4ZN3B

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
HHHHHSQDPRACLKCKYLTNDEICPICHSPTSENWIGLLIVINPEKSEIAKKAGIDIKGKYALSVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2015-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.90 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4zn3B00
3P8BA 3LPEB 4ZN3B 3QQCE 4ZN1B 1RYQA
chains in the Genus database with same CATH superfamily
3I4NL 8RXNA 2ERSA 2M6OA 1NXEA 1B13A 1RYTA 2APOB 1Z92B 4BBSL 1SMUA 1QCVA 2K2DA 3P8BA 1OWCA 2A68D 1LKOA 3PWFA 4AHWA 3S16L 4K9FA 2ERJA 2GMGA 2CKAA 3LWQB 1FHMA 2WAQP 1PFVA 3S1NL 1RB9A 3HKZP 5JVG1 1VZIA 3JR7A 4C2M1 3A44A 2JA5L 1VCXA 3KYYA 3P2AA 1LKMA 1YV1A 3S1RL 2XJTA 2J9UB 3RZDL 3GTML 3B08B 2O5JD 4AI3A 1DVBA 2XJPA 1IW7D 4AI2A 5MF6A 3PIO1 1IU5A 1T9PA 3H97A 4A3GL 1R0JA 4RXNA 4A3BL 1IROA 1RDGA 2B5ID 2XJUA 5GAGc 4LHLA 2NVTL 1CAAA 3H9BA 5MGNA 3PZAA 5IYBL 5M3ML 4ZN3B 2V3BB 3HOUL 5MLC3 2JI1A 5IYCL 4A3LL 3H99A 1R9TL 1WJVA 5AI2A 1SFOL 3I4ML 4X6AL 3MPSA 3H3VM 2M6PA 1RDVA 3GTGL 1E8JA 3SS2A 1DX8A 5EINC 1T9QA 3KYWA 3PO3L 1C09A 3HAXC 1PFUA 4AYBP 3GTPL 4A3EL 1YUZA 4A3JL 1YUXA 5C3EL 4WFN1 2HVYC 3HJYB 4POFA 2WB1P 1Y1VL 3GTJL 2RDVA 1NNQA 5M3FL 3LWVB 3KYVA 2LCQA 5M5XL 1BQ8A 3PL5A 4AR3A 3S1QL 3K35A 1R0IA 2L0ZA 4A3DL 1RWDA 2YU9L 3KYUA 6RXNA 3RZOL 5IYDL 1BE7A 2JI3A 3RZTA 4A3KL 2A6HD 2XJSA 2Z3RB 2A69D 1QYBA 2JA8L 3GTKL 2CKCA 3MSUA 1TWCL 3PO2L 4AHYA 1R0HA 2M4VA 1WCML 4TVMA 3GTOL 1SMWA 3PKIA 3FKIL 2MS3A 3J7Y1 4LHNA 3MQKB 4C3IL 2R92L 3HOVL 2PMZP 3VPBE 1JYBA 2XJRA 2E2HL 3HOXL 4V196 4Y7NL 5IY0A 4AI0A 1H7VA 1CADA 2A6ED 4C3HL 3RYGA 3K7AL 3QQCE 4A3FL 1I3QL 1F4LA 4YWMA 1Y1WL 5AI3A 3LWRB 5IP7L 1IU6A 2HR5A 4AR4A 2C6BA 3KYXA 1TWGL 2PVXA 1ODHA 3M4OL 3S2DL 1VZHA 3QVDA 1S24A 1R0FA 4TPUA 4XGHA 1BRFA 3PIP1 2NVXL 3J7Z1 2AQCA 3NFPI 5C4XL 3HOYL 1YK5A 1B2JA 2Y0SP 5MFPA 4AHXA 4ZN1B 2E2IL 2DSXA 2R7ZL 2V0EA 2PYAA 2VL6A 4JAGA 4JADA 3WWNB 1I50L 5IP9L 5EIOC 5C44L 1P7PA 3S14L 1PFWA 1QQTA 3HOZL 3H0GL 1PFYA 5FLML 2AUSB 2NVQL 2PVEA 5K2ME 4A3IL 2BE5D 3IU3I 1I6HL 4B8CD 1YK4A 4C3JL 5DM61 3HJWB 5GAEc 2KN9A 5H1Sc 4AR6A 5M5WL 2EY4E 4JAEA 2E2JL 1TWAL 1ZRPA 2RFKB 2XJVA 2AYJA 5M5YL 3CQZL 4U671 1BQ9A 1FHHA 2JA6L 5JVH1 1LKPA 4BBRL 2H12A 4GS7D 5MFZA 3LNLA 1B2OA 4G6BA 5RXNA 4POGA 5DM71 3GTQL 2NVYL 4XXBB 4AR5A 1K83L 2CR8A 4A93L 2VUML 4ME3A 3ZG6A 2B63L 3FDJA 4AHZA 4AI1A 3S15L 3S1ML 4BXXL 4Y52L 1TWHL 1BFYA 1S30A 2XJQA 2V0FA 3GTLL 2JI2A 2Z3QB 1TWFL 3LWPB 1VZGA 3PKJA 1PZXA 2C6AA 7RXNA 5FJ8L 3RZ6A 5AN9H 4BY1L 4JAFA 1LTLA 1RYQA 2PSMC 1R0GA 3LPEB 4BY7L 4QIWP 3HOWL 4A3CL 1S2ZA 5GADc 5C4JL 2JA7L 4UY81 2NYDA 3B0AB 2PPTA 1NXGA 1SMMA 2KKDA 3S17L 3S2HL 1B71A 2R93L 2ZIXA 3H9CA 2QL0A 3M3YL 1IRNA 4YWLA 1OWBA 4E6YA 2M4YA 4A3ML 1T9OA 3WWLA 3LWOB 5GAHc
chains in the Genus database with same CATH topology
8RXNA 4AI0A 5IY0A 2ERSA 1CADA 5JVH1 1DX8A 1H7VA 1LKPA 5EINC 2M6OA 2H12A 4GS7D 1NXEA 5MFZA 1T9QA 1B13A 3LNLA 3KYWA 1B2OA 2A6ED 1C09A 1RYTA 4G6BA 1Z92B 5RXNA 4POGA 3RYGA 3QQCE 1SMUA 1QCVA 5DM71 4YWMA 1YUZA 2K2DA 3P8BA 1OWCA 1YUXA 2A68D 5AI3A 4WFN1 1LKOA 3PWFA 4XXBB 4POFA 1IU6A 4AHWA 2HR5A 4AR4A 4AR5A 2C6BA 3KYXA 2PVXA 4K9FA 1ODHA 2ERJA 2CR8A 1VZHA 3QVDA 1S24A 1R0FA 2GMGA 4TPUA 4ME3A 4XGHA 1BRFA 3ZG6A 2CKAA 3PIP1 3J7Z1 1FHMA 2RDVA 1NNQA 4AHZA 3KYVA 2LCQA 3NFPI 1RB9A 4AI1A 5JVG1 1VZIA 1YK5A 1BQ8A 3A44A 1VCXA 3KYYA 3P2AA 1B2JA 1LKMA 1YV1A 4AR3A 3K35A 1R0IA 2XJTA 5MFPA 4AHXA 2L0ZA 4ZN1B 1BFYA 1S30A 2J9UB 2DSXA 2V0FA 1RWDA 2XJQA 3KYUA 6RXNA 2JI2A 2Z3QB 1BE7A 2JI3A 2PYAA 1VZGA 2V0EA 2VL6A 3B08B 3RZTA 4AI3A 2O5JD 2A6HD 3PKJA 4JADA 4JAGA 3WWNB 1DVBA 2XJSA 2XJPA 1IW7D 2Z3RB 4AI2A 2A69D 5EIOC 1QYBA 5MF6A 3PIO1 1IU5A 2C6AA 1T9PA 7RXNA 3RZ6A 1R0JA 4RXNA 2CKCA 1IROA 3MSUA 1RDGA 2B5ID 2XJUA 5AN9H 5GAGc 4AHYA 4JAFA 1LTLA 1R0HA 1RYQA 2PSMC 4LHLA 1R0GA 1CAAA 2PVEA 2M4VA 3LPEB 4TVMA 5K2ME 2BE5D 5MGNA 3IU3I 3PZAA 1S2ZA 4B8CD 1YK4A 5GADc 1SMWA 5DM61 4UY81 2NYDA 3B0AB 2PPTA 3PKIA 5GAEc 2MS3A 3J7Y1 1NXGA 2KN9A 4LHNA 1SMMA 5H1Sc 4AR6A 2KKDA 4ZN3B 2V3BB 4JAEA 3VPBE 1B71A 5MLC3 2JI1A 2ZIXA 2QL0A 1JYBA 1ZRPA 2XJVA 2AYJA 2XJRA 1IRNA 1WJVA 4YWLA 1OWBA 5AI2A 4E6YA 2M4YA 1T9OA 3MPSA 4U671 2M6PA 1BQ9A 1RDVA 3WWLA 4V196 1E8JA 5GAHc 1FHHA 3SS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8B A;  3LPE B;  4ZN3 B;  3QQC E;  4ZN1 B;  1RYQ A; 
#chains in the Genus database with same CATH topology
 3I4N L;  8RXN A;  2ERS A;  2M6O A;  1NXE A;  1B13 A;  1RYT A;  2APO B;  1Z92 B;  4BBS L;  1SMU A;  1QCV A;  2K2D A;  3P8B A;  1OWC A;  2A68 D;  1LKO A;  3PWF A;  4AHW A;  3S16 L;  4K9F A;  2ERJ A;  2GMG A;  2CKA A;  3LWQ B;  1FHM A;  2WAQ P;  1PFV A;  3S1N L;  1RB9 A;  3HKZ P;  5JVG 1;  1VZI A;  3JR7 A;  4C2M 1;  3A44 A;  2JA5 L;  1VCX A;  3KYY A;  3P2A A;  1LKM A;  1YV1 A;  3S1R L;  2XJT A;  2J9U B;  3RZD L;  3GTM L;  3B08 B;  2O5J D;  4AI3 A;  1DVB A;  2XJP A;  1IW7 D;  4AI2 A;  5MF6 A;  3PIO 1;  1IU5 A;  1T9P A;  3H97 A;  4A3G L;  1R0J A;  4RXN A;  4A3B L;  1IRO A;  1RDG A;  2B5I D;  2XJU A;  5GAG c;  4LHL A;  2NVT L;  1CAA A;  3H9B A;  5MGN A;  3PZA A;  5IYB L;  5M3M L;  4ZN3 B;  2V3B B;  3HOU L;  5MLC 3;  2JI1 A;  5IYC L;  4A3L L;  3H99 A;  1R9T L;  1WJV A;  5AI2 A;  1SFO L;  3I4M L;  4X6A L;  3MPS A;  3H3V M;  2M6P A;  1RDV A;  3GTG L;  1E8J A;  3SS2 A;  1DX8 A;  5EIN C;  1T9Q A;  3KYW A;  3PO3 L;  1C09 A;  3HAX C;  1PFU A;  4AYB P;  3GTP L;  4A3E L;  1YUZ A;  4A3J L;  1YUX A;  5C3E L;  4WFN 1;  2HVY C;  3HJY B;  4POF A;  2WB1 P;  1Y1V L;  3GTJ L;  2RDV A;  1NNQ A;  5M3F L;  3LWV B;  3KYV A;  2LCQ A;  5M5X L;  1BQ8 A;  3PL5 A;  4AR3 A;  3S1Q L;  3K35 A;  1R0I A;  2L0Z A;  4A3D L;  1RWD A;  2YU9 L;  3KYU A;  6RXN A;  3RZO L;  5IYD L;  1BE7 A;  2JI3 A;  3RZT A;  4A3K L;  2A6H D;  2XJS A;  2Z3R B;  2A69 D;  1QYB A;  2JA8 L;  3GTK L;  2CKC A;  3MSU A;  1TWC L;  3PO2 L;  4AHY A;  1R0H A;  2M4V A;  1WCM L;  4TVM A;  3GTO L;  1SMW A;  3PKI A;  3FKI L;  2MS3 A;  3J7Y 1;  4LHN A;  3MQK B;  4C3I L;  2R92 L;  3HOV L;  2PMZ P;  3VPB E;  1JYB A;  2XJR A;  2E2H L;  3HOX L;  4V19 6;  4Y7N L;  5IY0 A;  4AI0 A;  1H7V A;  1CAD A;  2A6E D;  4C3H L;  3RYG A;  3K7A L;  3QQC E;  4A3F L;  1I3Q L;  1F4L A;  4YWM A;  1Y1W L;  5AI3 A;  3LWR B;  5IP7 L;  1IU6 A;  2HR5 A;  4AR4 A;  2C6B A;  3KYX A;  1TWG L;  2PVX A;  1ODH A;  3M4O L;  3S2D L;  1VZH A;  3QVD A;  1S24 A;  1R0F A;  4TPU A;  4XGH A;  1BRF A;  3PIP 1;  2NVX L;  3J7Z 1;  2AQC A;  3NFP I;  5C4X L;  3HOY L;  1YK5 A;  1B2J A;  2Y0S P;  5MFP A;  4AHX A;  4ZN1 B;  2E2I L;  2DSX A;  2R7Z L;  2V0E A;  2PYA A;  2VL6 A;  4JAG A;  4JAD A;  3WWN B;  1I50 L;  5IP9 L;  5EIO C;  5C44 L;  1P7P A;  3S14 L;  1PFW A;  1QQT A;  3HOZ L;  3H0G L;  1PFY A;  5FLM L;  2AUS B;  2NVQ L;  2PVE A;  5K2M E;  4A3I L;  2BE5 D;  3IU3 I;  1I6H L;  4B8C D;  1YK4 A;  4C3J L;  5DM6 1;  3HJW B;  5GAE c;  2KN9 A;  5H1S c;  4AR6 A;  5M5W L;  2EY4 E;  4JAE A;  2E2J L;  1TWA L;  1ZRP A;  2RFK B;  2XJV A;  2AYJ A;  5M5Y L;  3CQZ L;  4U67 1;  1BQ9 A;  1FHH A;  2JA6 L;  5JVH 1;  1LKP A;  4BBR L;  2H12 A;  4GS7 D;  5MFZ A;  3LNL A;  1B2O A;  4G6B A;  5RXN A;  4POG A;  5DM7 1;  3GTQ L;  2NVY L;  4XXB B;  4AR5 A;  1K83 L;  2CR8 A;  4A93 L;  2VUM L;  4ME3 A;  3ZG6 A;  2B63 L;  3FDJ A;  4AHZ A;  4AI1 A;  3S15 L;  3S1M L;  4BXX L;  4Y52 L;  1TWH L;  1BFY A;  1S30 A;  2XJQ A;  2V0F A;  3GTL L;  2JI2 A;  2Z3Q B;  1TWF L;  3LWP B;  1VZG A;  3PKJ A;  1PZX A;  2C6A A;  7RXN A;  5FJ8 L;  3RZ6 A;  5AN9 H;  4BY1 L;  4JAF A;  1LTL A;  1RYQ A;  2PSM C;  1R0G A;  3LPE B;  4BY7 L;  4QIW P;  3HOW L;  4A3C L;  1S2Z A;  5GAD c;  5C4J L;  2JA7 L;  4UY8 1;  2NYD A;  3B0A B;  2PPT A;  1NXG A;  1SMM A;  2KKD A;  3S17 L;  3S2H L;  1B71 A;  2R93 L;  2ZIX A;  3H9C A;  2QL0 A;  3M3Y L;  1IRN A;  4YWL A;  1OWB A;  4E6Y A;  2M4Y A;  4A3M L;  1T9O A;  3WWL A;  3LWO B;  5GAH c; 
#chains in the Genus database with same CATH homology
 8RXN A;  4AI0 A;  5IY0 A;  2ERS A;  1CAD A;  5JVH 1;  1DX8 A;  1H7V A;  1LKP A;  5EIN C;  2M6O A;  2H12 A;  4GS7 D;  1NXE A;  5MFZ A;  1T9Q A;  1B13 A;  3LNL A;  3KYW A;  1B2O A;  2A6E D;  1C09 A;  1RYT A;  4G6B A;  1Z92 B;  5RXN A;  4POG A;  3RYG A;  3QQC E;  1SMU A;  1QCV A;  5DM7 1;  4YWM A;  1YUZ A;  2K2D A;  3P8B A;  1OWC A;  1YUX A;  2A68 D;  5AI3 A;  4WFN 1;  1LKO A;  3PWF A;  4XXB B;  4POF A;  1IU6 A;  4AHW A;  2HR5 A;  4AR4 A;  4AR5 A;  2C6B A;  3KYX A;  2PVX A;  4K9F A;  1ODH A;  2ERJ A;  2CR8 A;  1VZH A;  3QVD A;  1S24 A;  1R0F A;  2GMG A;  4TPU A;  4ME3 A;  4XGH A;  1BRF A;  3ZG6 A;  2CKA A;  3PIP 1;  3J7Z 1;  1FHM A;  2RDV A;  1NNQ A;  4AHZ A;  3KYV A;  2LCQ A;  3NFP I;  1RB9 A;  4AI1 A;  5JVG 1;  1VZI A;  1YK5 A;  1BQ8 A;  3A44 A;  1VCX A;  3KYY A;  3P2A A;  1B2J A;  1LKM A;  1YV1 A;  4AR3 A;  3K35 A;  1R0I A;  2XJT A;  5MFP A;  4AHX A;  2L0Z A;  4ZN1 B;  1BFY A;  1S30 A;  2J9U B;  2DSX A;  2V0F A;  1RWD A;  2XJQ A;  3KYU A;  6RXN A;  2JI2 A;  2Z3Q B;  1BE7 A;  2JI3 A;  2PYA A;  1VZG A;  2V0E A;  2VL6 A;  3B08 B;  3RZT A;  4AI3 A;  2O5J D;  2A6H D;  3PKJ A;  4JAD A;  4JAG A;  3WWN B;  1DVB A;  2XJS A;  2XJP A;  1IW7 D;  2Z3R B;  4AI2 A;  2A69 D;  5EIO C;  1QYB A;  5MF6 A;  3PIO 1;  1IU5 A;  2C6A A;  1T9P A;  7RXN A;  3RZ6 A;  1R0J A;  4RXN A;  2CKC A;  1IRO A;  3MSU A;  1RDG A;  2B5I D;  2XJU A;  5AN9 H;  5GAG c;  4AHY A;  4JAF A;  1LTL A;  1R0H A;  1RYQ A;  2PSM C;  4LHL A;  1R0G A;  1CAA A;  2PVE A;  2M4V A;  3LPE B;  4TVM A;  5K2M E;  2BE5 D;  5MGN A;  3IU3 I;  3PZA A;  1S2Z A;  4B8C D;  1YK4 A;  5GAD c;  1SMW A;  5DM6 1;  4UY8 1;  2NYD A;  3B0A B;  2PPT A;  3PKI A;  5GAE c;  2MS3 A;  3J7Y 1;  1NXG A;  2KN9 A;  4LHN A;  1SMM A;  5H1S c;  4AR6 A;  2KKD A;  4ZN3 B;  2V3B B;  4JAE A;  3VPB E;  1B71 A;  5MLC 3;  2JI1 A;  2ZIX A;  2QL0 A;  1JYB A;  1ZRP A;  2XJV A;  2AYJ A;  2XJR A;  1IRN A;  1WJV A;  4YWL A;  1OWB A;  5AI2 A;  4E6Y A;  2M4Y A;  1T9O A;  3MPS A;  4U67 1;  2M6P A;  1BQ9 A;  1RDV A;  3WWL A;  4V19 6;  1E8J A;  5GAH c;  1FHH A;  3SS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...