1YK4A

Ultra-high resolution structure of pyrococcus abyssi rubredoxin w4l/r5s
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
AKLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Ultrahigh-resolution study on Pyrococcus abyssi rubredoxin. I. 0.69 A X-ray structure of mutant W4L/R5S.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Electron transport
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yk4A00
8RXNA 4K9FA 4AR6A 1IROA 2PYAA 1B2JA 1R0GA 4AR5A 1YUXA 1H7VA 2KKDA 1RWDA 1RB9A 1BRFA 1LKPA 4POFA 4YWLA 1SMWA 1SMUA 2QL0A 4RXNA 1ZRPA 1JYBA 2HR5A 1CADA 1YV1A 3PZAA 3KYVA 1FHMA 1R0JA 1B13A 1SMMA 2GMGA 1R0HA 1BE7A 1LKOA 1S24A 1IRNA 2RDVA 1S30A 1VCXA 1BQ8A 1YK5A 3KYYA 4TPUA 2VL6A 5IY0A 2M4YA 4ME3A 3MPSA 2PVEA 1DX8A 1RDGA 4POGA 5RXNA 1YK4A 1NNQA 1BQ9A 1T9PA 3KYUA 1R0FA 2V3BB 1DVBA 1RDVA 1RYTA 1IU6A 4YWMA 1CAAA 1IU5A 2KN9A 1QCVA 3KYWA 2MS3A 1B71A 1S2ZA 3QVDA 3KYXA 3RYGA 1BFYA 3PWFA 1B2OA 1T9OA 3SS2A 2LCQA 6RXNA 5AI2A 1E8JA 7RXNA 4AR3A 4AR4A 3RZ6A 1YUZA 1C09A 3RZTA 1QYBA 1LKMA 3A44A 1R0IA 1FHHA 2PVXA 2K2DA 1T9QA 5AI3A 1LTLA 2DSXA
chains in the Genus database with same CATH superfamily
1I50L 4AYBP 2PPTA 1R9TL 5M5XL 4BBSL 2PYAA 4BBRL 4C2M1 1R0GA 2KKDA 3GTOL 1BRFA 2XJPA 1LKPA 4YWLA 4RXNA 4BY1L 4LHLA 1YV1A 3PZAA 2C6BA 4JAGA 1R0JA 3LWVB 1BE7A 1IRNA 2RDVA 1BQ8A 5C4JL 4A3DL 5IY0A 2M4YA 1PFWA 2H12A 5M3FL 3IU3I 5FJ8L 1TWAL 1NNQA 1T9PA 3KYUA 2CKCA 1CAAA 2E2HL 2ZIXA 3LWRB 2JI1A 3MSUA 2KN9A 3S1NL 3M3YL 1PFVA 3KYWA 2XJUA 1PFUA 3QQCE 3H9BA 3NFPI 2R7ZL 3GTML 2EY4E 3KYXA 1BFYA 4ZN3B 2B63L 3SS2A 5GAEc 7RXNA 2M4VA 4AR3A 2Y0SP 3GTKL 4AHWA 3VPBE 1ODHA 5GAHc 1R0IA 1Y1VL 3I4ML 5M5YL 5IYCL 1LTLA 2YU9L 8RXNA 4K9FA 1NXEA 1IROA 3WWNB 4AR5A 1YUXA 5FLML 4LHNA 4POFA 2V0FA 3HOUL 3FKIL 5K2ME 5MFZA 1CADA 5IP9L 3KYVA 5DM71 4AHZA 2VUML 1VZHA 1B13A 4WFN1 1P7PA 1R0HA 4AHYA 2XJVA 3CQZL 2M6PA 1K83L 1S30A 1VCXA 2JA6L 4JAFA 3K7AL 3B0AB 1TWFL 3HOWL 3PO2L 1DX8A 1RDGA 4POGA 5RXNA 1YK4A 3GTLL 3LWQB 1OWCA 2E2IL 1R0FA 5AN9H 5M5WL 1RDVA 1RYTA 1IU6A 1PFYA 2R93L 4A3CL 4A3ML 2ERJA 4AI2A 4C3HL 1QQTA 1VZIA 3ZG6A 2Z3RB 4AI0A 2Z3QB 1B71A 3K35A 1TWCL 2B5ID 3PWFA 1B2OA 3HJWB 3FDJA 4Y52L 2ERSA 3S1QL 3I4NL 3J7Y1 3H9CA 4AR4A 4AHXA 3RZ6A 4A93L 3PKJA 3HAXC 3LPEB 4E6YA 3PKIA 3JR7A 2PVXA 1T9QA 5AI3A 5MLC3 1SFOL 4AI3A 4A3IL 5H1Sc 3S2HL 3H3VM 4Y7NL 3HOYL 1H7VA 1WJVA 1RB9A 5EIOC 2PSMC 2R92L 2JA7L 1SMUA 2QL0A 2WB1P 1ZRPA 5MF6A 1JYBA 5MGNA 5IYDL 1TWGL 4A3FL 4XXBB 1FHMA 2AQCA 4X6AL 5IP7L 2XJQA 2A68D 2XJRA 4U671 1WCML 1LKOA 1S24A 2BE5D 3GTPL 1YK5A 1F4LA 2E2JL 4TPUA 3MQKB 3MPSA 2NVTL 2AUSB 2JA8L 3HOZL 3GTGL 2V3BB 3WWLA 1DVBA 2O5JD 4TVMA 4YWMA 4JAEA 1PZXA 1QCVA 1TWHL 4A3GL 3HKZP 2XJTA 2MS3A 3PIO1 3HOXL 3S16L 1S2ZA 3RYGA 2A6HD 2WAQP 1T9OA 2J9UB 6RXNA 3J7Z1 4UY81 1E8JA 1NXGA 2AYJA 5GAGc 4C3IL 3H0GL 4ZN1B 3RZTA 1QYBA 3A44A 2A69D 2V0EA 2K2DA 1OWBA 1Z92B 4G6BA 3PO3L 3GTQL 3S14L 3RZOL 4BXXL 2JA5L 4AR6A 2PMZP 1B2JA 5JVH1 1RWDA 4C3JL 2APOB 4A3BL 3P8BA 1SMWA 2HR5A 3LWOB 4A3KL 3S15L 3HOVL 5EINC 5DM61 3GTJL 3B08B 4QIWP 3M4OL 5IYBL 3PIP1 2XJSA 3P2AA 1SMMA 3S1ML 2GMGA 2JI2A 2NVQL 3KYYA 2HVYC 2VL6A 5C44L 5M3ML 1VZGA 4GS7D 3S2DL 4ME3A 2CKAA 2NVYL 4A3LL 2PVEA 4V196 2A6ED 4A3JL 1RYQA 2NVXL 2RFKB 1BQ9A 4AI1A 2JI3A 1I3QL 2L0ZA 3LNLA 3H97A 1IU5A 3HJYB 2C6AA 2NYDA 4B8CD 3S1RL 2CR8A 3QVDA 1I6HL 5C3EL 3S17L 2LCQA 5C4XL 5AI2A 4BY7L 5GADc 3PL5A 3RZDL 1Y1WL 1YUZA 2M6OA 1C09A 4JADA 5MFPA 1IW7D 1LKMA 4XGHA 5JVG1 4A3EL 1FHHA 3H99A 3LWPB 2DSXA
chains in the Genus database with same CATH topology
4AI3A 8RXNA 4K9FA 5H1Sc 4AR6A 1NXEA 2PPTA 1IROA 2PYAA 3WWNB 1B2JA 1R0GA 4AR5A 5JVH1 1YUXA 1H7VA 2KKDA 1RWDA 1WJVA 1RB9A 1BRFA 2XJPA 1LKPA 4LHNA 5EIOC 2PSMC 4POFA 2V0FA 3P8BA 4YWLA 1SMWA 1SMUA 2QL0A 4RXNA 1ZRPA 5K2ME 5MF6A 1JYBA 5MFZA 4LHLA 2HR5A 5MGNA 1CADA 1YV1A 3PZAA 5EINC 3KYVA 5DM71 5DM61 3B08B 4AHZA 2C6BA 1VZHA 4JAGA 4XXBB 1FHMA 1R0JA 3PIP1 1B13A 2XJSA 4WFN1 2XJQA 2A68D 1SMMA 2XJRA 3P2AA 2GMGA 1R0HA 4U671 4AHYA 1BE7A 2XJVA 1LKOA 1S24A 1IRNA 2RDVA 2BE5D 2M6PA 1S30A 1VCXA 2JI2A 1BQ8A 1YK5A 3KYYA 4JAFA 4TPUA 2VL6A 5IY0A 1VZGA 2M4YA 4GS7D 4ME3A 2CKAA 3B0AB 2H12A 3MPSA 2PVEA 1DX8A 1RDGA 4POGA 4V196 5RXNA 2A6ED 1YK4A 3IU3I 1RYQA 1NNQA 1BQ9A 1OWCA 1T9PA 3KYUA 2CKCA 1R0FA 4AI1A 5AN9H 2V3BB 2JI3A 2L0ZA 3WWLA 1DVBA 3LNLA 1RDVA 2O5JD 1RYTA 1IU6A 4TVMA 4YWMA 1CAAA 4JAEA 2ZIXA 2ERJA 4AI2A 1IU5A 2JI1A 3MSUA 2KN9A 1QCVA 2XJTA 3KYWA 2MS3A 2XJUA 2C6AA 2NYDA 3PIO1 1VZIA 3QQCE 3ZG6A 3NFPI 2Z3RB 4AI0A 4B8CD 2Z3QB 1B71A 2CR8A 3K35A 1S2ZA 3KYXA 3QVDA 3RYGA 1BFYA 4ZN3B 2B5ID 3PWFA 1B2OA 2A6HD 1T9OA 3SS2A 5GAEc 2LCQA 2ERSA 2J9UB 6RXNA 5AI2A 3J7Z1 4UY81 1E8JA 1NXGA 5GADc 2AYJA 7RXNA 5GAGc 3J7Y1 2M4VA 4AR3A 4AR4A 4AHXA 3RZ6A 1YUZA 2M6OA 4ZN1B 1C09A 4AHWA 3PKJA 3LPEB 4JADA 5MFPA 3RZTA 3VPBE 4E6YA 1QYBA 3PKIA 1IW7D 5GAHc 1LKMA 3A44A 4XGHA 1R0IA 5JVG1 1ODHA 2A69D 1FHHA 2PVXA 2V0EA 2K2DA 1OWBA 1T9QA 5AI3A 1Z92B 4G6BA 1LTLA 5MLC3 2DSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8RXN A;  4K9F A;  4AR6 A;  1IRO A;  2PYA A;  1B2J A;  1R0G A;  4AR5 A;  1YUX A;  1H7V A;  2KKD A;  1RWD A;  1RB9 A;  1BRF A;  1LKP A;  4POF A;  4YWL A;  1SMW A;  1SMU A;  2QL0 A;  4RXN A;  1ZRP A;  1JYB A;  2HR5 A;  1CAD A;  1YV1 A;  3PZA A;  3KYV A;  1FHM A;  1R0J A;  1B13 A;  1SMM A;  2GMG A;  1R0H A;  1BE7 A;  1LKO A;  1S24 A;  1IRN A;  2RDV A;  1S30 A;  1VCX A;  1BQ8 A;  1YK5 A;  3KYY A;  4TPU A;  2VL6 A;  5IY0 A;  2M4Y A;  4ME3 A;  3MPS A;  2PVE A;  1DX8 A;  1RDG A;  4POG A;  5RXN A;  1YK4 A;  1NNQ A;  1BQ9 A;  1T9P A;  3KYU A;  1R0F A;  2V3B B;  1DVB A;  1RDV A;  1RYT A;  1IU6 A;  4YWM A;  1CAA A;  1IU5 A;  2KN9 A;  1QCV A;  3KYW A;  2MS3 A;  1B71 A;  1S2Z A;  3QVD A;  3KYX A;  3RYG A;  1BFY A;  3PWF A;  1B2O A;  1T9O A;  3SS2 A;  2LCQ A;  6RXN A;  5AI2 A;  1E8J A;  7RXN A;  4AR3 A;  4AR4 A;  3RZ6 A;  1YUZ A;  1C09 A;  3RZT A;  1QYB A;  1LKM A;  3A44 A;  1R0I A;  1FHH A;  2PVX A;  2K2D A;  1T9Q A;  5AI3 A;  1LTL A;  2DSX A; 
#chains in the Genus database with same CATH topology
 1I50 L;  4AYB P;  2PPT A;  1R9T L;  5M5X L;  4BBS L;  2PYA A;  4BBR L;  4C2M 1;  1R0G A;  2KKD A;  3GTO L;  1BRF A;  2XJP A;  1LKP A;  4YWL A;  4RXN A;  4BY1 L;  4LHL A;  1YV1 A;  3PZA A;  2C6B A;  4JAG A;  1R0J A;  3LWV B;  1BE7 A;  1IRN A;  2RDV A;  1BQ8 A;  5C4J L;  4A3D L;  5IY0 A;  2M4Y A;  1PFW A;  2H12 A;  5M3F L;  3IU3 I;  5FJ8 L;  1TWA L;  1NNQ A;  1T9P A;  3KYU A;  2CKC A;  1CAA A;  2E2H L;  2ZIX A;  3LWR B;  2JI1 A;  3MSU A;  2KN9 A;  3S1N L;  3M3Y L;  1PFV A;  3KYW A;  2XJU A;  1PFU A;  3QQC E;  3H9B A;  3NFP I;  2R7Z L;  3GTM L;  2EY4 E;  3KYX A;  1BFY A;  4ZN3 B;  2B63 L;  3SS2 A;  5GAE c;  7RXN A;  2M4V A;  4AR3 A;  2Y0S P;  3GTK L;  4AHW A;  3VPB E;  1ODH A;  5GAH c;  1R0I A;  1Y1V L;  3I4M L;  5M5Y L;  5IYC L;  1LTL A;  2YU9 L;  8RXN A;  4K9F A;  1NXE A;  1IRO A;  3WWN B;  4AR5 A;  1YUX A;  5FLM L;  4LHN A;  4POF A;  2V0F A;  3HOU L;  3FKI L;  5K2M E;  5MFZ A;  1CAD A;  5IP9 L;  3KYV A;  5DM7 1;  4AHZ A;  2VUM L;  1VZH A;  1B13 A;  4WFN 1;  1P7P A;  1R0H A;  4AHY A;  2XJV A;  3CQZ L;  2M6P A;  1K83 L;  1S30 A;  1VCX A;  2JA6 L;  4JAF A;  3K7A L;  3B0A B;  1TWF L;  3HOW L;  3PO2 L;  1DX8 A;  1RDG A;  4POG A;  5RXN A;  1YK4 A;  3GTL L;  3LWQ B;  1OWC A;  2E2I L;  1R0F A;  5AN9 H;  5M5W L;  1RDV A;  1RYT A;  1IU6 A;  1PFY A;  2R93 L;  4A3C L;  4A3M L;  2ERJ A;  4AI2 A;  4C3H L;  1QQT A;  1VZI A;  3ZG6 A;  2Z3R B;  4AI0 A;  2Z3Q B;  1B71 A;  3K35 A;  1TWC L;  2B5I D;  3PWF A;  1B2O A;  3HJW B;  3FDJ A;  4Y52 L;  2ERS A;  3S1Q L;  3I4N L;  3J7Y 1;  3H9C A;  4AR4 A;  4AHX A;  3RZ6 A;  4A93 L;  3PKJ A;  3HAX C;  3LPE B;  4E6Y A;  3PKI A;  3JR7 A;  2PVX A;  1T9Q A;  5AI3 A;  5MLC 3;  1SFO L;  4AI3 A;  4A3I L;  5H1S c;  3S2H L;  3H3V M;  4Y7N L;  3HOY L;  1H7V A;  1WJV A;  1RB9 A;  5EIO C;  2PSM C;  2R92 L;  2JA7 L;  1SMU A;  2QL0 A;  2WB1 P;  1ZRP A;  5MF6 A;  1JYB A;  5MGN A;  5IYD L;  1TWG L;  4A3F L;  4XXB B;  1FHM A;  2AQC A;  4X6A L;  5IP7 L;  2XJQ A;  2A68 D;  2XJR A;  4U67 1;  1WCM L;  1LKO A;  1S24 A;  2BE5 D;  3GTP L;  1YK5 A;  1F4L A;  2E2J L;  4TPU A;  3MQK B;  3MPS A;  2NVT L;  2AUS B;  2JA8 L;  3HOZ L;  3GTG L;  2V3B B;  3WWL A;  1DVB A;  2O5J D;  4TVM A;  4YWM A;  4JAE A;  1PZX A;  1QCV A;  1TWH L;  4A3G L;  3HKZ P;  2XJT A;  2MS3 A;  3PIO 1;  3HOX L;  3S16 L;  1S2Z A;  3RYG A;  2A6H D;  2WAQ P;  1T9O A;  2J9U B;  6RXN A;  3J7Z 1;  4UY8 1;  1E8J A;  1NXG A;  2AYJ A;  5GAG c;  4C3I L;  3H0G L;  4ZN1 B;  3RZT A;  1QYB A;  3A44 A;  2A69 D;  2V0E A;  2K2D A;  1OWB A;  1Z92 B;  4G6B A;  3PO3 L;  3GTQ L;  3S14 L;  3RZO L;  4BXX L;  2JA5 L;  4AR6 A;  2PMZ P;  1B2J A;  5JVH 1;  1RWD A;  4C3J L;  2APO B;  4A3B L;  3P8B A;  1SMW A;  2HR5 A;  3LWO B;  4A3K L;  3S15 L;  3HOV L;  5EIN C;  5DM6 1;  3GTJ L;  3B08 B;  4QIW P;  3M4O L;  5IYB L;  3PIP 1;  2XJS A;  3P2A A;  1SMM A;  3S1M L;  2GMG A;  2JI2 A;  2NVQ L;  3KYY A;  2HVY C;  2VL6 A;  5C44 L;  5M3M L;  1VZG A;  4GS7 D;  3S2D L;  4ME3 A;  2CKA A;  2NVY L;  4A3L L;  2PVE A;  4V19 6;  2A6E D;  4A3J L;  1RYQ A;  2NVX L;  2RFK B;  1BQ9 A;  4AI1 A;  2JI3 A;  1I3Q L;  2L0Z A;  3LNL A;  3H97 A;  1IU5 A;  3HJY B;  2C6A A;  2NYD A;  4B8C D;  3S1R L;  2CR8 A;  3QVD A;  1I6H L;  5C3E L;  3S17 L;  2LCQ A;  5C4X L;  5AI2 A;  4BY7 L;  5GAD c;  3PL5 A;  3RZD L;  1Y1W L;  1YUZ A;  2M6O A;  1C09 A;  4JAD A;  5MFP A;  1IW7 D;  1LKM A;  4XGH A;  5JVG 1;  4A3E L;  1FHH A;  3H99 A;  3LWP B;  2DSX A; 
#chains in the Genus database with same CATH homology
 4AI3 A;  8RXN A;  4K9F A;  5H1S c;  4AR6 A;  1NXE A;  2PPT A;  1IRO A;  2PYA A;  3WWN B;  1B2J A;  1R0G A;  4AR5 A;  5JVH 1;  1YUX A;  1H7V A;  2KKD A;  1RWD A;  1WJV A;  1RB9 A;  1BRF A;  2XJP A;  1LKP A;  4LHN A;  5EIO C;  2PSM C;  4POF A;  2V0F A;  3P8B A;  4YWL A;  1SMW A;  1SMU A;  2QL0 A;  4RXN A;  1ZRP A;  5K2M E;  5MF6 A;  1JYB A;  5MFZ A;  4LHL A;  2HR5 A;  5MGN A;  1CAD A;  1YV1 A;  3PZA A;  5EIN C;  3KYV A;  5DM7 1;  5DM6 1;  3B08 B;  4AHZ A;  2C6B A;  1VZH A;  4JAG A;  4XXB B;  1FHM A;  1R0J A;  3PIP 1;  1B13 A;  2XJS A;  4WFN 1;  2XJQ A;  2A68 D;  1SMM A;  2XJR A;  3P2A A;  2GMG A;  1R0H A;  4U67 1;  4AHY A;  1BE7 A;  2XJV A;  1LKO A;  1S24 A;  1IRN A;  2RDV A;  2BE5 D;  2M6P A;  1S30 A;  1VCX A;  2JI2 A;  1BQ8 A;  1YK5 A;  3KYY A;  4JAF A;  4TPU A;  2VL6 A;  5IY0 A;  1VZG A;  2M4Y A;  4GS7 D;  4ME3 A;  2CKA A;  3B0A B;  2H12 A;  3MPS A;  2PVE A;  1DX8 A;  1RDG A;  4POG A;  4V19 6;  5RXN A;  2A6E D;  1YK4 A;  3IU3 I;  1RYQ A;  1NNQ A;  1BQ9 A;  1OWC A;  1T9P A;  3KYU A;  2CKC A;  1R0F A;  4AI1 A;  5AN9 H;  2V3B B;  2JI3 A;  2L0Z A;  3WWL A;  1DVB A;  3LNL A;  1RDV A;  2O5J D;  1RYT A;  1IU6 A;  4TVM A;  4YWM A;  1CAA A;  4JAE A;  2ZIX A;  2ERJ A;  4AI2 A;  1IU5 A;  2JI1 A;  3MSU A;  2KN9 A;  1QCV A;  2XJT A;  3KYW A;  2MS3 A;  2XJU A;  2C6A A;  2NYD A;  3PIO 1;  1VZI A;  3QQC E;  3ZG6 A;  3NFP I;  2Z3R B;  4AI0 A;  4B8C D;  2Z3Q B;  1B71 A;  2CR8 A;  3K35 A;  1S2Z A;  3KYX A;  3QVD A;  3RYG A;  1BFY A;  4ZN3 B;  2B5I D;  3PWF A;  1B2O A;  2A6H D;  1T9O A;  3SS2 A;  5GAE c;  2LCQ A;  2ERS A;  2J9U B;  6RXN A;  5AI2 A;  3J7Z 1;  4UY8 1;  1E8J A;  1NXG A;  5GAD c;  2AYJ A;  7RXN A;  5GAG c;  3J7Y 1;  2M4V A;  4AR3 A;  4AR4 A;  4AHX A;  3RZ6 A;  1YUZ A;  2M6O A;  4ZN1 B;  1C09 A;  4AHW A;  3PKJ A;  3LPE B;  4JAD A;  5MFP A;  3RZT A;  3VPB E;  4E6Y A;  1QYB A;  3PKI A;  1IW7 D;  5GAH c;  1LKM A;  3A44 A;  4XGH A;  1R0I A;  5JVG 1;  1ODH A;  2A69 D;  1FHH A;  2PVX A;  2V0E A;  2K2D A;  1OWB A;  1T9Q A;  5AI3 A;  1Z92 B;  4G6B A;  1LTL A;  5MLC 3;  2DSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...