4ZN3B

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
HHHHHSQDPRACLKCKYLTNDEICPICHSPTSENWIGLLIVINPEKSEIAKKAGIDIKGKYALSVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2015-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.90 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4zn3B00
4ZN1B 3QQCE 3P8BA 1RYQA 4ZN3B 3LPEB
chains in the Genus database with same CATH superfamily
3B0AB 2R92L 1BQ9A 4AR3A 5M5WL 3GTOL 1CADA 1Y1VL 4K9FA 4GS7D 3H0GL 3S2HL 3NFPI 5M5XL 5FLML 3S15L 2A68D 4A3KL 2H12A 3P2AA 5AI2A 3MSUA 3J7Z1 2CKCA 2R93L 1PFVA 1WJVA 1R0GA 1DVBA 1TWHL 3HOWL 2XJPA 3PWFA 3B08B 2ZIXA 2Z3RB 2AUSB 3S14L 5GAGc 5JVH1 3LWRB 2Z3QB 3LWVB 3ZG6A 2XJVA 1LKOA 3H99A 3PZAA 1BE7A 5AN9H 2NVYL 3S1RL 4A3IL 6RXNA 3K7AL 1SFOL 2PPTA 3WWNB 2NVTL 2O5JD 3HOXL 2A6HD 3PL5A 3KYUA 3GTGL 1YK5A 5M3FL 2VUML 5MFZA 2AQCA 2RFKB 5GADc 4YWLA 2B63L 2PMZP 3S1NL 3CQZL 1T9QA 4TPUA 1F4LA 1RB9A 4LHNA 2M6PA 5EINC 2M4VA 4POGA 3PKJA 1RYQA 4A3DL 2J9UB 2JI1A 2V0FA 3LPEB 2BE5D 5MLC3 2NVXL 1T9OA 4QIWP 2E2IL 3P8BA 2LCQA 3GTQL 4A3LL 1SMUA 4BBSL 3VPBE 1FHHA 8RXNA 5IP9L 5C4JL 4BXXL 1PZXA 2JA6L 3GTML 5IY0A 1TWAL 1B2JA 2XJQA 2JA5L 4B8CD 1YK4A 2NVQL 4A3EL 4JADA 3IU3I 2K2DA 2V0EA 3KYWA 2M6OA 2KN9A 3FKIL 3GTJL 3HOZL 2CKAA 5C4XL 1VZGA 3M4OL 2JA8L 3SS2A 4Y7NL 1B2OA 5RXNA 3PKIA 1IRNA 3GTLL 1YV1A 4POFA 5C44L 5IYCL 1QYBA 1VZHA 4AHXA 1YUXA 3GTPL 1I50L 3S16L 2HVYC 1ZRPA 3PO3L 3S1QL 3J7Y1 2V3BB 1FHMA 1R0IA 2E2JL 3KYXA 5M5YL 4WFN1 2XJRA 4A3FL 1BFYA 3MPSA 2E2HL 1Z92B 2WAQP 1TWFL 1IROA 5DM61 2KKDA 1LKMA 1RDGA 3FDJA 4XXBB 1E8JA 1JYBA 1SMWA 3M3YL 1CAAA 5AI3A 4E6YA 2JA7L 4AHZA 5K2ME 5EIOC 2WB1P 3RZOL 3PIO1 1H7VA 2DSXA 4LHLA 3RYGA 1PFYA 3HAXC 1TWCL 3I4NL 1WCML 1S24A 5GAEc 4RXNA 2VL6A 4AR5A 4ME3A 4XGHA 3LWQB 1LKPA 4A3GL 3RZDL 3GTKL 1QCVA 3HKZP 2CR8A 4C3JL 1RWDA 2RDVA 1ODHA 2GMGA 4TVMA 1BQ8A 5IP7L 1B71A 1OWBA 1Y1WL 3H97A 4ZN3B 4JAGA 2PVEA 1I6HL 2XJTA 4AHWA 4V196 2PYAA 3WWLA 3KYVA 4AR6A 1PFWA 4YWMA 1VCXA 4JAFA 2EY4E 3HOVL 3S2DL 5MF6A 2PVXA 1T9PA 5MFPA 3PO2L 3RZTA 1S30A 3QQCE 4C3HL 3JR7A 2L0ZA 1R0HA 1R9TL 2APOB 1VZIA 1YUZA 4A3BL 1S2ZA 2MS3A 3LNLA 2JI2A 3LWOB 1IU6A 1K83L 3H3VM 4C2M1 4JAEA 4AYBP 2PSMC 1IU5A 1P7PA 2XJSA 2YU9L 1C09A 2M4YA 4ZN1B 2R7ZL 3S1ML 2Y0SP 3S17L 3H9BA 3I4ML 5GAHc 2A69D 3RZ6A 1R0FA 5C3EL 4G6BA 2ERSA 4AR4A 1LTLA 2QL0A 4BY7L 1NNQA 4A93L 3KYYA 4AI0A 5H1Sc 1QQTA 2C6AA 1DX8A 4X6AL 3HJYB 4AI1A 4UY81 1TWGL 3QVDA 3HJWB 4A3CL 7RXNA 3HOUL 1PFUA 3MQKB 1RYTA 4AI3A 5IYDL 1NXGA 2C6BA 2HR5A 5IYBL 4A3JL 1NXEA 5MGNA 2ERJA 1SMMA 4AHYA 3HOYL 2B5ID 3PIP1 4U671 5JVG1 5M3ML 3K35A 1OWCA 1RDVA 1I3QL 2A6ED 4A3ML 4AI2A 4C3IL 4BY1L 1BRFA 3LWPB 1B13A 5DM71 2NYDA 3H9CA 2AYJA 5FJ8L 1R0JA 4Y52L 2JI3A 3A44A 2XJUA 4BBRL 1IW7D
chains in the Genus database with same CATH topology
1YUZA 3B0AB 1S2ZA 2J9UB 2MS3A 2JI1A 5DM61 2KKDA 3LNLA 1LKMA 2V0FA 1BQ9A 1RDGA 2JI2A 2BE5D 3LPEB 5MLC3 1IU6A 1T9OA 4AR3A 3P8BA 4XXBB 2LCQA 1JYBA 4JAEA 1E8JA 1SMWA 1CADA 1SMUA 4K9FA 2PSMC 4GS7D 1IU5A 2XJSA 3VPBE 1C09A 1FHHA 2M4YA 3NFPI 1CAAA 4ZN1B 8RXNA 5AI3A 4E6YA 2A68D 4AHZA 5K2ME 5EIOC 3PIO1 1H7VA 5GAHc 2DSXA 2H12A 3P2AA 4LHLA 5AI2A 2A69D 3MSUA 3RZ6A 1R0FA 3RYGA 4G6BA 2ERSA 3PKJA 4AR4A 5IY0A 1LTLA 1B2JA 2XJQA 3J7Z1 1S24A 2QL0A 2CKCA 4B8CD 1YK4A 1NNQA 5GAEc 1WJVA 1IW7D 1DVBA 4RXNA 3KYYA 1R0GA 2VL6A 4AI0A 2XJPA 4JADA 5H1Sc 4AR5A 3IU3I 4ME3A 3PWFA 3B08B 2ZIXA 4XGHA 2C6AA 2Z3RB 1LKPA 1DX8A 1QCVA 2K2DA 2V0EA 5GAGc 5JVH1 4AI1A 3KYWA 4UY81 2M6OA 2CR8A 2KN9A 3QVDA 2Z3QB 3ZG6A 2XJVA 1LKOA 3PZAA 1RWDA 1BE7A 2RDVA 7RXNA 2CKAA 5AN9H 1ODHA 1RYTA 4AI3A 2GMGA 4TVMA 1BQ8A 1NXGA 1VZGA 6RXNA 3SS2A 1B71A 1B2OA 2C6BA 2HR5A 5RXNA 3PKIA 1OWBA 1IRNA 1YV1A 2PPTA 3WWNB 1NXEA 5MGNA 2O5JD 4POFA 2ERJA 4ZN3B 4JAGA 1QYBA 2A6HD 1VZHA 2PVEA 4AHXA 1YUXA 3KYUA 1SMMA 2XJTA 4AHYA 4AHWA 4V196 1YK5A 2B5ID 2PYAA 3PIP1 4U671 3WWLA 3KYVA 4AR6A 4YWMA 1ZRPA 5JVG1 3K35A 5MFZA 1OWCA 1RDVA 1VCXA 3J7Y1 2V3BB 2A6ED 4JAFA 1FHMA 4AI2A 1R0IA 5GADc 1BRFA 1B13A 3KYXA 5DM71 4YWLA 5MF6A 2PVXA 4WFN1 2XJRA 2NYDA 1T9PA 1BFYA 2AYJA 5MFPA 3MPSA 3RZTA 1S30A 1R0JA 1T9QA 3QQCE 2JI3A 4TPUA 3A44A 1RB9A 1Z92B 2XJUA 4LHNA 2L0ZA 2M6PA 5EINC 2M4VA 1R0HA 4POGA 1RYQA 1IROA 1VZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN1 B;  3QQC E;  3P8B A;  1RYQ A;  4ZN3 B;  3LPE B; 
#chains in the Genus database with same CATH topology
 3B0A B;  2R92 L;  1BQ9 A;  4AR3 A;  5M5W L;  3GTO L;  1CAD A;  1Y1V L;  4K9F A;  4GS7 D;  3H0G L;  3S2H L;  3NFP I;  5M5X L;  5FLM L;  3S15 L;  2A68 D;  4A3K L;  2H12 A;  3P2A A;  5AI2 A;  3MSU A;  3J7Z 1;  2CKC A;  2R93 L;  1PFV A;  1WJV A;  1R0G A;  1DVB A;  1TWH L;  3HOW L;  2XJP A;  3PWF A;  3B08 B;  2ZIX A;  2Z3R B;  2AUS B;  3S14 L;  5GAG c;  5JVH 1;  3LWR B;  2Z3Q B;  3LWV B;  3ZG6 A;  2XJV A;  1LKO A;  3H99 A;  3PZA A;  1BE7 A;  5AN9 H;  2NVY L;  3S1R L;  4A3I L;  6RXN A;  3K7A L;  1SFO L;  2PPT A;  3WWN B;  2NVT L;  2O5J D;  3HOX L;  2A6H D;  3PL5 A;  3KYU A;  3GTG L;  1YK5 A;  5M3F L;  2VUM L;  5MFZ A;  2AQC A;  2RFK B;  5GAD c;  4YWL A;  2B63 L;  2PMZ P;  3S1N L;  3CQZ L;  1T9Q A;  4TPU A;  1F4L A;  1RB9 A;  4LHN A;  2M6P A;  5EIN C;  2M4V A;  4POG A;  3PKJ A;  1RYQ A;  4A3D L;  2J9U B;  2JI1 A;  2V0F A;  3LPE B;  2BE5 D;  5MLC 3;  2NVX L;  1T9O A;  4QIW P;  2E2I L;  3P8B A;  2LCQ A;  3GTQ L;  4A3L L;  1SMU A;  4BBS L;  3VPB E;  1FHH A;  8RXN A;  5IP9 L;  5C4J L;  4BXX L;  1PZX A;  2JA6 L;  3GTM L;  5IY0 A;  1TWA L;  1B2J A;  2XJQ A;  2JA5 L;  4B8C D;  1YK4 A;  2NVQ L;  4A3E L;  4JAD A;  3IU3 I;  2K2D A;  2V0E A;  3KYW A;  2M6O A;  2KN9 A;  3FKI L;  3GTJ L;  3HOZ L;  2CKA A;  5C4X L;  1VZG A;  3M4O L;  2JA8 L;  3SS2 A;  4Y7N L;  1B2O A;  5RXN A;  3PKI A;  1IRN A;  3GTL L;  1YV1 A;  4POF A;  5C44 L;  5IYC L;  1QYB A;  1VZH A;  4AHX A;  1YUX A;  3GTP L;  1I50 L;  3S16 L;  2HVY C;  1ZRP A;  3PO3 L;  3S1Q L;  3J7Y 1;  2V3B B;  1FHM A;  1R0I A;  2E2J L;  3KYX A;  5M5Y L;  4WFN 1;  2XJR A;  4A3F L;  1BFY A;  3MPS A;  2E2H L;  1Z92 B;  2WAQ P;  1TWF L;  1IRO A;  5DM6 1;  2KKD A;  1LKM A;  1RDG A;  3FDJ A;  4XXB B;  1E8J A;  1JYB A;  1SMW A;  3M3Y L;  1CAA A;  5AI3 A;  4E6Y A;  2JA7 L;  4AHZ A;  5K2M E;  5EIO C;  2WB1 P;  3RZO L;  3PIO 1;  1H7V A;  2DSX A;  4LHL A;  3RYG A;  1PFY A;  3HAX C;  1TWC L;  3I4N L;  1WCM L;  1S24 A;  5GAE c;  4RXN A;  2VL6 A;  4AR5 A;  4ME3 A;  4XGH A;  3LWQ B;  1LKP A;  4A3G L;  3RZD L;  3GTK L;  1QCV A;  3HKZ P;  2CR8 A;  4C3J L;  1RWD A;  2RDV A;  1ODH A;  2GMG A;  4TVM A;  1BQ8 A;  5IP7 L;  1B71 A;  1OWB A;  1Y1W L;  3H97 A;  4ZN3 B;  4JAG A;  2PVE A;  1I6H L;  2XJT A;  4AHW A;  4V19 6;  2PYA A;  3WWL A;  3KYV A;  4AR6 A;  1PFW A;  4YWM A;  1VCX A;  4JAF A;  2EY4 E;  3HOV L;  3S2D L;  5MF6 A;  2PVX A;  1T9P A;  5MFP A;  3PO2 L;  3RZT A;  1S30 A;  3QQC E;  4C3H L;  3JR7 A;  2L0Z A;  1R0H A;  1R9T L;  2APO B;  1VZI A;  1YUZ A;  4A3B L;  1S2Z A;  2MS3 A;  3LNL A;  2JI2 A;  3LWO B;  1IU6 A;  1K83 L;  3H3V M;  4C2M 1;  4JAE A;  4AYB P;  2PSM C;  1IU5 A;  1P7P A;  2XJS A;  2YU9 L;  1C09 A;  2M4Y A;  4ZN1 B;  2R7Z L;  3S1M L;  2Y0S P;  3S17 L;  3H9B A;  3I4M L;  5GAH c;  2A69 D;  3RZ6 A;  1R0F A;  5C3E L;  4G6B A;  2ERS A;  4AR4 A;  1LTL A;  2QL0 A;  4BY7 L;  1NNQ A;  4A93 L;  3KYY A;  4AI0 A;  5H1S c;  1QQT A;  2C6A A;  1DX8 A;  4X6A L;  3HJY B;  4AI1 A;  4UY8 1;  1TWG L;  3QVD A;  3HJW B;  4A3C L;  7RXN A;  3HOU L;  1PFU A;  3MQK B;  1RYT A;  4AI3 A;  5IYD L;  1NXG A;  2C6B A;  2HR5 A;  5IYB L;  4A3J L;  1NXE A;  5MGN A;  2ERJ A;  1SMM A;  4AHY A;  3HOY L;  2B5I D;  3PIP 1;  4U67 1;  5JVG 1;  5M3M L;  3K35 A;  1OWC A;  1RDV A;  1I3Q L;  2A6E D;  4A3M L;  4AI2 A;  4C3I L;  4BY1 L;  1BRF A;  3LWP B;  1B13 A;  5DM7 1;  2NYD A;  3H9C A;  2AYJ A;  5FJ8 L;  1R0J A;  4Y52 L;  2JI3 A;  3A44 A;  2XJU A;  4BBR L;  1IW7 D; 
#chains in the Genus database with same CATH homology
 1YUZ A;  3B0A B;  1S2Z A;  2J9U B;  2MS3 A;  2JI1 A;  5DM6 1;  2KKD A;  3LNL A;  1LKM A;  2V0F A;  1BQ9 A;  1RDG A;  2JI2 A;  2BE5 D;  3LPE B;  5MLC 3;  1IU6 A;  1T9O A;  4AR3 A;  3P8B A;  4XXB B;  2LCQ A;  1JYB A;  4JAE A;  1E8J A;  1SMW A;  1CAD A;  1SMU A;  4K9F A;  2PSM C;  4GS7 D;  1IU5 A;  2XJS A;  3VPB E;  1C09 A;  1FHH A;  2M4Y A;  3NFP I;  1CAA A;  4ZN1 B;  8RXN A;  5AI3 A;  4E6Y A;  2A68 D;  4AHZ A;  5K2M E;  5EIO C;  3PIO 1;  1H7V A;  5GAH c;  2DSX A;  2H12 A;  3P2A A;  4LHL A;  5AI2 A;  2A69 D;  3MSU A;  3RZ6 A;  1R0F A;  3RYG A;  4G6B A;  2ERS A;  3PKJ A;  4AR4 A;  5IY0 A;  1LTL A;  1B2J A;  2XJQ A;  3J7Z 1;  1S24 A;  2QL0 A;  2CKC A;  4B8C D;  1YK4 A;  1NNQ A;  5GAE c;  1WJV A;  1IW7 D;  1DVB A;  4RXN A;  3KYY A;  1R0G A;  2VL6 A;  4AI0 A;  2XJP A;  4JAD A;  5H1S c;  4AR5 A;  3IU3 I;  4ME3 A;  3PWF A;  3B08 B;  2ZIX A;  4XGH A;  2C6A A;  2Z3R B;  1LKP A;  1DX8 A;  1QCV A;  2K2D A;  2V0E A;  5GAG c;  5JVH 1;  4AI1 A;  3KYW A;  4UY8 1;  2M6O A;  2CR8 A;  2KN9 A;  3QVD A;  2Z3Q B;  3ZG6 A;  2XJV A;  1LKO A;  3PZA A;  1RWD A;  1BE7 A;  2RDV A;  7RXN A;  2CKA A;  5AN9 H;  1ODH A;  1RYT A;  4AI3 A;  2GMG A;  4TVM A;  1BQ8 A;  1NXG A;  1VZG A;  6RXN A;  3SS2 A;  1B71 A;  1B2O A;  2C6B A;  2HR5 A;  5RXN A;  3PKI A;  1OWB A;  1IRN A;  1YV1 A;  2PPT A;  3WWN B;  1NXE A;  5MGN A;  2O5J D;  4POF A;  2ERJ A;  4ZN3 B;  4JAG A;  1QYB A;  2A6H D;  1VZH A;  2PVE A;  4AHX A;  1YUX A;  3KYU A;  1SMM A;  2XJT A;  4AHY A;  4AHW A;  4V19 6;  1YK5 A;  2B5I D;  2PYA A;  3PIP 1;  4U67 1;  3WWL A;  3KYV A;  4AR6 A;  4YWM A;  1ZRP A;  5JVG 1;  3K35 A;  5MFZ A;  1OWC A;  1RDV A;  1VCX A;  3J7Y 1;  2V3B B;  2A6E D;  4JAF A;  1FHM A;  4AI2 A;  1R0I A;  5GAD c;  1BRF A;  1B13 A;  3KYX A;  5DM7 1;  4YWL A;  5MF6 A;  2PVX A;  4WFN 1;  2XJR A;  2NYD A;  1T9P A;  1BFY A;  2AYJ A;  5MFP A;  3MPS A;  3RZT A;  1S30 A;  1R0J A;  1T9Q A;  3QQC E;  2JI3 A;  4TPU A;  3A44 A;  1RB9 A;  1Z92 B;  2XJU A;  4LHN A;  2L0Z A;  2M6P A;  5EIN C;  2M4V A;  1R0H A;  4POG A;  1RYQ A;  1IRO A;  1VZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...