1OVN A;  5G31 A;  3UOM A;  3V1W A;  1BYE A;  2P0G A;  2RUE A;  3IV4 A;  1PD2 1;  4EE0 A;  4OO4 A;  3O3T A;  1GLP A;  2GZY A;  1WOU A;  2N5A A;  1M7T A;  3N9J A;  2F8A A;  4F0C A;  4V1A g;  4TR3 A;  6GSU A;  1THO A;  1UVZ A;  1QXH A;  3QAV A;  3D21 A;  1ERW A;  3GUS A;  1SYX A;  2EIR A;  3HHV A;  4MPF A;  3ZZX A;  1BG5 A;  1NHY A;  2EC4 A;  2M80 A;  2PGT A;  3FW2 A;  3QD9 A;  2DJ1 A;  3C1R A;  3A2X A;  4I8B A;  4OFM A;  1ST9 A;  2WFC A;  4IKH A;  3TJK A;  3GTU A;  5J5N A;  7GSS A;  3RBT A;  4TR4 A;  1JZR A;  4I6X A;  5KEJ A;  1AQV A;  4BVX A;  3D6I A;  3HXS A;  3UBL A;  1LU4 A;  5B8A A;  4GF0 A;  1SK1 A;  2HT9 A;  1NM3 A;  2L59 A;  3MAK A;  4PUA A;  4ZBA A;  3K8N A;  2CVD A;  2VCZ A;  4XIH A;  2KOK A;  4X0X A;  2FWG A;  1A2J A;  1GTU A;  2FLS A;  1ON4 A;  4MZW A;  2FWH A;  5F8B A;  2LRN A;  4WXT A;  1XVW A;  2GZZ A;  5FWG A;  1FAA A;  1R5A A;  3W8J A;  4GST A;  1Q98 A;  4LMW A;  3QCP A;  3D22 A;  3FYG A;  2JAD A;  4LA1 A;  3UL3 A;  2RUF A;  2B6M A;  1G6W A;  2K9F A;  2LNT A;  2QSI A;  5A5K A;  1SKR B;  2O87 A;  1FB0 A;  1SD9 A;  3F6F A;  3LSZ A;  5DJM A;  2O85 A;  3IBH A;  3UVT A;  2MMA A;  3HVX A;  1EOH A;  2VM1 A;  3FR3 A;  5IOW A;  5J4U A;  5HFK A;  2K18 A;  2FWF A;  5IOX A;  2NDO A;  2I81 A;  4E8H A;  3ZML A;  3QMX A;  3CYN A;  5IMF A;  4KDY A;  4NMU A;  5EVO A;  1PN9 A;  3WYW A;  1O81 A;  3Q19 A;  2MBT A;  3N5O A;  2PWJ A;  3MWH A;  5HR3 A;  4RQX A;  2TIR A;  2C0D A;  2YZU A;  1XOB A;  3KTB A;  2GZP A;  1ZOF A;  2B5X A;  3VWX A;  3MSZ A;  1M0U A;  1OKD A;  4TXO A;  3ZIV A;  2R2J A;  4Q5F A;  2YWN A;  2XPD A;  2CV4 A;  2P31 A;  1BX9 A;  3FZ9 A;  3A3T A;  4D73 B;  5GAN D;  1OC9 B;  2PER A;  1H4O A;  3A2V A;  1U6T A;  6GSV A;  3F3Q A;  3ZRD A;  3ZVJ D;  2CVB A;  2HSH A;  1ERU A;  4EUY A;  4AJ6 A;  3VPQ A;  4WBJ A;  3EWL A;  3FY7 A;  2GLR A;  1ACV A;  2LRT A;  5AIX A;  5J41 A;  5HFI A;  4NWY A;  4GLT A;  4HUA A;  3HKR A;  2K8V A;  5CRH A;  1UC7 A;  5IPH A;  4TR0 A;  2WS2 A;  3GIX A;  5B6M A;  2B3S A;  2OE1 A;  4HI7 A;  2WDU A;  1ML6 A;  2L4Q A;  1V57 A;  1R4W A;  2C0G A;  3HA9 A;  2NTO A;  1LJR A;  5B8B A;  4ILF A;  3W8S A;  3VWV A;  4AJ7 A;  3IPZ A;  5EPF A;  2GT6 A;  1XW6 A;  3LYP A;  1PA3 A;  2H01 A;  4FYB A;  2L5L A;  3RHB A;  4OMV A;  2FNO A;  1Z7P A;  2V6O A;  3M8N A;  2IL3 A;  5IQY A;  5CP1 A;  3L0H A;  3A2W A;  1A2L A;  2LJA A;  4XRD A;  2DJK A;  3DVX A;  2RII A;  22GS A;  5G30 A;  4TXV A;  1GUL A;  3KTL A;  1TRV A;  5ABR A;  1TK0 B;  3IRA A;  2RLI A;  2B5E A;  1QMV A;  3IAM 2;  2PN8 A;  2DBC A;  1U87 A;  1AQW A;  4KB3 A;  4Z7X A;  1F2E A;  1TP9 A;  1JZO A;  5CRG A;  4PQI A;  2NPB A;  3VWU A;  3WT1 A;  4HS1 A;  3IK9 A;  3DGQ A;  4MDC A;  1VGL A;  1VF3 A;  3GKM A;  3W6G A;  1K0O A;  3CSI A;  3RPN A;  5ECQ B;  3IXR A;  4NXI A;  3BCI A;  1UN2 A;  2HE3 A;  10GS A;  3MNG A;  3MDK A;  5H5S A;  4YQU A;  1GRX A;  6GSS A;  5ECN B;  1U3I A;  4XRA A;  3EUR A;  5INY A;  4KCA A;  3UVH A;  2L5O A;  5LCZ A;  4RQR A;  2R6K A;  4CDO A;  2L4C A;  4PGT A;  1GSE A;  2I9H A;  3EMP A;  1PX7 A;  1XCC A;  1XZO A;  2LJK A;  4NHZ A;  4OD7 A;  1OAZ A;  2KUC A;  2YWI A;  4HEA 2;  4X1U A;  1EV4 A;  1O85 A;  1GSQ A;  3TKS E;  5HR0 A;  4ZIJ A;  4AJ8 A;  3HZ4 A;  4TKY A;  4ECJ A;  5ECS A;  3GYK A;  2IPA A;  1F6M C;  3F6D A;  3HYP A;  4KUN A;  3VK9 A;  5DQY A;  4IEL A;  1OE8 A;  2GGT A;  3Q6O A;  2FUG 2;  3Q18 A;  1QUW A;  3GSS A;  1J08 A;  1Z7R A;  4ECC A;  3FRC A;  2QGV A;  3GRX A;  1T1V A;  4MJE A;  1HNA A;  2DLX A;  4HJ2 A;  2A4V A;  2PU9 C;  5C00 A;  5DDL A;  1X0R A;  4N30 A;  3GH6 A;  4OWY A;  1WWJ A;  3DD3 A;  2IWT A;  5JCG A;  1SJZ A;  1QFN A;  1TU8 A;  3TJB A;  4KX4 A;  1PQN A;  4LL4 B;  1A24 A;  4MJB A;  3ERF A;  1AW9 A;  5HQP A;  3S9F A;  2VO4 A;  3IE3 A;  1R5P A;  2FY6 A;  1QK8 A;  1K0N A;  3E9J B;  4OFT A;  2OA7 A;  3G7I A;  5AGY A;  3H79 A;  2IN3 A;  1IYI A;  1JZD A;  4IS0 A;  3EU4 A;  2H66 A;  5CRD A;  2M46 A;  1HYU A;  5DBQ A;  12GS A;  2YAN A;  1SEN A;  3FZ4 A;  5H5R A;  1SD8 A;  2LJR A;  4G9H A;  4MF7 A;  3HDC A;  1A2M A;  1AXD A;  2ES7 A;  2YWM A;  4IVF A;  1TW9 A;  4XHM A;  4K7O A;  3O6T A;  1OKT A;  3P7X A;  5GSS A;  2GTU A;  4K9Z A;  5DQS A;  1M9B A;  3PR8 A;  5D96 A;  5G1L A;  5IMV A;  4PXO A;  2AUV A;  2H6Y A;  5LNK e;  3KGK A;  1AAZ A;  1M2A A;  2WRT A;  6GST A;  5DJL A;  3CTG A;  5IPG A;  3OR5 A;  2KP1 A;  1GTI A;  2ON5 A;  4D73 A;  1TRW A;  1OC9 A;  1WE0 A;  1WP0 A;  3GV1 A;  3HJO A;  5CRE A;  4EC0 A;  2YWO A;  3HZ8 A;  1ILO A;  1PSQ A;  4F0B A;  3GL3 A;  1TK8 B;  4MA9 A;  3ZRE A;  1XWG A;  3GN3 A;  2KHP A;  1TXX A;  4ZBD A;  2PMT A;  4OCE A;  1RK4 A;  3CSH A;  1JZW A;  3GKK A;  2HNL A;  1R7H A;  4L8E A;  2I4A A;  4K7I A;  3FK8 A;  2R4V A;  4MPG A;  1SYR A;  1QGV A;  4JBB A;  1V40 A;  5DAL A;  3APO A;  8GSS A;  2JSY A;  4L5O A;  4G10 A;  17GS A;  3KH7 A;  3NIV A;  3VI7 A;  3GST A;  1W4V A;  1GUH A;  3WGX A;  1K0D A;  1V98 A;  6GSY A;  14GS A;  4TR1 B;  1M9A A;  4LMV A;  1ABA A;  4JR6 A;  3M0F A;  3TJJ A;  5B6N A;  4EDZ A;  3PIN A;  3EU3 A;  5ECI B;  2GT5 A;  1XW5 A;  2WB9 A;  2CX3 A;  3IK7 A;  5ENU A;  1URM A;  2FA4 A;  3GFK A;  4BL7 A;  2F51 A;  4NV2 A;  4YAP A;  1J9B A;  1B8X A;  1M2B A;  3EMX A;  4ACS A;  3QAG A;  5ECP B;  2VCW A;  5JCW A;  3J7Y b;  3GX8 A;  1M2D A;  4ZBB A;  4J2F A;  1K3O A;  3I43 A;  4NV5 A;  4IQA A;  1OC8 A;  2PVQ A;  2LKU A;  1GWC A;  1PRX A;  2O7K A;  3F0I A;  3ZMK A;  13GS A;  3FHK A;  5DCH A;  4L0U A;  2YPM A;  1G6Y A;  2CZ2 A;  1BED A;  2B7J A;  3M9K A;  1E2Y A;  3LJR A;  2C3T A;  2IMF A;  4JED A;  5IMD A;  2BJX A;  2P5R A;  4DEJ A;  3F3R A;  1PL2 A;  3M1G A;  3UAR A;  2XC2 A;  4O32 A;  1PL1 A;  3BOA A;  2ALB A;  3RHC A;  3HD5 A;  1OYJ A;  4WKW A;  5AN1 A;  2DC5 A;  3C73 A;  5IMA A;  2F9S A;  4BVY A;  1EOG A;  1FW1 A;  1USB A;  3DIE A;  4GCI A;  4I5Q A;  1WPI A;  3F4R A;  3TUE A;  4ZB6 A;  2G0F A;  5EY6 A;  4MAB A;  4FO5 A;  1EGO A;  2L57 A;  2C3Q A;  2FWE A;  1Z6M A;  4V2N A;  4H86 A;  2H71 A;  1WIK A;  1J0F A;  4I97 A;  2LTK A;  2MMN A;  2VCV A;  1YY7 A;  2VLU A;  5CAX A;  3CBU A;  1W89 A;  1A8L A;  2I1U A;  4IP1 A;  1TI1 A;  2VOC A;  2L6D A;  1GLQ A;  3C1S A;  4WR4 A;  5ECH B;  4DSS B;  3H8Q A;  5D9X A;  1LBK A;  5E4W A;  2ZCT A;  1GNW A;  3TJF A;  5ID2 B;  4JE1 A;  4JU5 A;  2B5Y A;  4RI6 A;  1O73 A;  1VRS D;  2GSR A;  4J57 E;  1EEM A;  3IOS A;  2VM2 A;  3D4M A;  4OO5 A;  1A0R P;  1H75 A;  1GP1 A;  1DBY A;  2H0I A;  2HRF A;  4F82 A;  5GST A;  3HJM A;  4K6X A;  1O6J A;  3GHA A;  2MYG A;  2MZC A;  4WBR D;  4IJ3 A;  1XIY A;  4O92 A;  4WET A;  1SKW B;  2H8L A;  2HRN A;  3U5R E;  5KN2 A;  4XTS A;  3D0Z A;  3VPT A;  5G2Z A;  4L5L A;  3U6V A;  1G7O A;  5CYY A;  3CMI A;  5H5Q A;  1EP7 A;  3BJ5 A;  4ML6 A;  3UAP A;  2IIY A;  2REM A;  5GAP D;  5JWR B;  1XPV A;  2H1A A;  3QPM A;  5ELA A;  1YF0 A;  4HQZ A;  1N2A A;  4ISD A;  2V6K A;  5DAK B;  3UJ1 A;  4GRF A;  2BMX A;  4ZL7 A;  2WZ9 A;  1HQO A;  6GSX A;  3C71 A;  3H4K A;  5GZZ B;  2GSQ A;  5F07 A;  2LQO A;  4QQ7 A;  4L0W A;  2VL3 A;  2V2G A;  4YQV A;  3QFB C;  2V41 A;  3LG6 A;  1FB6 A;  3ZVJ A;  4AF2 A;  1T7P B;  4XS4 B;  3PGT A;  3IHQ A;  1YQ1 A;  2AJQ B;  1JLW A;  2BTO T;  1T4Y A;  2NVL A;  1Z3E A;  1UA5 A;  1OC3 A;  2K6V A;  3F63 A;  2VD1 A;  2C4J A;  1ERT A;  3KD0 A;  1GTB A;  4POL A;  2N5B A;  1Z6N A;  4MH2 A;  3TRX A;  1A8Y A;  2H73 A;  4KDX A;  1MD4 A;  5EL8 A;  2DIY A;  4PNF A;  1S3D A;  4JZQ A;  1SU9 A;  4BPY A;  3TKQ A;  3I6A A;  3P2A A;  3LEF A;  4MZC A;  1BAY A;  3F8U A;  5D73 A;  4GSN A;  4LL1 B;  5E59 A;  3IDV A;  2YJH A;  2CQ9 A;  1I5G A;  1GSD A;  4KGI A;  2CA8 A;  1GH2 A;  4ECI A;  3RPP A;  4XXB B;  2R37 A;  4EKZ A;  3ZYW A;  4ZL9 A;  3UBK A;  3RDW A;  3ERW A;  2G2Q A;  3WT2 A;  2OE3 A;  1KEB A;  1KTE A;  3EC3 A;  4V2L A;  2X8H A;  2H70 A;  3HY2 A;  3AY8 A;  4TR1 A;  1DUG A;  2H30 A;  1KBN A;  3NZN A;  4TOP A;  2DSA A;  3GMF A;  4I2T A;  1VF4 A;  4KSO A;  1E6B A;  5FHI A;  4IHU A;  2PPT A;  2F8F A;  2OBI A;  5DCG A;  2CZ3 A;  2HZE B;  3ISO A;  2AV4 A;  4Q5Q A;  2L6C A;  3VI5 A;  2WCI A;  4HQS A;  1U88 A;  2JL4 A;  3DRN A;  3DKS A;  4POB A;  3SBC A;  4I2U A;  4NAX A;  1XVQ A;  1S3A A;  1SJI A;  4MMM A;  3CTF A;  2H1D A;  2H75 A;  5C04 A;  1ZMA A;  3I9V 2;  5A4V A;  3BD2 A;  1Z5Y E;  3KJY A;  4K8M A;  2H6Z A;  1JFU A;  4MK3 A;  2LEG A;  2B7K A;  3TRP A;  2HZF A;  4G19 A;  2HLS A;  1XFL A;  3M3M A;  3KIJ A;  2HI7 A;  2E2G A;  3TB2 A;  1TRU A;  2VCT A;  1GSF A;  5CRW A;  1A23 A;  2AHE A;  4TXO B;  1HNC A;  1FOV A;  3DXB A;  3GH9 A;  4BWQ A;  1YF1 A;  4MF6 A;  4N0V A;  2V32 A;  4MH3 A;  3TJG A;  1K3L A;  4K0G A;  3HVS A;  4K1F A;  2IMD A;  3VFI A;  1GSS A;  4EF0 A;  1BJX A;  1VF2 A;  2HXK A;  3VUR A;  4GQF A;  5HR1 A;  2DJ0 A;  2JZS A;  4IN0 A;  2HSY A;  3L4N A;  4HU7 A;  2C0F A;  2YV9 A;  3LXZ A;  5G5E A;  1QQ2 A;  2TRX A;  2VAF A;  3QAW A;  2GQL A;  3FZ5 A;  1TK5 B;  5IMC A;  1YJ6 A;  3TOU A;  5A4W A;  5A4U A;  1ZGN A;  1DSB A;  3KEB A;  1FVJ A;  4EL1 A;  3D5J A;  4DSS A;  1GNE A;  2M72 A;  3QFA C;  3UMA A;  3B08 B;  2OAD A;  2DJJ A;  4KDU A;  1Z9H A;  4KA0 A;  5D9V A;  5ID2 A;  4MJC A;  4EDY A;  5D9W A;  5ECK B;  1B48 A;  2KP2 A;  3C7M A;  3EE2 A;  3TDG A;  1K0B A;  3APS A;  3IA1 A;  1U3A A;  5ECR B;  1EGR A;  1TTZ A;  4PUF C;  2IMK A;  1XWK A;  2IJY A;  1RQM A;  3LOR A;  3DML A;  4CHS A;  3KP9 A;  3QOU A;  1B9Y C;  4YAV A;  1HNB A;  5G1K A;  2J9H A;  4DSQ A;  2ZUP A;  1F37 A;  1K0A A;  1SK2 A;  1SL1 B;  4GTU A;  1K0C A;  3L9S A;  3TKP A;  5HR2 A;  5AIS A;  2R3X A;  5COH A;  4HZ2 A;  2C1Y A;  2MMZ A;  5D93 A;  3VWW A;  4V2M A;  4WEY A;  2X8C A;  3D4T A;  1SL0 B;  4ZB8 A;  2JZR A;  3VLN A;  2H74 A;  4G2E A;  2K8S A;  5FT3 A;  1TRS A;  4F03 A;  5DAK A;  2YCD A;  4HU9 A;  1C72 A;  4K0N A;  3M9J A;  4IJI A;  1X9M B;  3HJP A;  2V1M A;  4WR5 A;  1GTA A;  4QL9 A;  1YKC A;  1YEX A;  3TCO A;  5ECL B;  1B4P A;  4GWR A;  1NSW A;  2OAC A;  1YDK A;  1SKS B;  4GSS A;  5JCU A;  2IFQ B;  4CW9 A;  4EXJ A;  4XS4 A;  1O8W A;  2LQQ A;  2E2M A;  4MP4 A;  3ZTL A;  3WD6 A;  4KAE A;  1V2A A;  4KSM A;  3ERG A;  2B1K A;  2RM6 A;  1R26 A;  1XWB A;  2ON7 A;  1PKW A;  2YNX A;  4HZ4 A;  2H1G A;  4F2I A;  5F06 A;  1FO5 A;  2FD3 A;  1YKA A;  4MJA A;  4WF4 A;  5ECM B;  2NBS A;  3L9U A;  3IC4 A;  2IME A;  2I3Y A;  2GSS A;  1CQH A;  16GS A;  1G7E A;  2A2S A;  3GX0 A;  4HJM A;  1TOF A;  1MTC A;  4ZXG A;  5DVB A;  4K2D A;  3F9U A;  3ZFB A;  4FH8 A;  4XS1 A;  2C6A A;  3FR9 A;  3L9V A;  3C8E A;  1JLV A;  2XBI A;  3GA4 A;  3P8W A;  4PQH A;  4F9Z A;  4HDE A;  1WRY A;  4RUV A;  3KH9 A;  18GS A;  1T8E B;  2C3N A;  5J9C A;  3QR6 A;  1PMT A;  1EWX A;  1YEP A;  1KNG A;  1DE1 A;  3LFL A;  3TGZ A;  5L71 A;  2X99 A;  3US3 A;  1TJD A;  1TU7 A;  4FYC A;  2JZT A;  4IQ1 A;  4TVE A;  3P90 A;  1SK0 A;  4N0Z A;  3WGD A;  3LWA A;  2FHE A;  1F9M A;  2X64 A;  4HOJ A;  1O7U A;  2TRC P;  4IBP A;  2A2R A;  2HZE A;  4J56 E;  3TKR A;  1WJK A;  2O89 A;  5JWQ B;  4DSR A;  5IO2 A;  6GSW A;  1V58 A;  3KP8 A;  1V9W A;  3IAS 2;  1B9X C;  5G5F A;  4ULX A;  19GS A;  4BA7 A;  5AIV A;  3FEU A;  2GVP A;  1PKZ A;  2YP6 A;  4O5R A;  2JAC A;  2N5F A;  1T00 A;  2H76 A;  3H93 A;  3CSJ A;  4JR4 A;  3ZIT A;  1O8X A;  4FYU A;  4TN8 A;  3F4T A;  4IW9 A;  2YJ7 A;  1T3B A;  2J23 A;  2ZNM A;  3LQ7 A;  1VF1 A;  1ERV A;  5KN3 A;  5CNW A;  1A0F A;  1X5D A;  5ELG A;  4XCS A;  2J9U B;  2R5G A;  2LST A;  1AIU A;  1X5C A;  1X5E A;  2LNS A;  4BWS A;  2MBS A;  4N10 A;  2P5Q A;  1GSY A;  2AB6 A;  1MD3 A;  3LGC A;  4IP6 A;  1N8J A;  3PH9 A;  5CO3 A;  3APQ A;  3GKN A;  2C80 A;  2KLX A;  3ED3 A;  2C6B A;  3Q74 A;  2YN1 A;  2HYX A;  1EEJ A;  2VCX A;  5KN0 A;  2WGR A;  3E3E A;  3DEX A;  2CAI A;  3UIW A;  5DAL B;  4PNG A;  5KN1 A;  4WF5 A;  2FGX A;  4Q5N A;  4MF5 A;  1WMJ A;  4Q5R A;  2GS3 A;  4PX1 A; 
#chains in the Genus database with same CATH topology
 4G0L A;  1SJ6 A;  4PQ1 A;  1CAD A;  3DVW A;  20GS A;  4LLR A;  2H19 A;  2LS5 A;  4MCU A;  2PUK C;  4ECB A;  1R9T L;  3DWV A;  1XOA A;  5JVH 1;  4EVM A;  2OKA A;  3JCM L;  4A3D L;  3EYT A;  2GQK A;  4C2M 1;  3J7Z 1;  1AUC A;  4RI7 A;  1B2O A;  5JWO B;  4YWL A;  3FR6 A;  2PBJ A;  5IMZ A;  1XBS A;  2YV7 A;  2H6X A;  1XWA A;  1THX A;  2GST A;  3GTU B;  2AYJ A;  4BIK A;  2DMM A;  2X8G A;  11GS A;  4YQM A;  1FHE A;  2WUL A;  1Y6E A;  1I9D A;  2VIM A;  3ZLP A;  4BVX B;  1K3Y A;  3ZL5 A;  1TDI A;  4KE3 A;  3KCM A;  2D2Z A;  2CVK A;  2DIZ A;  4QL7 A;  4ZB9 A;  4C3H L;  1Y25 A;  2AYT A;  5KOX A;  2OJL A;  4ID0 A;  5DM7 1;  5J9B A;  2OBK A;  4ML1 A;  1FVK A;  2PVE A;  3FZA A;  5J3R A;  3EVI A;  3ME7 A;  3HVV A;  1GSU A;  2YZH A;  4RXN A;  1X9S B;  3I69 A;  2YOI A;  5HFG A;  1FG4 A;  3CRU A;  4MZB A;  3B0A B;  2VUP A;  1EZK A;  2IFQ A;  2XJT A;  1XXU A;  1MDJ A;  3S1N L;  4PTS A;  2RDV A;  4NHW A;  2VLT A;  3HCZ A;  3IR4 A;  4XS6 A;  3ZIJ A;  2B1L A;  2LV3 A;  4DVC A;  2PVO C;  2ZIX A;  1JHB A;  4GQC A;  2VL9 A;  1YZX A;  2F3M A;  2GQM A;  5IO0 A;  9GSS A;  4KH7 A;  2ERS A;  2GDR A;  3LW9 A;  2B63 L;  4P3Y B;  4GXZ A;  3HJW B;  5K2M E;  3WGE A;  2OE0 A;  1XW9 A;  2E0Q A;  2DJ3 A;  3TOT A;  1EV9 A;  1PFO A;  3RYG A;  2QKE A;  1DE2 A;  3H3V M;  1MDK A;  3O76 A;  1GUK A;  3QDN A;  4K7N A;  3H9B A;  2H1B A;  4ZN3 B;  2EIQ A;  2RM5 A;  4ZIL A;  1AQX A;  4ZN1 B;  2IMI A;  2C0E A;  1F4L A;  4YH2 A;  1B4Q A;  2JI3 A;  4IGJ A;  4KW6 A;  2H72 A;  4ZL8 A;  3KZQ A;  1M99 A;  2E7P A;  4TRX A;  2PSM C;  3G9B A;  4KCE A;  3GTK L;  3RAZ A;  2R0C A;  4V1A p;  3TRQ A;  5D9T A;  1QYB A;  1TWH L;  2UZ8 A;  1X9W B;  3L78 A;  1NXG A;  3G7J A;  2R0G A;  3GL5 A;  4MLY A;  4X43 A;  5DM6 1;  4O5U A;  3K35 A;  1SL2 B;  1FHM A;  1ZYE A;  1TKD B;  3ME8 A;  4OFN A;  2LRC A;  3CXG A;  2XHF A;  1F3A A;  2WJU A;  3EIN A;  3WWN B;  2JU5 A;  5ECO B;  1NHO A;  1IYH A;  2PYA A;  1XWC A;  1T4Z A;  1Q4J A;  3KMN A;  4EO3 A;  3DYR A;  3ZFL A;  3A5W A;  1RDV A;  5F05 A;  1RW1 A;  3TKS A;  3MIX A;  4NPB A;  4E8E A;  2JSZ A;  5H1S c;  1MEK A;  2EIO A;  4AHX A;  4YWM A;  5IM9 A;  3BBY A;  3R2Q A;  2FCH A;  1M3I A;  5F0G A;  3KM6 A;  4JAF A;  1HD2 A;  2VL2 A;  1GL8 A;  3BCK A;  2CX4 A;  1PGT A;  3LYK A;  1ZYQ B;  3S15 L;  1EP8 A;  4POK A;  3SWL A;  1CQG A;  4XGH A;  5IIZ A;  1ZCP A;  2FA8 A;  4O7H A;  2DJ2 A;  3KXO A;  2DML A;  1NNQ A;  1PX6 A;  1TWG L;  2HFD A;  1MDI A;  3SS2 A;  2VLV A;  2VCQ A;  2CAQ A;  1G0T A;  2VD0 A;  2C8U A;  3GNJ A;  3S2H L;  2AAW A;  5LD0 A;  3UEM A;  4JRR A;  3CRT A;  1T9O A;  2H0G A;  2O8V B;  4TW5 A;  2Z9S A;  2XBQ A;  1S3C A;  4AGS A;  2LUS A;  4PUR A;  1OE7 A;  4KND A;  5B7C A;  1NW2 A;  3NOF A;  1BQ7 A;  2MMO A;  2QC7 A;  1K0M A;  3GKX A;  3GTM L;  1ZZY A;  4U67 1;  1TI3 A;  1S24 A;  1F3B A;  2XPE A;  3E0U A;  3LXT A;  4K5R A;  3KYW A;  1AC1 A;  3TKS C;  3GUR A;  5C44 L;  4OCF A;  3H1N A;  3G7Y A;  3J7Y k;  1ZYN A;  2H0H A;  3HJY B;  3F4S A;  3KMO A;  4POM A;  4N11 A;  5D8I A;  4FIW A;  3PIP 1;  3R3E A;  3H99 A;  3FKF A;  1GUM A;  2CT6 A;  1ZL9 A;  2VL2 C;  1OVN A;  5G31 A;  2HVY C;  3UOM A;  2MS3 A;  1CAA A;  1DX8 A;  3V1W A;  1BYE A;  2P0G A;  2RUE A;  3IV4 A;  2V0F A;  5BRT A;  1PD2 1;  4EE0 A;  4OO4 A;  2B5I D;  2O5J D;  3O3T A;  1GLP A;  2GZY A;  1WOU A;  2N5A A;  1M7T A;  3N9J A;  2F8A A;  4JAD A;  4F0C A;  4V1A g;  1R0J A;  3M4O L;  4TR3 A;  6GSU A;  1THO A;  1UVZ A;  1QXH A;  3QAV A;  3D21 A;  3RZD L;  1ERW A;  3GUS A;  1SYX A;  2EIR A;  3HHV A;  4MPF A;  3ZZX A;  2QL0 A;  1BG5 A;  1NHY A;  2EC4 A;  1FOH A;  2M80 A;  2PGT A;  3FW2 A;  3QD9 A;  3JR7 A;  4B8C D;  2DJ1 A;  3C1R A;  3A2X A;  4I8B A;  4OFM A;  1ST9 A;  2WFC A;  4IKH A;  3TJK A;  3GTU A;  5J5N A;  7GSS A;  3RBT A;  4TR4 A;  1JZR A;  4I6X A;  5KEJ A;  1AQV A;  2A4H A;  4BVX A;  3D6I A;  3HXS A;  3UBL A;  1LU4 A;  5B8A A;  4GF0 A;  1SK1 A;  2HT9 A;  1NM3 A;  2L59 A;  3MAK A;  4PUA A;  4ZBA A;  3K8N A;  5EIN C;  2CVD A;  2VCZ A;  4XIH A;  2KOK A;  4AR3 A;  4X0X A;  2Z3R B;  2FWG A;  1A2J A;  1GTU A;  4E6Y A;  2FLS A;  1ON4 A;  4MZW A;  2FWH A;  5F8B A;  2R92 L;  2LRN A;  4WXT A;  1XVW A;  2GZZ A;  4Y7N L;  1I3Q L;  5FWG A;  1FAA A;  4AR6 A;  1R5A A;  3W8J A;  4GST A;  1Q98 A;  4LMW A;  3J7Y 1;  3QCP A;  1TWA L;  3D22 A;  3FYG A;  2JAD A;  2WAQ P;  4LA1 A;  3UL3 A;  2RUF A;  2B6M A;  1G6W A;  2K9F A;  2LNT A;  3LWR B;  2QSI A;  5A5K A;  1SKR B;  2O87 A;  1FB0 A;  1SD9 A;  3F6F A;  3LSZ A;  5DJM A;  2O85 A;  4Z2T A;  3LWQ B;  3IBH A;  3UVT A;  2MMA A;  3HVX A;  1EOH A;  2VM1 A;  3FR3 A;  5IOW A;  5J4U A;  5HFK A;  2K18 A;  2FWF A;  4A3B L;  5IOX A;  2NDO A;  1WJV A;  2I81 A;  4E8H A;  3ZML A;  3QMX A;  3CYN A;  5IMF A;  1IU6 A;  4KDY A;  4NMU A;  5EVO A;  3RZT A;  1PN9 A;  3WYW A;  1O81 A;  5M3M L;  3Q19 A;  2MBT A;  3N5O A;  5AN9 H;  2PWJ A;  3MWH A;  5HR3 A;  2A6H D;  2A68 D;  4C3I L;  4AHZ A;  4RQX A;  1IRN A;  2TIR A;  2C0D A;  2YZU A;  1XOB A;  3KTB A;  2GZP A;  1BQ9 A;  1ZOF A;  2B5X A;  3VWX A;  3MSZ A;  1M0U A;  4A3J L;  1OKD A;  4TXO A;  3ZIV A;  2CKA A;  2R2J A;  2VL6 A;  4Q5F A;  2HRA A;  2YWN A;  2XPD A;  2CV4 A;  2P31 A;  1BX9 A;  3FZ9 A;  3A3T A;  4D73 B;  5GAN D;  1OC9 B;  2PER A;  1H4O A;  5IYC L;  3A2V A;  1U6T A;  6GSV A;  3F3Q A;  3ZRD A;  3ZVJ D;  2CVB A;  3H0G L;  2HSH A;  1ERU A;  4EUY A;  4AJ6 A;  3VPQ A;  3EPT A;  2NVY L;  1T9P A;  4WBJ A;  2H12 A;  3EWL A;  2GLR A;  3FY7 A;  1ACV A;  2LRT A;  5AIX A;  5J41 A;  3I4M L;  5HFI A;  4NWY A;  3WWL A;  4GLT A;  4JAE A;  4HUA A;  3HKR A;  5GAD c;  2K8V A;  5CRH A;  1UC7 A;  5IPH A;  4TR0 A;  2WS2 A;  3GIX A;  5B6M A;  2B3S A;  4LHN A;  2OE1 A;  4HI7 A;  1E8J A;  2WDU A;  1ML6 A;  2L4Q A;  1V57 A;  1H7V A;  1R4W A;  2C0G A;  3HA9 A;  2NTO A;  1LJR A;  5B8B A;  4ILF A;  3W8S A;  3VWV A;  3S16 L;  4AJ7 A;  3IPZ A;  5EPF A;  2GT6 A;  1XW6 A;  3LYP A;  1PA3 A;  2H01 A;  4FYB A;  2L5L A;  3RHB A;  4OMV A;  2FNO A;  1Z7P A;  3K7A L;  2V6O A;  3M8N A;  2IL3 A;  3PPU A;  5IQY A;  5CP1 A;  3L0H A;  4YKG A;  3VPB E;  3A2W A;  4MNN A;  1A2L A;  1BRF A;  2LJA A;  4XRD A;  2DJK A;  3DVX A;  2RII A;  22GS A;  5G30 A;  4BL7 B;  4TXV A;  2JA8 L;  1GUL A;  3KTL A;  1TRV A;  4A93 L;  5ABR A;  1TK0 B;  1M3J A;  2APO B;  2E2H L;  3IRA A;  2RLI A;  2B5E A;  1QMV A;  3IAM 2;  2PN8 A;  2HR5 A;  2DBC A;  2E2J L;  1U87 A;  1AQW A;  4AR5 A;  4KB3 A;  4Z7X A;  1YV1 A;  1F2E A;  1TP9 A;  1JZO A;  5CRG A;  4PQI A;  2NPB A;  2JA5 L;  3VWU A;  3WT1 A;  4HS1 A;  3IK9 A;  3DGQ A;  4MDC A;  1VGL A;  3MYD A;  1VF3 A;  3GKM A;  3W6G A;  1K0O A;  3CSI A;  3RPN A;  5ECQ B;  3IXR A;  4NXI A;  3BCI A;  1R0H A;  1IW7 D;  1UN2 A;  2HE3 A;  1I6H L;  10GS A;  3MNG A;  4K2X A;  3MDK A;  5H5S A;  4YQU A;  4G0K A;  1Y1W L;  1VZI A;  1GRX A;  6GSS A;  5ECN B;  4BVY B;  1U3I A;  2JI1 A;  4XRA A;  3EUR A;  5INY A;  4KCA A;  3QVD A;  3UVH A;  2L5O A;  5LCZ A;  3PKJ A;  4RQR A;  2R6K A;  3A5I A;  4CDO A;  2L4C A;  4PGT A;  4AHW A;  1GSE A;  2I9H A;  4BBR L;  3EMP A;  5MF6 A;  1PFY A;  1PX7 A;  1XCC A;  1XZO A;  2LJK A;  3S2D L;  4NHZ A;  4OD7 A;  4USS A;  5M5X L;  1OAZ A;  2KUC A;  2YWI A;  4HEA 2;  4X1U A;  1EV4 A;  1O85 A;  1GSQ A;  3TKS E;  5HR0 A;  1SFO L;  4ZIJ A;  4AJ8 A;  3HZ4 A;  4TKY A;  3LWP B;  4ECJ A;  5ECS A;  3GYK A;  2IPA A;  4O5Q A;  1F6M C;  3F6D A;  3HYP A;  4KUN A;  5IY0 A;  1K83 L;  3VK9 A;  5DQY A;  4LHL A;  4IEL A;  1OE8 A;  2GGT A;  3Q6O A;  1OWC A;  2FUG 2;  3Q18 A;  4KF9 A;  1QUW A;  3GSS A;  1J08 A;  4HSC X;  1Z7R A;  3FMW A;  4ECC A;  3FRC A;  3FKI L;  2QGV A;  3GRX A;  1T1V A;  4MJE A;  1HNA A;  2DLX A;  4HJ2 A;  4POG A;  3HOY L;  2A4V A;  5MFP A;  2PU9 C;  5C00 A;  3HOV L;  5DDL A;  1X0R A;  1PZX A;  4N30 A;  3GH6 A;  4OWY A;  1WWJ A;  3DD3 A;  2IWT A;  5JCG A;  1SJZ A;  1QFN A;  1TU8 A;  3TJB A;  4KX4 A;  1PQN A;  4LL4 B;  1A24 A;  3LNL A;  4MJB A;  3ERF A;  1AW9 A;  5HQP A;  3S9F A;  2VO4 A;  3KYV A;  3IE3 A;  4G6B A;  1R5P A;  2FY6 A;  1QK8 A;  1K0N A;  2JI2 A;  3E9J B;  5IP9 L;  4OFT A;  2OA7 A;  3G7I A;  5AGY A;  3H79 A;  2IN3 A;  1IYI A;  1JZD A;  4IS0 A;  3EU4 A;  2H66 A;  5CRD A;  2M46 A;  1HYU A;  5DBQ A;  3CQF A;  12GS A;  2YAN A;  1SEN A;  5IP7 L;  3FZ4 A;  5H5R A;  1SD8 A;  4JAG A;  2LJR A;  4G9H A;  4MF7 A;  4A3G L;  4G0I A;  3HDC A;  1A2M A;  1AXD A;  2ES7 A;  2YWM A;  1VCX A;  4IVF A;  1TW9 A;  4XHM A;  4K7O A;  3O6T A;  1LTL A;  3IC8 A;  1OKT A;  2NVX L;  3P7X A;  5GSS A;  2GTU A;  4K9Z A;  5DQS A;  1M9B A;  3PR8 A;  5D96 A;  5G1L A;  5IMV A;  4PXO A;  2AUV A;  2H6Y A;  4EIP A;  5LNK e;  5C3E L;  3KGK A;  3HOU L;  1AAZ A;  1M2A A;  2WRT A;  6GST A;  4BY7 L;  5DJL A;  3CTG A;  5IPG A;  3OR5 A;  2KP1 A;  1GTI A;  2ON5 A;  4D73 A;  1TRW A;  1OC9 A;  1RDG A;  1WE0 A;  1WP0 A;  3GV1 A;  3HJO A;  5CRE A;  4EC0 A;  2YWO A;  3HZ8 A;  2CKC A;  1ILO A;  1RYQ A;  1PSQ A;  4F0B A;  3GL3 A;  1TK8 B;  4MA9 A;  3ZRE A;  1XWG A;  3GN3 A;  2KHP A;  1TXX A;  4ZBD A;  2PMT A;  4OCE A;  1RK4 A;  3CSH A;  1JZW A;  3RZO L;  3GKK A;  2Y0S P;  2HNL A;  1R7H A;  4A3C L;  1YK4 A;  4L8E A;  2I4A A;  4K7I A;  3FK8 A;  2R4V A;  4UY8 1;  1OWB A;  4AI3 A;  4MPG A;  1SYR A;  1QGV A;  4JBB A;  1V40 A;  5DAL A;  1PFW A;  1SMW A;  4A5P A;  3APO A;  8GSS A;  2JSY A;  1C09 A;  5GAG c;  4L5O A;  4G10 A;  17GS A;  2NVQ L;  3KH7 A;  3NIV A;  3VI7 A;  1ODH A;  3GST A;  2K2D A;  1W4V A;  1GUH A;  3WGX A;  1K0D A;  1V98 A;  6GSY A;  14GS A;  4TR1 B;  1M9A A;  4LMV A;  1ABA A;  4JR6 A;  3M0F A;  3TJJ A;  5B6N A;  4EDZ A;  3PIN A;  3EU3 A;  5ECI B;  2GT5 A;  3S1R L;  1XW5 A;  2CX3 A;  2WB9 A;  3IK7 A;  5ENU A;  3GTG L;  1FHH A;  5IYB L;  1URM A;  2FA4 A;  3GFK A;  4BL7 A;  2F51 A;  3P8B A;  4NV2 A;  4YAP A;  1J9B A;  1B8X A;  1M2B A;  3EMX A;  4ACS A;  3QAG A;  5ECP B;  2VCW A;  5JCW A;  3J7Y b;  3GX8 A;  1M2D A;  4AHY A;  4ZBB A;  4J2F A;  1K3O A;  2XJS A;  3I43 A;  4NV5 A;  4IQA A;  1OC8 A;  2R0P A;  1NXE A;  2PVQ A;  2LKU A;  1GWC A;  1PRX A;  2O7K A;  3F0I A;  3ZMK A;  13GS A;  3GTO L;  3FHK A;  5DCH A;  4L0U A;  2YPM A;  1G6Y A;  3PKI A;  2CZ2 A;  1BED A;  2XJP A;  2B7J A;  3M9K A;  1E2Y A;  3LJR A;  2C3T A;  2IMF A;  4JED A;  2M4V A;  3PWF A;  5IMD A;  2BJX A;  2P5R A;  1QQT A;  4DEJ A;  3GTP L;  3F3R A;  6RXN A;  1PL2 A;  3M1G A;  3UAR A;  2XC2 A;  4O32 A;  1PL1 A;  3BOA A;  2ALB A;  3RHC A;  3HD5 A;  5RXN A;  1OYJ A;  1PFV A;  4WKW A;  5AN1 A;  2DC5 A;  3C73 A;  5IMA A;  2F9S A;  4BVY A;  1EOG A;  1FW1 A;  1USB A;  3DIE A;  4Z2R A;  4GCI A;  3GTQ L;  4I5Q A;  1WPI A;  4V19 6;  3F4R A;  3TUE A;  4ZB6 A;  2G0F A;  5EY6 A;  4MAB A;  4FO5 A;  1EGO A;  2NVT L;  2L57 A;  2C3Q A;  2FWE A;  1Z6M A;  4V2N A;  4H86 A;  2H71 A;  1WIK A;  1J0F A;  4I97 A;  4X6A L;  2LTK A;  2MMN A;  2VCV A;  1YY7 A;  2VLU A;  5CAX A;  3CBU A;  1W89 A;  1A8L A;  2I1U A;  4IP1 A;  1TI1 A;  2DSX A;  2VOC A;  1T9Q A;  2L6D A;  1GLQ A;  5MFZ A;  3C1S A;  2PVX A;  5FLM L;  4WR4 A;  5ECH B;  1ZRP A;  4DSS B;  4GS7 D;  3H8Q A;  5D9X A;  4AYB P;  1PFU A;  1LBK A;  5E4W A;  2ZCT A;  1GNW A;  3TJF A;  3NFP I;  2KN9 A;  5ID2 B;  4JE1 A;  4JU5 A;  2B5Y A;  4RI6 A;  1O73 A;  5C4J L;  1VRS D;  2GSR A;  4BXX L;  4J57 E;  1EEM A;  3IOS A;  8RXN A;  2VM2 A;  3D4M A;  4OO5 A;  1A0R P;  1H75 A;  1GP1 A;  1DBY A;  2H0I A;  2HRF A;  4F82 A;  5GST A;  3HJM A;  4K6X A;  2VUM L;  1O6J A;  3GHA A;  2MYG A;  1LKO A;  5BMU A;  2Z3Q B;  2MZC A;  2ERJ A;  4WBR D;  4IJ3 A;  1ZYP A;  1XIY A;  4O92 A;  4WET A;  2PMZ P;  1SKW B;  2H8L A;  2HRN A;  1BFY A;  3HKZ P;  3U5R E;  4AR4 A;  5KN2 A;  4XTS A;  3D0Z A;  3VPT A;  5G2Z A;  1TWC L;  4L5L A;  3U6V A;  1G7O A;  5CYY A;  3CMI A;  5H5Q A;  1EP7 A;  3BJ5 A;  4ML6 A;  3UAP A;  2IIY A;  2REM A;  5GAP D;  7RXN A;  5C4X L;  5JWR B;  1XPV A;  2H1A A;  3QPM A;  5ELA A;  1YF0 A;  1Y1V L;  4HQZ A;  2E2I L;  1N2A A;  4ISD A;  2V6K A;  5DAK B;  3UJ1 A;  4GRF A;  2BMX A;  3I4N L;  4ZL7 A;  2WZ9 A;  1HQO A;  6GSX A;  3C71 A;  1I50 L;  3H4K A;  5GZZ B;  2GSQ A;  5F07 A;  2LQO A;  4QQ7 A;  4L0W A;  2VL3 A;  3KYY A;  3S1M L;  2V2G A;  4YQV A;  3QFB C;  2V41 A;  3LG6 A;  1FB6 A;  3ZVJ A;  4AF2 A;  4WFN 1;  3LWV B;  1T7P B;  4XS4 B;  3PGT A;  3IHQ A;  1YQ1 A;  2AJQ B;  1JLW A;  2BTO T;  2NVL A;  1T4Y A;  1Z3E A;  1UA5 A;  1OC3 A;  2K6V A;  3F63 A;  2VD1 A;  2C4J A;  1ERT A;  3KD0 A;  1GTB A;  4YKF A;  4POL A;  2N5B A;  1B13 A;  1Z6N A;  4MH2 A;  3TRX A;  1A8Y A;  2H73 A;  4AI1 A;  3KYX A;  4KDX A;  1MD4 A;  2QA2 A;  5EL8 A;  2A69 D;  2DIY A;  4PNF A;  1S3D A;  4JZQ A;  1SU9 A;  4BPY A;  3TKQ A;  3I6A A;  1IU5 A;  3P2A A;  3LEF A;  4MZC A;  1BAY A;  3F8U A;  3HOX L;  5D73 A;  1YUZ A;  4GSN A;  4LL1 B;  5E59 A;  3IDV A;  2YJH A;  2CQ9 A;  1I5G A;  1GSD A;  4KGI A;  2CA8 A;  1GH2 A;  4ECI A;  3RPP A;  4XXB B;  2R37 A;  3LPE B;  3HAX C;  4EKZ A;  3ZYW A;  4ZL9 A;  3UBK A;  3IHG A;  3RDW A;  3ERW A;  4A3L L;  2G2Q A;  3WT2 A;  2OE3 A;  1KEB A;  1KTE A;  3EC3 A;  4V2L A;  2X8H A;  1Z92 B;  2H70 A;  3HY2 A;  3AY8 A;  2A6E D;  1DUG A;  2H30 A;  2JA7 L;  1KBN A;  3NZN A;  4TR1 A;  4TOP A;  2DSA A;  3GMF A;  4I2T A;  1VF4 A;  4KSO A;  1E6B A;  5FHI A;  4IHU A;  3H97 A;  2PPT A;  1LKM A;  2F8F A;  2OBI A;  5DCG A;  2R7Z L;  2CZ3 A;  2HZE B;  3ISO A;  2AV4 A;  4Q5Q A;  2L6C A;  3VI5 A;  2HRK A;  2WCI A;  4HQS A;  1U88 A;  2L0Z A;  2JL4 A;  4A3M L;  2V0E A;  3FDJ A;  3DRN A;  3DKS A;  4POB A;  3SBC A;  4I2U A;  2KKD A;  4NAX A;  3GTL L;  1XVQ A;  1S3A A;  2YU9 L;  1WCM L;  1SJI A;  4MMM A;  3CTF A;  2H1D A;  2H75 A;  5C04 A;  1ZMA A;  1B2J A;  2DKI A;  3I9V 2;  2X4A A;  5A4V A;  5M3F L;  3BD2 A;  1TWF L;  1Z5Y E;  3KJY A;  4K8M A;  2H6Z A;  2M6O A;  1JFU A;  3PO2 L;  4QIW P;  4MK3 A;  3A44 A;  2LEG A;  2B7K A;  3TRP A;  2HZF A;  4G19 A;  2HLS A;  1XFL A;  2GMG A;  3M3M A;  2M6P A;  3QQC E;  3KIJ A;  2HI7 A;  2E2G A;  3TB2 A;  1TRU A;  2VCT A;  1GSF A;  4FQU A;  5CRW A;  1A23 A;  2AHE A;  4TXO B;  1HNC A;  1FOV A;  3DXB A;  3GH9 A;  4BWQ A;  1YF1 A;  1YUX A;  4MF6 A;  4N0V A;  1B71 A;  2V32 A;  5MGN A;  4MH3 A;  4A3I L;  3TJG A;  1K3L A;  4K0G A;  3HVS A;  2WB1 P;  4K1F A;  2IMD A;  3VFI A;  1GSS A;  4EF0 A;  1BJX A;  1R0I A;  1VF2 A;  1SMM A;  1PN0 A;  2HXK A;  3VUR A;  2HSM A;  4GQF A;  1DVB A;  2DJ0 A;  2JZS A;  4IN0 A;  5HR1 A;  2HSY A;  3L4N A;  4HU7 A;  2C0F A;  2YV9 A;  3MPS A;  3LXZ A;  5G5E A;  4A3K L;  1QQ2 A;  2TRX A;  2VAF A;  3QAW A;  2GQL A;  3FZ5 A;  1TK5 B;  4K9F A;  5IMC A;  1YJ6 A;  3TOU A;  3PO3 L;  5A4W A;  5A4U A;  1ZGN A;  1DSB A;  3KEB A;  1FVJ A;  4EL1 A;  3D5J A;  4DSS A;  1GNE A;  2M72 A;  3QFA C;  3UMA A;  3B08 B;  2OAD A;  2DJJ A;  4KDU A;  1Z9H A;  4KA0 A;  5D9V A;  5ID2 A;  4MJC A;  4EDY A;  5D9W A;  5ECK B;  1B48 A;  1VZH A;  1R0G A;  1BQ8 A;  2KP2 A;  3C7M A;  3EE2 A;  3TDG A;  1K0B A;  3APS A;  3IA1 A;  1IRO A;  1U3A A;  5ECR B;  3GTJ L;  1EGR A;  1TTZ A;  4PUF C;  2IMK A;  1XWK A;  2IJY A;  1RQM A;  3LOR A;  3DML A;  4CHS A;  3KP9 A;  3QOU A;  1B9Y C;  4YAV A;  1HNB A;  5G1K A;  2J9H A;  4DSQ A;  2ZUP A;  1F37 A;  1K0A A;  1SK2 A;  1SL1 B;  4GTU A;  1K0C A;  3RZ6 A;  3L9S A;  3TKP A;  5HR2 A;  5AIS A;  2R3X A;  5COH A;  5IYD L;  4HZ2 A;  2C1Y A;  2MMZ A;  5D93 A;  3VWW A;  3S17 L;  4V2M A;  4WEY A;  2X8C A;  3D4T A;  4POF A;  5JVG 1;  4BY1 L;  1SL0 B;  4ZB8 A;  2JZR A;  3VLN A;  2H74 A;  1RB9 A;  4G2E A;  2K8S A;  5FT3 A;  3PIO 1;  1TRS A;  4F03 A;  5DAK A;  2YCD A;  4HU9 A;  4ICY A;  1C72 A;  4K0N A;  1LKP A;  3M9J A;  4IJI A;  1X9M B;  2RFK B;  3HJP A;  2XJR A;  2V1M A;  4WR5 A;  1GTA A;  4QL9 A;  2CR8 A;  5GAE c;  1YKC A;  1YEX A;  3TCO A;  5ECL B;  2X49 A;  1B4P A;  5AI2 A;  4GWR A;  1NSW A;  2OAC A;  1YDK A;  1SKS B;  4EIQ A;  4GSS A;  5M5Y L;  5JCU A;  2IFQ B;  4CW9 A;  4EXJ A;  3S1Q L;  4XS4 A;  1O8W A;  2LQQ A;  5M5W L;  2E2M A;  4MP4 A;  3ZTL A;  3WD6 A;  4KAE A;  1V2A A;  4KSM A;  3ERG A;  2B1K A;  2RM6 A;  1R26 A;  1XWB A;  2ON7 A;  1PKW A;  2YNX A;  4HZ4 A;  4Z2U A;  4ME3 A;  4A3F L;  2H1G A;  4F2I A;  5F06 A;  1FO5 A;  4X4J A;  2XJQ A;  2FD3 A;  1YKA A;  4MJA A;  4WF4 A;  5ECM B;  4C3J L;  2NBS A;  3MSU A;  1R0F A;  3L9U A;  5EIO C;  2NYD A;  3MQK B;  2AUS B;  3IC4 A;  2V3B B;  2IME A;  1JYB A;  2I3Y A;  2GSS A;  1CQH A;  1VZG A;  16GS A;  1G7E A;  2A2S A;  3GX0 A;  4HJM A;  1TOF A;  1MTC A;  4ZXG A;  5DVB A;  4K2D A;  4AI0 A;  3F9U A;  3ZFB A;  4FH8 A;  3ZG6 A;  4XS1 A;  2C6A A;  3PL5 A;  3FR9 A;  3LWO B;  3L9V A;  1XG8 A;  1BE7 A;  1SMU A;  3C8E A;  1JLV A;  2XBI A;  3GA4 A;  3P8W A;  4PQH A;  4F9Z A;  4HDE A;  3HOZ L;  1WRY A;  4RUV A;  3KH9 A;  18GS A;  3HOW L;  2C3N A;  1T8E B;  5J9C A;  3QR6 A;  1PMT A;  1EWX A;  1YEP A;  1KNG A;  1DE1 A;  2BE5 D;  3PZA A;  3LFL A;  3TGZ A;  5L71 A;  2X99 A;  5AI3 A;  3US3 A;  1TJD A;  1TU7 A;  1RYT A;  4FYC A;  2XJV A;  4BBS L;  2JZT A;  4IQ1 A;  4TVE A;  3P90 A;  1SK0 A;  4N0Z A;  3WGD A;  3LWA A;  2FHE A;  1F9M A;  2X64 A;  4HOJ A;  1O7U A;  2TRC P;  4IBP A;  2A2R A;  2HZE A;  4J56 E;  3TKR A;  4TPU A;  1WJK A;  2O89 A;  5JWQ B;  4DSR A;  5IO2 A;  6GSW A;  1V58 A;  2QA1 A;  1V9W A;  2R93 L;  1QCV A;  3KP8 A;  5FJ8 L;  3IAS 2;  1B9X C;  5G5F A;  4ULX A;  19GS A;  4BA7 A;  4Y52 L;  5AIV A;  3FEU A;  2GVP A;  5MLC 3;  1YK5 A;  1PKZ A;  4CY6 A;  2YP6 A;  4TVM A;  4O5R A;  2JAC A;  2N5F A;  1RWD A;  2A2P A;  1T00 A;  2H76 A;  3H93 A;  2LCQ A;  3CSJ A;  3S14 L;  4JR4 A;  1S2Z A;  3ZIT A;  1O8X A;  4FYU A;  4TN8 A;  3F4T A;  4IW9 A;  2YJ7 A;  1T3B A;  2J23 A;  2ZNM A;  3LQ7 A;  1VF1 A;  1ERV A;  5KN3 A;  5CNW A;  1A0F A;  1X5D A;  5ELG A;  4XCS A;  2J9U B;  2R5G A;  2LST A;  1AIU A;  4A3E L;  1X5C A;  1S3R A;  3KYU A;  1X5E A;  2JA6 L;  2LNS A;  4BWS A;  2EY4 E;  2MBS A;  2M4Y A;  2P5Q A;  4N10 A;  5GAH c;  4CY8 A;  4AI2 A;  1GSY A;  2AB6 A;  1MD3 A;  3LGC A;  4IP6 A;  1N8J A;  3PH9 A;  5CO3 A;  3APQ A;  2DKH A;  3GKN A;  3HVN A;  2C80 A;  2KLX A;  3ED3 A;  2C6B A;  3Q74 A;  2YN1 A;  2HYX A;  1EEJ A;  2VCX A;  5KN0 A;  2WGR A;  3E3E A;  3DEX A;  2CAI A;  2XJU A;  3UIW A;  5DAL B;  4PNG A;  5KN1 A;  4WF5 A;  3H9C A;  3IU3 I;  3M3Y L;  5KOW A;  1S30 A;  2FGX A;  3CQZ L;  4Q5N A;  4K5S A;  1P7P A;  4MF5 A;  1WMJ A;  4Q5R A;  2GS3 A;  4PX1 A;  2AQC A; 
#chains in the Genus database with same CATH homology
 4G0L A;  1SJ6 A;  4PQ1 A;  1CAD A;  3DVW A;  20GS A;  4LLR A;  2H19 A;  2LS5 A;  4MCU A;  2PUK C;  4ECB A;  3DWV A;  1XOA A;  5JVH 1;  4EVM A;  2OKA A;  3JCM L;  3EYT A;  2GQK A;  3J7Z 1;  1AUC A;  4RI7 A;  1B2O A;  5JWO B;  4YWL A;  3FR6 A;  2PBJ A;  5IMZ A;  1XBS A;  2YV7 A;  2H6X A;  1XWA A;  1THX A;  2GST A;  3GTU B;  2AYJ A;  2DMM A;  2X8G A;  11GS A;  4YQM A;  1FHE A;  2WUL A;  1Y6E A;  1I9D A;  2VIM A;  3ZLP A;  4BVX B;  1K3Y A;  3ZL5 A;  1TDI A;  4KE3 A;  3KCM A;  2D2Z A;  2CVK A;  2DIZ A;  4QL7 A;  4ZB9 A;  1Y25 A;  2AYT A;  5KOX A;  2OJL A;  4ID0 A;  5DM7 1;  5J9B A;  2OBK A;  4ML1 A;  1FVK A;  2PVE A;  3FZA A;  5J3R A;  3EVI A;  3ME7 A;  3HVV A;  1GSU A;  2YZH A;  4RXN A;  1X9S B;  3I69 A;  2YOI A;  5HFG A;  1FG4 A;  3CRU A;  4MZB A;  3B0A B;  2VUP A;  1EZK A;  2IFQ A;  2XJT A;  1XXU A;  1MDJ A;  4PTS A;  2RDV A;  4NHW A;  2VLT A;  3HCZ A;  3IR4 A;  4XS6 A;  3ZIJ A;  2B1L A;  2LV3 A;  4DVC A;  2PVO C;  2ZIX A;  1JHB A;  4GQC A;  2VL9 A;  1YZX A;  2F3M A;  2GQM A;  5IO0 A;  9GSS A;  4KH7 A;  2ERS A;  2GDR A;  3LW9 A;  4P3Y B;  4GXZ A;  5K2M E;  3WGE A;  2OE0 A;  1XW9 A;  2E0Q A;  2DJ3 A;  3TOT A;  1EV9 A;  3RYG A;  2QKE A;  1DE2 A;  1MDK A;  3O76 A;  1GUK A;  3QDN A;  4K7N A;  2H1B A;  4ZN3 B;  2EIQ A;  2RM5 A;  4ZIL A;  1AQX A;  4ZN1 B;  2IMI A;  2C0E A;  4YH2 A;  1B4Q A;  2JI3 A;  4IGJ A;  4KW6 A;  2H72 A;  4ZL8 A;  3KZQ A;  1M99 A;  2E7P A;  4TRX A;  2PSM C;  3G9B A;  4KCE A;  3RAZ A;  2R0C A;  4V1A p;  3TRQ A;  5D9T A;  1QYB A;  2UZ8 A;  1X9W B;  3L78 A;  1NXG A;  3G7J A;  2R0G A;  3GL5 A;  4MLY A;  4X43 A;  5DM6 1;  4O5U A;  3K35 A;  1SL2 B;  1FHM A;  1ZYE A;  1TKD B;  3ME8 A;  4OFN A;  2LRC A;  3CXG A;  2XHF A;  1F3A A;  2WJU A;  3EIN A;  3WWN B;  2JU5 A;  5ECO B;  1NHO A;  1IYH A;  2PYA A;  1XWC A;  1T4Z A;  1Q4J A;  3KMN A;  4EO3 A;  3DYR A;  3ZFL A;  3A5W A;  1RDV A;  5F05 A;  1RW1 A;  3TKS A;  3MIX A;  4NPB A;  4E8E A;  2JSZ A;  5H1S c;  1MEK A;  2EIO A;  4AHX A;  4YWM A;  5IM9 A;  3BBY A;  3R2Q A;  2FCH A;  5F0G A;  3KM6 A;  4JAF A;  1HD2 A;  2VL2 A;  1GL8 A;  3BCK A;  2CX4 A;  1PGT A;  3LYK A;  1ZYQ B;  1EP8 A;  4POK A;  3SWL A;  1CQG A;  4XGH A;  5IIZ A;  1ZCP A;  2FA8 A;  4O7H A;  2DJ2 A;  3KXO A;  2DML A;  1NNQ A;  1PX6 A;  2HFD A;  1MDI A;  3SS2 A;  2VLV A;  2VCQ A;  2CAQ A;  1G0T A;  2VD0 A;  2C8U A;  3GNJ A;  2AAW A;  5LD0 A;  3UEM A;  4JRR A;  3CRT A;  1T9O A;  2H0G A;  2O8V B;  4TW5 A;  2Z9S A;  2XBQ A;  1S3C A;  4AGS A;  2LUS A;  4PUR A;  1OE7 A;  4KND A;  5B7C A;  1NW2 A;  3NOF A;  1BQ7 A;  2MMO A;  2QC7 A;  1K0M A;  3GKX A;  1ZZY A;  4U67 1;  1TI3 A;  1S24 A;  1F3B A;  2XPE A;  3E0U A;  3LXT A;  4K5R A;  3KYW A;  1AC1 A;  3TKS C;  3GUR A;  4OCF A;  3H1N A;  3G7Y A;  3J7Y k;  1ZYN A;  2H0H A;  3F4S A;  3KMO A;  4POM A;  4N11 A;  5D8I A;  4FIW A;  3PIP 1;  3R3E A;  3FKF A;  1GUM A;  2CT6 A;  1ZL9 A;  2VL2 C;  1OVN A;  5G31 A;  3UOM A;  2MS3 A;  1CAA A;  1DX8 A;  3V1W A;  1BYE A;  2P0G A;  2RUE A;  3IV4 A;  2V0F A;  5BRT A;  1PD2 1;  4EE0 A;  4OO4 A;  2B5I D;  2O5J D;  3O3T A;  1GLP A;  2GZY A;  1WOU A;  2N5A A;  1M7T A;  3N9J A;  2F8A A;  4JAD A;  4F0C A;  4V1A g;  1R0J A;  4TR3 A;  6GSU A;  1THO A;  1UVZ A;  1QXH A;  3QAV A;  3D21 A;  1ERW A;  3GUS A;  1SYX A;  2EIR A;  3HHV A;  4MPF A;  3ZZX A;  2QL0 A;  1BG5 A;  1NHY A;  2EC4 A;  1FOH A;  2M80 A;  2PGT A;  3FW2 A;  3QD9 A;  4B8C D;  2DJ1 A;  3C1R A;  3A2X A;  4I8B A;  4OFM A;  1ST9 A;  2WFC A;  4IKH A;  3TJK A;  3GTU A;  5J5N A;  7GSS A;  3RBT A;  4TR4 A;  1JZR A;  4I6X A;  5KEJ A;  1AQV A;  2A4H A;  4BVX A;  3D6I A;  3HXS A;  3UBL A;  1LU4 A;  5B8A A;  4GF0 A;  1SK1 A;  2HT9 A;  1NM3 A;  2L59 A;  3MAK A;  4PUA A;  4ZBA A;  3K8N A;  5EIN C;  2CVD A;  2VCZ A;  4XIH A;  2KOK A;  4AR3 A;  4X0X A;  2Z3R B;  2FWG A;  1A2J A;  1GTU A;  4E6Y A;  2FLS A;  1ON4 A;  4MZW A;  2FWH A;  5F8B A;  2LRN A;  4WXT A;  1XVW A;  2GZZ A;  5FWG A;  1FAA A;  4AR6 A;  1R5A A;  3W8J A;  4GST A;  1Q98 A;  4LMW A;  3J7Y 1;  3QCP A;  3D22 A;  3FYG A;  2JAD A;  4LA1 A;  3UL3 A;  2RUF A;  2B6M A;  1G6W A;  2K9F A;  2LNT A;  2QSI A;  5A5K A;  1SKR B;  2O87 A;  1FB0 A;  1SD9 A;  3F6F A;  3LSZ A;  5DJM A;  2O85 A;  4Z2T A;  3IBH A;  3UVT A;  2MMA A;  3HVX A;  1EOH A;  2VM1 A;  3FR3 A;  5IOW A;  5J4U A;  5HFK A;  2K18 A;  2FWF A;  5IOX A;  2NDO A;  1WJV A;  2I81 A;  4E8H A;  3ZML A;  3QMX A;  3CYN A;  5IMF A;  1IU6 A;  4KDY A;  4NMU A;  5EVO A;  3RZT A;  1PN9 A;  3WYW A;  1O81 A;  3Q19 A;  2MBT A;  3N5O A;  5AN9 H;  2PWJ A;  3MWH A;  5HR3 A;  2A6H D;  2A68 D;  4AHZ A;  4RQX A;  1IRN A;  2TIR A;  2C0D A;  2YZU A;  1XOB A;  3KTB A;  2GZP A;  1BQ9 A;  1ZOF A;  2B5X A;  3VWX A;  3MSZ A;  1M0U A;  1OKD A;  4TXO A;  3ZIV A;  2CKA A;  2R2J A;  2VL6 A;  4Q5F A;  2HRA A;  2YWN A;  2XPD A;  2CV4 A;  2P31 A;  1BX9 A;  3FZ9 A;  3A3T A;  4D73 B;  5GAN D;  1OC9 B;  2PER A;  1H4O A;  3A2V A;  1U6T A;  6GSV A;  3F3Q A;  3ZRD A;  3ZVJ D;  2CVB A;  2HSH A;  1ERU A;  4EUY A;  4AJ6 A;  3VPQ A;  3EPT A;  1T9P A;  4WBJ A;  2H12 A;  3FY7 A;  2GLR A;  3EWL A;  1ACV A;  2LRT A;  5AIX A;  5J41 A;  5HFI A;  4NWY A;  3WWL A;  4GLT A;  4JAE A;  4HUA A;  3HKR A;  5GAD c;  2K8V A;  5CRH A;  1UC7 A;  5IPH A;  4TR0 A;  2WS2 A;  3GIX A;  5B6M A;  2B3S A;  4LHN A;  2OE1 A;  4HI7 A;  1E8J A;  2WDU A;  1ML6 A;  2L4Q A;  1V57 A;  1H7V A;  1R4W A;  2C0G A;  3HA9 A;  2NTO A;  1LJR A;  5B8B A;  4ILF A;  3W8S A;  3VWV A;  4AJ7 A;  3IPZ A;  5EPF A;  2GT6 A;  1XW6 A;  3LYP A;  1PA3 A;  2H01 A;  4FYB A;  2L5L A;  3RHB A;  4OMV A;  2FNO A;  1Z7P A;  2V6O A;  3M8N A;  2IL3 A;  3PPU A;  5IQY A;  5CP1 A;  3L0H A;  4YKG A;  3VPB E;  3A2W A;  4MNN A;  1A2L A;  1BRF A;  2LJA A;  4XRD A;  2DJK A;  3DVX A;  2RII A;  22GS A;  5G30 A;  4BL7 B;  4TXV A;  1GUL A;  3KTL A;  1TRV A;  5ABR A;  1TK0 B;  3IRA A;  2RLI A;  2B5E A;  1QMV A;  3IAM 2;  2PN8 A;  2HR5 A;  2DBC A;  1U87 A;  1AQW A;  4AR5 A;  4KB3 A;  4Z7X A;  1YV1 A;  1F2E A;  1TP9 A;  1JZO A;  5CRG A;  4PQI A;  2NPB A;  3VWU A;  3WT1 A;  4HS1 A;  3IK9 A;  3DGQ A;  4MDC A;  1VGL A;  3MYD A;  1VF3 A;  3GKM A;  3W6G A;  1K0O A;  3CSI A;  3RPN A;  5ECQ B;  3IXR A;  4NXI A;  3BCI A;  1R0H A;  1IW7 D;  1UN2 A;  2HE3 A;  10GS A;  3MNG A;  4K2X A;  3MDK A;  5H5S A;  4YQU A;  4G0K A;  1VZI A;  1GRX A;  6GSS A;  5ECN B;  4BVY B;  1U3I A;  2JI1 A;  4XRA A;  3EUR A;  5INY A;  4KCA A;  3QVD A;  3UVH A;  2L5O A;  5LCZ A;  3PKJ A;  4RQR A;  2R6K A;  3A5I A;  4CDO A;  2L4C A;  4PGT A;  4AHW A;  1GSE A;  2I9H A;  3EMP A;  5MF6 A;  1PX7 A;  1XCC A;  1XZO A;  2LJK A;  4NHZ A;  4OD7 A;  4USS A;  1OAZ A;  2KUC A;  2YWI A;  4HEA 2;  4X1U A;  1EV4 A;  1O85 A;  1GSQ A;  3TKS E;  5HR0 A;  4ZIJ A;  4AJ8 A;  3HZ4 A;  4TKY A;  4ECJ A;  5ECS A;  3GYK A;  2IPA A;  4O5Q A;  1F6M C;  3F6D A;  3HYP A;  4KUN A;  5IY0 A;  3VK9 A;  5DQY A;  4LHL A;  4IEL A;  1OE8 A;  2GGT A;  3Q6O A;  1OWC A;  2FUG 2;  3Q18 A;  4KF9 A;  1QUW A;  3GSS A;  1J08 A;  1Z7R A;  3FMW A;  4ECC A;  3FRC A;  2QGV A;  3GRX A;  1T1V A;  4MJE A;  1HNA A;  2DLX A;  4HJ2 A;  4POG A;  2A4V A;  5MFP A;  2PU9 C;  5C00 A;  5DDL A;  1X0R A;  4N30 A;  3GH6 A;  4OWY A;  1WWJ A;  3DD3 A;  2IWT A;  5JCG A;  1SJZ A;  1QFN A;  1TU8 A;  3TJB A;  4KX4 A;  1PQN A;  4LL4 B;  1A24 A;  3LNL A;  4MJB A;  3ERF A;  1AW9 A;  5HQP A;  3S9F A;  2VO4 A;  3KYV A;  3IE3 A;  4G6B A;  1R5P A;  2FY6 A;  1QK8 A;  1K0N A;  2JI2 A;  3E9J B;  4OFT A;  2OA7 A;  3G7I A;  5AGY A;  3H79 A;  2IN3 A;  1IYI A;  1JZD A;  4IS0 A;  3EU4 A;  2H66 A;  5CRD A;  2M46 A;  1HYU A;  5DBQ A;  12GS A;  2YAN A;  1SEN A;  3FZ4 A;  5H5R A;  1SD8 A;  4JAG A;  2LJR A;  4G9H A;  4MF7 A;  4G0I A;  3HDC A;  1A2M A;  1AXD A;  2ES7 A;  2YWM A;  1VCX A;  4IVF A;  1TW9 A;  4XHM A;  4K7O A;  3O6T A;  1LTL A;  3IC8 A;  1OKT A;  3P7X A;  5GSS A;  2GTU A;  4K9Z A;  5DQS A;  1M9B A;  3PR8 A;  5D96 A;  5G1L A;  5IMV A;  4PXO A;  2AUV A;  2H6Y A;  4EIP A;  5LNK e;  3KGK A;  1AAZ A;  1M2A A;  2WRT A;  6GST A;  5DJL A;  3CTG A;  5IPG A;  3OR5 A;  2KP1 A;  1GTI A;  2ON5 A;  4D73 A;  1TRW A;  1OC9 A;  1RDG A;  1WE0 A;  1WP0 A;  3GV1 A;  3HJO A;  5CRE A;  4EC0 A;  2YWO A;  2CKC A;  3HZ8 A;  1ILO A;  1RYQ A;  1PSQ A;  4F0B A;  3GL3 A;  1TK8 B;  4MA9 A;  3ZRE A;  1XWG A;  3GN3 A;  2KHP A;  1TXX A;  4ZBD A;  2PMT A;  4OCE A;  1RK4 A;  3CSH A;  1JZW A;  3GKK A;  2HNL A;  1R7H A;  1YK4 A;  4L8E A;  2I4A A;  4K7I A;  3FK8 A;  2R4V A;  4UY8 1;  1OWB A;  4AI3 A;  4MPG A;  1SYR A;  1QGV A;  4JBB A;  1V40 A;  5DAL A;  1SMW A;  4A5P A;  3APO A;  8GSS A;  2JSY A;  1C09 A;  5GAG c;  4L5O A;  4G10 A;  17GS A;  3KH7 A;  3NIV A;  3VI7 A;  1ODH A;  3GST A;  2K2D A;  1W4V A;  1GUH A;  3WGX A;  1K0D A;  1V98 A;  6GSY A;  14GS A;  4TR1 B;  1M9A A;  4LMV A;  1ABA A;  4JR6 A;  3M0F A;  3TJJ A;  5B6N A;  4EDZ A;  3PIN A;  3EU3 A;  5ECI B;  2GT5 A;  1XW5 A;  2WB9 A;  2CX3 A;  3IK7 A;  5ENU A;  1FHH A;  1URM A;  2FA4 A;  3GFK A;  4BL7 A;  2F51 A;  3P8B A;  4NV2 A;  4YAP A;  1J9B A;  1B8X A;  1M2B A;  3EMX A;  4ACS A;  3QAG A;  5ECP B;  2VCW A;  5JCW A;  3J7Y b;  3GX8 A;  1M2D A;  4AHY A;  4ZBB A;  4J2F A;  1K3O A;  2XJS A;  3I43 A;  4NV5 A;  4IQA A;  1OC8 A;  2R0P A;  1NXE A;  2PVQ A;  2LKU A;  1GWC A;  1PRX A;  2O7K A;  3F0I A;  3ZMK A;  13GS A;  3FHK A;  5DCH A;  4L0U A;  2YPM A;  1G6Y A;  3PKI A;  2CZ2 A;  1BED A;  2XJP A;  2B7J A;  3M9K A;  1E2Y A;  3LJR A;  2C3T A;  2IMF A;  4JED A;  2M4V A;  3PWF A;  5IMD A;  2BJX A;  2P5R A;  4DEJ A;  3F3R A;  6RXN A;  1PL2 A;  3M1G A;  3UAR A;  2XC2 A;  4O32 A;  1PL1 A;  3BOA A;  2ALB A;  3RHC A;  3HD5 A;  5RXN A;  1OYJ A;  4WKW A;  5AN1 A;  2DC5 A;  3C73 A;  5IMA A;  2F9S A;  4BVY A;  1EOG A;  1FW1 A;  1USB A;  3DIE A;  4Z2R A;  4GCI A;  4I5Q A;  1WPI A;  4V19 6;  3F4R A;  3TUE A;  4ZB6 A;  2G0F A;  5EY6 A;  4MAB A;  4FO5 A;  1EGO A;  2L57 A;  2C3Q A;  2FWE A;  1Z6M A;  4V2N A;  4H86 A;  2H71 A;  1WIK A;  1J0F A;  4I97 A;  2LTK A;  2MMN A;  2VCV A;  1YY7 A;  2VLU A;  5CAX A;  3CBU A;  1W89 A;  1A8L A;  2I1U A;  4IP1 A;  1TI1 A;  2DSX A;  2VOC A;  1T9Q A;  2L6D A;  1GLQ A;  5MFZ A;  3C1S A;  2PVX A;  4WR4 A;  5ECH B;  1ZRP A;  4DSS B;  4GS7 D;  3H8Q A;  5D9X A;  1LBK A;  5E4W A;  2ZCT A;  1GNW A;  3TJF A;  3NFP I;  2KN9 A;  5ID2 B;  4JE1 A;  4JU5 A;  2B5Y A;  4RI6 A;  1O73 A;  1VRS D;  2GSR A;  4J57 E;  1EEM A;  3IOS A;  8RXN A;  2VM2 A;  3D4M A;  4OO5 A;  1A0R P;  1H75 A;  1GP1 A;  1DBY A;  2H0I A;  2HRF A;  4F82 A;  5GST A;  3HJM A;  4K6X A;  1O6J A;  3GHA A;  2MYG A;  1LKO A;  5BMU A;  2Z3Q B;  2MZC A;  2ERJ A;  4WBR D;  4IJ3 A;  1ZYP A;  1XIY A;  4O92 A;  4WET A;  1SKW B;  2H8L A;  2HRN A;  1BFY A;  3U5R E;  4AR4 A;  5KN2 A;  4XTS A;  3D0Z A;  3VPT A;  5G2Z A;  4L5L A;  3U6V A;  1G7O A;  5CYY A;  3CMI A;  5H5Q A;  1EP7 A;  3BJ5 A;  4ML6 A;  3UAP A;  2IIY A;  2REM A;  5GAP D;  7RXN A;  5JWR B;  1XPV A;  2H1A A;  3QPM A;  5ELA A;  1YF0 A;  4HQZ A;  1N2A A;  4ISD A;  2V6K A;  5DAK B;  3UJ1 A;  4GRF A;  2BMX A;  4ZL7 A;  2WZ9 A;  1HQO A;  6GSX A;  3C71 A;  3H4K A;  5GZZ B;  2GSQ A;  5F07 A;  2LQO A;  4QQ7 A;  4L0W A;  3KYY A;  2VL3 A;  2V2G A;  4YQV A;  3QFB C;  2V41 A;  3LG6 A;  1FB6 A;  3ZVJ A;  4AF2 A;  4WFN 1;  1T7P B;  4XS4 B;  3PGT A;  3IHQ A;  1YQ1 A;  2AJQ B;  1JLW A;  2BTO T;  2NVL A;  1T4Y A;  1Z3E A;  1UA5 A;  1OC3 A;  2K6V A;  3F63 A;  2VD1 A;  2C4J A;  1ERT A;  3KD0 A;  1GTB A;  4YKF A;  4POL A;  2N5B A;  1B13 A;  1Z6N A;  4MH2 A;  3TRX A;  1A8Y A;  2H73 A;  4AI1 A;  3KYX A;  4KDX A;  1MD4 A;  2QA2 A;  5EL8 A;  2A69 D;  2DIY A;  4PNF A;  1S3D A;  4JZQ A;  1SU9 A;  4BPY A;  3TKQ A;  3I6A A;  1IU5 A;  3P2A A;  3LEF A;  4MZC A;  1BAY A;  3F8U A;  5D73 A;  1YUZ A;  4GSN A;  4LL1 B;  5E59 A;  3IDV A;  2YJH A;  2CQ9 A;  1I5G A;  1GSD A;  4KGI A;  2CA8 A;  1GH2 A;  4ECI A;  3RPP A;  4XXB B;  2R37 A;  3LPE B;  4EKZ A;  3ZYW A;  4ZL9 A;  3UBK A;  3IHG A;  3RDW A;  3ERW A;  2G2Q A;  3WT2 A;  2OE3 A;  1KEB A;  1KTE A;  3EC3 A;  4V2L A;  2X8H A;  1Z92 B;  2H70 A;  3HY2 A;  3AY8 A;  2A6E D;  1DUG A;  2H30 A;  1KBN A;  4TR1 A;  3NZN A;  4TOP A;  2DSA A;  3GMF A;  4I2T A;  1VF4 A;  4KSO A;  1E6B A;  5FHI A;  4IHU A;  2PPT A;  1LKM A;  2F8F A;  2OBI A;  5DCG A;  2CZ3 A;  2HZE B;  3ISO A;  2AV4 A;  4Q5Q A;  2L6C A;  3VI5 A;  2HRK A;  2WCI A;  4HQS A;  1U88 A;  2L0Z A;  2JL4 A;  2V0E A;  3DRN A;  3DKS A;  4POB A;  3SBC A;  4I2U A;  2KKD A;  4NAX A;  1XVQ A;  1S3A A;  1SJI A;  4MMM A;  3CTF A;  2H1D A;  2H75 A;  5C04 A;  1ZMA A;  1B2J A;  2DKI A;  3I9V 2;  2X4A A;  5A4V A;  3BD2 A;  1Z5Y E;  3KJY A;  4K8M A;  2H6Z A;  2M6O A;  1JFU A;  4MK3 A;  3A44 A;  2LEG A;  2B7K A;  3TRP A;  2HZF A;  4G19 A;  2HLS A;  1XFL A;  2GMG A;  3M3M A;  2M6P A;  3QQC E;  3KIJ A;  2HI7 A;  2E2G A;  3TB2 A;  1TRU A;  2VCT A;  1GSF A;  4FQU A;  5CRW A;  1A23 A;  2AHE A;  4TXO B;  1HNC A;  1FOV A;  3DXB A;  3GH9 A;  4BWQ A;  1YF1 A;  1YUX A;  4MF6 A;  4N0V A;  1B71 A;  2V32 A;  5MGN A;  4MH3 A;  3TJG A;  1K3L A;  4K0G A;  3HVS A;  4K1F A;  2IMD A;  3VFI A;  1GSS A;  4EF0 A;  1BJX A;  1R0I A;  1VF2 A;  1SMM A;  1PN0 A;  2HXK A;  3VUR A;  2HSM A;  4GQF A;  1DVB A;  2DJ0 A;  2JZS A;  4IN0 A;  5HR1 A;  2HSY A;  3L4N A;  4HU7 A;  2C0F A;  2YV9 A;  3MPS A;  3LXZ A;  5G5E A;  1QQ2 A;  2TRX A;  2VAF A;  3QAW A;  2GQL A;  3FZ5 A;  1TK5 B;  4K9F A;  5IMC A;  1YJ6 A;  3TOU A;  5A4W A;  5A4U A;  1ZGN A;  1DSB A;  3KEB A;  1FVJ A;  4EL1 A;  3D5J A;  4DSS A;  1GNE A;  2M72 A;  3QFA C;  3UMA A;  3B08 B;  2OAD A;  2DJJ A;  4KDU A;  1Z9H A;  4KA0 A;  5D9V A;  5ID2 A;  4MJC A;  4EDY A;  5D9W A;  5ECK B;  1B48 A;  1VZH A;  1R0G A;  1BQ8 A;  2KP2 A;  3C7M A;  3EE2 A;  3TDG A;  1K0B A;  3APS A;  3IA1 A;  1IRO A;  1U3A A;  5ECR B;  1EGR A;  1TTZ A;  4PUF C;  2IMK A;  1XWK A;  2IJY A;  1RQM A;  3LOR A;  3DML A;  4CHS A;  3KP9 A;  3QOU A;  1B9Y C;  4YAV A;  1HNB A;  5G1K A;  2J9H A;  4DSQ A;  2ZUP A;  1F37 A;  1K0A A;  1SK2 A;  1SL1 B;  4GTU A;  1K0C A;  3RZ6 A;  3L9S A;  3TKP A;  5HR2 A;  5AIS A;  2R3X A;  5COH A;  4HZ2 A;  2C1Y A;  2MMZ A;  5D93 A;  3VWW A;  4V2M A;  4WEY A;  2X8C A;  3D4T A;  4POF A;  5JVG 1;  1SL0 B;  4ZB8 A;  2JZR A;  3VLN A;  2H74 A;  1RB9 A;  4G2E A;  2K8S A;  5FT3 A;  3PIO 1;  1TRS A;  4F03 A;  5DAK A;  2YCD A;  4HU9 A;  4ICY A;  1C72 A;  4K0N A;  1LKP A;  3M9J A;  4IJI A;  1X9M B;  3HJP A;  2XJR A;  2V1M A;  4WR5 A;  1GTA A;  4QL9 A;  2CR8 A;  5GAE c;  1YKC A;  1YEX A;  3TCO A;  5ECL B;  2X49 A;  1B4P A;  5AI2 A;  4GWR A;  1NSW A;  2OAC A;  1YDK A;  1SKS B;  4EIQ A;  4GSS A;  5JCU A;  2IFQ B;  4CW9 A;  4EXJ A;  4XS4 A;  1O8W A;  2LQQ A;  2E2M A;  4MP4 A;  3ZTL A;  3WD6 A;  4KAE A;  1V2A A;  4KSM A;  3ERG A;  2B1K A;  2RM6 A;  1R26 A;  1XWB A;  2ON7 A;  1PKW A;  2YNX A;  4HZ4 A;  4Z2U A;  4ME3 A;  2H1G A;  4F2I A;  5F06 A;  1FO5 A;  4X4J A;  2XJQ A;  2FD3 A;  1YKA A;  4MJA A;  4WF4 A;  5ECM B;  2NBS A;  3MSU A;  1R0F A;  3L9U A;  5EIO C;  2NYD A;  3IC4 A;  2V3B B;  2IME A;  1JYB A;  2I3Y A;  2GSS A;  1CQH A;  1VZG A;  16GS A;  1G7E A;  2A2S A;  3GX0 A;  4HJM A;  1TOF A;  1MTC A;  4ZXG A;  5DVB A;  4K2D A;  4AI0 A;  3F9U A;  3ZFB A;  4FH8 A;  3ZG6 A;  4XS1 A;  2C6A A;  3FR9 A;  3L9V A;  1BE7 A;  1SMU A;  3C8E A;  1JLV A;  2XBI A;  3GA4 A;  3P8W A;  4PQH A;  4F9Z A;  4HDE A;  1WRY A;  4RUV A;  3KH9 A;  18GS A;  1T8E B;  2C3N A;  5J9C A;  3QR6 A;  1PMT A;  1EWX A;  1YEP A;  1KNG A;  1DE1 A;  2BE5 D;  3PZA A;  3LFL A;  3TGZ A;  5L71 A;  2X99 A;  5AI3 A;  3US3 A;  1TJD A;  1TU7 A;  1RYT A;  4FYC A;  2XJV A;  2JZT A;  4IQ1 A;  4TVE A;  3P90 A;  1SK0 A;  4N0Z A;  3WGD A;  3LWA A;  2FHE A;  1F9M A;  2X64 A;  4HOJ A;  1O7U A;  2TRC P;  4IBP A;  2A2R A;  2HZE A;  4J56 E;  3TKR A;  4TPU A;  1WJK A;  2O89 A;  5JWQ B;  4DSR A;  5IO2 A;  6GSW A;  1V58 A;  2QA1 A;  3KP8 A;  1V9W A;  1QCV A;  3IAS 2;  1B9X C;  5G5F A;  4ULX A;  19GS A;  4BA7 A;  5AIV A;  3FEU A;  2GVP A;  5MLC 3;  1YK5 A;  1PKZ A;  4CY6 A;  2YP6 A;  4TVM A;  4O5R A;  2JAC A;  2N5F A;  1RWD A;  2A2P A;  1T00 A;  2H76 A;  3H93 A;  2LCQ A;  3CSJ A;  4JR4 A;  1S2Z A;  3ZIT A;  1O8X A;  4FYU A;  4TN8 A;  3F4T A;  4IW9 A;  2YJ7 A;  1T3B A;  2J23 A;  2ZNM A;  3LQ7 A;  1VF1 A;  1ERV A;  5KN3 A;  5CNW A;  1A0F A;  1X5D A;  5ELG A;  4XCS A;  2J9U B;  2R5G A;  2LST A;  1AIU A;  1X5C A;  3KYU A;  1X5E A;  2LNS A;  4BWS A;  2MBS A;  2M4Y A;  2P5Q A;  4N10 A;  5GAH c;  4CY8 A;  4AI2 A;  1GSY A;  2AB6 A;  1MD3 A;  3LGC A;  4IP6 A;  1N8J A;  3PH9 A;  5CO3 A;  3APQ A;  2DKH A;  3GKN A;  2C80 A;  2KLX A;  3ED3 A;  2C6B A;  3Q74 A;  2YN1 A;  2HYX A;  1EEJ A;  2VCX A;  5KN0 A;  2WGR A;  3E3E A;  3DEX A;  2CAI A;  2XJU A;  3UIW A;  5DAL B;  4PNG A;  5KN1 A;  4WF5 A;  3IU3 I;  5KOW A;  1S30 A;  2FGX A;  4Q5N A;  4K5S A;  4MF5 A;  1WMJ A;  4Q5R A;  2GS3 A;  4PX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...