3P2AA

Crystal structure of thioredoxin 2 from yersinia pestis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
b'NAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thioredoxin-like protein
publication title Crystal Structure of Thioredoxin 2 from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3p2aA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3p2aA02
4GSTA 3GSTA 2J9HA 1WJKA 3UL3A 1XZOA 1O73A 4TRXA 1Y25A 1X5EA 2DMLA 3F0IA 4EE0A 2B5EA 2LUSA 5JCGA 2YANA 2PWJA 4MZCA 2GZYA 2OBKA 4PUFC 3RBTA 1WRYA 2CX3A 4GRFA 3BOAA 2H1GA 4KSOA 5F0GA 1I9DA 3DVXA 6GSUA 2L4CA 4XS4A 5DDLA 2H1AA 3BCIA 3EURA 4ZBDA 2K18A 5DAKA 5ECRB 2J23A 3L9UA 4BL7A 1BEDA 3VI7A 2IWTA 2PU9C 5J3RA 2PERA 4DSRA 3WT1A 2H75A 4GSSA 1FHEA 2JU5A 1A23A 5JCWA 3Q19A 4MF7A 1EP7A 2FWGA 1XXUA 3VWWA 1K3YA 2O7KA 3HA9A 1EWXA 3TJFA 1O8XA 3ZLPA 2G0FA 4JBBA 2YJHA 5ECHB 5ELAA 1SK2A 4HUAA 1T4ZA 2GZZA 3GL3A 2HE3A 2K6VA 3C1RA 5LD0A 3IA1A 3GH9A 1Y6EA 4PQHA 2YPMA 1Z7PA 3F4RA 3FR3A 5GAPD 1B9YC 1USBA 2N5FA 3O3TA 2DC5A 1T8EB 3QPMA 2K8VA 3QR6A 4I2TA 5ID2A 1EV4A 4PNFA 2L5OA 1ERVA 3BCKA 2GQMA 5F07A 4IELA 1O7UA 3CTGA 2VCXA 1M9BA 3ERGA 3E0UA 4N30A 2FNOA 1ZYEA 2O8VB 1TI1A 1FB0A 5CRHA 3UBLA 2DJJA 2LEGA 2R37A 3TJJA 4KW6A 1XFLA 1TU8A 3HZ4A 1NW2A 3L4NA 5A4VA 4L0UA 2V1MA 4O5RA 4TXVA 4X1UA 5HFGA 3VWXA 4DSSA 1N2AA 4AJ6A 1H4OA 1XWKA 3F4SA 3MSZA 1GTAA 3C7MA 3D0ZA 3VWUA 1FG4A 1PL1A 4K7NA 2HSHA 4OMVA 2OA7A 3LGCA 2PN8A 2X8GA 4MF5A 4KE3A 3VFIA 3QAVA 4BVXA 3D21A 4TKYA 5IO0A 4TW5A 2VCVA 3GKKA 2OKAA 1EGRA 5DBQA 3TJKA 4PX1A 9GSSA 2NTOA 3L0HA 1JZRA 3GTUB 4IKHA 5AN1A 1VF4A 3D4MA 3DGQA 3ZMLA 4D73A 1AQVA 1YQ1A 4JU5A 4PUAA 1A24A 2IMDA 2P5RA 1Q4JA 2L6CA 1SYXA 5D9VA 3DRNA 3DYRA 5J41A 3IAS2 1DE1A 4ZXGA 4HOJA 4EVMA 1OYJA 1URMA 4GWRA 3RPNA 3ZRDA 3TRXA 1AQXA 17GSA 2JACA 2X8CA 2YCDA 1C72A 1GSFA 1AC1A 4WKWA 4ZB6A 5DJMA 3RPPA 2QSIA 5CRWA 5ECIB 5G30A 1XVWA 3H8QA 2YNXA 2LJAA 1K0DA 4FO5A 1UVZA 4V2LA 3IAM2 3GA4A 1N8JA 4I6XA 1ZMAA 4BWSA 2GT6A 4PQ1A 2IN3A 1WOUA 2IIYA 2I81A 5KN1A 4O92A 5G1LA 2VD1A 2H1BA 2CX4A 4F2IA 1AIUA 5G5FA 1PQNA 3PGTA 1MTCA 1F3BA 5LCZA 2DJ2A 3VURA 4MA9A 5J9BA 2LRTA 2YN1A 1A0FA 1R4WA 2CV4A 2YOIA 2B6MA 2FA8A 4OCFA 5D9TA 2K9FA 1FO5A 2B3SA 4V2MA 5D8IA 1MDJA 2R4VA 3G7YA 2KLXA 3EE2A 5HFKA 1K0OA 2XPEA 2YJ7A 4GQCA 1V40A 1I5GA 2WS2A 2JADA 3MNGA 1FVJA 3R2QA 1W4VA 4NXIA 2VL3A 4CW9A 1EOGA 1V2AA 1XIYA 3TJGA 3F8UA 4LLRA 3C8EA 1TP9A 3QD9A 1EOHA 5IM9A 5B8AA 2LV3A 2CAIA 3HCZA 3GN3A 2NDOA 1MEKA 1EZKA 4FIWA 3G7JA 2PVQA 2N5BA 2DMMA 1ABAA 4Z7XA 3ZL5A 4OD7A 2IL3A 3MWHA 1GSSA 3HY2A 3S9FA 4IJ3A 2YZUA 1FOVA 5DCHA 4HJMA 2B5YA 1TI3A 3TKRA 2C6BA 4MDCA 1R5AA 2JSYA 3FZ9A 1T4YA 5A4WA 3SWLA 4TR1A 2ZNMA 3KGKA 3DKSA 5AGYA 3B0AB 3K8NA 1QMVA 1ERUA 4XS4B 5INYA 5DAKB 3WD6A 3W8SA 3U6VA 1F37A 1EEMA 1B9XC 2FUG2 3GSSA 1A2LA 2B1KA 3FR6A 2GQKA 4I2UA 3ZTLA 2RLIA 4AJ7A 4I8BA 2OADA 3ZIVA 3O6TA 1WPIA 1J9BA 3CRUA 5FHIA 2HFDA 2E2GA 3QMXA 1XOBA 3A3TA 3H93A 1ZGNA 4MP4A 1M2AA 4TR4A 3KD0A 3WGXA 1K0NA 4ML1A 3I6AA 3KMOA 18GSA 5IOWA 3IHQA 2IMIA 2MMNA 2DSAA 4G10A 3QDNA 2HLSA 1G0TA 2WGRA 3PH9A 1HNBA 3QFAC 5ECMB 4EDYA 1GTBA 3KH9A 2DJ3A 1K0MA 5ID2B 5IQYA 1LU4A 2XBQA 4KAEA 2DJ0A 3ME8A 1GP1A 3M8NA 4XTSA 4Q5RA 3PR8A 3TRQA 2B7JA 2MYGA 4ZL7A 5H5QA 3J7Yk 1CQGA 1TTZA 1SJZA 4YAPA 1Z7RA 2H73A 3KEBA 4ZBBA 3GUSA 5C04A 3KTLA 2OJLA 2TRCP 3FK8A 2QKEA 1JZOA 5HR3A 2IMFA 1X9MB 5CNWA 5IPHA 2WRTA 3HJMA 2H66A 2AB6A 2HSYA 1SJIA 2HRNA 4IP1A 2DIYA 1XWGA 3ZREA 1VF3A 2JL4A 5GSTA 1TK8B 1O81A 1V9WA 5IMAA 1TRSA 4NWYA 3GL5A 2H30A 4DSSB 1RQMA 2C0EA 1GLQA 1XBSA 1YDKA 1MD3A 2H76A 5IMDA 1TDIA 4MH3A 3GURA 4ZIJA 4KH7A 1GNWA 3I69A 3FRCA 4EO3A 2H01A 1EV9A 4I97A 3IBHA 2A2SA 1UA5A 3IK7A 4MJAA 4LL4B 1AUCA 3ED3A 3US3A 1QUWA 1G6YA 2NPBA 5IO2A 2V6KA 3CRTA 5AIXA 3FZAA 3UEMA 3NOFA 2VL2A 1GTIA 4ZL9A 4K6XA 3PINA 2Z9SA 2XBIA 4WR4A 2O85A 3QFBC 3N9JA 5HR0A 1TOFA 3WT2A 4Q5NA 4D73B 3ERWA 1GSEA 3M3MA 4K0GA 4E8HA 1SL2B 4IQAA 5HFIA 1TKDB 3TKQA 4MPFA 3DVWA 3KCMA 5E59A 3JCML 2CAQA 2DJKA 1MD4A 5ECSA 4MABA 4WF5A 1Z6NA 2YV9A 3AY8A 4MZWA 1G7OA 5A4UA 2KP1A 1GL8A 1M0UA 3KTBA 2X99A 2GDRA 1THXA 4XRAA 1T00A 2VIMA 2JZSA 2WULA 3CSHA 5HR2A 2OE0A 2MMOA 1PL2A 5CRGA 1BAYA 1GSUA 3IR4A 3KXOA 4ID0A 1F2EA 1X5CA 4QQ7A 2O89A 2I4AA 2A4VA 1X9SB 3H1NA 4WR5A 5COHA 2JSZA 2QC7A 2G2QA 5G1KA 1VF1A 3FR9A 2AAWA 4LMVA 3V1WA 4L0WA 1XPVA 4FYCA 4K1FA 2F51A 1GNEA 1DUGA 1OC3A 1YY7A 1V58A 4DSQA 2VCQA 3IXRA 4X0XA 1QK8A 1F3AA 2CZ2A 2J9UB 4EC0A 1SD9A 4BVYA 1GH2A 3I9V2 4ZB8A 5JWRB 2C0FA 2OACA 1ZCPA 1OAZA 4K7IA 4OFTA 4YQUA 1SL0B 1KTEA 4IP6A 3A5WA 1XW6A 3KP8A 2OE1A 3ZVJA 1SK0A 3NIVA 3SBCA 1YF0A 1XWCA 4WBJA 5ECLB 2C1YA 1HD2A 4V1Ap 3GHAA 3LWAA 2FWEA 2TRXA 2FLSA 1EGOA 3F3RA 1WIKA 2AV4A 3RHBA 4KCEA 1IYHA 2D2ZA 3KIJA 1BYEA 3J7Yb 4MF6A 2M46A 3C73A 1VRSD 3MAKA 11GSA 2XPDA 1GSQA 5G5EA 1ML6A 5EY6A 1U87A 1SENA 1YZXA 3UARA 3HXSA 2ON7A 4N11A 2LNSA 3WGEA 3GV1A 1JLWA 2HXKA 2P31A 3HKRA 3VLNA 1UC7A 2VO4A 4E8EA 1XW9A 5D9WA 1W89A 4O7HA 4TOPA 4TR1B 6GSYA 6GSWA 2FGXA 1HNAA 2PVOC 3APOA 4MMMA 3L9VA 1M2DA 4P3YB 3W8JA 3HVSA 4RI7A 13GSA 5JCUA 4J56E 5D96A 5H5RA 3TKSA 2MBSA 4KSMA 1TK5B 5DQSA 5EVOA 3GKNA 3GKXA 2H8LA 4RUVA 1KEBA 2K8SA 1Z5YE 2YWOA 3FHKA 1PA3A 3CMIA 2VCTA 3UVHA 3BD2A 8GSSA 3UVTA 5F8BA 2L6DA 1PRXA 4HDEA 3G7IA 4XXBB 2I9HA 3TOUA 5CAXA 4OWYA 1G6WA 4WEYA 3CSJA 2NVLA 4GCIA 4IW9A 4TR0A 2ON5A 1H75A 3IE3A 1EP8A 3GYKA 4TR3A 2CVDA 5D93A 4IJIA 4N0ZA 2ES7A 4IQ1A 1TRVA 4MLYA 5DQYA 3WYWA 2GSSA 1S3DA 2GTUA 4IVFA 2H0HA 4OO4A 1YJ6A 3LXZA 4JEDA 4TXOB 1JLVA 1ZOFA 1XCCA 3EVIA 3LORA 3IC4A 3NZNA 4HEA2 4WXTA 5DCGA 5CO3A 3WGDA 3KM6A 3HHVA 1Q98A 1TRUA 1SKSB 2CVKA 4DEJA 5GSSA 3HVVA 3D4TA 2LRCA 3C71A 2YWNA 2LRNA 4KDUA 1SU9A 2HRFA 2C4JA 2RM5A 4JE1A 4X43A 2C80A 4RI6A 3P7XA 4XS1A 5IMZA 2AYTA 1WE0A 1V57A 2C3TA 3HVXA 2AHEA 3TRPA 3UAPA 1J08A 3FZ4A 2RUFA 2YV7A 4PQIA 2HZEA 2JZTA 3ISOA 2XHFA 1SKWB 1OKTA 2IFQA 4BA7A 4NV5A 4HZ4A 2H19A 3KJYA 1PX7A 4HQZA 2M80A 1DBYA 4IBPA 2F3MA 1CQHA 4FYBA 4K9ZA 5L71A 2F8FA 5GZZB 1JZDA 4NMUA 1XWAA 4MJBA 3UMAA 1O6JA 3BBYA 2VLTA 2MMAA 4HZ2A 5LNKe 3CSIA 2R2JA 3CTFA 3OR5A 4ZILA 2DBCA 5FWGA 2HZFA 2MMZA 4GSNA 2FWFA 3ME7A 4L5LA 4L8EA 3LFLA 2GLRA 3F9UA 4DVCA 6GSXA 1K3OA 3LSZA 1FAAA 3G9BA 12GSA 4G2EA 2R6KA 3APQA 3HD5A 1LJRA 2L5LA 1T1VA 2REMA 3D5JA 4EXJA 1ZZYA 3TKSE 2H0IA 2JZRA 4MK3A 1SL1B 2HYXA 1GUMA 3IRAA 1F9MA 3A2WA 4BWQA 2YWIA 2VM1A 3ZYWA 4HU9A 14GSA 2LNTA 4N10A 2H6ZA 2KP2A 5DALA 1UN2A 2WJUA 3EWLA 4MPGA 3RAZA 5HR1A 1TRWA 3LYKA 4GXZA 1AXDA 1B48A 1ILOA 3QOUA 5ECQB 3HYPA 3IV4A 4TXOA 1R5PA 3ZIJA 2LSTA 4K0NA 1R26A 2C0GA 1DSBA 1M7TA 1O85A 3LG6A 3HDCA 1BJXA 19GSA 1T3BA 1KBNA 3VPTA 4HJ2A 2E0QA 1F6MC 4F0CA 5C00A 4MZBA 3FY7A 3M1GA 4LMWA 1TW9A 3D22A 3LJRA 4MCUA 4XCSA 1O8WA 4KCAA 4L5OA 3L78A 2B7KA 2ZUPA 4PURA 4TN8A 2A2RA 1S3CA 4KA0A 1ERWA 2PMTA 3VK9A 4ILFA 3QAGA 5KEJA 2ZCTA 2IMEA 2LJRA 1GTUA 4WF4A 2M72A 4LL1B 5IOXA 1GSDA 3P2AA 1XW5A 2CZ3A 3TUEA 4ZB9A 4YQVA 4HQSA 4EDZA 3M9JA 2H0GA 2CQ9A 2H6XA 4GLTA 2LQQA 3F6FA 4O32A 4J57E 5JWQB 6GSSA 1GRXA 1VF2A 1X5DA 4HS1A 5J9CA 3EMXA 5F06A 2VL2C 1KNGA 4EF0A 4POBA 5ECKB 4XS6A 2DIZA 1QQ2A 1G7EA 2GSRA 1GULA 1OC9B 2PGTA 1ZL9A 1A8YA 1BX9A 3HJPA 1A2MA 3TCOA 1TJDA 2H1DA 4XRDA 2KHPA 3P90A 3VI5A 1V98A 4ISDA 3Q74A 4IHUA 4PNGA 1PGTA 2R3XA 3GKMA 4FH8A 2VL9A 3ZVJD 1QFNA 16GSA 1U6TA 2KOKA 1GWCA 3ZMKA 1OE7A 1U3IA 1HYUA 3QAWA 4ECIA 20GSA 1K0CA 3ZFBA 3DIEA 2FY6A 5B7CA 1SKRB 3F3QA 4POKA 2WCIA 4EKZA 3TDGA 3F4TA 5EPFA 2GSTA 3GNJA 4ACSA 4RQRA 2N5AA 5IMCA 3DEXA 4IGJA 3VPQA 3W6GA 4F0BA 3EC3A 3F6DA 4ECCA 1K3LA 2MZCA 1TXXA 2FCHA 3L9SA 3E3EA 3P8WA 2P5QA 3A2VA 3IPZA 3M0FA 3CXGA 2I3YA 5CP1A 1AQWA 3GRXA 3GX8A 2L59A 1WP0A 5J4UA 2OBIA 2X64A 3IOSA 3GH6A 1M9AA 4F9ZA 2DJ1A 1OC8A 2V41A 2V2GA 4AF2A 5D73A 2GQLA 1YEXA 1GSYA 5KN3A 2C3NA 1J0FA 2E2MA 4ECJA 1ZYQB 1OKDA 1THOA 2ALBA 4NHZA 2LQOA 1WWJA 2VAFA 4YH2A 2WFCA 4Q5FA 2IPAA 1K0BA 2PUKC 5EL8A 2VM2A 1SD8A 3IDVA 2FHEA 2HI7A 4KB3A 5IMVA 2E7PA 1GUHA 3MDKA 3QCPA 4KNDA 4POLA 1XOAA 4G19A 3EINA 1Z3EA 5A5KA 2RUEA 2VOCA 3I43A 2RIIA 4MJCA 4RQXA 1MDIA 2EIOA 3UOMA 1M2BA 2HZEB 4CDOA 1OC9A 2EC4A 2I1UA 4MJEA 5ABRA 2KUCA 4F82A 2F9SA 2H72A 3H79A 2BTOT 4JR4A 4EL1A 2GZPA 2IFQB 1X0RA 3EYTA 1T7PB 1PSQA 1DE2A 3Q6OA 2IMKA 1A8LA 4QL7A 3LYPA 3D6IA 2MBTA 1E6BA 4KX4A 4I5QA 2VLUA 3TB2A 1S3AA 3HZ8A 4ML6A 3DD3A 1LBKA 3APSA 5FT3A 1PD21 4AGSA 1JHBA 1A2JA 2BJXA 2FD3A 4JZQA 1ERTA 3DWVA 1Z9HA 2PPTA 3E9JB 1NHOA 3ZITA 2CVBA 5J5NA 2H70A 4HU7A 1QXHA 2XC2A 3TKSC 5ECPB 3UIWA 2H6YA 4JRRA 2V6OA 3FEUA 4TVEA 5DVBA 2YP6A 1BG5A 4KDYA 1GLPA 2PBJA 1RW1A 2WZ9A 2VLVA 5JWOB 3TGZA 5GAND 4KGIA 5IPGA 3B08B 3VWVA 3F63A 4IS0A 5DJLA 2V32A 3KMNA 5ECOB 3KP9A 4JR6A 1XVQA 6GSVA 2R5GA 5B6NA 3IK9A 2WB9A 1BQ7A 2LTKA 5DALB 1RK4A 2B5XA 1ST9A 2NBSA 5ELGA 4YQMA 4GQFA 3LQ7A 4NPBA 3KZQA 3O76A 3UJ1A 1FB6A 3FKFA 1ACVA 4OCEA 4GF0A 1SJ6A 2YZHA 2VD0A 1HNCA 2CT6A 1X9WB 5G31A 3LEFA 3CBUA 3UBKA 1B4QA 1IYIA 1HQOA 4XIHA 1VGLA 1AAZA 1XWBA 2GS3A 2FWHA 4N0VA 1NSWA 5CREA 2L57A 2C3QA 5CRDA 3Q18A 4G9HA 1FW1A 1A0RP 5KN2A 3LXTA 4ZBAA 5G2ZA 4NHWA 4XHMA 2C0DA 3GTUA 1TK0B 3FW2A 3HJOA 4NAXA 3GX0A 2C6AA 3C1SA 4AJ8A 2GT5A 5B6MA 4BPYA 3ZZXA 2HT9A 1PKWA 2IJYA 5H5SA 3DXBA 1FVKA 1QGVA 4K8MA 3ERFA 3M9KA 4MH2A 1PN9A 1YKCA 1EEJA 3FYGA 5IMFA 1NHYA 1PKZA 1YF1A 3RHCA 1AW9A 2VCWA 1TU7A 2O87A 3GFKA 1B8XA 10GSA 2TIRA 4KDXA 2GGTA 2H74A 4V1Ag 1WMJA 1GUKA 4CHSA 4KUNA 2BMXA 1OE8A 2C8UA 1ON4A 6GSTA 2EIRA 5CYYA 3RDWA 4PXOA 3N5OA 3TJBA 4OO5A 7GSSA 1SK1A 2GVPA 2QGVA 1JZWA 3CYNA 3A2XA 3GIXA 1NM3A 4IN0A 5B8BA 2DLXA 1B4PA 3TOTA 4K2DA 1PX6A 3GMFA 4NV2A 5AISA 4OFMA 2X8HA 5HQPA 1MDKA 1R7HA 3H4KA 2LS5A 4OFNA 2P0GA 5E4WA 5ENUA 22GSA 3DMLA 2VCZA 3KH7A 4ECBA 5ECNB 3TKPA 5IIZA 4ZL8A 2H71A 4ULXA 1YKAA 2OE3A 2LJKA 1PMTA 3EU3A 1SYRA 2WDUA 3FZ5A 4V2NA 5D9XA 3ZFLA 4J2FA 2CA8A 1OVNA 1Z6MA 1K0AA 2GSQA 1YEPA 4GTUA 4EUYA 2RM6A 4PGTA 2AJQB 2HNLA 4F03A 4LA1A 2B1LA 4QL9A 4K7OA 1JFUA 2AUVA 4HI7A 1E2YA 4H86A 4POMA 2FA4A 4FYUA 4WETA 1M99A 5KN0A 2YWMA 1U3AA 5AIVA 2LKUA 4YAVA 3U5RE 3EU4A 3EMPA 3BJ5A 1U88A 2EIQA 2L4QA 2F8AA 4Q5QA 5F05A 2VUPA 4WBRD
chains in the Genus database with same CATH superfamily
4GSTA 3GSTA 2J9HA 1WJKA 3UL3A 3S16L 1XZOA 1O73A 4TRXA 2ZIXA 1Y25A 1X5EA 2HRAA 2DMLA 3F0IA 4EE0A 2VL6A 4C3JL 2B5EA 5IYBL 1R0IA 2LUSA 5JCGA 5MFPA 5AI2A 2YANA 2PWJA 4MZCA 2PYAA 4Y7NL 2GZYA 2OBKA 4PUFC 3RBTA 1WRYA 2CX3A 4GRFA 3BOAA 2H1GA 4KSOA 5F0GA 1I9DA 3DVXA 6GSUA 2L4CA 4XS4A 5DDLA 2JA7L 2H1AA 3BCIA 3EURA 4ZBDA 2K18A 3LWOB 5DAKA 2J23A 3L9UA 5ECRB 4BL7A 1BEDA 3VI7A 2IWTA 2PU9C 5J3RA 2PERA 4DSRA 3WT1A 2H75A 4GSSA 1FHEA 2JU5A 1A23A 2AUSB 5JCWA 1LTLA 3Q19A 2V3BB 4MF7A 1EP7A 2FWGA 1BFYA 1XXUA 3VWWA 1K3YA 2O7KA 3HA9A 1EWXA 3TJFA 1IU6A 1O8XA 1S24A 3ZLPA 2G0FA 4JBBA 2YJHA 5ECHB 1NXGA 2A6HD 2LCQA 5ELAA 1SK2A 4HUAA 1T4ZA 5M5YL 2GZZA 3GL3A 3PZAA 2HE3A 2K6VA 3C1RA 5LD0A 3IA1A 2R0GA 3GH9A 1Y6EA 4PQHA 3M4OL 2YPMA 1Z7PA 1IROA 3F4RA 1P7PA 1SMUA 3FR3A 5GAPD 1B9YC 1USBA 1RDVA 2N5FA 3O3TA 2DC5A 1T8EB 3QPMA 3IU3I 2K8VA 3QR6A 4I2TA 5ID2A 1EV4A 4PNFA 2L5OA 2NVQL 1ERVA 4Z2TA 3BCKA 2WB1P 3IC8A 2GQMA 5F07A 4IELA 2DKHA 1O7UA 3CTGA 2VCXA 1YV1A 3HJYB 1M9BA 5DM61 3ERGA 3E0UA 4N30A 2FNOA 1SMWA 1ZYEA 2O8VB 1TI1A 1FB0A 5CRHA 3UBLA 2DJJA 2LEGA 2R37A 3TJJA 1SMMA 4KW6A 1XFLA 5GAGc 4Z2UA 1TU8A 3HZ4A 1NW2A 3L4NA 5A4VA 4L0UA 1PFYA 2V1MA 4O5RA 4TXVA 4X1UA 5HFGA 3VWXA 4DSSA 1N2AA 4AJ6A 5BMUA 1H4OA 1XWKA 2PSMC 3F4SA 3MSZA 1GTAA 3C7MA 3D0ZA 3VWUA 2B63L 5DM71 1FG4A 1PL1A 4K7NA 2HSHA 4OMVA 4CY8A 2OA7A 3LGCA 3K35A 2PN8A 2X8GA 4MF5A 4KE3A 3KYXA 3VFIA 3RZTA 3QAVA 4K5RA 4BVXA 3D21A 4TKYA 5GAEc 5IO0A 4TW5A 2VCVA 3GKKA 2WAQP 2OKAA 1EGRA 3GTML 2BE5D 5DBQA 3TJKA 4PX1A 9GSSA 2NTOA 3L0HA 1JZRA 3GTUB 4IKHA 5AN1A 1VF4A 3D4MA 3DGQA 3ZMLA 4D73A 1AQVA 3HJWB 1YQ1A 4JU5A 1H7VA 4PUAA 1A24A 2IMDA 2P5RA 4O5UA 5MFZA 1Q4JA 2L6CA 1SYXA 5D9VA 3DRNA 5M5XL 3DYRA 5J41A 3IAS2 1DE1A 4ZXGA 4HOJA 4EVMA 1OYJA 1URMA 5MGNA 4GWRA 1ZRPA 3MQKB 3LWRB 1R0HA 3RPNA 3ZRDA 4BBSL 3TRXA 1AQXA 17GSA 2JACA 2X8CA 2YCDA 1FOHA 1C72A 4C3HL 1GSFA 1AC1A 4WKWA 4EIQA 2R0PA 3WWNB 4ZB6A 1BE7A 5DJMA 3RPPA 2QSIA 5CRWA 5ECIB 5G30A 1XVWA 3H8QA 2YNXA 2LJAA 1K0DA 4FO5A 1UVZA 4V2LA 2E2IL 3IAM2 3GA4A 1N8JA 3WWLA 4I6XA 1ZMAA 4BWSA 2GT6A 4PQ1A 2XJQA 2IN3A 1WOUA 2IIYA 5M3FL 2I81A 5KN1A 4O92A 1K83L 5G1LA 2VD1A 2H1BA 2CX4A 4F2IA 1AIUA 5G5FA 4AI3A 1LKMA 1PQNA 3PGTA 1MTCA 1F3BA 5LCZA 4A3LL 2DJ2A 3VURA 4MA9A 5J9BA 2LRTA 4BBRL 2YN1A 1A0FA 1R4WA 2CV4A 4A3BL 2YOIA 2B6MA 3P8BA 2FA8A 4OCFA 5D9TA 2K9FA 1FO5A 2B3SA 4V2MA 5D8IA 1MDJA 2R4VA 3H9BA 3G7YA 2KLXA 3EE2A 5HFKA 3H97A 1K0OA 2XPEA 2YJ7A 4GQCA 1V40A 1I5GA 2WS2A 2JADA 3MNGA 1FVJA 3R2QA 1W4VA 4NXIA 2VL3A 1IW7D 2A68D 4CW9A 1EOGA 3PKJA 1V2AA 1XIYA 3TJGA 3F8UA 1T9PA 4LLRA 3C8EA 1TP9A 3QD9A 1EOHA 5IM9A 4QIWP 5B8AA 2LV3A 2CAIA 3HCZA 1B2JA 3GN3A 2NDOA 1MEKA 3PL5A 1EZKA 4AHWA 4FIWA 3G7JA 2PVQA 2N5BA 4B8CD 2DMMA 1ABAA 4Z7XA 3ZL5A 4OD7A 2IL3A 3MWHA 1GSSA 3HY2A 3S9FA 4IJ3A 3S14L 4YWLA 2YZUA 1NNQA 1FOVA 5DCHA 4HJMA 5MLC3 4BY1L 1TWHL 2B5YA 1TI3A 3TKRA 2C6BA 4MDCA 1R5AA 2JSYA 1JYBA 3FZ9A 1T4YA 5A4WA 3SWLA 4TR1A 4AHYA 1R0JA 2ZNMA 3KGKA 3DKSA 5AGYA 3B0AB 3MPSA 3K8NA 5BRTA 1QMVA 1ERUA 4XS4B 3HOZL 1BRFA 5INYA 5DAKB 4BL7B 1WJVA 3WD6A 3CQZL 3W8SA 3U6VA 1F37A 1EEMA 1B9XC 3VPBE 2FUG2 3GSSA 1A2LA 2B1KA 3FR6A 1I50L 1TWGL 5C3EL 2GQKA 4I2UA 1YK4A 3ZTLA 2RLIA 4AJ7A 1QCVA 4I8BA 2OADA 3ZIVA 2O5JD 3O6TA 1WPIA 1J9BA 3CRUA 3S1NL 5FHIA 2HFDA 2E2GA 2ERJA 3QMXA 1XOBA 3A3TA 3H93A 1ZGNA 4MP4A 1M2AA 4TR4A 3KD0A 3WGXA 1K0NA 4ML1A 3I6AA 3HAXC 18GSA 3KMOA 5IOWA 3IHQA 2IMIA 2MMNA 2DSAA 4G10A 3QDNA 2HLSA 1G0TA 2WGRA 2JA6L 1IU5A 6RXNA 3PH9A 1HNBA 3QFAC 5ECMB 4EDYA 1GTBA 3KH9A 2DJ3A 2QL0A 1K0MA 1TWCL 5ID2B 5IQYA 1LU4A 2XBQA 4KAEA 3JR7A 2DJ0A 3ME8A 1GP1A 3M8NA 4XTSA 4Q5RA 3PR8A 3TRQA 2B7JA 2MYGA 4ZL7A 5H5QA 3J7Yk 1CQGA 3RZOL 1TTZA 4YKGA 1SJZA 4YAPA 1Z7RA 2H73A 3KEBA 4ZBBA 4TVMA 3GUSA 5C04A 1VZHA 3KTLA 2OJLA 2KKDA 3H0GL 2TRCP 3FK8A 2QKEA 1B13A 3PIO1 1JZOA 5HR3A 2A69D 2IMFA 1X9MB 5CNWA 5IPHA 2WRTA 3HJMA 2H66A 3FDJA 4K9FA 2AB6A 2HSYA 3H3VM 1SJIA 2HRNA 4IP1A 4BY7L 2DIYA 1XWGA 3ZREA 4A3KL 2XJTA 2A6ED 4BVYB 1VF3A 3HKZP 2JL4A 5GSTA 1TK8B 1O81A 1V9WA 5IMAA 2HRKA 5MF6A 1TRSA 4NWYA 3GL5A 3RZ6A 2H30A 1T9QA 4DSSB 1RQMA 2C0EA 1GLQA 2HVYC 2RDVA 1XBSA 1YDKA 1MD3A 2H76A 4V196 5IMDA 1TDIA 4MH3A 1Y1VL 4WFN1 3GURA 2M4VA 4ZIJA 4KH7A 3H99A 3PPUA 1GNWA 3I69A 3FRCA 4EO3A 4U671 2H01A 1EV9A 4I97A 5IP9L 4AR5A 3IBHA 2A2SA 4X4JA 1UA5A 4C3IL 3IK7A 4MJAA 4LL4B 3J7Z1 1AUCA 4POFA 3ED3A 3US3A 4BVXB 1QUWA 1G6YA 2NPBA 5IO2A 2V6KA 3CRTA 5AIXA 3FZAA 3UEMA 4ZN1B 3NOFA 2VL2A 1GTIA 4ZL9A 4K6XA 3KYYA 3PINA 2Z9SA 2XBIA 4WR4A 2O85A 1R0GA 3QFBC 3FMWA 3N9JA 5HR0A 1TOFA 3WT2A 5C4XL 4Q5NA 2NVTL 4D73B 3ERWA 2XJSA 1GSEA 3M3MA 4K0GA 4E8HA 1SL2B 2UZ8A 1TWFL 4IQAA 1PN0A 3KYWA 5HFIA 1SFOL 1TKDB 3TKQA 4MPFA 3DVWA 3KCMA 5E59A 3JCML 2CAQA 2DJKA 4UY81 1MD4A 2M6OA 5ECSA 4MABA 4WF5A 1Z6NA 2YV9A 3AY8A 4MZWA 1G7OA 2E2HL 5A4UA 5IP7L 2KP1A 1GL8A 1M0UA 4AR6A 3KTBA 2X99A 4RXNA 2GDRA 1THXA 4XRAA 1T00A 2VIMA 2JZSA 2WULA 2NVYL 3CSHA 5HR2A 2OE0A 2MMOA 1RYQA 1PL2A 5CRGA 1BAYA 1GSUA 3IR4A 3KXOA 4ID0A 1F2EA 1X5CA 1ZYPA 4QQ7A 2O89A 4YKFA 2I4AA 2A4VA 1X9SB 3H1NA 1YUZA 4WR5A 5COHA 2JSZA 2QC7A 2G2QA 5G1KA 1VF1A 3FR9A 2JI1A 5M5WL 4A3JL 2AAWA 5FJ8L 3LWVB 4LMVA 3V1WA 4L0WA 1XPVA 4FYCA 1S3RA 4K1FA 2F51A 4ICYA 1GNEA 1DUGA 1OC3A 1YY7A 1V58A 4DSQA 2VCQA 3IXRA 4X0XA 3PIP1 4POGA 1QK8A 1F3AA 2CZ2A 2J9UB 3GTPL 4EC0A 1YK5A 1SD9A 4BVYA 1GH2A 3I9V2 4ZB8A 5JWRB 2C0FA 2OACA 1ZCPA 1OAZA 4JAEA 4G0IA 4K7IA 4OFTA 4YQUA 1SL0B 1KTEA 4IP6A 3A5WA 5JVG1 1XW6A 3GTOL 3KP8A 2OE1A 3ZVJA 1SK0A 3NIVA 3SBCA 1YF0A 1YUXA 1XWCA 4WBJA 5ECLB 2C1YA 1HD2A 4V1Ap 1PFOA 2R0CA 3GHAA 3LWAA 2FWEA 4TPUA 2TRXA 2CKCA 2FLSA 1EGOA 4JAFA 3F3RA 3S17L 1WIKA 2AV4A 3RHBA 4KCEA 1IYHA 3J7Y1 2D2ZA 1BYEA 3KIJA 3J7Yb 2NVXL 4MF6A 2M46A 3C73A 1VRSD 3MAKA 11GSA 2XPDA 1GSQA 5KOXA 5G5EA 1ML6A 5EY6A 2K2DA 1U87A 1SENA 1YZXA 3UARA 3HXSA 2ON7A 1CADA 4N11A 2KN9A 2A2PA 5K2ME 2LNSA 3WGEA 3GV1A 1JLWA 5EIOC 3ZG6A 2HXKA 2P31A 3HKRA 3VLNA 1LKOA 1UC7A 2VO4A 1LKPA 4E8EA 1XW9A 5D9WA 1W89A 4O7HA 4TOPA 1PFWA 4TR1B 6GSYA 4X6AL 6GSWA 2FGXA 1HNAA 2PVOC 3APOA 4MMMA 3L9VA 1M2DA 4P3YB 2QA1A 3W8JA 3HVSA 4RI7A 13GSA 5JCUA 1PFUA 4J56E 3QVDA 5D96A 5H5RA 3TKSA 2MBSA 4KSMA 1TK5B 3LWPB 4A5PA 5DQSA 5EVOA 3GKNA 3GKXA 2H8LA 4RUVA 3NFPI 1KEBA 2K8SA 1Z5YE 2YWOA 3FHKA 1PA3A 3CMIA 2VCTA 2AYJA 3UVHA 3BD2A 8GSSA 3UVTA 2RFKB 5F8BA 2L6DA 1PRXA 4HDEA 3G7IA 4XXBB 2I9HA 3TOUA 5CAXA 4OWYA 1ODHA 1G6WA 4WEYA 3CSJA 2NVLA 4GCIA 4IW9A 4TR0A 2ON5A 1H75A 3IE3A 1VCXA 1EP8A 3GYKA 4TR3A 2CVDA 5D93A 4IJIA 4XGHA 4K2XA 4N0ZA 2ES7A 3EPTA 4IQ1A 1TRVA 4MLYA 2CKAA 5DQYA 3WYWA 2GSSA 2AQCA 1S3DA 2GTUA 2GMGA 4IVFA 2H0HA 4OO4A 1YJ6A 3LXZA 1M3JA 4JEDA 4TXOB 1JLVA 1ZOFA 1XCCA 3EVIA 4LHLA 5EINC 3LORA 3IC4A 3NZNA 4HEA2 4BIKA 4WXTA 5DCGA 5CO3A 3WGDA 3HOVL 3KM6A 3HHVA 1Q98A 1TRUA 3PO3L 1SKSB 2PVEA 2CVKA 4DEJA 4GS7D 5GSSA 3HVVA 3D4TA 2LRCA 3C71A 2YWNA 2LRNA 4KDUA 1SU9A 3A5IA 3HOUL 2C4JA 2HRFA 2RM5A 4JE1A 3MYDA 4X43A 2C80A 4RI6A 1XG8A 4USSA 3P7XA 4XS1A 5IMZA 2AYTA 1WE0A 1V57A 2HR5A 2C3TA 3HVXA 2AHEA 3TRPA 3UAPA 1J08A 3FZ4A 2RUFA 4A3DL 2YV7A 4PQIA 2HZEA 4AI1A 2JZTA 5AI3A 3ISOA 2XHFA 1SKWB 1OKTA 2IFQA 4BA7A 4NV5A 4HZ4A 2H19A 4G0LA 3KJYA 1PX7A 4HQZA 2M80A 1DBYA 4IBPA 2F3MA 1CQHA 4FYBA 4K9ZA 5L71A 2XJPA 2F8FA 5GZZB 1JZDA 4NMUA 3CQFA 1XWAA 4MJBA 3UMAA 1O6JA 3BBYA 2VLTA 2MMAA 4HZ2A 5LNKe 3CSIA 2R2JA 2XJRA 3CTFA 3OR5A 4ZILA 1B71A 2DBCA 5FWGA 2HZFA 2MMZA 4GSNA 2FWFA 3ME7A 4L5LA 7RXNA 4L8EA 3LFLA 2GLRA 3F9UA 1Y1WL 4DVCA 1FHHA 6GSXA 1K3OA 3LSZA 1FAAA 3G9BA 3M3YL 12GSA 4G2EA 2R6KA 3APQA 1TWAL 1RYTA 3LPEB 3HD5A 2XJVA 1LJRA 2L5LA 1T1VA 2REMA 3D5JA 4EXJA 1ZZYA 3TKSE 2H0IA 2JZRA 4MK3A 1SL1B 2HYXA 2DKIA 1GUMA 3IRAA 1F9MA 3A2WA 4BWQA 2YWIA 2VM1A 3ZYWA 4HU9A 14GSA 2LNTA 4N10A 4A3EL 3RZDL 2H6ZA 2KP2A 5DALA 1UN2A 2WJUA 3EWLA 4MPGA 3RAZA 3GTLL 1TRWA 3LYKA 5HR1A 4GXZA 1AXDA 1B48A 1ILOA 1I3QL 3QOUA 5ECQB 3HYPA 3IV4A 4TXOA 1R5PA 3ZIJA 2LSTA 4K0NA 2V0FA 3GTKL 1R26A 2C0GA 1DSBA 1M7TA 1O85A 3LG6A 3HDCA 1BJXA 19GSA 3HOYL 1T3BA 1KBNA 3VPTA 4HJ2A 2E0QA 1C09A 1F6MC 4F0CA 5C00A 4MZBA 3FY7A 3M1GA 4LMWA 1TW9A 3D22A 1NXEA 3LJRA 2JA8L 4MCUA 4XCSA 1O8WA 4KCAA 1CAAA 4L5OA 3L78A 2B7KA 2ZUPA 1B2OA 4PURA 4TN8A 2A2RA 2M6PA 1S3CA 3KYVA 3LNLA 4KA0A 3PO2L 1ERWA 2Y0SP 2PMTA 3VK9A 4ILFA 3QAGA 5KEJA 2ZCTA 2X4AA 2IMEA 2LJRA 1GTUA 4WF4A 1ZYNA 2M72A 4LL1B 5IOXA 1GSDA 3P2AA 1XW5A 2CZ3A 3TUEA 4ZB9A 4YQVA 3GTGL 4HQSA 4EDZA 3M9JA 2H0GA 2CQ9A 3S1RL 2H6XA 4GLTA 2LQQA 3F6FA 4O32A 1OWCA 1VZGA 4J57E 3RYGA 5JWQB 6GSSA 4AR3A 1GRXA 2VUML 1VF2A 1X5DA 1PFVA 5C4JL 3MIXA 4HS1A 5J9CA 3EMXA 4K5SA 5F06A 2VL2C 5KOWA 1KNGA 4EF0A 2A4HA 4POBA 3H9CA 5ECKB 4XS6A 2DIZA 1QQ2A 1R0FA 1G7EA 2GSRA 4G0KA 1GULA 3MSUA 1OC9B 2PGTA 4ZN3B 1ZL9A 2EY4E 5IYCL 1A8YA 1BX9A 2PMZP 3HJPA 1A2MA 3GTQL 3TCOA 1TJDA 4CY6A 2H1DA 4XRDA 2KHPA 3P90A 3VI5A 1V98A 4ISDA 3Q74A 4IHUA 4PNGA 1PGTA 2R3XA 3GKMA 4FH8A 2VL9A 3ZVJD 1QFNA 16GSA 1U6TA 2KOKA 1GWCA 3ZMKA 2M4YA 1OE7A 1U3IA 1HYUA 3QAWA 4ECIA 20GSA 1T9OA 1K0CA 3ZFBA 1IRNA 3DIEA 2FY6A 5B7CA 1SKRB 3F3QA 1QQTA 2Z3QB 4POKA 2WCIA 4EKZA 3TDGA 3F4TA 5EPFA 2GSTA 3GNJA 1E8JA 4ACSA 4HSCX 4E6YA 4RQRA 1Z92B 2N5AA 5IMCA 2R7ZL 1PZXA 3PKIA 3DEXA 4IGJA 3VPQA 3W6GA 4F0BA 3EC3A 3F6DA 4ECCA 1K3LA 2HSMA 4O5QA 2MZCA 1TXXA 2FCHA 3L9SA 3E3EA 5M3ML 3P8WA 2P5QA 3A2VA 3IPZA 3M0FA 4AI0A 3CXGA 2I3YA 5CP1A 5H1Sc 5JVH1 1AQWA 3GRXA 3GX8A 2L59A 1WP0A 5J4UA 2OBIA 2X64A 3IOSA 3GH6A 1M9AA 4F9ZA 2DJ1A 3KYUA 1OC8A 2V41A 3R3EA 2R93L 2V2GA 4AF2A 5D73A 2GQLA 1YEXA 1GSYA 5KN3A 2C3NA 1J0FA 2E2MA 4ECJA 1ZYQB 1OKDA 1THOA 2ALBA 4NHZA 2LQOA 1WWJA 2VAFA 4YH2A 2WFCA 4Q5FA 1QYBA 4JAGA 2IPAA 1K0BA 2PUKC 5EL8A 2VM2A 1SD8A 3IDVA 2FHEA 2V0EA 2HI7A 4KB3A 1VZIA 4MNNA 5IMVA 2E7PA 1GUHA 3MDKA 3QCPA 4KNDA 4POLA 1DVBA 1XOAA 4G19A 3EINA 1Z3EA 5A5KA 2RUEA 2VOCA 3I43A 2RIIA 4MJCA 5FLML 4RQXA 1MDIA 3LW9A 2NYDA 2EIOA 1DX8A 3UOMA 1F4LA 1M2BA 2HZEB 4CDOA 1OC9A 2EC4A 2I1UA 4MJEA 5ABRA 2CR8A 1BQ8A 2KUCA 4F82A 2F9SA 4AYBP 2Z3RB 2H72A 3H79A 2BTOT 4JR4A 4EL1A 2GZPA 2IFQB 1X0RA 3EYTA 1T7PB 1PSQA 1DE2A 3Q6OA 2IMKA 1A8LA 4QL7A 4A3ML 3LYPA 3D6IA 2MBTA 1E6BA 4KX4A 4I5QA 2VLUA 2L0ZA 3S1QL 3TB2A 1S3AA 3HZ8A 2JI3A 4ML6A 3DD3A 3I4NL 5AN9H 1LBKA 3APSA 5FT3A 1PD21 4AGSA 1JHBA 1A2JA 4AHZA 2BJXA 2FD3A 4JZQA 1ERTA 4LHNA 4Z2RA 3DWVA 1Z9HA 2PPTA 3E9JB 1NHOA 3ZITA 2CVBA 5J5NA 4BXXL 2H70A 4HU7A 4ME3A 4EIPA 3PWFA 1QXHA 2XC2A 8RXNA 3TKSC 5ECPB 3UIWA 2H6YA 1OWBA 4JRRA 2R92L 2V6OA 3FKIL 3FEUA 4TVEA 5DVBA 2YP6A 1BG5A 4KDYA 1GLPA 1R9TL 2PBJA 1RW1A 2WZ9A 2VLVA 5JWOB 3TGZA 2XJUA 5GAND 4KGIA 5IPGA 3B08B 3VWVA 3F63A 4IS0A 5DJLA 2V32A 3KMNA 5ECOB 3QQCE 3KP9A 4A3GL 1XVQA 4JR6A 3S2DL 6GSVA 3SS2A 2R5GA 5B6NA 3IK9A 2WB9A 2JI2A 1BQ7A 2LTKA 5DALB 1RK4A 2B5XA 1ST9A 2NBSA 3K7AL 5ELGA 4YQMA 4GQFA 3LQ7A 4NPBA 3HOWL 3KZQA 3O76A 3UJ1A 1FB6A 3FKFA 1ACVA 4OCEA 4GF0A 5GADc 1SJ6A 2YZHA 2VD0A 1HNCA 2CT6A 4A93L 1X9WB 1RB9A 2X49A 5G31A 3LEFA 3GTJL 3S2HL 3CBUA 3UBKA 1B4QA 1IYIA 1HQOA 4XIHA 1VGLA 3LWQB 1AAZA 1XWBA 2GS3A 2FWHA 4N0VA 4JADA 1RWDA 1NSWA 5CREA 4G6BA 2L57A 2C3QA 5CRDA 3Q18A 4G9HA 1FW1A 1A0RP 5KN2A 3LXTA 4ZBAA 5G2ZA 4NHWA 4XHMA 2C0DA 2DSXA 3GTUA 4C2M1 1TK0B 3FW2A 3HJOA 4NAXA 3GX0A 2C6AA 5C44L 3C1SA 4AJ8A 2GT5A 5B6MA 4BPYA 3ZZXA 2HT9A 1PKWA 2IJYA 5H5SA 3DXBA 1FVKA 1QGVA 4K8MA 3ERFA 3M9KA 4PTSA 4MH2A 1PN9A 1I6HL 1YKCA 1EEJA 3FYGA 5IMFA 1NHYA 1PKZA 2B5ID 1YF1A 3RHCA 1AW9A 2VCWA 1TU7A 2O87A 3GFKA 1B8XA 10GSA 2TIRA 4KDXA 2QA2A 2GGTA 2H74A 4V1Ag 1WMJA 1GUKA 4CHSA 4KUNA 2BMXA 3HOXL 1OE8A 2APOB 2C8UA 1ON4A 6GSTA 2EIRA 5CYYA 3RDWA 4PXOA 3N5OA 3TJBA 4OO5A 7GSSA 1SK1A 2GVPA 2ERSA 2QGVA 2YU9L 1JZWA 3CYNA 3A2XA 3GIXA 1NM3A 4IN0A 5IY0A 3A44A 5B8BA 2DLXA 1B4PA 3TOTA 1S2ZA 1M3IA 1S30A 4AHXA 4K2DA 1PX6A 4A3CL 3GMFA 4NV2A 5AISA 4OFMA 5GAHc 2X8HA 4A3IL 5HQPA 1MDKA 3HVNA 1R7HA 5RXNA 3H4KA 2LS5A 4OFNA 2P0GA 1BQ9A 5E4WA 5ENUA 22GSA 3DMLA 2VCZA 3KH7A 4ECBA 4YWMA 3S15L 5ECNB 3TKPA 5IIZA 4ZL8A 2H71A 4ULXA 1YKAA 2OE3A 2LJKA 4KF9A 1PMTA 3EU3A 1SYRA 2WDUA 5IYDL 3FZ5A 4V2NA 5D9XA 2PVXA 3ZFLA 4J2FA 2CA8A 1OVNA 1Z6MA 1K0AA 2GSQA 4AI2A 1YEPA 4GTUA 4EUYA 2RM6A 4PGTA 2AJQB 2HNLA 4A3FL 4F03A 4LA1A 3I4ML 2B1LA 4QL9A 4K7OA 2MS3A 1JFUA 2E2JL 2AUVA 4HI7A 1WCML 1E2YA 4FQUA 4H86A 4POMA 1RDGA 2FA4A 4FYUA 1FHMA 4WETA 1M99A 2H12A 5KN0A 3S1ML 4Y52L 3IHGA 2YWMA 1U3AA 5AIVA 2LKUA 4YAVA 3U5RE 3EU4A 2JA5L 3EMPA 3BJ5A 1U88A 2EIQA 4AR4A 2L4QA 2F8AA 4Q5QA 5F05A 2VUPA 4WBRD
chains in the Genus database with same CATH topology
4GSTA 3GSTA 2J9HA 1WJKA 3UL3A 1XZOA 1O73A 4TRXA 2ZIXA 1Y25A 1X5EA 2HRAA 2DMLA 3F0IA 4EE0A 2VL6A 2B5EA 1R0IA 2LUSA 5JCGA 5MFPA 5AI2A 2YANA 2PWJA 4MZCA 2PYAA 2GZYA 2OBKA 4PUFC 3RBTA 1WRYA 2CX3A 4GRFA 3BOAA 2H1GA 4KSOA 5F0GA 1I9DA 3DVXA 6GSUA 2L4CA 4XS4A 5DDLA 2H1AA 3BCIA 3EURA 4ZBDA 2K18A 5DAKA 5ECRB 2J23A 3L9UA 4BL7A 1BEDA 3VI7A 2IWTA 2PU9C 5J3RA 2PERA 4DSRA 3WT1A 2H75A 4GSSA 1FHEA 2JU5A 1A23A 5JCWA 1LTLA 3Q19A 2V3BB 4MF7A 1EP7A 2FWGA 1BFYA 1XXUA 3VWWA 1K3YA 2O7KA 3HA9A 1EWXA 3TJFA 1IU6A 1O8XA 1S24A 3ZLPA 2G0FA 4JBBA 2YJHA 5ECHB 1NXGA 2A6HD 2LCQA 5ELAA 1SK2A 4HUAA 1T4ZA 2GZZA 3GL3A 3PZAA 2HE3A 2K6VA 3C1RA 5LD0A 3IA1A 2R0GA 3GH9A 1Y6EA 4PQHA 2YPMA 1Z7PA 1IROA 3F4RA 1SMUA 3FR3A 5GAPD 1B9YC 1USBA 1RDVA 2N5FA 3O3TA 2DC5A 1T8EB 3QPMA 3IU3I 2K8VA 3QR6A 4I2TA 5ID2A 1EV4A 4PNFA 2L5OA 1ERVA 4Z2TA 3BCKA 3IC8A 2GQMA 5F07A 4IELA 2DKHA 1O7UA 3CTGA 2VCXA 1YV1A 1M9BA 5DM61 3ERGA 3E0UA 4N30A 2FNOA 1SMWA 1ZYEA 2O8VB 1TI1A 1FB0A 5CRHA 3UBLA 2DJJA 2LEGA 2R37A 3TJJA 1SMMA 4KW6A 1XFLA 5GAGc 4Z2UA 1TU8A 3HZ4A 1NW2A 3L4NA 5A4VA 4L0UA 2V1MA 4O5RA 4TXVA 4X1UA 5HFGA 3VWXA 4DSSA 1N2AA 4AJ6A 5BMUA 1H4OA 1XWKA 2PSMC 3F4SA 3MSZA 1GTAA 3C7MA 3D0ZA 3VWUA 5DM71 1FG4A 1PL1A 4K7NA 2HSHA 4OMVA 4CY8A 2OA7A 3LGCA 3K35A 2PN8A 2X8GA 4MF5A 4KE3A 3KYXA 3VFIA 3RZTA 3QAVA 4K5RA 4BVXA 3D21A 4TKYA 5GAEc 5IO0A 4TW5A 2VCVA 3GKKA 2OKAA 1EGRA 2BE5D 5DBQA 3TJKA 4PX1A 9GSSA 2NTOA 3L0HA 1JZRA 3GTUB 4IKHA 5AN1A 1VF4A 3D4MA 3DGQA 3ZMLA 4D73A 1AQVA 1YQ1A 4JU5A 1H7VA 4PUAA 1A24A 2IMDA 2P5RA 4O5UA 5MFZA 1Q4JA 2L6CA 1SYXA 5D9VA 3DRNA 3DYRA 5J41A 3IAS2 1DE1A 4ZXGA 4HOJA 4EVMA 1OYJA 1URMA 5MGNA 4GWRA 1ZRPA 1R0HA 3RPNA 3ZRDA 3TRXA 1AQXA 17GSA 2JACA 2X8CA 2YCDA 1FOHA 1C72A 1GSFA 1AC1A 4WKWA 4EIQA 2R0PA 3WWNB 4ZB6A 1BE7A 5DJMA 3RPPA 2QSIA 5CRWA 5ECIB 5G30A 1XVWA 3H8QA 2YNXA 2LJAA 1K0DA 4FO5A 1UVZA 4V2LA 3IAM2 3GA4A 1N8JA 3WWLA 4I6XA 1ZMAA 4BWSA 2GT6A 4PQ1A 2XJQA 2IN3A 1WOUA 2IIYA 2I81A 5KN1A 4O92A 5G1LA 2VD1A 2H1BA 2CX4A 4F2IA 1AIUA 5G5FA 4AI3A 1LKMA 1PQNA 3PGTA 1MTCA 1F3BA 5LCZA 2DJ2A 3VURA 4MA9A 5J9BA 2LRTA 2YN1A 1A0FA 1R4WA 2CV4A 2YOIA 2B6MA 3P8BA 2FA8A 4OCFA 5D9TA 2K9FA 1FO5A 2B3SA 4V2MA 5D8IA 1MDJA 2R4VA 3G7YA 2KLXA 3EE2A 5HFKA 1K0OA 2XPEA 2YJ7A 4GQCA 1V40A 1I5GA 2WS2A 2JADA 3MNGA 1FVJA 3R2QA 1W4VA 4NXIA 2VL3A 1IW7D 2A68D 4CW9A 1EOGA 3PKJA 1V2AA 1XIYA 3TJGA 3F8UA 1T9PA 4LLRA 3C8EA 1TP9A 3QD9A 1EOHA 5IM9A 5B8AA 2LV3A 2CAIA 3HCZA 1B2JA 3GN3A 2NDOA 1MEKA 1EZKA 4AHWA 4FIWA 3G7JA 2PVQA 2N5BA 4B8CD 2DMMA 1ABAA 4Z7XA 3ZL5A 4OD7A 2IL3A 3MWHA 1GSSA 3HY2A 3S9FA 4IJ3A 4YWLA 2YZUA 1NNQA 1FOVA 5DCHA 4HJMA 5MLC3 2B5YA 1TI3A 3TKRA 2C6BA 4MDCA 1R5AA 2JSYA 1JYBA 3FZ9A 1T4YA 5A4WA 3SWLA 4TR1A 4AHYA 1R0JA 2ZNMA 3KGKA 3DKSA 5AGYA 3B0AB 3MPSA 3K8NA 5BRTA 1QMVA 1ERUA 4XS4B 1BRFA 5INYA 5DAKB 4BL7B 1WJVA 3WD6A 3W8SA 3U6VA 1F37A 1EEMA 1B9XC 3VPBE 2FUG2 3GSSA 1A2LA 2B1KA 3FR6A 2GQKA 4I2UA 1YK4A 3ZTLA 2RLIA 4AJ7A 1QCVA 4I8BA 2OADA 3ZIVA 2O5JD 3O6TA 1WPIA 1J9BA 3CRUA 5FHIA 2HFDA 2E2GA 2ERJA 3QMXA 1XOBA 3A3TA 3H93A 1ZGNA 4MP4A 1M2AA 4TR4A 3KD0A 3WGXA 1K0NA 4ML1A 3I6AA 3KMOA 18GSA 5IOWA 3IHQA 2IMIA 2MMNA 2DSAA 4G10A 3QDNA 2HLSA 1G0TA 2WGRA 1IU5A 6RXNA 3PH9A 1HNBA 3QFAC 5ECMB 4EDYA 1GTBA 3KH9A 2DJ3A 2QL0A 1K0MA 5ID2B 5IQYA 1LU4A 2XBQA 4KAEA 2DJ0A 3ME8A 1GP1A 3M8NA 4XTSA 4Q5RA 3PR8A 3TRQA 2B7JA 2MYGA 4ZL7A 5H5QA 3J7Yk 1CQGA 1TTZA 4YKGA 1SJZA 4YAPA 1Z7RA 2H73A 3KEBA 4ZBBA 4TVMA 3GUSA 5C04A 1VZHA 3KTLA 2OJLA 2KKDA 2TRCP 3FK8A 2QKEA 1B13A 3PIO1 1JZOA 5HR3A 2A69D 2IMFA 1X9MB 5CNWA 5IPHA 2WRTA 3HJMA 2H66A 4K9FA 2AB6A 2HSYA 1SJIA 2HRNA 4IP1A 2DIYA 1XWGA 3ZREA 2XJTA 2A6ED 4BVYB 1VF3A 2JL4A 5GSTA 1TK8B 1O81A 1V9WA 5IMAA 2HRKA 5MF6A 1TRSA 4NWYA 3GL5A 3RZ6A 2H30A 1T9QA 4DSSB 1RQMA 2C0EA 1GLQA 2RDVA 1XBSA 1YDKA 1MD3A 2H76A 4V196 5IMDA 1TDIA 4MH3A 4WFN1 3GURA 2M4VA 4ZIJA 4KH7A 3PPUA 1GNWA 3I69A 3FRCA 4EO3A 4U671 2H01A 1EV9A 4I97A 4AR5A 3IBHA 2A2SA 4X4JA 1UA5A 3IK7A 4MJAA 4LL4B 3J7Z1 1AUCA 4POFA 3ED3A 3US3A 4BVXB 1QUWA 1G6YA 2NPBA 5IO2A 2V6KA 3CRTA 5AIXA 3FZAA 3UEMA 4ZN1B 3NOFA 2VL2A 1GTIA 4ZL9A 4K6XA 3KYYA 3PINA 2Z9SA 2XBIA 4WR4A 2O85A 1R0GA 3QFBC 3FMWA 3N9JA 5HR0A 1TOFA 3WT2A 4Q5NA 4D73B 3ERWA 2XJSA 1GSEA 3M3MA 4K0GA 4E8HA 1SL2B 2UZ8A 4IQAA 1PN0A 3KYWA 5HFIA 1TKDB 3TKQA 4MPFA 3DVWA 3KCMA 5E59A 3JCML 2CAQA 2DJKA 4UY81 1MD4A 2M6OA 5ECSA 4MABA 4WF5A 1Z6NA 2YV9A 3AY8A 4MZWA 1G7OA 5A4UA 2KP1A 1GL8A 1M0UA 4AR6A 3KTBA 2X99A 4RXNA 2GDRA 1THXA 4XRAA 1T00A 2VIMA 2JZSA 2WULA 3CSHA 5HR2A 2OE0A 2MMOA 1RYQA 1PL2A 5CRGA 1BAYA 1GSUA 3IR4A 3KXOA 4ID0A 1F2EA 1X5CA 1ZYPA 4QQ7A 2O89A 4YKFA 2I4AA 2A4VA 1X9SB 3H1NA 1YUZA 4WR5A 5COHA 2JSZA 2QC7A 2G2QA 5G1KA 1VF1A 3FR9A 2JI1A 2AAWA 4LMVA 3V1WA 4L0WA 1XPVA 4FYCA 4K1FA 2F51A 4ICYA 1GNEA 1DUGA 1OC3A 1YY7A 1V58A 4DSQA 2VCQA 3IXRA 4X0XA 3PIP1 4POGA 1QK8A 1F3AA 2CZ2A 2J9UB 4EC0A 1YK5A 1SD9A 4BVYA 1GH2A 3I9V2 4ZB8A 5JWRB 2C0FA 2OACA 1ZCPA 1OAZA 4JAEA 4G0IA 4K7IA 4OFTA 4YQUA 1SL0B 1KTEA 4IP6A 3A5WA 5JVG1 1XW6A 3KP8A 2OE1A 3ZVJA 1SK0A 3NIVA 3SBCA 1YF0A 1YUXA 1XWCA 4WBJA 5ECLB 2C1YA 1HD2A 4V1Ap 2R0CA 3GHAA 3LWAA 2FWEA 4TPUA 2TRXA 2CKCA 2FLSA 1EGOA 4JAFA 3F3RA 1WIKA 2AV4A 3RHBA 4KCEA 1IYHA 3J7Y1 2D2ZA 1BYEA 3KIJA 3J7Yb 4MF6A 2M46A 3C73A 1VRSD 3MAKA 11GSA 2XPDA 1GSQA 5KOXA 5G5EA 1ML6A 5EY6A 2K2DA 1U87A 1SENA 1YZXA 3UARA 3HXSA 2ON7A 1CADA 4N11A 2KN9A 2A2PA 5K2ME 2LNSA 3WGEA 3GV1A 1JLWA 5EIOC 3ZG6A 2HXKA 2P31A 3HKRA 3VLNA 1LKOA 1UC7A 2VO4A 1LKPA 4E8EA 1XW9A 5D9WA 1W89A 4O7HA 4TOPA 4TR1B 6GSYA 6GSWA 2FGXA 1HNAA 2PVOC 3APOA 4MMMA 3L9VA 1M2DA 4P3YB 2QA1A 3W8JA 3HVSA 4RI7A 13GSA 5JCUA 4J56E 3QVDA 5D96A 5H5RA 3TKSA 2MBSA 4KSMA 1TK5B 4A5PA 5DQSA 5EVOA 3GKNA 3GKXA 2H8LA 4RUVA 3NFPI 1KEBA 2K8SA 1Z5YE 2YWOA 3FHKA 1PA3A 3CMIA 2VCTA 2AYJA 3UVHA 3BD2A 8GSSA 3UVTA 5F8BA 2L6DA 1PRXA 4HDEA 3G7IA 4XXBB 2I9HA 3TOUA 5CAXA 4OWYA 1ODHA 1G6WA 4WEYA 3CSJA 2NVLA 4GCIA 4IW9A 4TR0A 2ON5A 1H75A 3IE3A 1VCXA 1EP8A 3GYKA 4TR3A 2CVDA 5D93A 4IJIA 4XGHA 4K2XA 4N0ZA 2ES7A 3EPTA 4IQ1A 1TRVA 4MLYA 2CKAA 5DQYA 3WYWA 2GSSA 1S3DA 2GTUA 2GMGA 4IVFA 2H0HA 4OO4A 1YJ6A 3LXZA 4JEDA 4TXOB 1JLVA 1ZOFA 1XCCA 3EVIA 4LHLA 5EINC 3LORA 3IC4A 3NZNA 4HEA2 4WXTA 5DCGA 5CO3A 3WGDA 3KM6A 3HHVA 1Q98A 1TRUA 1SKSB 2PVEA 2CVKA 4DEJA 4GS7D 5GSSA 3HVVA 3D4TA 2LRCA 3C71A 2YWNA 2LRNA 4KDUA 1SU9A 3A5IA 2HRFA 2C4JA 2RM5A 4JE1A 3MYDA 4X43A 2C80A 4RI6A 4USSA 3P7XA 4XS1A 5IMZA 2AYTA 1WE0A 1V57A 2HR5A 2C3TA 3HVXA 2AHEA 3TRPA 3UAPA 1J08A 3FZ4A 2RUFA 2YV7A 4PQIA 2HZEA 4AI1A 2JZTA 5AI3A 3ISOA 2XHFA 1SKWB 1OKTA 2IFQA 4BA7A 4NV5A 4HZ4A 2H19A 4G0LA 3KJYA 1PX7A 4HQZA 2M80A 1DBYA 4IBPA 2F3MA 1CQHA 4FYBA 4K9ZA 5L71A 2XJPA 2F8FA 5GZZB 1JZDA 4NMUA 1XWAA 4MJBA 3UMAA 1O6JA 3BBYA 2VLTA 2MMAA 4HZ2A 5LNKe 3CSIA 2R2JA 2XJRA 3CTFA 3OR5A 4ZILA 1B71A 2DBCA 5FWGA 2HZFA 2MMZA 4GSNA 2FWFA 3ME7A 4L5LA 7RXNA 4L8EA 3LFLA 2GLRA 3F9UA 4DVCA 1FHHA 6GSXA 1K3OA 3LSZA 1FAAA 3G9BA 12GSA 4G2EA 2R6KA 3APQA 1RYTA 3LPEB 3HD5A 2XJVA 1LJRA 2L5LA 1T1VA 2REMA 3D5JA 4EXJA 1ZZYA 3TKSE 2H0IA 2JZRA 4MK3A 1SL1B 2HYXA 2DKIA 1GUMA 3IRAA 1F9MA 3A2WA 4BWQA 2YWIA 2VM1A 3ZYWA 4HU9A 14GSA 2LNTA 4N10A 2H6ZA 2KP2A 5DALA 1UN2A 2WJUA 3EWLA 4MPGA 3RAZA 5HR1A 1TRWA 3LYKA 4GXZA 1AXDA 1B48A 1ILOA 3QOUA 5ECQB 3HYPA 3IV4A 4TXOA 1R5PA 3ZIJA 2LSTA 4K0NA 2V0FA 1R26A 2C0GA 1DSBA 1M7TA 3LG6A 1O85A 3HDCA 1BJXA 19GSA 1T3BA 1KBNA 3VPTA 4HJ2A 2E0QA 1C09A 1F6MC 4F0CA 5C00A 4MZBA 3FY7A 3M1GA 4LMWA 1TW9A 3D22A 1NXEA 3LJRA 4MCUA 4XCSA 1O8WA 4KCAA 1CAAA 4L5OA 3L78A 2B7KA 2ZUPA 1B2OA 4PURA 4TN8A 2A2RA 2M6PA 1S3CA 3KYVA 3LNLA 4KA0A 1ERWA 2PMTA 3VK9A 4ILFA 3QAGA 5KEJA 2ZCTA 2X4AA 2IMEA 2LJRA 1GTUA 4WF4A 1ZYNA 2M72A 4LL1B 5IOXA 1GSDA 3P2AA 1XW5A 2CZ3A 3TUEA 4ZB9A 4YQVA 4HQSA 4EDZA 3M9JA 2H0GA 2CQ9A 2H6XA 4GLTA 2LQQA 3F6FA 4O32A 1OWCA 1VZGA 4J57E 3RYGA 5JWQB 6GSSA 4AR3A 1GRXA 1VF2A 1X5DA 3MIXA 4HS1A 5J9CA 3EMXA 4K5SA 5F06A 2VL2C 5KOWA 1KNGA 4EF0A 2A4HA 4POBA 5ECKB 4XS6A 2DIZA 1QQ2A 1R0FA 1G7EA 2GSRA 4G0KA 1GULA 3MSUA 1OC9B 2PGTA 4ZN3B 1ZL9A 1A8YA 1BX9A 3HJPA 1A2MA 3TCOA 1TJDA 4CY6A 2H1DA 4XRDA 2KHPA 3P90A 3VI5A 1V98A 4ISDA 3Q74A 4IHUA 4PNGA 1PGTA 2R3XA 3GKMA 4FH8A 2VL9A 3ZVJD 1QFNA 16GSA 1U6TA 2KOKA 1GWCA 3ZMKA 2M4YA 1OE7A 1U3IA 1HYUA 3QAWA 4ECIA 20GSA 1T9OA 1K0CA 3ZFBA 1IRNA 3DIEA 2FY6A 5B7CA 1SKRB 3F3QA 2Z3QB 4POKA 2WCIA 4EKZA 3TDGA 3F4TA 5EPFA 2GSTA 3GNJA 1E8JA 4ACSA 4E6YA 4RQRA 1Z92B 2N5AA 5IMCA 3PKIA 3DEXA 4IGJA 3VPQA 3W6GA 4F0BA 3EC3A 3F6DA 4ECCA 1K3LA 2HSMA 4O5QA 2MZCA 1TXXA 2FCHA 3L9SA 3E3EA 3P8WA 2P5QA 3A2VA 3IPZA 3M0FA 4AI0A 3CXGA 2I3YA 5CP1A 5H1Sc 5JVH1 1AQWA 3GRXA 3GX8A 2L59A 1WP0A 5J4UA 2OBIA 2X64A 3IOSA 3GH6A 1M9AA 4F9ZA 2DJ1A 3KYUA 1OC8A 2V41A 3R3EA 2V2GA 4AF2A 5D73A 2GQLA 1YEXA 1GSYA 5KN3A 2C3NA 1J0FA 2E2MA 4ECJA 1ZYQB 1OKDA 1THOA 2ALBA 4NHZA 2LQOA 1WWJA 2VAFA 4YH2A 2WFCA 4Q5FA 1QYBA 4JAGA 2IPAA 1K0BA 2PUKC 5EL8A 2VM2A 1SD8A 3IDVA 2FHEA 2V0EA 2HI7A 4KB3A 1VZIA 4MNNA 5IMVA 2E7PA 1GUHA 3MDKA 3QCPA 4KNDA 4POLA 1DVBA 1XOAA 4G19A 3EINA 1Z3EA 5A5KA 2RUEA 2VOCA 3I43A 2RIIA 4MJCA 4RQXA 1MDIA 3LW9A 2NYDA 2EIOA 1DX8A 3UOMA 1M2BA 2HZEB 4CDOA 1OC9A 2EC4A 2I1UA 4MJEA 5ABRA 2CR8A 1BQ8A 2KUCA 4F82A 2F9SA 2Z3RB 2H72A 3H79A 2BTOT 4JR4A 4EL1A 2GZPA 2IFQB 1X0RA 3EYTA 1T7PB 1PSQA 1DE2A 3Q6OA 2IMKA 1A8LA 4QL7A 3LYPA 3D6IA 2MBTA 1E6BA 4KX4A 4I5QA 2VLUA 2L0ZA 3TB2A 1S3AA 3HZ8A 2JI3A 4ML6A 3DD3A 5AN9H 1LBKA 3APSA 5FT3A 1PD21 4AGSA 1JHBA 1A2JA 4AHZA 2BJXA 2FD3A 4JZQA 1ERTA 4LHNA 4Z2RA 3DWVA 1Z9HA 2PPTA 3E9JB 1NHOA 3ZITA 2CVBA 5J5NA 2H70A 4HU7A 4ME3A 4EIPA 3PWFA 1QXHA 2XC2A 8RXNA 3TKSC 5ECPB 3UIWA 2H6YA 1OWBA 4JRRA 2V6OA 3FEUA 4TVEA 5DVBA 2YP6A 1BG5A 4KDYA 1GLPA 2PBJA 1RW1A 2WZ9A 2VLVA 5JWOB 3TGZA 2XJUA 5GAND 4KGIA 5IPGA 3B08B 3VWVA 3F63A 4IS0A 5DJLA 2V32A 3KMNA 5ECOB 3QQCE 3KP9A 4JR6A 1XVQA 6GSVA 3SS2A 2R5GA 5B6NA 3IK9A 2WB9A 2JI2A 1BQ7A 2LTKA 5DALB 1RK4A 2B5XA 1ST9A 2NBSA 5ELGA 4YQMA 4GQFA 3LQ7A 4NPBA 3KZQA 3O76A 3UJ1A 1FB6A 3FKFA 1ACVA 4OCEA 4GF0A 5GADc 1SJ6A 2YZHA 2VD0A 1HNCA 2CT6A 1X9WB 1RB9A 2X49A 5G31A 3LEFA 3CBUA 3UBKA 1B4QA 1IYIA 1HQOA 4XIHA 1VGLA 1AAZA 1XWBA 2GS3A 2FWHA 4N0VA 4JADA 1RWDA 1NSWA 5CREA 4G6BA 2L57A 2C3QA 5CRDA 3Q18A 4G9HA 1FW1A 1A0RP 5KN2A 3LXTA 4ZBAA 5G2ZA 4NHWA 4XHMA 2C0DA 2DSXA 3GTUA 1TK0B 3FW2A 3HJOA 4NAXA 3GX0A 2C6AA 3C1SA 4AJ8A 2GT5A 5B6MA 4BPYA 3ZZXA 2HT9A 1PKWA 2IJYA 5H5SA 3DXBA 1FVKA 1QGVA 4K8MA 3ERFA 3M9KA 4PTSA 4MH2A 1PN9A 1YKCA 1EEJA 3FYGA 5IMFA 1NHYA 1PKZA 2B5ID 1YF1A 3RHCA 1AW9A 2VCWA 1TU7A 2O87A 3GFKA 1B8XA 10GSA 2TIRA 4KDXA 2QA2A 2GGTA 2H74A 4V1Ag 1WMJA 1GUKA 4CHSA 4KUNA 2BMXA 1OE8A 2C8UA 1ON4A 6GSTA 2EIRA 5CYYA 3RDWA 4PXOA 3N5OA 3TJBA 4OO5A 7GSSA 1SK1A 2GVPA 2ERSA 2QGVA 1JZWA 3CYNA 3A2XA 3GIXA 1NM3A 4IN0A 5IY0A 3A44A 5B8BA 2DLXA 1B4PA 3TOTA 1S2ZA 1S30A 4AHXA 4K2DA 1PX6A 3GMFA 4NV2A 5AISA 4OFMA 5GAHc 2X8HA 5HQPA 1MDKA 1R7HA 5RXNA 3H4KA 2LS5A 4OFNA 2P0GA 1BQ9A 5E4WA 5ENUA 22GSA 3DMLA 2VCZA 3KH7A 4ECBA 4YWMA 5ECNB 3TKPA 5IIZA 4ZL8A 2H71A 4ULXA 1YKAA 2OE3A 2LJKA 4KF9A 1PMTA 3EU3A 1SYRA 2WDUA 3FZ5A 4V2NA 5D9XA 2PVXA 3ZFLA 4J2FA 2CA8A 1OVNA 1Z6MA 1K0AA 2GSQA 4AI2A 1YEPA 4GTUA 4EUYA 2RM6A 4PGTA 2AJQB 2HNLA 4F03A 4LA1A 2B1LA 4QL9A 4K7OA 2MS3A 1JFUA 2AUVA 4HI7A 1E2YA 4FQUA 4H86A 4POMA 1RDGA 2FA4A 4FYUA 1FHMA 4WETA 1M99A 2H12A 5KN0A 3IHGA 2YWMA 1U3AA 5AIVA 2LKUA 4YAVA 3U5RE 3EU4A 3EMPA 3BJ5A 1U88A 2EIQA 4AR4A 2L4QA 2F8AA 4Q5QA 5F05A 2VUPA 4WBRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GST A;  3GST A;  2J9H A;  1WJK A;  3UL3 A;  1XZO A;  1O73 A;  4TRX A;  1Y25 A;  1X5E A;  2DML A;  3F0I A;  4EE0 A;  2B5E A;  2LUS A;  5JCG A;  2YAN A;  2PWJ A;  4MZC A;  2GZY A;  2OBK A;  4PUF C;  3RBT A;  1WRY A;  2CX3 A;  4GRF A;  3BOA A;  2H1G A;  4KSO A;  5F0G A;  1I9D A;  3DVX A;  6GSU A;  2L4C A;  4XS4 A;  5DDL A;  2H1A A;  3BCI A;  3EUR A;  4ZBD A;  2K18 A;  5DAK A;  5ECR B;  2J23 A;  3L9U A;  4BL7 A;  1BED A;  3VI7 A;  2IWT A;  2PU9 C;  5J3R A;  2PER A;  4DSR A;  3WT1 A;  2H75 A;  4GSS A;  1FHE A;  2JU5 A;  1A23 A;  5JCW A;  3Q19 A;  4MF7 A;  1EP7 A;  2FWG A;  1XXU A;  3VWW A;  1K3Y A;  2O7K A;  3HA9 A;  1EWX A;  3TJF A;  1O8X A;  3ZLP A;  2G0F A;  4JBB A;  2YJH A;  5ECH B;  5ELA A;  1SK2 A;  4HUA A;  1T4Z A;  2GZZ A;  3GL3 A;  2HE3 A;  2K6V A;  3C1R A;  5LD0 A;  3IA1 A;  3GH9 A;  1Y6E A;  4PQH A;  2YPM A;  1Z7P A;  3F4R A;  3FR3 A;  5GAP D;  1B9Y C;  1USB A;  2N5F A;  3O3T A;  2DC5 A;  1T8E B;  3QPM A;  2K8V A;  3QR6 A;  4I2T A;  5ID2 A;  1EV4 A;  4PNF A;  2L5O A;  1ERV A;  3BCK A;  2GQM A;  5F07 A;  4IEL A;  1O7U A;  3CTG A;  2VCX A;  1M9B A;  3ERG A;  3E0U A;  4N30 A;  2FNO A;  1ZYE A;  2O8V B;  1TI1 A;  1FB0 A;  5CRH A;  3UBL A;  2DJJ A;  2LEG A;  2R37 A;  3TJJ A;  4KW6 A;  1XFL A;  1TU8 A;  3HZ4 A;  1NW2 A;  3L4N A;  5A4V A;  4L0U A;  2V1M A;  4O5R A;  4TXV A;  4X1U A;  5HFG A;  3VWX A;  4DSS A;  1N2A A;  4AJ6 A;  1H4O A;  1XWK A;  3F4S A;  3MSZ A;  1GTA A;  3C7M A;  3D0Z A;  3VWU A;  1FG4 A;  1PL1 A;  4K7N A;  2HSH A;  4OMV A;  2OA7 A;  3LGC A;  2PN8 A;  2X8G A;  4MF5 A;  4KE3 A;  3VFI A;  3QAV A;  4BVX A;  3D21 A;  4TKY A;  5IO0 A;  4TW5 A;  2VCV A;  3GKK A;  2OKA A;  1EGR A;  5DBQ A;  3TJK A;  4PX1 A;  9GSS A;  2NTO A;  3L0H A;  1JZR A;  3GTU B;  4IKH A;  5AN1 A;  1VF4 A;  3D4M A;  3DGQ A;  3ZML A;  4D73 A;  1AQV A;  1YQ1 A;  4JU5 A;  4PUA A;  1A24 A;  2IMD A;  2P5R A;  1Q4J A;  2L6C A;  1SYX A;  5D9V A;  3DRN A;  3DYR A;  5J41 A;  3IAS 2;  1DE1 A;  4ZXG A;  4HOJ A;  4EVM A;  1OYJ A;  1URM A;  4GWR A;  3RPN A;  3ZRD A;  3TRX A;  1AQX A;  17GS A;  2JAC A;  2X8C A;  2YCD A;  1C72 A;  1GSF A;  1AC1 A;  4WKW A;  4ZB6 A;  5DJM A;  3RPP A;  2QSI A;  5CRW A;  5ECI B;  5G30 A;  1XVW A;  3H8Q A;  2YNX A;  2LJA A;  1K0D A;  4FO5 A;  1UVZ A;  4V2L A;  3IAM 2;  3GA4 A;  1N8J A;  4I6X A;  1ZMA A;  4BWS A;  2GT6 A;  4PQ1 A;  2IN3 A;  1WOU A;  2IIY A;  2I81 A;  5KN1 A;  4O92 A;  5G1L A;  2VD1 A;  2H1B A;  2CX4 A;  4F2I A;  1AIU A;  5G5F A;  1PQN A;  3PGT A;  1MTC A;  1F3B A;  5LCZ A;  2DJ2 A;  3VUR A;  4MA9 A;  5J9B A;  2LRT A;  2YN1 A;  1A0F A;  1R4W A;  2CV4 A;  2YOI A;  2B6M A;  2FA8 A;  4OCF A;  5D9T A;  2K9F A;  1FO5 A;  2B3S A;  4V2M A;  5D8I A;  1MDJ A;  2R4V A;  3G7Y A;  2KLX A;  3EE2 A;  5HFK A;  1K0O A;  2XPE A;  2YJ7 A;  4GQC A;  1V40 A;  1I5G A;  2WS2 A;  2JAD A;  3MNG A;  1FVJ A;  3R2Q A;  1W4V A;  4NXI A;  2VL3 A;  4CW9 A;  1EOG A;  1V2A A;  1XIY A;  3TJG A;  3F8U A;  4LLR A;  3C8E A;  1TP9 A;  3QD9 A;  1EOH A;  5IM9 A;  5B8A A;  2LV3 A;  2CAI A;  3HCZ A;  3GN3 A;  2NDO A;  1MEK A;  1EZK A;  4FIW A;  3G7J A;  2PVQ A;  2N5B A;  2DMM A;  1ABA A;  4Z7X A;  3ZL5 A;  4OD7 A;  2IL3 A;  3MWH A;  1GSS A;  3HY2 A;  3S9F A;  4IJ3 A;  2YZU A;  1FOV A;  5DCH A;  4HJM A;  2B5Y A;  1TI3 A;  3TKR A;  2C6B A;  4MDC A;  1R5A A;  2JSY A;  3FZ9 A;  1T4Y A;  5A4W A;  3SWL A;  4TR1 A;  2ZNM A;  3KGK A;  3DKS A;  5AGY A;  3B0A B;  3K8N A;  1QMV A;  1ERU A;  4XS4 B;  5INY A;  5DAK B;  3WD6 A;  3W8S A;  3U6V A;  1F37 A;  1EEM A;  1B9X C;  2FUG 2;  3GSS A;  1A2L A;  2B1K A;  3FR6 A;  2GQK A;  4I2U A;  3ZTL A;  2RLI A;  4AJ7 A;  4I8B A;  2OAD A;  3ZIV A;  3O6T A;  1WPI A;  1J9B A;  3CRU A;  5FHI A;  2HFD A;  2E2G A;  3QMX A;  1XOB A;  3A3T A;  3H93 A;  1ZGN A;  4MP4 A;  1M2A A;  4TR4 A;  3KD0 A;  3WGX A;  1K0N A;  4ML1 A;  3I6A A;  3KMO A;  18GS A;  5IOW A;  3IHQ A;  2IMI A;  2MMN A;  2DSA A;  4G10 A;  3QDN A;  2HLS A;  1G0T A;  2WGR A;  3PH9 A;  1HNB A;  3QFA C;  5ECM B;  4EDY A;  1GTB A;  3KH9 A;  2DJ3 A;  1K0M A;  5ID2 B;  5IQY A;  1LU4 A;  2XBQ A;  4KAE A;  2DJ0 A;  3ME8 A;  1GP1 A;  3M8N A;  4XTS A;  4Q5R A;  3PR8 A;  3TRQ A;  2B7J A;  2MYG A;  4ZL7 A;  5H5Q A;  3J7Y k;  1CQG A;  1TTZ A;  1SJZ A;  4YAP A;  1Z7R A;  2H73 A;  3KEB A;  4ZBB A;  3GUS A;  5C04 A;  3KTL A;  2OJL A;  2TRC P;  3FK8 A;  2QKE A;  1JZO A;  5HR3 A;  2IMF A;  1X9M B;  5CNW A;  5IPH A;  2WRT A;  3HJM A;  2H66 A;  2AB6 A;  2HSY A;  1SJI A;  2HRN A;  4IP1 A;  2DIY A;  1XWG A;  3ZRE A;  1VF3 A;  2JL4 A;  5GST A;  1TK8 B;  1O81 A;  1V9W A;  5IMA A;  1TRS A;  4NWY A;  3GL5 A;  2H30 A;  4DSS B;  1RQM A;  2C0E A;  1GLQ A;  1XBS A;  1YDK A;  1MD3 A;  2H76 A;  5IMD A;  1TDI A;  4MH3 A;  3GUR A;  4ZIJ A;  4KH7 A;  1GNW A;  3I69 A;  3FRC A;  4EO3 A;  2H01 A;  1EV9 A;  4I97 A;  3IBH A;  2A2S A;  1UA5 A;  3IK7 A;  4MJA A;  4LL4 B;  1AUC A;  3ED3 A;  3US3 A;  1QUW A;  1G6Y A;  2NPB A;  5IO2 A;  2V6K A;  3CRT A;  5AIX A;  3FZA A;  3UEM A;  3NOF A;  2VL2 A;  1GTI A;  4ZL9 A;  4K6X A;  3PIN A;  2Z9S A;  2XBI A;  4WR4 A;  2O85 A;  3QFB C;  3N9J A;  5HR0 A;  1TOF A;  3WT2 A;  4Q5N A;  4D73 B;  3ERW A;  1GSE A;  3M3M A;  4K0G A;  4E8H A;  1SL2 B;  4IQA A;  5HFI A;  1TKD B;  3TKQ A;  4MPF A;  3DVW A;  3KCM A;  5E59 A;  3JCM L;  2CAQ A;  2DJK A;  1MD4 A;  5ECS A;  4MAB A;  4WF5 A;  1Z6N A;  2YV9 A;  3AY8 A;  4MZW A;  1G7O A;  5A4U A;  2KP1 A;  1GL8 A;  1M0U A;  3KTB A;  2X99 A;  2GDR A;  1THX A;  4XRA A;  1T00 A;  2VIM A;  2JZS A;  2WUL A;  3CSH A;  5HR2 A;  2OE0 A;  2MMO A;  1PL2 A;  5CRG A;  1BAY A;  1GSU A;  3IR4 A;  3KXO A;  4ID0 A;  1F2E A;  1X5C A;  4QQ7 A;  2O89 A;  2I4A A;  2A4V A;  1X9S B;  3H1N A;  4WR5 A;  5COH A;  2JSZ A;  2QC7 A;  2G2Q A;  5G1K A;  1VF1 A;  3FR9 A;  2AAW A;  4LMV A;  3V1W A;  4L0W A;  1XPV A;  4FYC A;  4K1F A;  2F51 A;  1GNE A;  1DUG A;  1OC3 A;  1YY7 A;  1V58 A;  4DSQ A;  2VCQ A;  3IXR A;  4X0X A;  1QK8 A;  1F3A A;  2CZ2 A;  2J9U B;  4EC0 A;  1SD9 A;  4BVY A;  1GH2 A;  3I9V 2;  4ZB8 A;  5JWR B;  2C0F A;  2OAC A;  1ZCP A;  1OAZ A;  4K7I A;  4OFT A;  4YQU A;  1SL0 B;  1KTE A;  4IP6 A;  3A5W A;  1XW6 A;  3KP8 A;  2OE1 A;  3ZVJ A;  1SK0 A;  3NIV A;  3SBC A;  1YF0 A;  1XWC A;  4WBJ A;  5ECL B;  2C1Y A;  1HD2 A;  4V1A p;  3GHA A;  3LWA A;  2FWE A;  2TRX A;  2FLS A;  1EGO A;  3F3R A;  1WIK A;  2AV4 A;  3RHB A;  4KCE A;  1IYH A;  2D2Z A;  3KIJ A;  1BYE A;  3J7Y b;  4MF6 A;  2M46 A;  3C73 A;  1VRS D;  3MAK A;  11GS A;  2XPD A;  1GSQ A;  5G5E A;  1ML6 A;  5EY6 A;  1U87 A;  1SEN A;  1YZX A;  3UAR A;  3HXS A;  2ON7 A;  4N11 A;  2LNS A;  3WGE A;  3GV1 A;  1JLW A;  2HXK A;  2P31 A;  3HKR A;  3VLN A;  1UC7 A;  2VO4 A;  4E8E A;  1XW9 A;  5D9W A;  1W89 A;  4O7H A;  4TOP A;  4TR1 B;  6GSY A;  6GSW A;  2FGX A;  1HNA A;  2PVO C;  3APO A;  4MMM A;  3L9V A;  1M2D A;  4P3Y B;  3W8J A;  3HVS A;  4RI7 A;  13GS A;  5JCU A;  4J56 E;  5D96 A;  5H5R A;  3TKS A;  2MBS A;  4KSM A;  1TK5 B;  5DQS A;  5EVO A;  3GKN A;  3GKX A;  2H8L A;  4RUV A;  1KEB A;  2K8S A;  1Z5Y E;  2YWO A;  3FHK A;  1PA3 A;  3CMI A;  2VCT A;  3UVH A;  3BD2 A;  8GSS A;  3UVT A;  5F8B A;  2L6D A;  1PRX A;  4HDE A;  3G7I A;  4XXB B;  2I9H A;  3TOU A;  5CAX A;  4OWY A;  1G6W A;  4WEY A;  3CSJ A;  2NVL A;  4GCI A;  4IW9 A;  4TR0 A;  2ON5 A;  1H75 A;  3IE3 A;  1EP8 A;  3GYK A;  4TR3 A;  2CVD A;  5D93 A;  4IJI A;  4N0Z A;  2ES7 A;  4IQ1 A;  1TRV A;  4MLY A;  5DQY A;  3WYW A;  2GSS A;  1S3D A;  2GTU A;  4IVF A;  2H0H A;  4OO4 A;  1YJ6 A;  3LXZ A;  4JED A;  4TXO B;  1JLV A;  1ZOF A;  1XCC A;  3EVI A;  3LOR A;  3IC4 A;  3NZN A;  4HEA 2;  4WXT A;  5DCG A;  5CO3 A;  3WGD A;  3KM6 A;  3HHV A;  1Q98 A;  1TRU A;  1SKS B;  2CVK A;  4DEJ A;  5GSS A;  3HVV A;  3D4T A;  2LRC A;  3C71 A;  2YWN A;  2LRN A;  4KDU A;  1SU9 A;  2HRF A;  2C4J A;  2RM5 A;  4JE1 A;  4X43 A;  2C80 A;  4RI6 A;  3P7X A;  4XS1 A;  5IMZ A;  2AYT A;  1WE0 A;  1V57 A;  2C3T A;  3HVX A;  2AHE A;  3TRP A;  3UAP A;  1J08 A;  3FZ4 A;  2RUF A;  2YV7 A;  4PQI A;  2HZE A;  2JZT A;  3ISO A;  2XHF A;  1SKW B;  1OKT A;  2IFQ A;  4BA7 A;  4NV5 A;  4HZ4 A;  2H19 A;  3KJY A;  1PX7 A;  4HQZ A;  2M80 A;  1DBY A;  4IBP A;  2F3M A;  1CQH A;  4FYB A;  4K9Z A;  5L71 A;  2F8F A;  5GZZ B;  1JZD A;  4NMU A;  1XWA A;  4MJB A;  3UMA A;  1O6J A;  3BBY A;  2VLT A;  2MMA A;  4HZ2 A;  5LNK e;  3CSI A;  2R2J A;  3CTF A;  3OR5 A;  4ZIL A;  2DBC A;  5FWG A;  2HZF A;  2MMZ A;  4GSN A;  2FWF A;  3ME7 A;  4L5L A;  4L8E A;  3LFL A;  2GLR A;  3F9U A;  4DVC A;  6GSX A;  1K3O A;  3LSZ A;  1FAA A;  3G9B A;  12GS A;  4G2E A;  2R6K A;  3APQ A;  3HD5 A;  1LJR A;  2L5L A;  1T1V A;  2REM A;  3D5J A;  4EXJ A;  1ZZY A;  3TKS E;  2H0I A;  2JZR A;  4MK3 A;  1SL1 B;  2HYX A;  1GUM A;  3IRA A;  1F9M A;  3A2W A;  4BWQ A;  2YWI A;  2VM1 A;  3ZYW A;  4HU9 A;  14GS A;  2LNT A;  4N10 A;  2H6Z A;  2KP2 A;  5DAL A;  1UN2 A;  2WJU A;  3EWL A;  4MPG A;  3RAZ A;  5HR1 A;  1TRW A;  3LYK A;  4GXZ A;  1AXD A;  1B48 A;  1ILO A;  3QOU A;  5ECQ B;  3HYP A;  3IV4 A;  4TXO A;  1R5P A;  3ZIJ A;  2LST A;  4K0N A;  1R26 A;  2C0G A;  1DSB A;  1M7T A;  1O85 A;  3LG6 A;  3HDC A;  1BJX A;  19GS A;  1T3B A;  1KBN A;  3VPT A;  4HJ2 A;  2E0Q A;  1F6M C;  4F0C A;  5C00 A;  4MZB A;  3FY7 A;  3M1G A;  4LMW A;  1TW9 A;  3D22 A;  3LJR A;  4MCU A;  4XCS A;  1O8W A;  4KCA A;  4L5O A;  3L78 A;  2B7K A;  2ZUP A;  4PUR A;  4TN8 A;  2A2R A;  1S3C A;  4KA0 A;  1ERW A;  2PMT A;  3VK9 A;  4ILF A;  3QAG A;  5KEJ A;  2ZCT A;  2IME A;  2LJR A;  1GTU A;  4WF4 A;  2M72 A;  4LL1 B;  5IOX A;  1GSD A;  3P2A A;  1XW5 A;  2CZ3 A;  3TUE A;  4ZB9 A;  4YQV A;  4HQS A;  4EDZ A;  3M9J A;  2H0G A;  2CQ9 A;  2H6X A;  4GLT A;  2LQQ A;  3F6F A;  4O32 A;  4J57 E;  5JWQ B;  6GSS A;  1GRX A;  1VF2 A;  1X5D A;  4HS1 A;  5J9C A;  3EMX A;  5F06 A;  2VL2 C;  1KNG A;  4EF0 A;  4POB A;  5ECK B;  4XS6 A;  2DIZ A;  1QQ2 A;  1G7E A;  2GSR A;  1GUL A;  1OC9 B;  2PGT A;  1ZL9 A;  1A8Y A;  1BX9 A;  3HJP A;  1A2M A;  3TCO A;  1TJD A;  2H1D A;  4XRD A;  2KHP A;  3P90 A;  3VI5 A;  1V98 A;  4ISD A;  3Q74 A;  4IHU A;  4PNG A;  1PGT A;  2R3X A;  3GKM A;  4FH8 A;  2VL9 A;  3ZVJ D;  1QFN A;  16GS A;  1U6T A;  2KOK A;  1GWC A;  3ZMK A;  1OE7 A;  1U3I A;  1HYU A;  3QAW A;  4ECI A;  20GS A;  1K0C A;  3ZFB A;  3DIE A;  2FY6 A;  5B7C A;  1SKR B;  3F3Q A;  4POK A;  2WCI A;  4EKZ A;  3TDG A;  3F4T A;  5EPF A;  2GST A;  3GNJ A;  4ACS A;  4RQR A;  2N5A A;  5IMC A;  3DEX A;  4IGJ A;  3VPQ A;  3W6G A;  4F0B A;  3EC3 A;  3F6D A;  4ECC A;  1K3L A;  2MZC A;  1TXX A;  2FCH A;  3L9S A;  3E3E A;  3P8W A;  2P5Q A;  3A2V A;  3IPZ A;  3M0F A;  3CXG A;  2I3Y A;  5CP1 A;  1AQW A;  3GRX A;  3GX8 A;  2L59 A;  1WP0 A;  5J4U A;  2OBI A;  2X64 A;  3IOS A;  3GH6 A;  1M9A A;  4F9Z A;  2DJ1 A;  1OC8 A;  2V41 A;  2V2G A;  4AF2 A;  5D73 A;  2GQL A;  1YEX A;  1GSY A;  5KN3 A;  2C3N A;  1J0F A;  2E2M A;  4ECJ A;  1ZYQ B;  1OKD A;  1THO A;  2ALB A;  4NHZ A;  2LQO A;  1WWJ A;  2VAF A;  4YH2 A;  2WFC A;  4Q5F A;  2IPA A;  1K0B A;  2PUK C;  5EL8 A;  2VM2 A;  1SD8 A;  3IDV A;  2FHE A;  2HI7 A;  4KB3 A;  5IMV A;  2E7P A;  1GUH A;  3MDK A;  3QCP A;  4KND A;  4POL A;  1XOA A;  4G19 A;  3EIN A;  1Z3E A;  5A5K A;  2RUE A;  2VOC A;  3I43 A;  2RII A;  4MJC A;  4RQX A;  1MDI A;  2EIO A;  3UOM A;  1M2B A;  2HZE B;  4CDO A;  1OC9 A;  2EC4 A;  2I1U A;  4MJE A;  5ABR A;  2KUC A;  4F82 A;  2F9S A;  2H72 A;  3H79 A;  2BTO T;  4JR4 A;  4EL1 A;  2GZP A;  2IFQ B;  1X0R A;  3EYT A;  1T7P B;  1PSQ A;  1DE2 A;  3Q6O A;  2IMK A;  1A8L A;  4QL7 A;  3LYP A;  3D6I A;  2MBT A;  1E6B A;  4KX4 A;  4I5Q A;  2VLU A;  3TB2 A;  1S3A A;  3HZ8 A;  4ML6 A;  3DD3 A;  1LBK A;  3APS A;  5FT3 A;  1PD2 1;  4AGS A;  1JHB A;  1A2J A;  2BJX A;  2FD3 A;  4JZQ A;  1ERT A;  3DWV A;  1Z9H A;  2PPT A;  3E9J B;  1NHO A;  3ZIT A;  2CVB A;  5J5N A;  2H70 A;  4HU7 A;  1QXH A;  2XC2 A;  3TKS C;  5ECP B;  3UIW A;  2H6Y A;  4JRR A;  2V6O A;  3FEU A;  4TVE A;  5DVB A;  2YP6 A;  1BG5 A;  4KDY A;  1GLP A;  2PBJ A;  1RW1 A;  2WZ9 A;  2VLV A;  5JWO B;  3TGZ A;  5GAN D;  4KGI A;  5IPG A;  3B08 B;  3VWV A;  3F63 A;  4IS0 A;  5DJL A;  2V32 A;  3KMN A;  5ECO B;  3KP9 A;  4JR6 A;  1XVQ A;  6GSV A;  2R5G A;  5B6N A;  3IK9 A;  2WB9 A;  1BQ7 A;  2LTK A;  5DAL B;  1RK4 A;  2B5X A;  1ST9 A;  2NBS A;  5ELG A;  4YQM A;  4GQF A;  3LQ7 A;  4NPB A;  3KZQ A;  3O76 A;  3UJ1 A;  1FB6 A;  3FKF A;  1ACV A;  4OCE A;  4GF0 A;  1SJ6 A;  2YZH A;  2VD0 A;  1HNC A;  2CT6 A;  1X9W B;  5G31 A;  3LEF A;  3CBU A;  3UBK A;  1B4Q A;  1IYI A;  1HQO A;  4XIH A;  1VGL A;  1AAZ A;  1XWB A;  2GS3 A;  2FWH A;  4N0V A;  1NSW A;  5CRE A;  2L57 A;  2C3Q A;  5CRD A;  3Q18 A;  4G9H A;  1FW1 A;  1A0R P;  5KN2 A;  3LXT A;  4ZBA A;  5G2Z A;  4NHW A;  4XHM A;  2C0D A;  3GTU A;  1TK0 B;  3FW2 A;  3HJO A;  4NAX A;  3GX0 A;  2C6A A;  3C1S A;  4AJ8 A;  2GT5 A;  5B6M A;  4BPY A;  3ZZX A;  2HT9 A;  1PKW A;  2IJY A;  5H5S A;  3DXB A;  1FVK A;  1QGV A;  4K8M A;  3ERF A;  3M9K A;  4MH2 A;  1PN9 A;  1YKC A;  1EEJ A;  3FYG A;  5IMF A;  1NHY A;  1PKZ A;  1YF1 A;  3RHC A;  1AW9 A;  2VCW A;  1TU7 A;  2O87 A;  3GFK A;  1B8X A;  10GS A;  2TIR A;  4KDX A;  2GGT A;  2H74 A;  4V1A g;  1WMJ A;  1GUK A;  4CHS A;  4KUN A;  2BMX A;  1OE8 A;  2C8U A;  1ON4 A;  6GST A;  2EIR A;  5CYY A;  3RDW A;  4PXO A;  3N5O A;  3TJB A;  4OO5 A;  7GSS A;  1SK1 A;  2GVP A;  2QGV A;  1JZW A;  3CYN A;  3A2X A;  3GIX A;  1NM3 A;  4IN0 A;  5B8B A;  2DLX A;  1B4P A;  3TOT A;  4K2D A;  1PX6 A;  3GMF A;  4NV2 A;  5AIS A;  4OFM A;  2X8H A;  5HQP A;  1MDK A;  1R7H A;  3H4K A;  2LS5 A;  4OFN A;  2P0G A;  5E4W A;  5ENU A;  22GS A;  3DML A;  2VCZ A;  3KH7 A;  4ECB A;  5ECN B;  3TKP A;  5IIZ A;  4ZL8 A;  2H71 A;  4ULX A;  1YKA A;  2OE3 A;  2LJK A;  1PMT A;  3EU3 A;  1SYR A;  2WDU A;  3FZ5 A;  4V2N A;  5D9X A;  3ZFL A;  4J2F A;  2CA8 A;  1OVN A;  1Z6M A;  1K0A A;  2GSQ A;  1YEP A;  4GTU A;  4EUY A;  2RM6 A;  4PGT A;  2AJQ B;  2HNL A;  4F03 A;  4LA1 A;  2B1L A;  4QL9 A;  4K7O A;  1JFU A;  2AUV A;  4HI7 A;  1E2Y A;  4H86 A;  4POM A;  2FA4 A;  4FYU A;  4WET A;  1M99 A;  5KN0 A;  2YWM A;  1U3A A;  5AIV A;  2LKU A;  4YAV A;  3U5R E;  3EU4 A;  3EMP A;  3BJ5 A;  1U88 A;  2EIQ A;  2L4Q A;  2F8A A;  4Q5Q A;  5F05 A;  2VUP A;  4WBR D; 
#chains in the Genus database with same CATH topology
 4GST A;  3GST A;  2J9H A;  1WJK A;  3UL3 A;  3S16 L;  1XZO A;  1O73 A;  4TRX A;  2ZIX A;  1Y25 A;  1X5E A;  2HRA A;  2DML A;  3F0I A;  4EE0 A;  2VL6 A;  4C3J L;  2B5E A;  5IYB L;  1R0I A;  2LUS A;  5JCG A;  5MFP A;  5AI2 A;  2YAN A;  2PWJ A;  4MZC A;  2PYA A;  4Y7N L;  2GZY A;  2OBK A;  4PUF C;  3RBT A;  1WRY A;  2CX3 A;  4GRF A;  3BOA A;  2H1G A;  4KSO A;  5F0G A;  1I9D A;  3DVX A;  6GSU A;  2L4C A;  4XS4 A;  5DDL A;  2JA7 L;  2H1A A;  3BCI A;  3EUR A;  4ZBD A;  2K18 A;  3LWO B;  5DAK A;  2J23 A;  3L9U A;  5ECR B;  4BL7 A;  1BED A;  3VI7 A;  2IWT A;  2PU9 C;  5J3R A;  2PER A;  4DSR A;  3WT1 A;  2H75 A;  4GSS A;  1FHE A;  2JU5 A;  1A23 A;  2AUS B;  5JCW A;  1LTL A;  3Q19 A;  2V3B B;  4MF7 A;  1EP7 A;  2FWG A;  1BFY A;  1XXU A;  3VWW A;  1K3Y A;  2O7K A;  3HA9 A;  1EWX A;  3TJF A;  1IU6 A;  1O8X A;  1S24 A;  3ZLP A;  2G0F A;  4JBB A;  2YJH A;  5ECH B;  1NXG A;  2A6H D;  2LCQ A;  5ELA A;  1SK2 A;  4HUA A;  1T4Z A;  5M5Y L;  2GZZ A;  3GL3 A;  3PZA A;  2HE3 A;  2K6V A;  3C1R A;  5LD0 A;  3IA1 A;  2R0G A;  3GH9 A;  1Y6E A;  4PQH A;  3M4O L;  2YPM A;  1Z7P A;  1IRO A;  3F4R A;  1P7P A;  1SMU A;  3FR3 A;  5GAP D;  1B9Y C;  1USB A;  1RDV A;  2N5F A;  3O3T A;  2DC5 A;  1T8E B;  3QPM A;  3IU3 I;  2K8V A;  3QR6 A;  4I2T A;  5ID2 A;  1EV4 A;  4PNF A;  2L5O A;  2NVQ L;  1ERV A;  4Z2T A;  3BCK A;  2WB1 P;  3IC8 A;  2GQM A;  5F07 A;  4IEL A;  2DKH A;  1O7U A;  3CTG A;  2VCX A;  1YV1 A;  3HJY B;  1M9B A;  5DM6 1;  3ERG A;  3E0U A;  4N30 A;  2FNO A;  1SMW A;  1ZYE A;  2O8V B;  1TI1 A;  1FB0 A;  5CRH A;  3UBL A;  2DJJ A;  2LEG A;  2R37 A;  3TJJ A;  1SMM A;  4KW6 A;  1XFL A;  5GAG c;  4Z2U A;  1TU8 A;  3HZ4 A;  1NW2 A;  3L4N A;  5A4V A;  4L0U A;  1PFY A;  2V1M A;  4O5R A;  4TXV A;  4X1U A;  5HFG A;  3VWX A;  4DSS A;  1N2A A;  4AJ6 A;  5BMU A;  1H4O A;  1XWK A;  2PSM C;  3F4S A;  3MSZ A;  1GTA A;  3C7M A;  3D0Z A;  3VWU A;  2B63 L;  5DM7 1;  1FG4 A;  1PL1 A;  4K7N A;  2HSH A;  4OMV A;  4CY8 A;  2OA7 A;  3LGC A;  3K35 A;  2PN8 A;  2X8G A;  4MF5 A;  4KE3 A;  3KYX A;  3VFI A;  3RZT A;  3QAV A;  4K5R A;  4BVX A;  3D21 A;  4TKY A;  5GAE c;  5IO0 A;  4TW5 A;  2VCV A;  3GKK A;  2WAQ P;  2OKA A;  1EGR A;  3GTM L;  2BE5 D;  5DBQ A;  3TJK A;  4PX1 A;  9GSS A;  2NTO A;  3L0H A;  1JZR A;  3GTU B;  4IKH A;  5AN1 A;  1VF4 A;  3D4M A;  3DGQ A;  3ZML A;  4D73 A;  1AQV A;  3HJW B;  1YQ1 A;  4JU5 A;  1H7V A;  4PUA A;  1A24 A;  2IMD A;  2P5R A;  4O5U A;  5MFZ A;  1Q4J A;  2L6C A;  1SYX A;  5D9V A;  3DRN A;  5M5X L;  3DYR A;  5J41 A;  3IAS 2;  1DE1 A;  4ZXG A;  4HOJ A;  4EVM A;  1OYJ A;  1URM A;  5MGN A;  4GWR A;  1ZRP A;  3MQK B;  3LWR B;  1R0H A;  3RPN A;  3ZRD A;  4BBS L;  3TRX A;  1AQX A;  17GS A;  2JAC A;  2X8C A;  2YCD A;  1FOH A;  1C72 A;  4C3H L;  1GSF A;  1AC1 A;  4WKW A;  4EIQ A;  2R0P A;  3WWN B;  4ZB6 A;  1BE7 A;  5DJM A;  3RPP A;  2QSI A;  5CRW A;  5ECI B;  5G30 A;  1XVW A;  3H8Q A;  2YNX A;  2LJA A;  1K0D A;  4FO5 A;  1UVZ A;  4V2L A;  2E2I L;  3IAM 2;  3GA4 A;  1N8J A;  3WWL A;  4I6X A;  1ZMA A;  4BWS A;  2GT6 A;  4PQ1 A;  2XJQ A;  2IN3 A;  1WOU A;  2IIY A;  5M3F L;  2I81 A;  5KN1 A;  4O92 A;  1K83 L;  5G1L A;  2VD1 A;  2H1B A;  2CX4 A;  4F2I A;  1AIU A;  5G5F A;  4AI3 A;  1LKM A;  1PQN A;  3PGT A;  1MTC A;  1F3B A;  5LCZ A;  4A3L L;  2DJ2 A;  3VUR A;  4MA9 A;  5J9B A;  2LRT A;  4BBR L;  2YN1 A;  1A0F A;  1R4W A;  2CV4 A;  4A3B L;  2YOI A;  2B6M A;  3P8B A;  2FA8 A;  4OCF A;  5D9T A;  2K9F A;  1FO5 A;  2B3S A;  4V2M A;  5D8I A;  1MDJ A;  2R4V A;  3H9B A;  3G7Y A;  2KLX A;  3EE2 A;  5HFK A;  3H97 A;  1K0O A;  2XPE A;  2YJ7 A;  4GQC A;  1V40 A;  1I5G A;  2WS2 A;  2JAD A;  3MNG A;  1FVJ A;  3R2Q A;  1W4V A;  4NXI A;  2VL3 A;  1IW7 D;  2A68 D;  4CW9 A;  1EOG A;  3PKJ A;  1V2A A;  1XIY A;  3TJG A;  3F8U A;  1T9P A;  4LLR A;  3C8E A;  1TP9 A;  3QD9 A;  1EOH A;  5IM9 A;  4QIW P;  5B8A A;  2LV3 A;  2CAI A;  3HCZ A;  1B2J A;  3GN3 A;  2NDO A;  1MEK A;  3PL5 A;  1EZK A;  4AHW A;  4FIW A;  3G7J A;  2PVQ A;  2N5B A;  4B8C D;  2DMM A;  1ABA A;  4Z7X A;  3ZL5 A;  4OD7 A;  2IL3 A;  3MWH A;  1GSS A;  3HY2 A;  3S9F A;  4IJ3 A;  3S14 L;  4YWL A;  2YZU A;  1NNQ A;  1FOV A;  5DCH A;  4HJM A;  5MLC 3;  4BY1 L;  1TWH L;  2B5Y A;  1TI3 A;  3TKR A;  2C6B A;  4MDC A;  1R5A A;  2JSY A;  1JYB A;  3FZ9 A;  1T4Y A;  5A4W A;  3SWL A;  4TR1 A;  4AHY A;  1R0J A;  2ZNM A;  3KGK A;  3DKS A;  5AGY A;  3B0A B;  3MPS A;  3K8N A;  5BRT A;  1QMV A;  1ERU A;  4XS4 B;  3HOZ L;  1BRF A;  5INY A;  5DAK B;  4BL7 B;  1WJV A;  3WD6 A;  3CQZ L;  3W8S A;  3U6V A;  1F37 A;  1EEM A;  1B9X C;  3VPB E;  2FUG 2;  3GSS A;  1A2L A;  2B1K A;  3FR6 A;  1I50 L;  1TWG L;  5C3E L;  2GQK A;  4I2U A;  1YK4 A;  3ZTL A;  2RLI A;  4AJ7 A;  1QCV A;  4I8B A;  2OAD A;  3ZIV A;  2O5J D;  3O6T A;  1WPI A;  1J9B A;  3CRU A;  3S1N L;  5FHI A;  2HFD A;  2E2G A;  2ERJ A;  3QMX A;  1XOB A;  3A3T A;  3H93 A;  1ZGN A;  4MP4 A;  1M2A A;  4TR4 A;  3KD0 A;  3WGX A;  1K0N A;  4ML1 A;  3I6A A;  3HAX C;  18GS A;  3KMO A;  5IOW A;  3IHQ A;  2IMI A;  2MMN A;  2DSA A;  4G10 A;  3QDN A;  2HLS A;  1G0T A;  2WGR A;  2JA6 L;  1IU5 A;  6RXN A;  3PH9 A;  1HNB A;  3QFA C;  5ECM B;  4EDY A;  1GTB A;  3KH9 A;  2DJ3 A;  2QL0 A;  1K0M A;  1TWC L;  5ID2 B;  5IQY A;  1LU4 A;  2XBQ A;  4KAE A;  3JR7 A;  2DJ0 A;  3ME8 A;  1GP1 A;  3M8N A;  4XTS A;  4Q5R A;  3PR8 A;  3TRQ A;  2B7J A;  2MYG A;  4ZL7 A;  5H5Q A;  3J7Y k;  1CQG A;  3RZO L;  1TTZ A;  4YKG A;  1SJZ A;  4YAP A;  1Z7R A;  2H73 A;  3KEB A;  4ZBB A;  4TVM A;  3GUS A;  5C04 A;  1VZH A;  3KTL A;  2OJL A;  2KKD A;  3H0G L;  2TRC P;  3FK8 A;  2QKE A;  1B13 A;  3PIO 1;  1JZO A;  5HR3 A;  2A69 D;  2IMF A;  1X9M B;  5CNW A;  5IPH A;  2WRT A;  3HJM A;  2H66 A;  3FDJ A;  4K9F A;  2AB6 A;  2HSY A;  3H3V M;  1SJI A;  2HRN A;  4IP1 A;  4BY7 L;  2DIY A;  1XWG A;  3ZRE A;  4A3K L;  2XJT A;  2A6E D;  4BVY B;  1VF3 A;  3HKZ P;  2JL4 A;  5GST A;  1TK8 B;  1O81 A;  1V9W A;  5IMA A;  2HRK A;  5MF6 A;  1TRS A;  4NWY A;  3GL5 A;  3RZ6 A;  2H30 A;  1T9Q A;  4DSS B;  1RQM A;  2C0E A;  1GLQ A;  2HVY C;  2RDV A;  1XBS A;  1YDK A;  1MD3 A;  2H76 A;  4V19 6;  5IMD A;  1TDI A;  4MH3 A;  1Y1V L;  4WFN 1;  3GUR A;  2M4V A;  4ZIJ A;  4KH7 A;  3H99 A;  3PPU A;  1GNW A;  3I69 A;  3FRC A;  4EO3 A;  4U67 1;  2H01 A;  1EV9 A;  4I97 A;  5IP9 L;  4AR5 A;  3IBH A;  2A2S A;  4X4J A;  1UA5 A;  4C3I L;  3IK7 A;  4MJA A;  4LL4 B;  3J7Z 1;  1AUC A;  4POF A;  3ED3 A;  3US3 A;  4BVX B;  1QUW A;  1G6Y A;  2NPB A;  5IO2 A;  2V6K A;  3CRT A;  5AIX A;  3FZA A;  3UEM A;  4ZN1 B;  3NOF A;  2VL2 A;  1GTI A;  4ZL9 A;  4K6X A;  3KYY A;  3PIN A;  2Z9S A;  2XBI A;  4WR4 A;  2O85 A;  1R0G A;  3QFB C;  3FMW A;  3N9J A;  5HR0 A;  1TOF A;  3WT2 A;  5C4X L;  4Q5N A;  2NVT L;  4D73 B;  3ERW A;  2XJS A;  1GSE A;  3M3M A;  4K0G A;  4E8H A;  1SL2 B;  2UZ8 A;  1TWF L;  4IQA A;  1PN0 A;  3KYW A;  5HFI A;  1SFO L;  1TKD B;  3TKQ A;  4MPF A;  3DVW A;  3KCM A;  5E59 A;  3JCM L;  2CAQ A;  2DJK A;  4UY8 1;  1MD4 A;  2M6O A;  5ECS A;  4MAB A;  4WF5 A;  1Z6N A;  2YV9 A;  3AY8 A;  4MZW A;  1G7O A;  2E2H L;  5A4U A;  5IP7 L;  2KP1 A;  1GL8 A;  1M0U A;  4AR6 A;  3KTB A;  2X99 A;  4RXN A;  2GDR A;  1THX A;  4XRA A;  1T00 A;  2VIM A;  2JZS A;  2WUL A;  2NVY L;  3CSH A;  5HR2 A;  2OE0 A;  2MMO A;  1RYQ A;  1PL2 A;  5CRG A;  1BAY A;  1GSU A;  3IR4 A;  3KXO A;  4ID0 A;  1F2E A;  1X5C A;  1ZYP A;  4QQ7 A;  2O89 A;  4YKF A;  2I4A A;  2A4V A;  1X9S B;  3H1N A;  1YUZ A;  4WR5 A;  5COH A;  2JSZ A;  2QC7 A;  2G2Q A;  5G1K A;  1VF1 A;  3FR9 A;  2JI1 A;  5M5W L;  4A3J L;  2AAW A;  5FJ8 L;  3LWV B;  4LMV A;  3V1W A;  4L0W A;  1XPV A;  4FYC A;  1S3R A;  4K1F A;  2F51 A;  4ICY A;  1GNE A;  1DUG A;  1OC3 A;  1YY7 A;  1V58 A;  4DSQ A;  2VCQ A;  3IXR A;  4X0X A;  3PIP 1;  4POG A;  1QK8 A;  1F3A A;  2CZ2 A;  2J9U B;  3GTP L;  4EC0 A;  1YK5 A;  1SD9 A;  4BVY A;  1GH2 A;  3I9V 2;  4ZB8 A;  5JWR B;  2C0F A;  2OAC A;  1ZCP A;  1OAZ A;  4JAE A;  4G0I A;  4K7I A;  4OFT A;  4YQU A;  1SL0 B;  1KTE A;  4IP6 A;  3A5W A;  5JVG 1;  1XW6 A;  3GTO L;  3KP8 A;  2OE1 A;  3ZVJ A;  1SK0 A;  3NIV A;  3SBC A;  1YF0 A;  1YUX A;  1XWC A;  4WBJ A;  5ECL B;  2C1Y A;  1HD2 A;  4V1A p;  1PFO A;  2R0C A;  3GHA A;  3LWA A;  2FWE A;  4TPU A;  2TRX A;  2CKC A;  2FLS A;  1EGO A;  4JAF A;  3F3R A;  3S17 L;  1WIK A;  2AV4 A;  3RHB A;  4KCE A;  1IYH A;  3J7Y 1;  2D2Z A;  1BYE A;  3KIJ A;  3J7Y b;  2NVX L;  4MF6 A;  2M46 A;  3C73 A;  1VRS D;  3MAK A;  11GS A;  2XPD A;  1GSQ A;  5KOX A;  5G5E A;  1ML6 A;  5EY6 A;  2K2D A;  1U87 A;  1SEN A;  1YZX A;  3UAR A;  3HXS A;  2ON7 A;  1CAD A;  4N11 A;  2KN9 A;  2A2P A;  5K2M E;  2LNS A;  3WGE A;  3GV1 A;  1JLW A;  5EIO C;  3ZG6 A;  2HXK A;  2P31 A;  3HKR A;  3VLN A;  1LKO A;  1UC7 A;  2VO4 A;  1LKP A;  4E8E A;  1XW9 A;  5D9W A;  1W89 A;  4O7H A;  4TOP A;  1PFW A;  4TR1 B;  6GSY A;  4X6A L;  6GSW A;  2FGX A;  1HNA A;  2PVO C;  3APO A;  4MMM A;  3L9V A;  1M2D A;  4P3Y B;  2QA1 A;  3W8J A;  3HVS A;  4RI7 A;  13GS A;  5JCU A;  1PFU A;  4J56 E;  3QVD A;  5D96 A;  5H5R A;  3TKS A;  2MBS A;  4KSM A;  1TK5 B;  3LWP B;  4A5P A;  5DQS A;  5EVO A;  3GKN A;  3GKX A;  2H8L A;  4RUV A;  3NFP I;  1KEB A;  2K8S A;  1Z5Y E;  2YWO A;  3FHK A;  1PA3 A;  3CMI A;  2VCT A;  2AYJ A;  3UVH A;  3BD2 A;  8GSS A;  3UVT A;  2RFK B;  5F8B A;  2L6D A;  1PRX A;  4HDE A;  3G7I A;  4XXB B;  2I9H A;  3TOU A;  5CAX A;  4OWY A;  1ODH A;  1G6W A;  4WEY A;  3CSJ A;  2NVL A;  4GCI A;  4IW9 A;  4TR0 A;  2ON5 A;  1H75 A;  3IE3 A;  1VCX A;  1EP8 A;  3GYK A;  4TR3 A;  2CVD A;  5D93 A;  4IJI A;  4XGH A;  4K2X A;  4N0Z A;  2ES7 A;  3EPT A;  4IQ1 A;  1TRV A;  4MLY A;  2CKA A;  5DQY A;  3WYW A;  2GSS A;  2AQC A;  1S3D A;  2GTU A;  2GMG A;  4IVF A;  2H0H A;  4OO4 A;  1YJ6 A;  3LXZ A;  1M3J A;  4JED A;  4TXO B;  1JLV A;  1ZOF A;  1XCC A;  3EVI A;  4LHL A;  5EIN C;  3LOR A;  3IC4 A;  3NZN A;  4HEA 2;  4BIK A;  4WXT A;  5DCG A;  5CO3 A;  3WGD A;  3HOV L;  3KM6 A;  3HHV A;  1Q98 A;  1TRU A;  3PO3 L;  1SKS B;  2PVE A;  2CVK A;  4DEJ A;  4GS7 D;  5GSS A;  3HVV A;  3D4T A;  2LRC A;  3C71 A;  2YWN A;  2LRN A;  4KDU A;  1SU9 A;  3A5I A;  3HOU L;  2C4J A;  2HRF A;  2RM5 A;  4JE1 A;  3MYD A;  4X43 A;  2C80 A;  4RI6 A;  1XG8 A;  4USS A;  3P7X A;  4XS1 A;  5IMZ A;  2AYT A;  1WE0 A;  1V57 A;  2HR5 A;  2C3T A;  3HVX A;  2AHE A;  3TRP A;  3UAP A;  1J08 A;  3FZ4 A;  2RUF A;  4A3D L;  2YV7 A;  4PQI A;  2HZE A;  4AI1 A;  2JZT A;  5AI3 A;  3ISO A;  2XHF A;  1SKW B;  1OKT A;  2IFQ A;  4BA7 A;  4NV5 A;  4HZ4 A;  2H19 A;  4G0L A;  3KJY A;  1PX7 A;  4HQZ A;  2M80 A;  1DBY A;  4IBP A;  2F3M A;  1CQH A;  4FYB A;  4K9Z A;  5L71 A;  2XJP A;  2F8F A;  5GZZ B;  1JZD A;  4NMU A;  3CQF A;  1XWA A;  4MJB A;  3UMA A;  1O6J A;  3BBY A;  2VLT A;  2MMA A;  4HZ2 A;  5LNK e;  3CSI A;  2R2J A;  2XJR A;  3CTF A;  3OR5 A;  4ZIL A;  1B71 A;  2DBC A;  5FWG A;  2HZF A;  2MMZ A;  4GSN A;  2FWF A;  3ME7 A;  4L5L A;  7RXN A;  4L8E A;  3LFL A;  2GLR A;  3F9U A;  1Y1W L;  4DVC A;  1FHH A;  6GSX A;  1K3O A;  3LSZ A;  1FAA A;  3G9B A;  3M3Y L;  12GS A;  4G2E A;  2R6K A;  3APQ A;  1TWA L;  1RYT A;  3LPE B;  3HD5 A;  2XJV A;  1LJR A;  2L5L A;  1T1V A;  2REM A;  3D5J A;  4EXJ A;  1ZZY A;  3TKS E;  2H0I A;  2JZR A;  4MK3 A;  1SL1 B;  2HYX A;  2DKI A;  1GUM A;  3IRA A;  1F9M A;  3A2W A;  4BWQ A;  2YWI A;  2VM1 A;  3ZYW A;  4HU9 A;  14GS A;  2LNT A;  4N10 A;  4A3E L;  3RZD L;  2H6Z A;  2KP2 A;  5DAL A;  1UN2 A;  2WJU A;  3EWL A;  4MPG A;  3RAZ A;  3GTL L;  1TRW A;  3LYK A;  5HR1 A;  4GXZ A;  1AXD A;  1B48 A;  1ILO A;  1I3Q L;  3QOU A;  5ECQ B;  3HYP A;  3IV4 A;  4TXO A;  1R5P A;  3ZIJ A;  2LST A;  4K0N A;  2V0F A;  3GTK L;  1R26 A;  2C0G A;  1DSB A;  1M7T A;  1O85 A;  3LG6 A;  3HDC A;  1BJX A;  19GS A;  3HOY L;  1T3B A;  1KBN A;  3VPT A;  4HJ2 A;  2E0Q A;  1C09 A;  1F6M C;  4F0C A;  5C00 A;  4MZB A;  3FY7 A;  3M1G A;  4LMW A;  1TW9 A;  3D22 A;  1NXE A;  3LJR A;  2JA8 L;  4MCU A;  4XCS A;  1O8W A;  4KCA A;  1CAA A;  4L5O A;  3L78 A;  2B7K A;  2ZUP A;  1B2O A;  4PUR A;  4TN8 A;  2A2R A;  2M6P A;  1S3C A;  3KYV A;  3LNL A;  4KA0 A;  3PO2 L;  1ERW A;  2Y0S P;  2PMT A;  3VK9 A;  4ILF A;  3QAG A;  5KEJ A;  2ZCT A;  2X4A A;  2IME A;  2LJR A;  1GTU A;  4WF4 A;  1ZYN A;  2M72 A;  4LL1 B;  5IOX A;  1GSD A;  3P2A A;  1XW5 A;  2CZ3 A;  3TUE A;  4ZB9 A;  4YQV A;  3GTG L;  4HQS A;  4EDZ A;  3M9J A;  2H0G A;  2CQ9 A;  3S1R L;  2H6X A;  4GLT A;  2LQQ A;  3F6F A;  4O32 A;  1OWC A;  1VZG A;  4J57 E;  3RYG A;  5JWQ B;  6GSS A;  4AR3 A;  1GRX A;  2VUM L;  1VF2 A;  1X5D A;  1PFV A;  5C4J L;  3MIX A;  4HS1 A;  5J9C A;  3EMX A;  4K5S A;  5F06 A;  2VL2 C;  5KOW A;  1KNG A;  4EF0 A;  2A4H A;  4POB A;  3H9C A;  5ECK B;  4XS6 A;  2DIZ A;  1QQ2 A;  1R0F A;  1G7E A;  2GSR A;  4G0K A;  1GUL A;  3MSU A;  1OC9 B;  2PGT A;  4ZN3 B;  1ZL9 A;  2EY4 E;  5IYC L;  1A8Y A;  1BX9 A;  2PMZ P;  3HJP A;  1A2M A;  3GTQ L;  3TCO A;  1TJD A;  4CY6 A;  2H1D A;  4XRD A;  2KHP A;  3P90 A;  3VI5 A;  1V98 A;  4ISD A;  3Q74 A;  4IHU A;  4PNG A;  1PGT A;  2R3X A;  3GKM A;  4FH8 A;  2VL9 A;  3ZVJ D;  1QFN A;  16GS A;  1U6T A;  2KOK A;  1GWC A;  3ZMK A;  2M4Y A;  1OE7 A;  1U3I A;  1HYU A;  3QAW A;  4ECI A;  20GS A;  1T9O A;  1K0C A;  3ZFB A;  1IRN A;  3DIE A;  2FY6 A;  5B7C A;  1SKR B;  3F3Q A;  1QQT A;  2Z3Q B;  4POK A;  2WCI A;  4EKZ A;  3TDG A;  3F4T A;  5EPF A;  2GST A;  3GNJ A;  1E8J A;  4ACS A;  4HSC X;  4E6Y A;  4RQR A;  1Z92 B;  2N5A A;  5IMC A;  2R7Z L;  1PZX A;  3PKI A;  3DEX A;  4IGJ A;  3VPQ A;  3W6G A;  4F0B A;  3EC3 A;  3F6D A;  4ECC A;  1K3L A;  2HSM A;  4O5Q A;  2MZC A;  1TXX A;  2FCH A;  3L9S A;  3E3E A;  5M3M L;  3P8W A;  2P5Q A;  3A2V A;  3IPZ A;  3M0F A;  4AI0 A;  3CXG A;  2I3Y A;  5CP1 A;  5H1S c;  5JVH 1;  1AQW A;  3GRX A;  3GX8 A;  2L59 A;  1WP0 A;  5J4U A;  2OBI A;  2X64 A;  3IOS A;  3GH6 A;  1M9A A;  4F9Z A;  2DJ1 A;  3KYU A;  1OC8 A;  2V41 A;  3R3E A;  2R93 L;  2V2G A;  4AF2 A;  5D73 A;  2GQL A;  1YEX A;  1GSY A;  5KN3 A;  2C3N A;  1J0F A;  2E2M A;  4ECJ A;  1ZYQ B;  1OKD A;  1THO A;  2ALB A;  4NHZ A;  2LQO A;  1WWJ A;  2VAF A;  4YH2 A;  2WFC A;  4Q5F A;  1QYB A;  4JAG A;  2IPA A;  1K0B A;  2PUK C;  5EL8 A;  2VM2 A;  1SD8 A;  3IDV A;  2FHE A;  2V0E A;  2HI7 A;  4KB3 A;  1VZI A;  4MNN A;  5IMV A;  2E7P A;  1GUH A;  3MDK A;  3QCP A;  4KND A;  4POL A;  1DVB A;  1XOA A;  4G19 A;  3EIN A;  1Z3E A;  5A5K A;  2RUE A;  2VOC A;  3I43 A;  2RII A;  4MJC A;  5FLM L;  4RQX A;  1MDI A;  3LW9 A;  2NYD A;  2EIO A;  1DX8 A;  3UOM A;  1F4L A;  1M2B A;  2HZE B;  4CDO A;  1OC9 A;  2EC4 A;  2I1U A;  4MJE A;  5ABR A;  2CR8 A;  1BQ8 A;  2KUC A;  4F82 A;  2F9S A;  4AYB P;  2Z3R B;  2H72 A;  3H79 A;  2BTO T;  4JR4 A;  4EL1 A;  2GZP A;  2IFQ B;  1X0R A;  3EYT A;  1T7P B;  1PSQ A;  1DE2 A;  3Q6O A;  2IMK A;  1A8L A;  4QL7 A;  4A3M L;  3LYP A;  3D6I A;  2MBT A;  1E6B A;  4KX4 A;  4I5Q A;  2VLU A;  2L0Z A;  3S1Q L;  3TB2 A;  1S3A A;  3HZ8 A;  2JI3 A;  4ML6 A;  3DD3 A;  3I4N L;  5AN9 H;  1LBK A;  3APS A;  5FT3 A;  1PD2 1;  4AGS A;  1JHB A;  1A2J A;  4AHZ A;  2BJX A;  2FD3 A;  4JZQ A;  1ERT A;  4LHN A;  4Z2R A;  3DWV A;  1Z9H A;  2PPT A;  3E9J B;  1NHO A;  3ZIT A;  2CVB A;  5J5N A;  4BXX L;  2H70 A;  4HU7 A;  4ME3 A;  4EIP A;  3PWF A;  1QXH A;  2XC2 A;  8RXN A;  3TKS C;  5ECP B;  3UIW A;  2H6Y A;  1OWB A;  4JRR A;  2R92 L;  2V6O A;  3FKI L;  3FEU A;  4TVE A;  5DVB A;  2YP6 A;  1BG5 A;  4KDY A;  1GLP A;  1R9T L;  2PBJ A;  1RW1 A;  2WZ9 A;  2VLV A;  5JWO B;  3TGZ A;  2XJU A;  5GAN D;  4KGI A;  5IPG A;  3B08 B;  3VWV A;  3F63 A;  4IS0 A;  5DJL A;  2V32 A;  3KMN A;  5ECO B;  3QQC E;  3KP9 A;  4A3G L;  1XVQ A;  4JR6 A;  3S2D L;  6GSV A;  3SS2 A;  2R5G A;  5B6N A;  3IK9 A;  2WB9 A;  2JI2 A;  1BQ7 A;  2LTK A;  5DAL B;  1RK4 A;  2B5X A;  1ST9 A;  2NBS A;  3K7A L;  5ELG A;  4YQM A;  4GQF A;  3LQ7 A;  4NPB A;  3HOW L;  3KZQ A;  3O76 A;  3UJ1 A;  1FB6 A;  3FKF A;  1ACV A;  4OCE A;  4GF0 A;  5GAD c;  1SJ6 A;  2YZH A;  2VD0 A;  1HNC A;  2CT6 A;  4A93 L;  1X9W B;  1RB9 A;  2X49 A;  5G31 A;  3LEF A;  3GTJ L;  3S2H L;  3CBU A;  3UBK A;  1B4Q A;  1IYI A;  1HQO A;  4XIH A;  1VGL A;  3LWQ B;  1AAZ A;  1XWB A;  2GS3 A;  2FWH A;  4N0V A;  4JAD A;  1RWD A;  1NSW A;  5CRE A;  4G6B A;  2L57 A;  2C3Q A;  5CRD A;  3Q18 A;  4G9H A;  1FW1 A;  1A0R P;  5KN2 A;  3LXT A;  4ZBA A;  5G2Z A;  4NHW A;  4XHM A;  2C0D A;  2DSX A;  3GTU A;  4C2M 1;  1TK0 B;  3FW2 A;  3HJO A;  4NAX A;  3GX0 A;  2C6A A;  5C44 L;  3C1S A;  4AJ8 A;  2GT5 A;  5B6M A;  4BPY A;  3ZZX A;  2HT9 A;  1PKW A;  2IJY A;  5H5S A;  3DXB A;  1FVK A;  1QGV A;  4K8M A;  3ERF A;  3M9K A;  4PTS A;  4MH2 A;  1PN9 A;  1I6H L;  1YKC A;  1EEJ A;  3FYG A;  5IMF A;  1NHY A;  1PKZ A;  2B5I D;  1YF1 A;  3RHC A;  1AW9 A;  2VCW A;  1TU7 A;  2O87 A;  3GFK A;  1B8X A;  10GS A;  2TIR A;  4KDX A;  2QA2 A;  2GGT A;  2H74 A;  4V1A g;  1WMJ A;  1GUK A;  4CHS A;  4KUN A;  2BMX A;  3HOX L;  1OE8 A;  2APO B;  2C8U A;  1ON4 A;  6GST A;  2EIR A;  5CYY A;  3RDW A;  4PXO A;  3N5O A;  3TJB A;  4OO5 A;  7GSS A;  1SK1 A;  2GVP A;  2ERS A;  2QGV A;  2YU9 L;  1JZW A;  3CYN A;  3A2X A;  3GIX A;  1NM3 A;  4IN0 A;  5IY0 A;  3A44 A;  5B8B A;  2DLX A;  1B4P A;  3TOT A;  1S2Z A;  1M3I A;  1S30 A;  4AHX A;  4K2D A;  1PX6 A;  4A3C L;  3GMF A;  4NV2 A;  5AIS A;  4OFM A;  5GAH c;  2X8H A;  4A3I L;  5HQP A;  1MDK A;  3HVN A;  1R7H A;  5RXN A;  3H4K A;  2LS5 A;  4OFN A;  2P0G A;  1BQ9 A;  5E4W A;  5ENU A;  22GS A;  3DML A;  2VCZ A;  3KH7 A;  4ECB A;  4YWM A;  3S15 L;  5ECN B;  3TKP A;  5IIZ A;  4ZL8 A;  2H71 A;  4ULX A;  1YKA A;  2OE3 A;  2LJK A;  4KF9 A;  1PMT A;  3EU3 A;  1SYR A;  2WDU A;  5IYD L;  3FZ5 A;  4V2N A;  5D9X A;  2PVX A;  3ZFL A;  4J2F A;  2CA8 A;  1OVN A;  1Z6M A;  1K0A A;  2GSQ A;  4AI2 A;  1YEP A;  4GTU A;  4EUY A;  2RM6 A;  4PGT A;  2AJQ B;  2HNL A;  4A3F L;  4F03 A;  4LA1 A;  3I4M L;  2B1L A;  4QL9 A;  4K7O A;  2MS3 A;  1JFU A;  2E2J L;  2AUV A;  4HI7 A;  1WCM L;  1E2Y A;  4FQU A;  4H86 A;  4POM A;  1RDG A;  2FA4 A;  4FYU A;  1FHM A;  4WET A;  1M99 A;  2H12 A;  5KN0 A;  3S1M L;  4Y52 L;  3IHG A;  2YWM A;  1U3A A;  5AIV A;  2LKU A;  4YAV A;  3U5R E;  3EU4 A;  2JA5 L;  3EMP A;  3BJ5 A;  1U88 A;  2EIQ A;  4AR4 A;  2L4Q A;  2F8A A;  4Q5Q A;  5F05 A;  2VUP A;  4WBR D; 
#chains in the Genus database with same CATH homology
 4GST A;  3GST A;  2J9H A;  1WJK A;  3UL3 A;  1XZO A;  1O73 A;  4TRX A;  2ZIX A;  1Y25 A;  1X5E A;  2HRA A;  2DML A;  3F0I A;  4EE0 A;  2VL6 A;  2B5E A;  1R0I A;  2LUS A;  5JCG A;  5MFP A;  5AI2 A;  2YAN A;  2PWJ A;  4MZC A;  2PYA A;  2GZY A;  2OBK A;  4PUF C;  3RBT A;  1WRY A;  2CX3 A;  4GRF A;  3BOA A;  2H1G A;  4KSO A;  5F0G A;  1I9D A;  3DVX A;  6GSU A;  2L4C A;  4XS4 A;  5DDL A;  2H1A A;  3BCI A;  3EUR A;  4ZBD A;  2K18 A;  5DAK A;  5ECR B;  2J23 A;  3L9U A;  4BL7 A;  1BED A;  3VI7 A;  2IWT A;  2PU9 C;  5J3R A;  2PER A;  4DSR A;  3WT1 A;  2H75 A;  4GSS A;  1FHE A;  2JU5 A;  1A23 A;  5JCW A;  1LTL A;  3Q19 A;  2V3B B;  4MF7 A;  1EP7 A;  2FWG A;  1BFY A;  1XXU A;  3VWW A;  1K3Y A;  2O7K A;  3HA9 A;  1EWX A;  3TJF A;  1IU6 A;  1O8X A;  1S24 A;  3ZLP A;  2G0F A;  4JBB A;  2YJH A;  5ECH B;  1NXG A;  2A6H D;  2LCQ A;  5ELA A;  1SK2 A;  4HUA A;  1T4Z A;  2GZZ A;  3GL3 A;  3PZA A;  2HE3 A;  2K6V A;  3C1R A;  5LD0 A;  3IA1 A;  2R0G A;  3GH9 A;  1Y6E A;  4PQH A;  2YPM A;  1Z7P A;  1IRO A;  3F4R A;  1SMU A;  3FR3 A;  5GAP D;  1B9Y C;  1USB A;  1RDV A;  2N5F A;  3O3T A;  2DC5 A;  1T8E B;  3QPM A;  3IU3 I;  2K8V A;  3QR6 A;  4I2T A;  5ID2 A;  1EV4 A;  4PNF A;  2L5O A;  1ERV A;  4Z2T A;  3BCK A;  3IC8 A;  2GQM A;  5F07 A;  4IEL A;  2DKH A;  1O7U A;  3CTG A;  2VCX A;  1YV1 A;  1M9B A;  5DM6 1;  3ERG A;  3E0U A;  4N30 A;  2FNO A;  1SMW A;  1ZYE A;  2O8V B;  1TI1 A;  1FB0 A;  5CRH A;  3UBL A;  2DJJ A;  2LEG A;  2R37 A;  3TJJ A;  1SMM A;  4KW6 A;  1XFL A;  5GAG c;  4Z2U A;  1TU8 A;  3HZ4 A;  1NW2 A;  3L4N A;  5A4V A;  4L0U A;  2V1M A;  4O5R A;  4TXV A;  4X1U A;  5HFG A;  3VWX A;  4DSS A;  1N2A A;  4AJ6 A;  5BMU A;  1H4O A;  1XWK A;  2PSM C;  3F4S A;  3MSZ A;  1GTA A;  3C7M A;  3D0Z A;  3VWU A;  5DM7 1;  1FG4 A;  1PL1 A;  4K7N A;  2HSH A;  4OMV A;  4CY8 A;  2OA7 A;  3LGC A;  3K35 A;  2PN8 A;  2X8G A;  4MF5 A;  4KE3 A;  3KYX A;  3VFI A;  3RZT A;  3QAV A;  4K5R A;  4BVX A;  3D21 A;  4TKY A;  5GAE c;  5IO0 A;  4TW5 A;  2VCV A;  3GKK A;  2OKA A;  1EGR A;  2BE5 D;  5DBQ A;  3TJK A;  4PX1 A;  9GSS A;  2NTO A;  3L0H A;  1JZR A;  3GTU B;  4IKH A;  5AN1 A;  1VF4 A;  3D4M A;  3DGQ A;  3ZML A;  4D73 A;  1AQV A;  1YQ1 A;  4JU5 A;  1H7V A;  4PUA A;  1A24 A;  2IMD A;  2P5R A;  4O5U A;  5MFZ A;  1Q4J A;  2L6C A;  1SYX A;  5D9V A;  3DRN A;  3DYR A;  5J41 A;  3IAS 2;  1DE1 A;  4ZXG A;  4HOJ A;  4EVM A;  1OYJ A;  1URM A;  5MGN A;  4GWR A;  1ZRP A;  1R0H A;  3RPN A;  3ZRD A;  3TRX A;  1AQX A;  17GS A;  2JAC A;  2X8C A;  2YCD A;  1FOH A;  1C72 A;  1GSF A;  1AC1 A;  4WKW A;  4EIQ A;  2R0P A;  3WWN B;  4ZB6 A;  1BE7 A;  5DJM A;  3RPP A;  2QSI A;  5CRW A;  5ECI B;  5G30 A;  1XVW A;  3H8Q A;  2YNX A;  2LJA A;  1K0D A;  4FO5 A;  1UVZ A;  4V2L A;  3IAM 2;  3GA4 A;  1N8J A;  3WWL A;  4I6X A;  1ZMA A;  4BWS A;  2GT6 A;  4PQ1 A;  2XJQ A;  2IN3 A;  1WOU A;  2IIY A;  2I81 A;  5KN1 A;  4O92 A;  5G1L A;  2VD1 A;  2H1B A;  2CX4 A;  4F2I A;  1AIU A;  5G5F A;  4AI3 A;  1LKM A;  1PQN A;  3PGT A;  1MTC A;  1F3B A;  5LCZ A;  2DJ2 A;  3VUR A;  4MA9 A;  5J9B A;  2LRT A;  2YN1 A;  1A0F A;  1R4W A;  2CV4 A;  2YOI A;  2B6M A;  3P8B A;  2FA8 A;  4OCF A;  5D9T A;  2K9F A;  1FO5 A;  2B3S A;  4V2M A;  5D8I A;  1MDJ A;  2R4V A;  3G7Y A;  2KLX A;  3EE2 A;  5HFK A;  1K0O A;  2XPE A;  2YJ7 A;  4GQC A;  1V40 A;  1I5G A;  2WS2 A;  2JAD A;  3MNG A;  1FVJ A;  3R2Q A;  1W4V A;  4NXI A;  2VL3 A;  1IW7 D;  2A68 D;  4CW9 A;  1EOG A;  3PKJ A;  1V2A A;  1XIY A;  3TJG A;  3F8U A;  1T9P A;  4LLR A;  3C8E A;  1TP9 A;  3QD9 A;  1EOH A;  5IM9 A;  5B8A A;  2LV3 A;  2CAI A;  3HCZ A;  1B2J A;  3GN3 A;  2NDO A;  1MEK A;  1EZK A;  4AHW A;  4FIW A;  3G7J A;  2PVQ A;  2N5B A;  4B8C D;  2DMM A;  1ABA A;  4Z7X A;  3ZL5 A;  4OD7 A;  2IL3 A;  3MWH A;  1GSS A;  3HY2 A;  3S9F A;  4IJ3 A;  4YWL A;  2YZU A;  1NNQ A;  1FOV A;  5DCH A;  4HJM A;  5MLC 3;  2B5Y A;  1TI3 A;  3TKR A;  2C6B A;  4MDC A;  1R5A A;  2JSY A;  1JYB A;  3FZ9 A;  1T4Y A;  5A4W A;  3SWL A;  4TR1 A;  4AHY A;  1R0J A;  2ZNM A;  3KGK A;  3DKS A;  5AGY A;  3B0A B;  3MPS A;  3K8N A;  5BRT A;  1QMV A;  1ERU A;  4XS4 B;  1BRF A;  5INY A;  5DAK B;  4BL7 B;  1WJV A;  3WD6 A;  3W8S A;  3U6V A;  1F37 A;  1EEM A;  1B9X C;  3VPB E;  2FUG 2;  3GSS A;  1A2L A;  2B1K A;  3FR6 A;  2GQK A;  4I2U A;  1YK4 A;  3ZTL A;  2RLI A;  4AJ7 A;  1QCV A;  4I8B A;  2OAD A;  3ZIV A;  2O5J D;  3O6T A;  1WPI A;  1J9B A;  3CRU A;  5FHI A;  2HFD A;  2E2G A;  2ERJ A;  3QMX A;  1XOB A;  3A3T A;  3H93 A;  1ZGN A;  4MP4 A;  1M2A A;  4TR4 A;  3KD0 A;  3WGX A;  1K0N A;  4ML1 A;  3I6A A;  3KMO A;  18GS A;  5IOW A;  3IHQ A;  2IMI A;  2MMN A;  2DSA A;  4G10 A;  3QDN A;  2HLS A;  1G0T A;  2WGR A;  1IU5 A;  6RXN A;  3PH9 A;  1HNB A;  3QFA C;  5ECM B;  4EDY A;  1GTB A;  3KH9 A;  2DJ3 A;  2QL0 A;  1K0M A;  5ID2 B;  5IQY A;  1LU4 A;  2XBQ A;  4KAE A;  2DJ0 A;  3ME8 A;  1GP1 A;  3M8N A;  4XTS A;  4Q5R A;  3PR8 A;  3TRQ A;  2B7J A;  2MYG A;  4ZL7 A;  5H5Q A;  3J7Y k;  1CQG A;  1TTZ A;  4YKG A;  1SJZ A;  4YAP A;  1Z7R A;  2H73 A;  3KEB A;  4ZBB A;  4TVM A;  3GUS A;  5C04 A;  1VZH A;  3KTL A;  2OJL A;  2KKD A;  2TRC P;  3FK8 A;  2QKE A;  1B13 A;  3PIO 1;  1JZO A;  5HR3 A;  2A69 D;  2IMF A;  1X9M B;  5CNW A;  5IPH A;  2WRT A;  3HJM A;  2H66 A;  4K9F A;  2AB6 A;  2HSY A;  1SJI A;  2HRN A;  4IP1 A;  2DIY A;  1XWG A;  3ZRE A;  2XJT A;  2A6E D;  4BVY B;  1VF3 A;  2JL4 A;  5GST A;  1TK8 B;  1O81 A;  1V9W A;  5IMA A;  2HRK A;  5MF6 A;  1TRS A;  4NWY A;  3GL5 A;  3RZ6 A;  2H30 A;  1T9Q A;  4DSS B;  1RQM A;  2C0E A;  1GLQ A;  2RDV A;  1XBS A;  1YDK A;  1MD3 A;  2H76 A;  4V19 6;  5IMD A;  1TDI A;  4MH3 A;  4WFN 1;  3GUR A;  2M4V A;  4ZIJ A;  4KH7 A;  3PPU A;  1GNW A;  3I69 A;  3FRC A;  4EO3 A;  4U67 1;  2H01 A;  1EV9 A;  4I97 A;  4AR5 A;  3IBH A;  2A2S A;  4X4J A;  1UA5 A;  3IK7 A;  4MJA A;  4LL4 B;  3J7Z 1;  1AUC A;  4POF A;  3ED3 A;  3US3 A;  4BVX B;  1QUW A;  1G6Y A;  2NPB A;  5IO2 A;  2V6K A;  3CRT A;  5AIX A;  3FZA A;  3UEM A;  4ZN1 B;  3NOF A;  2VL2 A;  1GTI A;  4ZL9 A;  4K6X A;  3KYY A;  3PIN A;  2Z9S A;  2XBI A;  4WR4 A;  2O85 A;  1R0G A;  3QFB C;  3FMW A;  3N9J A;  5HR0 A;  1TOF A;  3WT2 A;  4Q5N A;  4D73 B;  3ERW A;  2XJS A;  1GSE A;  3M3M A;  4K0G A;  4E8H A;  1SL2 B;  2UZ8 A;  4IQA A;  1PN0 A;  3KYW A;  5HFI A;  1TKD B;  3TKQ A;  4MPF A;  3DVW A;  3KCM A;  5E59 A;  3JCM L;  2CAQ A;  2DJK A;  4UY8 1;  1MD4 A;  2M6O A;  5ECS A;  4MAB A;  4WF5 A;  1Z6N A;  2YV9 A;  3AY8 A;  4MZW A;  1G7O A;  5A4U A;  2KP1 A;  1GL8 A;  1M0U A;  4AR6 A;  3KTB A;  2X99 A;  4RXN A;  2GDR A;  1THX A;  4XRA A;  1T00 A;  2VIM A;  2JZS A;  2WUL A;  3CSH A;  5HR2 A;  2OE0 A;  2MMO A;  1RYQ A;  1PL2 A;  5CRG A;  1BAY A;  1GSU A;  3IR4 A;  3KXO A;  4ID0 A;  1F2E A;  1X5C A;  1ZYP A;  4QQ7 A;  2O89 A;  4YKF A;  2I4A A;  2A4V A;  1X9S B;  3H1N A;  1YUZ A;  4WR5 A;  5COH A;  2JSZ A;  2QC7 A;  2G2Q A;  5G1K A;  1VF1 A;  3FR9 A;  2JI1 A;  2AAW A;  4LMV A;  3V1W A;  4L0W A;  1XPV A;  4FYC A;  4K1F A;  2F51 A;  4ICY A;  1GNE A;  1DUG A;  1OC3 A;  1YY7 A;  1V58 A;  4DSQ A;  2VCQ A;  3IXR A;  4X0X A;  3PIP 1;  4POG A;  1QK8 A;  1F3A A;  2CZ2 A;  2J9U B;  4EC0 A;  1YK5 A;  1SD9 A;  4BVY A;  1GH2 A;  3I9V 2;  4ZB8 A;  5JWR B;  2C0F A;  2OAC A;  1ZCP A;  1OAZ A;  4JAE A;  4G0I A;  4K7I A;  4OFT A;  4YQU A;  1SL0 B;  1KTE A;  4IP6 A;  3A5W A;  5JVG 1;  1XW6 A;  3KP8 A;  2OE1 A;  3ZVJ A;  1SK0 A;  3NIV A;  3SBC A;  1YF0 A;  1YUX A;  1XWC A;  4WBJ A;  5ECL B;  2C1Y A;  1HD2 A;  4V1A p;  2R0C A;  3GHA A;  3LWA A;  2FWE A;  4TPU A;  2TRX A;  2CKC A;  2FLS A;  1EGO A;  4JAF A;  3F3R A;  1WIK A;  2AV4 A;  3RHB A;  4KCE A;  1IYH A;  3J7Y 1;  2D2Z A;  1BYE A;  3KIJ A;  3J7Y b;  4MF6 A;  2M46 A;  3C73 A;  1VRS D;  3MAK A;  11GS A;  2XPD A;  1GSQ A;  5KOX A;  5G5E A;  1ML6 A;  5EY6 A;  2K2D A;  1U87 A;  1SEN A;  1YZX A;  3UAR A;  3HXS A;  2ON7 A;  1CAD A;  4N11 A;  2KN9 A;  2A2P A;  5K2M E;  2LNS A;  3WGE A;  3GV1 A;  1JLW A;  5EIO C;  3ZG6 A;  2HXK A;  2P31 A;  3HKR A;  3VLN A;  1LKO A;  1UC7 A;  2VO4 A;  1LKP A;  4E8E A;  1XW9 A;  5D9W A;  1W89 A;  4O7H A;  4TOP A;  4TR1 B;  6GSY A;  6GSW A;  2FGX A;  1HNA A;  2PVO C;  3APO A;  4MMM A;  3L9V A;  1M2D A;  4P3Y B;  2QA1 A;  3W8J A;  3HVS A;  4RI7 A;  13GS A;  5JCU A;  4J56 E;  3QVD A;  5D96 A;  5H5R A;  3TKS A;  2MBS A;  4KSM A;  1TK5 B;  4A5P A;  5DQS A;  5EVO A;  3GKN A;  3GKX A;  2H8L A;  4RUV A;  3NFP I;  1KEB A;  2K8S A;  1Z5Y E;  2YWO A;  3FHK A;  1PA3 A;  3CMI A;  2VCT A;  2AYJ A;  3UVH A;  3BD2 A;  8GSS A;  3UVT A;  5F8B A;  2L6D A;  1PRX A;  4HDE A;  3G7I A;  4XXB B;  2I9H A;  3TOU A;  5CAX A;  4OWY A;  1ODH A;  1G6W A;  4WEY A;  3CSJ A;  2NVL A;  4GCI A;  4IW9 A;  4TR0 A;  2ON5 A;  1H75 A;  3IE3 A;  1VCX A;  1EP8 A;  3GYK A;  4TR3 A;  2CVD A;  5D93 A;  4IJI A;  4XGH A;  4K2X A;  4N0Z A;  2ES7 A;  3EPT A;  4IQ1 A;  1TRV A;  4MLY A;  2CKA A;  5DQY A;  3WYW A;  2GSS A;  1S3D A;  2GTU A;  2GMG A;  4IVF A;  2H0H A;  4OO4 A;  1YJ6 A;  3LXZ A;  4JED A;  4TXO B;  1JLV A;  1ZOF A;  1XCC A;  3EVI A;  4LHL A;  5EIN C;  3LOR A;  3IC4 A;  3NZN A;  4HEA 2;  4WXT A;  5DCG A;  5CO3 A;  3WGD A;  3KM6 A;  3HHV A;  1Q98 A;  1TRU A;  1SKS B;  2PVE A;  2CVK A;  4DEJ A;  4GS7 D;  5GSS A;  3HVV A;  3D4T A;  2LRC A;  3C71 A;  2YWN A;  2LRN A;  4KDU A;  1SU9 A;  3A5I A;  2HRF A;  2C4J A;  2RM5 A;  4JE1 A;  3MYD A;  4X43 A;  2C80 A;  4RI6 A;  4USS A;  3P7X A;  4XS1 A;  5IMZ A;  2AYT A;  1WE0 A;  1V57 A;  2HR5 A;  2C3T A;  3HVX A;  2AHE A;  3TRP A;  3UAP A;  1J08 A;  3FZ4 A;  2RUF A;  2YV7 A;  4PQI A;  2HZE A;  4AI1 A;  2JZT A;  5AI3 A;  3ISO A;  2XHF A;  1SKW B;  1OKT A;  2IFQ A;  4BA7 A;  4NV5 A;  4HZ4 A;  2H19 A;  4G0L A;  3KJY A;  1PX7 A;  4HQZ A;  2M80 A;  1DBY A;  4IBP A;  2F3M A;  1CQH A;  4FYB A;  4K9Z A;  5L71 A;  2XJP A;  2F8F A;  5GZZ B;  1JZD A;  4NMU A;  1XWA A;  4MJB A;  3UMA A;  1O6J A;  3BBY A;  2VLT A;  2MMA A;  4HZ2 A;  5LNK e;  3CSI A;  2R2J A;  2XJR A;  3CTF A;  3OR5 A;  4ZIL A;  1B71 A;  2DBC A;  5FWG A;  2HZF A;  2MMZ A;  4GSN A;  2FWF A;  3ME7 A;  4L5L A;  7RXN A;  4L8E A;  3LFL A;  2GLR A;  3F9U A;  4DVC A;  1FHH A;  6GSX A;  1K3O A;  3LSZ A;  1FAA A;  3G9B A;  12GS A;  4G2E A;  2R6K A;  3APQ A;  1RYT A;  3LPE B;  3HD5 A;  2XJV A;  1LJR A;  2L5L A;  1T1V A;  2REM A;  3D5J A;  4EXJ A;  1ZZY A;  3TKS E;  2H0I A;  2JZR A;  4MK3 A;  1SL1 B;  2HYX A;  2DKI A;  1GUM A;  3IRA A;  1F9M A;  3A2W A;  4BWQ A;  2YWI A;  2VM1 A;  3ZYW A;  4HU9 A;  14GS A;  2LNT A;  4N10 A;  2H6Z A;  2KP2 A;  5DAL A;  1UN2 A;  2WJU A;  3EWL A;  4MPG A;  3RAZ A;  5HR1 A;  1TRW A;  3LYK A;  4GXZ A;  1AXD A;  1B48 A;  1ILO A;  3QOU A;  5ECQ B;  3HYP A;  3IV4 A;  4TXO A;  1R5P A;  3ZIJ A;  2LST A;  4K0N A;  2V0F A;  1R26 A;  2C0G A;  1DSB A;  1M7T A;  3LG6 A;  1O85 A;  3HDC A;  1BJX A;  19GS A;  1T3B A;  1KBN A;  3VPT A;  4HJ2 A;  2E0Q A;  1C09 A;  1F6M C;  4F0C A;  5C00 A;  4MZB A;  3FY7 A;  3M1G A;  4LMW A;  1TW9 A;  3D22 A;  1NXE A;  3LJR A;  4MCU A;  4XCS A;  1O8W A;  4KCA A;  1CAA A;  4L5O A;  3L78 A;  2B7K A;  2ZUP A;  1B2O A;  4PUR A;  4TN8 A;  2A2R A;  2M6P A;  1S3C A;  3KYV A;  3LNL A;  4KA0 A;  1ERW A;  2PMT A;  3VK9 A;  4ILF A;  3QAG A;  5KEJ A;  2ZCT A;  2X4A A;  2IME A;  2LJR A;  1GTU A;  4WF4 A;  1ZYN A;  2M72 A;  4LL1 B;  5IOX A;  1GSD A;  3P2A A;  1XW5 A;  2CZ3 A;  3TUE A;  4ZB9 A;  4YQV A;  4HQS A;  4EDZ A;  3M9J A;  2H0G A;  2CQ9 A;  2H6X A;  4GLT A;  2LQQ A;  3F6F A;  4O32 A;  1OWC A;  1VZG A;  4J57 E;  3RYG A;  5JWQ B;  6GSS A;  4AR3 A;  1GRX A;  1VF2 A;  1X5D A;  3MIX A;  4HS1 A;  5J9C A;  3EMX A;  4K5S A;  5F06 A;  2VL2 C;  5KOW A;  1KNG A;  4EF0 A;  2A4H A;  4POB A;  5ECK B;  4XS6 A;  2DIZ A;  1QQ2 A;  1R0F A;  1G7E A;  2GSR A;  4G0K A;  1GUL A;  3MSU A;  1OC9 B;  2PGT A;  4ZN3 B;  1ZL9 A;  1A8Y A;  1BX9 A;  3HJP A;  1A2M A;  3TCO A;  1TJD A;  4CY6 A;  2H1D A;  4XRD A;  2KHP A;  3P90 A;  3VI5 A;  1V98 A;  4ISD A;  3Q74 A;  4IHU A;  4PNG A;  1PGT A;  2R3X A;  3GKM A;  4FH8 A;  2VL9 A;  3ZVJ D;  1QFN A;  16GS A;  1U6T A;  2KOK A;  1GWC A;  3ZMK A;  2M4Y A;  1OE7 A;  1U3I A;  1HYU A;  3QAW A;  4ECI A;  20GS A;  1T9O A;  1K0C A;  3ZFB A;  1IRN A;  3DIE A;  2FY6 A;  5B7C A;  1SKR B;  3F3Q A;  2Z3Q B;  4POK A;  2WCI A;  4EKZ A;  3TDG A;  3F4T A;  5EPF A;  2GST A;  3GNJ A;  1E8J A;  4ACS A;  4E6Y A;  4RQR A;  1Z92 B;  2N5A A;  5IMC A;  3PKI A;  3DEX A;  4IGJ A;  3VPQ A;  3W6G A;  4F0B A;  3EC3 A;  3F6D A;  4ECC A;  1K3L A;  2HSM A;  4O5Q A;  2MZC A;  1TXX A;  2FCH A;  3L9S A;  3E3E A;  3P8W A;  2P5Q A;  3A2V A;  3IPZ A;  3M0F A;  4AI0 A;  3CXG A;  2I3Y A;  5CP1 A;  5H1S c;  5JVH 1;  1AQW A;  3GRX A;  3GX8 A;  2L59 A;  1WP0 A;  5J4U A;  2OBI A;  2X64 A;  3IOS A;  3GH6 A;  1M9A A;  4F9Z A;  2DJ1 A;  3KYU A;  1OC8 A;  2V41 A;  3R3E A;  2V2G A;  4AF2 A;  5D73 A;  2GQL A;  1YEX A;  1GSY A;  5KN3 A;  2C3N A;  1J0F A;  2E2M A;  4ECJ A;  1ZYQ B;  1OKD A;  1THO A;  2ALB A;  4NHZ A;  2LQO A;  1WWJ A;  2VAF A;  4YH2 A;  2WFC A;  4Q5F A;  1QYB A;  4JAG A;  2IPA A;  1K0B A;  2PUK C;  5EL8 A;  2VM2 A;  1SD8 A;  3IDV A;  2FHE A;  2V0E A;  2HI7 A;  4KB3 A;  1VZI A;  4MNN A;  5IMV A;  2E7P A;  1GUH A;  3MDK A;  3QCP A;  4KND A;  4POL A;  1DVB A;  1XOA A;  4G19 A;  3EIN A;  1Z3E A;  5A5K A;  2RUE A;  2VOC A;  3I43 A;  2RII A;  4MJC A;  4RQX A;  1MDI A;  3LW9 A;  2NYD A;  2EIO A;  1DX8 A;  3UOM A;  1M2B A;  2HZE B;  4CDO A;  1OC9 A;  2EC4 A;  2I1U A;  4MJE A;  5ABR A;  2CR8 A;  1BQ8 A;  2KUC A;  4F82 A;  2F9S A;  2Z3R B;  2H72 A;  3H79 A;  2BTO T;  4JR4 A;  4EL1 A;  2GZP A;  2IFQ B;  1X0R A;  3EYT A;  1T7P B;  1PSQ A;  1DE2 A;  3Q6O A;  2IMK A;  1A8L A;  4QL7 A;  3LYP A;  3D6I A;  2MBT A;  1E6B A;  4KX4 A;  4I5Q A;  2VLU A;  2L0Z A;  3TB2 A;  1S3A A;  3HZ8 A;  2JI3 A;  4ML6 A;  3DD3 A;  5AN9 H;  1LBK A;  3APS A;  5FT3 A;  1PD2 1;  4AGS A;  1JHB A;  1A2J A;  4AHZ A;  2BJX A;  2FD3 A;  4JZQ A;  1ERT A;  4LHN A;  4Z2R A;  3DWV A;  1Z9H A;  2PPT A;  3E9J B;  1NHO A;  3ZIT A;  2CVB A;  5J5N A;  2H70 A;  4HU7 A;  4ME3 A;  4EIP A;  3PWF A;  1QXH A;  2XC2 A;  8RXN A;  3TKS C;  5ECP B;  3UIW A;  2H6Y A;  1OWB A;  4JRR A;  2V6O A;  3FEU A;  4TVE A;  5DVB A;  2YP6 A;  1BG5 A;  4KDY A;  1GLP A;  2PBJ A;  1RW1 A;  2WZ9 A;  2VLV A;  5JWO B;  3TGZ A;  2XJU A;  5GAN D;  4KGI A;  5IPG A;  3B08 B;  3VWV A;  3F63 A;  4IS0 A;  5DJL A;  2V32 A;  3KMN A;  5ECO B;  3QQC E;  3KP9 A;  4JR6 A;  1XVQ A;  6GSV A;  3SS2 A;  2R5G A;  5B6N A;  3IK9 A;  2WB9 A;  2JI2 A;  1BQ7 A;  2LTK A;  5DAL B;  1RK4 A;  2B5X A;  1ST9 A;  2NBS A;  5ELG A;  4YQM A;  4GQF A;  3LQ7 A;  4NPB A;  3KZQ A;  3O76 A;  3UJ1 A;  1FB6 A;  3FKF A;  1ACV A;  4OCE A;  4GF0 A;  5GAD c;  1SJ6 A;  2YZH A;  2VD0 A;  1HNC A;  2CT6 A;  1X9W B;  1RB9 A;  2X49 A;  5G31 A;  3LEF A;  3CBU A;  3UBK A;  1B4Q A;  1IYI A;  1HQO A;  4XIH A;  1VGL A;  1AAZ A;  1XWB A;  2GS3 A;  2FWH A;  4N0V A;  4JAD A;  1RWD A;  1NSW A;  5CRE A;  4G6B A;  2L57 A;  2C3Q A;  5CRD A;  3Q18 A;  4G9H A;  1FW1 A;  1A0R P;  5KN2 A;  3LXT A;  4ZBA A;  5G2Z A;  4NHW A;  4XHM A;  2C0D A;  2DSX A;  3GTU A;  1TK0 B;  3FW2 A;  3HJO A;  4NAX A;  3GX0 A;  2C6A A;  3C1S A;  4AJ8 A;  2GT5 A;  5B6M A;  4BPY A;  3ZZX A;  2HT9 A;  1PKW A;  2IJY A;  5H5S A;  3DXB A;  1FVK A;  1QGV A;  4K8M A;  3ERF A;  3M9K A;  4PTS A;  4MH2 A;  1PN9 A;  1YKC A;  1EEJ A;  3FYG A;  5IMF A;  1NHY A;  1PKZ A;  2B5I D;  1YF1 A;  3RHC A;  1AW9 A;  2VCW A;  1TU7 A;  2O87 A;  3GFK A;  1B8X A;  10GS A;  2TIR A;  4KDX A;  2QA2 A;  2GGT A;  2H74 A;  4V1A g;  1WMJ A;  1GUK A;  4CHS A;  4KUN A;  2BMX A;  1OE8 A;  2C8U A;  1ON4 A;  6GST A;  2EIR A;  5CYY A;  3RDW A;  4PXO A;  3N5O A;  3TJB A;  4OO5 A;  7GSS A;  1SK1 A;  2GVP A;  2ERS A;  2QGV A;  1JZW A;  3CYN A;  3A2X A;  3GIX A;  1NM3 A;  4IN0 A;  5IY0 A;  3A44 A;  5B8B A;  2DLX A;  1B4P A;  3TOT A;  1S2Z A;  1S30 A;  4AHX A;  4K2D A;  1PX6 A;  3GMF A;  4NV2 A;  5AIS A;  4OFM A;  5GAH c;  2X8H A;  5HQP A;  1MDK A;  1R7H A;  5RXN A;  3H4K A;  2LS5 A;  4OFN A;  2P0G A;  1BQ9 A;  5E4W A;  5ENU A;  22GS A;  3DML A;  2VCZ A;  3KH7 A;  4ECB A;  4YWM A;  5ECN B;  3TKP A;  5IIZ A;  4ZL8 A;  2H71 A;  4ULX A;  1YKA A;  2OE3 A;  2LJK A;  4KF9 A;  1PMT A;  3EU3 A;  1SYR A;  2WDU A;  3FZ5 A;  4V2N A;  5D9X A;  2PVX A;  3ZFL A;  4J2F A;  2CA8 A;  1OVN A;  1Z6M A;  1K0A A;  2GSQ A;  4AI2 A;  1YEP A;  4GTU A;  4EUY A;  2RM6 A;  4PGT A;  2AJQ B;  2HNL A;  4F03 A;  4LA1 A;  2B1L A;  4QL9 A;  4K7O A;  2MS3 A;  1JFU A;  2AUV A;  4HI7 A;  1E2Y A;  4FQU A;  4H86 A;  4POM A;  1RDG A;  2FA4 A;  4FYU A;  1FHM A;  4WET A;  1M99 A;  2H12 A;  5KN0 A;  3IHG A;  2YWM A;  1U3A A;  5AIV A;  2LKU A;  4YAV A;  3U5R E;  3EU4 A;  3EMP A;  3BJ5 A;  1U88 A;  2EIQ A;  4AR4 A;  2L4Q A;  2F8A A;  4Q5Q A;  5F05 A;  2VUP A;  4WBR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...