3PKIA

Human sirt6 crystal structure in complex with adp ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
b'ADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPAWDGPRVLERALPPLPRPPTPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-6
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pkiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3pkiA01
1BFDA 1T9CA 2EZTA 4QQ8A 5MF6A 1NM5C 1U28C 4RJJA 4KPUA 5D7NA 4D5GA 4V1CI 4FVTA 1UPCA 1Y9DA 5BWLA 1T9DA 2OD9A 1YHZA 3F6EX 4J16C 4K9OA 4K9MA 3CF4G 4FZ3A 4UU8A 1QPBA 1YHYA 4KGDA 3EA4A 4IF6A 4JUAA 4RJKA 2EZ4A 4L3OA 5EJ4A 2FRDC 4GM4A 1UPBA 1ICIA 3IAFA 2HJHA 3E9YA 4JD5A 4JUCA 4K9QA 4QPZA 3ZGVA 4JT9A 4C7BA 1M2KA 5MFZA 2EZ9A 4L2IA 4UTNA 1SZDA 2Q5JA 3D7KA 3OE1A 4MQ5A 2A1UA 2Q27A 2OD2A 2VBFA 4UUBA 1M2JA 1OZHA 2FWNA 4K9LA 4Y6LA 2C31A 1HZZC 4G1CA 2OORC 3K35A 2IHTA 3IAEA 1T9BA 3JR3A 1M2GA 5MFPA 4FEGA 1N0HA 1T9AA 5DEIA 3FSJX 4MPRA 4JU9A 2WVHA 2PGOA 3F6BX 2VJYA 2W93A 5FEMA 2FSVC 5EJ8A 3D81A 1JSCA 2H2IA 1PNOA 2H2FA 2JI8A 2EZ8A 1YI0A 5K6TA 1U31A 4KXQA 1Q6ZA 1YC2A 4HDAA 1Q1AA 2JI9A 1PNQA 3EYAA 5DGTA 5K3SA 4JUDX 4UTRA 4UUAA 4UTZA 4BVFA 2UZ1B 1YNOA 3HWWA 4GM1A 4UTXA 1M2NA 4GP9A 2H2HA 4R8MA 5K6RA 4RMHA 5K2OA 1POWA 2X7JA 3GLRA 3CLUD 4BN5A 1J8FA 1PVDA 4ZP1A 3PKJA 2H2DA 5IMSA 1UPAA 1V5EA 1OVMA 3U3DA 1U2GC 4K9PA 2VK8A 2H4JA 2VBGA 1YBHA 2JIBA 1OZFA 2VK4A 2A1TR 4X3OA 2BRUC 1YC5A 2IHUA 1MA3A 1EFPA 2PANA 2Q28A 2VK1A 5AHKA 4ZZIA 1Z8NA 1Q14A 4I5IA 1V5GA 2FN3A 3D4BA 2QQGA 4Y6QA 4J1TC 1U2DC 4GG1A 2IHVA 4JU8A 1MCZA 4TWJA 5FYQA 5BWOA 4V1CB 5EJ5A 1O97D 3CLRD 4GM0A 3EY9A 4RMIA 4JSRA 3CLTD 4RJIA 5MGNA 4BVGA 3LQ1A 4HD8A 2H4FA 1DJLA 2H2GA 2JLCA 4JT8A 4Y6OA 3RIYA 4RMGA 1YTLA 5EJAA 3FZNA 1PO7A 2Q29A 3GLSA 3PKIA 2EZUA 4X3PA 4IAOA 3ZGOA 3GLTA 5EJ9A 2VBIA 1D4OA 1M2HA 4K9KA 4IG9A 2H59A 2OO5C 2Q5QA 3RIGA 4D5EA 2H4HA 1PTJC 4BVEA 2DJIA 4COKA 2FR8C 5EJ6A 2Q5OA 5EJMA 1S7GA 4RMJA 4UTVA 1PT9A 1SZCA 4Q9DA 5BWNA 1Q17A 2Q5LA 3FLMA 4JUFA 4JUBA 4K9NA 5EJ7A 4F4UA 1PI3A 3CLSD 4O8ZA 4BUZA 4F56A 3HWX1 4TWIA 1PYDA 4FEEA 2WVAA 2B4YA 1XLTC 1ZPDA 3JWPA 4MZXA 2OD7A 4BN4A 1E3TA 4C78A 1V5FA 1OZGA 2JLAA 2QQFA 2AG0A 2NXWA 4BV2A 2PGNA 1YI1A 4BVBA 1EFVA 1O96B 2WVGA 3GLUA 2NYRA 4MPJA 4GPEA 4BVHA 1S5PA 4BV3A 4V1CA 2JI6A 4MPPA 2UZ1A 5DGDA 4QELA 1POXA 3U31A 2AG1A 2V3WA 3ZG6A 2JI7A 3PDHA 4UU7A
chains in the Genus database with same CATH superfamily
1GSIA 1S24A 1RKXA 5GVSA 1E9SA 2XB9A 1U2GA 3MBKA 2OBLA 3HSSA 1UM8A 4JODA 4MHSA 3GYGA 4OHRA 1ZCBA 5DK4A 2OXFA 2PKYX 2JFNA 2RFLA 2FGKA 1S1CA 1XHFA 3FOZA 3NXSA 3PI7A 5IKXA 3OO1A 1KZ9A 1C0LA 1FTWA 2HJRA 3CUTA 1LI5A 5C2JB 2FH5B 2KBEA 1KPGA 3WA7A 3FI0A 2FE1A 4G67A 3WRXC 1F2TB 3OU6A 4EPVA 1NMYA 3N2ZB 3OM9A 4EI9A 3IUQA 4QECA 2F00A 3N2EA 2Z5LA 3W6PA 2NVOA 1S7CA 2QD4A 1JQ5A 2RK6A 4JYMA 5SICE 1Y8QA 4R68A 1W1IA 4M1TA 5HKKD 1Z4PX 2IXBA 3LUAA 5ALOA 3UAOA 3VR5A 5HE8A 1OXUA 3X1XA 1K6IA 3GQBB 2J9ZB 1US8B 2XRFA 2B1QA 1TYCA 2IGTA 1X7YB 3ILVA 4PLHA 4B2YA 5A5DA 1LRKA 1NUUA 2FNAA 3RJTA 1Q7BA 3BHNA 4OHOA 4Z4EA 1E9CA 3WLLA 4EL0A 1ULTA 5A3RA 1R0SA 4LC9A 4NOMA 3WKDA 3ZOKA 2DM6A 3PFCA 4N54A 3CSUA 4FHDA 1XR3A 3JVEA 4DWWA 2DBQA 3DT9A 3SIWA 2GN4A 3RRYA 1ZGJA 4Z2YA 5CHYA 3WFJA 1T4DA 4MYCA 5DP2A 3PDWA 2PPLA 3L5KA 3O31A 4HEHA 1AB6A 4C3JL 2GGSA 3BCSA 4FCVA 3RU9A 2JFWA 2J9YB 2X1HA 1I4EB 1KFJB 3EXIA 3O84A 4G1MB 4M1EA 4JOBA 4NSNA 5BOSA 2WJPA 1UR5A 1Z8DA 3Q9NA 5IYZB 3AEKB 2XQJA 2Q4DA 5H0IA 1BDHA 1N6PA 5U4QA 3Q40A 3U39A 2PO7A 3QTBA 1DZ3A 3K71B 2J33A 3KR2A 3MG9A 2FUG1 2Y0SP 1IN8A 3WGQA 1ZN7A 1EDBA 3QX7A 4AMGA 4D2IA 4GT1A 2VUUA 2ZW9A 5BR8B 1PLKA 4CFSA 3O4FA 2WJGA 2F3PA 2WBLC 1HLFA 1G59A 2LDXA 3FNIA 1PKEA 4LJ6A 1NW7A 4FFNA 4XVCA 1O94C 3CR8A 1WY5A 3GLKA 1C7IA 4FZRA 1S7GA 4A16A 4ZYXA 3OKCA 5CG2A 3BH0A 4YAIA 1VL2A 4JLBA 3Q6NA 3N7AA 2R6JA 2FWBA 2OCGA 5IDQA 1BRTA 1C9KA 2HCJB 5AI2A 3RVMA 3T5CA 4JLPA 5ALIA 1Z36A 2XPCA 3RTBA 3ZD8A 4O2BB 5FORA 1UDCA 2QTTA 1BE8A 2CLHB 5CURA 1WZIA 4FGUA 4XFDA 2Q6VA 3LWVB 3LUHA 1OXTA 3AGQA 3COYA 4BB6A 1GG2A 4TM7A 3QQCE 1PNRA 1I32A 4X8OA 2FOIA 3G5UA 1QFJA 4E15A 4DV6B 3T3NA 1WQ4A 1XL0A 4A6PA 1FHMA 2VHVA 4AK9A 2BEWB 1KSGA 1C7ZA 4MARA 1F1JA 4RHYA 3N0WA 3VJKA 1Z47A 2O2XA 5KOJA 1NYLA 5FBVB 3BCHA 1YACA 2PWZA 2X58A 5F4BA 2YXLA 4QBIA 4IQ0A 4G8DA 4M76B 2REQA 3F5QA 4ERXA 4NULA 3I52A 3ID6C 5ALHA 4ND4A 3MRTA 4IHJF 3PFFA 3A3KA 4ZIRB 1U0LA 2XYHA 1XPRA 2I9KA 2CVQA 4F86A 3VR4D 2B8NA 1XXHE 4KQXA 3ZDRA 1I3OA 4UUPA 4GX1A 3IAHA 2CFTA 2I4TA 3B6EA 2OLKA 2PGIA 4GZ5A 2X0IA 3UV6A 5SZHB 1QIDA 4EFLA 3QYAA 9LDTA 2ANCA 1PJ4A 1JV2B 4KJXA 2HAEA 5JQGB 2OORC 1KEKA 1B8UA 4FFBA 1T9BA 1SBIA 1U7XA 5ITWA 4R40A 3QLUA 5D51S 2BKVA 4RTSA 2QX4A 2FUCA 3B51X 3BERA 2ENWA 3LCCA 4C2TA 2NU7B 2C5SA 4JBXA 1L8LA 3ESQA 4LC0A 5F1OA 4AWXA 2NP7A 3H9UA 1XMXA 3HA3A 4WKCA 3Q3HA 5GADl 1DFHA 1UC8A 3C85A 3ORQA 4HH4A 3K0HA 1Y5RA 1LKZA 2P77A 3D0KA 3GJQA 1KI8A 4I81A 2X0JA 5EZSA 3V1TC 1N2SA 3NBKA 3QFRA 3TW4A 3MMSA 4CMEC 3PENA 1ESEA 4OBXA 4HH0A 3UMGA 1TTHA 4UFNA 1XMSA 2GM4A 1CU1A 1JQEA 1RPZA 4TTJA 4FYXA 2OESA 3E81A 4PVCA 4ES6A 4F84A 2ZJAA 2FPRA 3ESXA 3D5TA 2Q8QA 2WIFA 3U3RA 4MWDA 3KFLA 4I1PA 2B6NA 4AWAA 1LRLA 1ZMTA 5D3ZA 3IS3A 2GNAA 2C88A 5IK2D 1U7HA 3OY2A 3PIIA 4I8XA 3QBTA 4UD2A 2OV2A 1HE1C 4XWOA 1AQIA 5AW5A 1LSUA 2P67A 2HA6A 1GGKA 2I9PA 2GZRA 2VNAA 3C4VA 4JEHA 4O8CA 4Q4AB 4YRFA 3L7NA 3ZE6A 1UBGA 2UVDA 1P29A 2IJGX 1H1TA 3I6YA 3PR3A 4FC7A 1EFDN 4AJEA 3GJ5A 2ORIA 4BFLA 1JAXA 4X6UA 3L1JA 3K2IA 4I7EA 3UWDA 1W5TA 3WYEA 5K8VA 1PBNA 2HXYA 2GXAA 1VIDA 1GZDA 4DANA 3OT4A 2NV2B 1I3MA 4O2BA 3G1WA 4O4IA 3C41J 4GOKA 4BFCA 4PIMA 4A1FA 2V6JA 4EY7A 3TKYA 2IEBA 1VMAA 5AW7A 1T9KA 2Q3BA 4UAVA 3KYXA 2CMGA 4NBNA 3BORA 3U0VA 4BUZA 5JSQA 2HYIC 1I2ZA 1GNPA 3F3KA 3QU7A 2ID9A 1VB5A 4XKJA 2DPXA 1OZ0A 2O8DB 1DU4A 2GO1A 3ZV3A 1IW7D 3LO5A 2IEYA 2OD7A 4WMLA 3IRVA 3ZE2B 4LEIA 1DQSA 2A7XA 4CV2A 3W2GA 3DD5A 3ER9A 3L1UA 2FRXA 3QOYA 3S70A 4BLVA 2PRJA 2Z3ZA 3KSZO 4I4LA 4KFSA 2X0DA 1WCXA 5AUPB 1K6XA 2J0VA 1LX7A 1U5AA 3JAMA 2ZUEA 4RWZA 5AK5A 2AG5A 3SXUA 3L5OA 4PQYA 2YJ3A 4NE2A 4IIXA 4I4TB 1KH2A 3FNHA 5JQWA 1BW9A 4EATA 3L05A 4Z0PA 2VLBA 4UW9A 3VZQA 3UXHA 2FFJA 3UT5B 4URVR 4D4MA 1SHTX 3TOZA 5KTNA 4ZI7F 2JK1A 2NO6A 4K6HA 1E3LA 2P3LA 4Y9TA 1JMVA 1L8AA 4BQSA 3C48A 4DAOA 3KQTA 2LKCA 3WRYC 2RGUA 4JD5A 5J59A 3FNEA 1O54A 2VH5R 5GGXA 1ISFA 2IYSA 2C94A 3OOSA 1JR3D 4X7RA 4MUFA 4UQLA 2PJZA 2Q4EA 3DONA 5CIQA 5IG2A 1TJNA 3GZ4A 3GRRA 2JFXA 1D6NA 4EWLA 5EMJA 3HL0A 4OATA 1Q0TA 1J09A 4G1VA 2XZPA 5EWLA 1M2GA 5TR9A 1A2OA 3F7OA 1U3CA 1XU9A 1GPYA 2JFFA 4CF6A 2ILTA 4EQZA 2BBTA 4QARA 1J2UA 3L6OO 1PHRA 2O7RA 3M6UA 2QN7A 4OMDA 5FPSA 3VNVA 5AHWA 3O92A 4HDAA 4G0MA 1Q1AA 1L4MA 4HFNA 2VTKA 5EXEA 4DR7B 2GAAA 2GZMA 4B9AA 2CNOA 2DH6A 1QIHA 5D1NA 2BF7A 3KLMX 5EEGA 1L6IA 2GZ3A 3MWLA 1BMFD 2RBEA 3EW7A 2B5OA 4IX9A 1YD7A 4M8LA 3RZTA 4A7PA 2WF9A 3CKLA 1XD2A 1XYVA 4BKMA 8MHTA 1J42A 5DEOA 2AOXA 2NQTA 3HYTA 1FSPA 5IMSA 1GTVA 1JQLB 3TLBA 1IOZA 1NI3A 3D59A 8OHMA 5JC8A 1W1WA 1E1QD 4ZARA 5THKA 4UBNA 5GIPE 5EI5A 5C7YA 3HN7A 3EC1A 3QPWA 4IIEA 1G2PA 4S1OA 1RLOA 1UKZA 1YBAA 1C1XB 2RKOA 1U02A 2X42A 2ZRAA 3NHYA 1P2GA 4LC1A 2IOQA 4Q6WA 1EVZA 3ISJA 4CR8A 3AUJB 4OHVA 3AF5A 2Z1MA 5AW3A 4P7BA 5EMKA 2CHGA 3EFBA 3CVXA 3EWAA 4YP0A 1XZMA 2ZJ4A 3SR4A 2VWGA 5FD8A 2QLFA 4GOMD 4Z9BA 1FMLA 5J2UF 3D5EA 3IOEA 3HDHA 3WKAA 3O83A 4BWYA 1WNFA 4J2OA 4U2BA 3I1IA 5M34A 1N3LA 1RRPA 3VNUA 4HDRB 3A3PA 5HK8A 4OGLA 1C0EA 1OYWA 4RVSA 4IDGA 1KK2A 1J06A 2DTEA 3DVRX 3HKBA 3IEIA 4H7IA 4QEDA 3S1LA 4RDXA 4BGDA 4GIBA 2PCJA 5LKRA 3KEOA 4Q4HA 1SNYA 3WQSB 1JTEA 2H4HA 2JJMA 4ZV7A 3GJ8A 2Q4BA 3VZBA 3NI2A 2O8CB 5FV4A 5EUQB 1Y9ZA 1ZJ4A 1E0AA 1CR1A 1C30A 1QHXA 2OBXA 2OHVA 3KU1A 4JJAA 1B7GO 2PS0A 2CDBA 1GRRA 2DHEA 2GPBA 2ZYDA 3FVTA 4PHFA 5FOVA 1E9EA 3AFIA 5DBHX 3D0RA 3H1PA 5HIMA 3VPBE 4FEEA 3VJMA 3AM4A 1J8QA 3C6KA 4WOBA 1G7SA 3HA5A 2C03A 4Q7JB 3VR4H 4K8RB 4YK7A 3QYFA 1JFRA 3C4QA 4MVJM 3DQQA 1XKQA 3AXSA 4JLKA 9ABPA 4AXBA 1O7JA 2Q50A 1DQYA 3P9IA 3PUIA 3ZD6A 3HCOA 4OOFA 3UAVA 1ZN9A 4ZOBA 2C92A 4BTVA 2F62A 1RHJA 3VOTA 2HO5A 3JWGA 3HYLA 4UHCA 2Z3WA 3KDPA 3EZ6A 4YAWA 3KKMA 5DBEX 1EJ2A 4JQOA 9MHTA 3BRWD 2QRKA 4JYPA 3QFCA 1R4MA 3IR5A 4KV9A 3DS8A 4GBMA 3E22B 1BXKA 5I9MA 3PITA 2X4LA 3CBGA 3K94A 4Q1CA 4ENVA 1DSSG 3OPQA 4TLBA 1BRFA 3GLHB 3QMWA 2QRMA 3L0IB 3STXA 1ZC4A 3P2OA 1VA5A 2HZ7A 3GT3A 3TRHA 1P3DA 521PA 5HCNA 1E2LA 1HQYE 1BU5A 1NI4B 2F48A 2WSLA 3ACBA 4HGZA 4YUYA 3P26A 5IXSA 2XGMA 1KP3A 4KCGA 4MCHA 4FYIA 3ND8A 3NGMA 5KQLA 4I9HA 3FGNA 1XP8A 2VLIA 1R7RA 3HR4A 2FPIB 4CF5A 2FMXA 2ZWMA 3LYUA 5FFFA 4G5XA 5CA0F 1Y4SA 5LBUA 4D6XA 4KVFA 4ESOA 2FEKA 3PQ3A 1TK2A 1W9MA 4R2LA 4DR2B 4QNMA 1RHMA 5E6UB 2YMMA 3F73A 1A5SB 4IEEA 5L3ZA 2B78A 5D5QA 3GJXC 4R51A 3H04A 1TO1E 3BHMA 1K88A 1P2VA 1S96A 3OJFA 3TRFA 3N8DA 4KQWA 5JVG1 3D8TA 1EVJA 2P6UA 1LS6A 5DM61 5IPFA 1GQFA 3R2JA 2H2AA 2DWOA 3G0GA 1NJGA 2C0CA 2W2KB 2WNSA 5EIBC 3ZY6A 2OP1A 5C1OA 3PGA1 4U7DA 3IPYA 3R8FA 4WOJA 4D41A 4ZOLF 3CVWA 4TZ6A 1NW8A 4LJ7A 3ND9A 1W0KA 2WYHA 3ZY2A 1H2AS 1QH1A 1Z35A 1YRBA 3SY8A 4I1UA 1K2VN 1QBKC 1RBMA 5KWSA 2N0SA 4GXNA 4OHPA 1MEOA 4S2EA 2PRYA 4BXOB 1BOOA 4HFMA 1DJLA 1P0QA 4PG5A 2MSCB 3H84A 3A1VA 3Q41A 5DHQA 3WSWA 4COOA 5FLML 2QMUA 3M6FA 1IONA 1O9GA 3MRXA 2Y1DA 3LCJA 1KC1A 1LTKA 5LQUA 3F3SA 4DSTA 4L8VA 5M5BA 5DN9A 2DT8A 4B5LA 3FFAA 3PT5A 2VXYA 3UUGA 1XZPA 1LDYA 4UMFA 5LOVF 4LVOA 5BXQC 2YY7A 3M81A 1ODJA 1YDWA 2I8LA 3OQJA 2P91A 3MNFA 2AXPA 3R7NA 3FHOA 2GEUA 4UU0A 1NSTA 4EKYA 2ZM6B 3BRSA 3QMMA 1N4DA 2PR2A 4YJ2B 2OWDA 4BO7A 3OF5A 3LFTA 4YV7A 2O50A 4FW9A 2IPOA 3VU1A 3ENKA 1VE6A 2BR3A 4Q19A 4I6EA 5D00A 4ZN1B 3HDVA 4R2MA 4OG2A 3U44B 2VNJA 1FRFS 2ZSUA 3FUUA 2YDXA 4OXKA 3R7AA 1W48A 1XTUA 2FFRA 2P30A 1OH7A 2Q6IA 4PHHA 3T34A 2XUPA 1A5BB 1TCCA 1UMDB 4AIRA 4ARZA 1RTTA 2B20A 1OB5A 4V0SA 4B3MB 4TT3D 3BT7A 3H19A 4C29A 4J7UA 4J3JA 3IEUA 1HE5A 3FCEA 3H2ZA 2R25B 4NCAA 5EQTA 2JH9A 1I1OA 4M7RA 4JAEA 1WM1A 2HSEA 4KPUA 5KYUA 3TTXA 3VHQA 4W5QA 4PQRA 3HZHA 3NM6B 2AQCA 4O2AF 1Z8FA 2FA9A 1GZ7A 2QR5A 4JJFA 1K4YA 2GCEA 3JY6A 4M8IA 4RTQA 5C32A 1ZONA 1F8UA 1U3FA 1ATIA 3AVQA 4N8DA 2R8OA 3W4KA 2VIIA 4B4OA 8GPBA 1UZMA 3NUQA 3COWA 4J49A 4UTNA 3CNLA 3VTKA 5JOQA 1IWPB 4JB3A 3U09A 3O90A 3CWQA 1N9KA 3RREA 3E9RA 2Q41A 1IK4A 1OF1A 1I13A 4FQ5A 1O89A 1WU7A 1JJFA 3H2BA 4WK4B 3PRHA 3J7TA 2XMBA 4OHYA 5K01A 1GL3A 1QO9A 4EENA 4F5YA 1U7UA 4Y1RA 2BEUB 2BY4A 1LDMA 4TN5A 2PKWA 3AHCA 4WLFA 3O26A 1GG9A 1IFXA 2PGJA 3Q3EA 4AKIA 3ICWA 4RORA 1Q0PA 4GP6A 4KXQA 3RS5A 3WAKA 3V9PA 5FWXB 1L5NA 1D07A 3DE4X 3SG0A 3EPJA 3DR5A 2RONA 4URWR 4MWBA 3P2YA 4X64B 2ZRBA 2ZYAA 4Y0AA 1BQ8A 5JI2E 2QYSA 2NUTA 2B4RO 3FPEA 1N2HA 1N2EA 3GL9A 3LP5A 3QENA 4MWZA 4OO3A 4Q39A 2ATXA 2L42A 4Z6KA 121PA 3DAHA 4G0QA 1FY2A 1TJ3A 1J8FA 1FDOA 1W5FA 3IBTA 1C7RA 5FLEX 4D26A 5TARA 4MCJA 1F0YA 2B21A 4KXVA 1ABBA 1O77A 2JGJA 2Z5FA 4QREA 2BTEA 3ICOA 2Q3EA 2HO4A 2M32A 2HHJA 4LSMA 2ZAOA 4D9IA 1CUXA 3JVIA 3DGEC 4D0GA 2YKGA 2JJ2D 1Y6GA 1AVTA 4FJ1A 3B0AB 2NWQA 5LP6C 1UFOA 1MO3A 1Z73A 1DMRA 1WCIA 1ZUHA 5BV2P 3JWJA 2AW3A 1E2IA 3RRFA 5FULA 1P5HA 1EGAA 1UAYA 1W4BA 1VL8A 3N39C 3WYNA 2C9MA 1KU0A 3B3AA 3HFSA 5FWXA 4DEYA 5ALFA 1DNPA 1T2NA 2NTJA 1A76A 3AR3A 5KTOA 2XUJA 4WERA 2GCOA 4A6EA 4B75A 1AHPA 2IS2A 5C8ZA 1T9OA 4A3JL 3KTOA 3KSBC 3E9CA 3Q12A 1T2FA 1FC0A 2FVYA 2IU4A 4PYLA 3O1HB 1WP4A 2OAP1 3IBSA 4P4UA 2FPOA 1EMDA 3CRMA 1IUKA 4D02A 4YDHB 2JHGA 4P22A 4MKXA 3OOHA 4IIFA 5FUXA 2VT2A 1HTBA 1TM2A 2JAXA 3P2EA 4RKYA 2O7NA 4RIIA 4CMBA 3KALA 5I7RA 3I9V1 6GPBA 1AA6A 2UU9B 1FVHA 2DPMA 3G2PA 4I2VA 1HG0A 4S1PA 3F47A 3R77A 4MX8A 3MGKA 4B79A 2W70A 3DF7A 4BE4A 3K96A 1DBIA 4LDQA 2PZKA 3F4KA 4FBMA 5JVH1 1Y7HA 4I6GA 2WUDA 1I9CA 2HEIA 2Q1UA 1SBQA 4PGAA 2J09A 4IEIA 4TQ9A 4EKDA 1Q0UA 2C3UA 4POAA 5T4FA 3UGKA 5C7IO 5JECA 1RZUA 1XLWA 5KNCD 1QWOA 1U28C 3ROGA 4FLFA 4YMWA 1Y9DA 3LIPA 4ICIA 4KO2S 4ZYWA 3L04A 1OHHD 2I2AA 3EA4A 4RVCA 1G38A 1Z8HA 4OM7A 5DTRA 2JKZA 3O3OB 1YZHA 4PXAA 4RAOA 2VOJA 4FDLA 5AH0A 1IRIA 4G0UA 2A5FA 3BZUA 1OAKA 4FZJA 2HWUA 2Q27A 1K7XB 1UQUA 3UMRA 1S3GA 2FWNA 2P4SA 4L02A 3LMKA 3E5HA 5FL7A 5KYKA 3IAEA 2JPDA 4BNMA 3GK3A 4KSBA 3C97A 4NR0A 4QDZA 2GA9A 2RD2A 1JIXA 2HA7A 2B2CA 1NQXA 3RR2A 2X6QA 2XNKA 4CM3A 1U8XX 1A9TA 1G6OA 3V00A 3VPXA 3EVZA 1JSCA 1Z62A 2HMUA 1EJBA 2V3VA 4LE1A 1YI0A 1SMWA 3FF4A 2ZSJA 4G63A 4PC7A 4UASA 3WL6A 3B6ZA 5K0JA 3F4LA 4B46A 3MHTA 1CYDA 2IIQA 5HZKA 2IYOA 3S7TA 1GAXA 1IY9A 3CONA 3ZX4A 4HNGA 1MXHA 1G2OA 2VEDA 3I0MA 4DQLA 5C8YB 1ADFA 1O9HA 2JKVA 5EHNA 4RY2A 1RYZA 3MFYA 3QF4A 3V6LA 4FEAA 9LDBA 4J4HA 4BCCA 1U7ZA 2BYTA 4LGMA 8ATCA 1E3IA 4C0BA 4KB5A 3BICA 3CLUD 3F5MA 1Q16A 1JDVA 1KJZA 1LZKA 1R37A 1RJFA 3DAPA 4EG0A 2BCGY 1AO3A 1SQ0A 2RJ3A 2IYLD 2W71A 3DT6A 1HORA 3IV6A 3QPUA 3QVOA 4BPBA 4KWCA 2ONCA 2C2BA 4YR9A 3IHTA 4YXFA 5BR4A 2GZHA 4P4GA 1XVLA 2JIBA 2II6A 3BXPA 3I9FA 3PC8A 1SA0B 1WABA 5I8WA 1XZQA 1BKDR 2IUEA 3DHWC 1FNCA 1PQWA 2CV1A 2FKNA 4B85A 1U6KA 3TMAA 2W00A 3L92A 4L8GA 4YAUA 3K5HA 3MT7A 1V1RB 2DR0A 1PX0A 2VJOA 5TQ2B 1E18A 2PKEA 1CUCA 2VA9A 3CLRD 2VPTA 3CCCA 3ESBA 4JEIA 4EW1A 4DDVA 2ZK7A 4CL2A 1JLHA 2C3MA 3LPLA 5H81A 4OXRA 1YVUA 1PJSA 4EHFA 2IP4A 2DR3A 1RI2A 1CDZA 1EFHA 3AHDA 1D2HA 4OJNA 3DVAA 3JWHA 4MGHA 2RG1A 3GCWA 3LUFA 3ROZA 2OFOA 1JFVA 2H1CA 2XE8A 3SMVA 5FEUA 1ZP6A 1N1GA 1Z4KA 4Q9KA 2OZKA 4U9IS 5JS8A 4DR5B 4KGXA 4XPIA 1VG1A 4IG9A 4WE3A 4DZTA 3NBYC 1VE5A 5KJ6A 3R0JA 3T94A 1NQAO 1G19A 1VSQA 1NUAA 2HQSA 4HATA 4UMEA 2XB2A 3GAFA 3NUZA 3PFKA 1DIAA 2DX7A 2IE8A 3FOAA 4U39A 5HHTA 3RGGA 2CXQA 4AF7A 4BEBA 4F4UA 1G8GA 1Z4NA 3G13A 4ZV9A 1LLCA 2IPNA 1FFWA 5K0FA 4LMBA 2PMFA 3DE3X 4BTLA 3C1AA 4QGFA 4WKPA 4YRIA 5MN4A 1W0JA 3HOUL 6ABPA 4IS2A 3FDIA 5LP6A 3ETJA 2XBMA 3L1IA 3L6BA 1TU3A 4LOIA 4X97A 1G8KA 1RXSA 3K1AA 4M7PA 2QTRA 3AL2A 3CYFA 4RA9A 4Q16A 2Z4TA 3KS9A 2RK3A 1IEXA 1A9RA 2OC9A 2ZU0C 1U1GA 1RPNA 3IERA 3MIIA 3NDJA 4KAAA 3S28A 3BWMA 4FR0A 3E27A 2W7TA 3OFNA 3REQA 4N3NA 1OX4B 1OCEA 1YULA 4OAOA 3M6VA 5FI5A 1P44A 3W5SA 3CE9A 3M8KA 2CL7X 3O2NA 2XA9A 2CHEA 1QPBA 1YHYA 1PJRA 2ISSD 1ZG3A 1ZCFA 1S8FA 1QP8A 2YWHA 1G6KA 3L8DA 3GFRA 3KSUA 3LSYA 3NFYA 4DT1B 3KPWA 1LLUA 2I7XA 2HQOA 2QN9A 3NTUA 4RQAA 3ZJVA 2Z83A 1I2MA 4LWQA 1LKOA 2OHGA 2Z2ZA 3G0IA 1NVAA 2IZ5A 5FQNA 2ERYA 2NVQL 3AKDA 4KR0A 4O63O 1KAOA 2POCA 4RXMA 3M9WA 3UKDA 2XZTA 1F2DA 2I03A 3LO8A 1F8GA 4Y6PA 1EBFA 1Z08A 2FZKA 3LLUA 2QSYA 4J29A 3AETB 4EDHA 4DSZA 5JH7F 3EAFA 1MC5A 3VI3B 5BYAA 5JNVA 1C4XA 1VIAA 5TS3A 3RU3A 3KXKA 4ADSG 1HQCA 3RS9A 1ZEMA 2KLBA 2VQ6A 2Q6TA 3DEJA 1LNSA 4LCEA 3DHNA 5EXXA 5TJ9A 1IG3A 1XN4A 2IYVA 4ETWA 2ZQZA 3JZMA 5JXGA 5TIIA 4CHGA 1WW8A 4B44A 3GDHA 4R31A 1X80B 2CYBA 3MW8A 5I45A 1R5JA 5KYYB 4PIVA 2A6PA 4PEVA 1VZ2A 1NWHA 1U1CA 4O4LF 4FJ2A 4RS3A 3RM3A 1B16A 3V4OA 1P0FA 3WJ1A 4IQ8A 4B4UA 4DUGD 2AEMA 3T3GA 1LPSA 3GLRA 2JFPA 3FRIA 2F3TA 1U2SA 3MCVA 2R6R1 4RKFA 3LM8A 4P84A 4ZO6A 3GD5A 1TUIA 1BXGA 1G16A 2O7SA 4EUSA 1XLUA 4PF1A 3WDLA 5J4LA 3UYLA 1K6JA 2EC5A 4A03A 3LX8A 1V9SA 2J6BA 4HAIA 1XQYA 4IDEA 3SNHA 4QJ5A 1N3YA 3UVEA 5MN6A 1Q0HA 3MB8A 1K66A 2YMLA 2YV1A 2IYAA 4PS0A 5FLKA 4YV0A 5BWOA 2PH7A 5HVNA 1Y7PA 1BE6A 2J67A 3HBNA 1GNTA 1L4UA 4G5YA 3SQXA 3HGMA 1DC5A 4UQOA 2RHWA 4OLBA 1THGA 2I80A 2QRPA 3WWEA 4F5ZA 1MHTA 3ACCA 3CCBA 3BE8A 3QIVA 3RW9A 1O4VA 4QUKA 3VYVA 2ATIA 4UD6A 4CIBA 2J85A 5ALSA 5J5VA 2VBIA 1E6WA 1HYGA 2OGZA 1R8QA 2PKCA 2SCUA 3DOCA 3AVWA 1CJTC 1J8VA 2WFLB 4MW0A 2EW8A 3KOXA 1JFTA 1JL3A 4WNCA 3GNQA 3LQYA 5KYWA 1M0EA 4YRNA 1AKRA 5H16A 2V5VA 1EX6A 2QJRA 2LNDA 3WLQA 4F3CA 1L7EA 1MO4A 3ANLA 3RBAA 3LZCA 4QXAA 4KXMA 1E20A 4PG6A 2CMFA 1E3QA 1HDRA 3FUCA 3JQRA 4ROTA 4RM2A 4UXHA 1PDWA 4TN1A 4ZCLA 5FF9A 1OJLA 3PQ7A 1Y3IA 5SY4A 1M8JA 3NTLA 5AJYA 1ZPDA 5KNDH 5LDDC 4NP6A 3UXYA 4EG7A 3G2IA 3ZE9A 4XYMA 3PPYA 1H2EA 1V47A 2J32A 4S1TA 3LLSA 4ABYA 2NMVA 2WWFA 4YRJA 3A9SA 1ES9A 4R9VA 4RKQA 4DLVA 1UK9A 3I0NA 5BOSB 4JI8B 4TS1A 3MAJA 4ZCSA 1VHQA 2X2OA 3H2GA 1OTXA 1N9GB 2A0XA 2VF7A 3DGFC 1LKMA 4EZBA 2R8XA 4GQBA 3NHLA 4NK5A 1BFDA 3AKCA 2QT1A 3TD6A 4KDRA 1G5HA 4MPDA 2MINA 1T25A 1RADA 1P8JA 2Q2OA 3NP7A 5EKUA 3FY4A 3F7NA 1ODCA 2ORYA 4MB2A 1JVNA 2PVCA 3FYDA 4C0JA 1JKIA 2XJTA 3CLRC 1CWUA 2XMDA 3G85A 4P1ZA 4R1LA 1V37A 3TD9A 4AN0A 2UUCB 4LFBB 221PA 3TD2A 1E8DA 1K27A 2DKFA 1F5SA 1WV0A 3OZDA 4AYXA 4CJXA 2CT8A 2QUKA 2Y0BA 3TEMA 1WF6A 4MAAA 5F35A 5L40A 2Q0SA 1FE8A 1S3SA 2CMDA 2QB5A 5F2OA 5KC9A 3DKIA 4L22A 2IUYA 1Y5MA 2RHJA 1R0WA 2GF9A 5AM3A 1XZFA 4NMWA 2H1FA 1N5RA 1VXRA 2I54A 4M9XA 4TV8B 5L3QB 1VCMA 4XH9B 3MAAC 4O1IA 4D9HA 1NYTA 4KMMA 4E4RA 2PUHA 3DF9A 5TMPA 2EKZA 1TWCL 3QOFA 3DCIA 2QJWA 3FYUC 5A2GA 3OZGA 1G63A 1KI7A 2QV0A 4JXJA 1OT3A 3S55A 5HQTA 1QAQA 1QHNA 1E4OA 1TYEB 2FZVA 3KJQA 1OBHA 4ZN3B 1A27A 4MCAA 3WY9A 2EGUA 4RNCA 3IQZA 3GBPA 3PSHA 3KJIA 3M0EA 5EIHA 1ZVJA 1O6CA 2X8JB 4HNTA 1LWNA 2WR8A 2Z0MA 5CT8A 4V02A 3C87A 3LT5A 1EZ4A 1PVDA 2JA2A 1GL6A 5BN4B 2CNWD 3C1TA 3Q9UA 3DHEA 2H4JA 3UANA 3ZWOA 4BGUA 4YHHB 3U61B 1VI2A 1NDQA 1R6BX 1K0UA 4G6BA 2FMHA 2PKXA 3NS7A 4RPCA 4QRDA 4WDRA 4ZVNA 5MHTA 1GAJA 1ZSNA 2DUMA 4LYGA 1PWXA 2HMYB 3BDIA 5TT1A 1P3Y1 4YCLA 5JZMA 4NKRA 1LFAA 3C3PA 2BM1A 4JAGA 2FSPA 2P9FA 3VPFA 1CJKC 1OB2A 3KAKA 3MVEA 2OEPA 3SZRA 4ER6A 4AYBP 3BX1A 4XM0A 1QE0A 1B8NA 2X6RA 2Q6KA 2GWHA 3LHSA 4KBFA 2H2GA 3PCRB 4TL9A 2WDZA 3BGVA 4O6VA 2VT7A 1NVWQ 3E2IA 3BWXA 4ND2A 4A26A 3SZ3A 4Y1GA 4O2AA 3G23A 1X94A 2UUBB 4C7JA 3SBDA 4WCFA 4O4JA 4EVIA 1YOBA 2CF6A 1CJMA 1FJHA 1WMAA 3NCTA 1T5OA 5JAQA 3SXPA 4CLXA 3MTBA 4IJQA 1ZINA 5HUQA 2IV7A 4DG9A 3HUTA 2YYYA 3T35A 3UT0A 1KNQA 4DNOA 3JQFA 5AVYA 4D9MA 4RJTA 4FE3A 4J2TA 3DUWA 2PWPA 3OEYA 1MBZA 3E61A 1CY7A 1E6MA 3NALA 3WRWA 4RK4A 3ADOA 1OGIA 3TTUA 2QROA 4DZRA 3TG8A 4GL2A 4QC2A 4DR6B 2BMEA 2XDAA 2X6TA 2AL7A 1KEPA 1R4ZA 2D5AA 3SX0A 3VJLA 3RC3A 1PUJA 3M6AA 2AG0A 1U8EA 2P90A 5EJGA 1MB4A 2ZYWX 1XGKA 3IQIX 1YV9A 4WQMA 3C16C 5GONA 2IWRA 3V8VA 1VLQA 1XRPA 4V0ME 3ZLVA 4PXSA 2BEVB 2H7VA 4AJ1A 5LMCA 3A9VA 5U9CA 4BNKA 3TXXA 3TSCA 3QUTA 1U3TA 4A3FL 5ILQA 4ZYTA 1ZRNA 3OIYA 2V9CA 1YAJA 4RTJA 4MVJH 1O94A 4IV0A 1XPJA 4OH7A 1HEUA 4MV4A 2X4GA 3HNPA 4EHKA 2HPZA 3D4OA 3V8PA 2Q8PA 3OZTA 5F3DA 1KBQA 2KB0A 2O0MA 4KRYA 3OZBA 3RS8A 4S04A 4CCAA 1F20A 1A2QA 3IU3I 5C80A 3FHTA 2G72A 5JNTA 3R9IA 5JIBA 3BFKA 5MFZA 3O8LA 5JJIA 2C82A 4C08A 3CSSA 5ICCA 4BRSA 3GMSA 1RWDA 1FL9A 3HMKA 2W2OA 4MQ5A 3GPCA 4YCCA 3ND5A 2AR9A 1DV2A 2GPSA 4V2UA 1OGYA 1XRQA 2CMKA 4M1SA 5FJIA 1E7MA 1XTZA 2I1QA 1BKSB 1W2GA 3IQGX 3QVVA 3QX3A 2JAUA 3NYWA 3QUAA 5TMEA 4B82A 3KUUA 2O6HA 5AJTA 5E0KB 1DX4A 5CJ2A 3C45A 1ULZA 3ZHQA 1DUIA 1XDBA 4RULA 1EP3B 4OI0A 2NT4A 1HE2A 4QFBA 3SMQA 3RD5A 1QCDA 2CFRA 3K3PA 1IUOA 1P9OA 1X7WA 3NB0A 5CVDA 1Z16A 5FWYB 3TVTA 3PNQA 1ZNQO 4QGAA 1L7DA 3K0AB 4BJ5A 2WWHA 2C3YA 1CZOA 3DCJA 2ZJ5A 2DHQA 2HH9A 3KXIA 5F7ZA 1TWGL 1J0DA 3CIOA 1P39A 5BMVA 2RCNA 3PGVA 2R0QC 3BMCA 2IIVA 2CV0A 2PBLA 1DEOA 3HFGA 4BQQA 4DMKA 4F3KA 1O5TA 2GTHA 1UDWA 3THXA 4EHIA 4M7WA 1NOIA 5IN4A 2GTIA 3HVUA 1CUIA 4U6SA 2ZUWA 3QFFA 4ER0A 3AB3A 2NO0A 3DEYX 3K1JA 2GAOA 4IL5A 2NZWA 3L8MA 4IFTA 1EQUA 1G8MA 2GJ4A 3U17A 4WBSA 2F1JA 4IDNA 3HO8A 4O4HA 5DP1A 4V196 2P7HA 4PIPA 2AC2A 3NBXX 5DB4A 4E5NA 2ES4A 1G9TA 3L8EA 3H9GA 4Z7JA 5FYQA 1U2DC 5TT0A 2ERJA 3ZVMA 1UEXC 3M9XA 3PEWA 4MQMA 4TRJA 3GLVA 5KTSA 1V16B 2XZDA 3HB0A 5MGNA 3DMYA 4HDKA 4HD8A 4K05A 3WQBA 4QYSA 1TT5B 4DV5B 4BVKA 1NTOA 4B3FX 4FM9A 2IBSA 3B7GA 3JTEA 1SVLA 4CKEA 1QP0A 3LQ4A 3B7WA 3IBCA 4N12A 3LLCA 2I4MA 4OJMX 3ZTTA 3ZWXA 4IAOA 2ZRLA 4EB6B 4EUKA 3LYHA 1T8WA 3MUNA 3SS8A 2WKSA 4N65A 4KXWA 1FP1D 2DFNA 3EDYA 2H59A 3ODPA 1BWPA 1MJHA 1Y8QB 3A37A 3CF2A 3I6QA 1LBHA 1QLWA 5DYIA 3REGA 3TQTA 2EQAA 1GU7A 2B1RA 2Y3IA 1TLLA 1XEFA 3GEMA 3OPNA 1TEXA 1WQ1R 3WWPA 2I0FA 4IJ6A 4DLTA 4IYJA 2CJFA 1I51A 3RUCA 1BA2A 1IY2A 1DIGA 3GA7A 2REXB 5IAKA 2NU8A 3JQAD 3WBKA 1HWYA 1KOGA 1I0IA 1GFSA 1PJBA 1ULAA 1ZOOA 2PS3A 4UUOA 4ZAXA 5FUVA 2EFYA 3JQBC 2NZJA 1W76A 2PS9A 1KJNA 2ZPTX 5J2UA 3HXKA 5FI0B 4BU0A 4KWTA 4QIWP 4D4LA 5JSZB 2JBWA 2DECA 2WJHA 4G37A 1NNI1 4MW9A 1ORWA 3W4IA 2FSGA 5AW8A 1FP7A 2ECPA 2IPAB 4WZAB 3A6JA 4HSGA 3GEEA 2ZZKA 3TI9A 1A0OA 2NYUA 3O73A 3N2IA 2O4UX 4DB4A 3JALA 3LUPA 3I62A 3MTDA 1KOFA 1DDOA 5HE9A 2XA1A 1JIKA 2BGTA 5IF3A 3LW7A 3H9BA 3CX8A 4R1QA 3HCDA 4F11A 2R60A 4HVLA 3FAZA 1XNJA 3I37X 1ZH8A 1XTQA 2EIXA 4L6IA 4CM9A 2X3YA 4JUCA 4N8EA 4Y6RA 3RV4A 4AFNA 3U4DA 5DNUA 5FWNA 4KACA 2ZLBA 3OZEA 3HVHA 2E2WA 4GUDA 3SXJA 4ZZ0A 4R2KA 3BEDA 4JGGA 1Y1TA 3ZGYA 2Y27A 2FPLA 4O4IF 3CO0S 2H5EA 2FZLA 1M2OA 4OP1A 4BFVA 4CN9A 3O1IC 4G2NA 3R75A 3UFXB 3E6AA 4ZI5A 4CKCA 4HZUA 3PNVA 4CQJA 2M4YA 1AE1A 1H93A 1WAMA 5IC6A 4MVJF 5LN1A 3EH1A 2DP4E 1QDUA 2VK2A 3ZV5A 3NHBA 1NJ1A 3GPDG 2HMVA 1I1QB 1U5BB 3V4FA 3I92A 4H31A 1XA3A 4OP3A 1ODHA 3SOPA 5JYCA 2FDCA 1AJEA 1ETUA 3VR6A 3DAYA 4C89A 1B71A 1NXSA 3QV1A 3T3HA 3TRDA 1CR0A 2FX5A 4TTAA 4FW8A 4K9SA 5EE1A 3RYHB 5IT4A 3PWKA 4L76A 2H12A 1QO7A 1CRPA 1IY8A 1VKOA 3OD5A 3VH4A 3KQVA 5E9WA 4EF5A 2FJ0A 4B48A 1KAGA 4EPXA 4FNGA 1Y7TA 5DT2A 1BTOA 1M8KA 3SZOA 1X7ZA 1KYXA 4KVGA 1N0VC 2CLDX 5T41A 1GKUB 1V8ZA 2ZCUA 3JQQA 1ZD4A 2DRIA 2FZCA 1XJCA 1ORRA 4AMBA 1CCWA 2YHBA 3H2SA 2ZFUA 3EZLA 1Y1WL 4V1CB 1QGDA 2IFTA 1C3OB 3BHIA 2G8NA 2DWCA 1HK7A 2OWEA 5IBCA 4QBHA 2VBCA 4HDNA 4RY9A 1EZ1A 4MULA 1U5CA 5KOIA 1E6LA 4RV9A 3I3SR 4I19A 4JVNA 4YUVA 5CG1A 1YMQA 4JR1A 1M5TA 2NUPB 2ODQA 2C4VA 3LXMA 4UE6A 1Y3DE 3FTCA 4LQLA 1MAWA 2YCLA 1QX3A 3FSRA 3I2HA 2FOXA 2NPIA 4XCXA 3HKZP 2GQ0A 4N9WA 2H9YA 5I6DA 1P33A 3PZAA 1PWYE 4YCMA 3GARA 4J94A 4RH1A 3F6SA 4J3FA 4J9VA 4KWHA 2C2YA 4TSRA 2QVCA 4TPKA 2XF8A 3UKJA 4LE2A 3VYSB 3ISVA 1V43A 3MLEA 4M8KA 1O9BA 3K31A 3LH5A 3CUUA 4JI3B 1CF2O 3AYXB 3KYYA 4ETMA 2FZ4A 4ZYLA 5L3SA 4WECA 2O0HA 2AUTA 1MNAA 2Q9AA 3FCOA 1WDKA 3GW8A 4WZAA 2KX7A 4KPUB 3MJTA 2R4QA 2AFIE 3AHFA 2QX7A 4XVQA 1AXEA 4DR3B 2UYCA 3VVBA 3ZHXA 2IYFA 1UPUA 3IE0A 2QVZX 3IIJA 5CB4B 2IX3A 4L75A 4MPJA 2I1WA 1GUBA 2EBUA 4TLDA 3ZXIA 4PFJA 1IN6A 1ZCZA 2PQMA 2Z09A 3AW9A 3L7BA 2DWUA 4D9FA 2BFFA 4HDKB 2CBGA 1A82A 3B1ZA 1DBQA 2HDOA 1DBVO 5EKSA 2A6HD 1J24A 2XT6A 2LPMA 2BAGA 4N5IX 5AJVB 3TPFA 2VQFB 4G5RA 3DR3A 1KJJA 5D85A 1VE3A 1GSAA 3K72B 3T06B 1XD8A 4W7IA 2LCFA 2XA2A 1ZJJA 2OT3B 2JW5A 4L3OA 2RGCA 4M3NA 1G8HA 2OHJA 3KLPX 2O2IA 5U4XA 4F2GA 1D7AA 1HC7A 4BDSA 4YP7A 3HJCA 1F38A 1HL7A 2OCPA 3UPUA 4RZUA 4YDQA 4RPKA 1CFZA 1GARA 1STOA 2YNMD 3VSBA 5ADWA 3OJEA 1ADYA 1GPJA 3EVEA 1W73A 1PFYA 1LJUA 1S9DA 4RLHA 3VR2D 2OVBA 5GM2A 4B6FA 4OQDA 5JZSA 3CEPB 4E46A 1V9CA 3WK6A 5K0CA 2ZZNA 4FUTA 5D3MB 4C7XA 2I8CA 1K0FA 2PEYA 1NBAA 2VJYA 4O2LA 3KCQA 3V4VB 3L41A 4M88A 4AHZA 1SOAA 3ORFA 1AGYA 1YR6A 2WZQA 3IB3A 3KPYA 5BPHA 1CKEA 3QVGB 1I6HL 1KDZA 3ZWMA 1P91A 1NSFA 5KMGB 4UEQA 3WAJA 1W4CA 4BVFA 4X7MA 1B6SA 2QLLA 5EMLA 4ZK2A 1L7BA 1QH1B 3N3BC 2ZTLA 4YRBA 1B0PA 2QVBA 3M5PA 2H9AA 3H0EA 4HLUA 2MSDB 1XMOB 3KIPA 3U7QB 1F9AA 1PV1A 3LT2A 5K51A 2FEAA 2OQRA 2PA3A 1WVMA 3RQIA 2DUJA 3L1HA 2D1SA 3AB7A 3RVPA 1Z38A 4LI0A 3IPAA 4E2XA 3PIDA 1IU5A 4JBNA 3AFMA 3DYIA 1WZNA 4P98A 3THRA 3I12A 1MG0A 2WF5A 1K8ZB 2GN8A 3TNYA 2I7CA 2XMCA 4MV8A 3WDMA 3FCUB 4M98A 4DLLA 5AVRA 5HF5A 3EQ9A 4CYMA 3B5IA 4BNFA 3ROMA 4JQCA 4UBOA 1V5IA 4ZI7A 2VQ3A 2HU8A 2VFAA 1LPMA 3S1NL 1WHSA 2M6SA 3TQOA 1C9JA 2AC4A 3O6VA 3DE1X 1R0CA 3DCYA 4XIYA 2Y66A 3QEAZ 4IGKA 4UVIA 1RRKA 1YK5A 1MAVA 1EG2A 2V03A 3PA6A 3QPDA 4P3YA 1A72A 4C0WA 1I7LA 3R0VA 2UZIR 4P7JA 2H08A 4URXR 1D2RA 1PG0A 1CUFA 2J3LA 2YRXA 4R6WA 5LL6P 2QHXA 4UDYX 1KA9H 4EY5A 2M6PA 2G5GX 3PGJA 5JEDA 5ES3A 2CBZA 2PV7A 4OKNA 5KBYA 4LZAA 3O1LA 2IS6A 3MCWA 1R8YA 3EBOA 3NJ8A 1P5FA 2ZJ7A 3B1FA 1KVTA 1P0IA 3HXLA 3TOSA 3NR2A 1AZSC 2X7HA 1NMQA 2R1ZA 3CRNA 4OHUA 4OIMA 5I8ZA 4YMVA 3ZU4A 2M1XA 1C2TA 2V0NA 4UXJA 2B4YA 3CX3A 3CTPA 3HMQA 4MZXA 2YWJA 1P1HA 1Z7EA 3AONB 3ZWPA 3L0DA 2PL1A 1D1SA 3DXZA 1IPFA 3O93A 2QL0A 4H7EA 4F3RA 3IAM1 4EELA 1EP2B 3F74A 4PZ9A 1UDBA 1Y9EA 2PR7A 4G1UC 4J0CA 1Z75A 1XAIA 2IOYA 3AESB 4F1JA 3F5FA 3MZ0A 4BNDA 1DC6A 1NW9B 1KI2A 2HADA 1ZZEA 3WMGA 3WYFA 3X1DA 1IDOA 2IP1A 2RDVA 1IBSA 5FUBA 2Z9BA 4H7DA 2O1XA 4IUBS 5L4NA 1DEHA 4HGNA 4P3XA 5LP1A 1KGDA 3ROPA 3VVLA 5SZKB 1SH7A 1S8NA 3LCRA 4R9RA 4IHKA 3SS2A 3LT1A 3AC0A 1HNNA 3AVOA 3Q7RA 4YT5A 1FZTA 1HXHA 2RI6A 2VDUE 4BQNA 2XXAB 4IDOA 1YVRA 1G5FA 4PO1A 5A62A 2WUVA 1VRVA 3GFSA 1FJGB 4AY4A 5DVZA 1WUJS 3HKBB 2IYWA 3MEQA 4YQEA 1SC4A 2LDBA 2P75A 3DBIA 3JSAA 3L9XA 4NECA 1W44A 2PGAA 4PZUA 5DGHA 5EPOA 5H3HA 4UARA 4EVSA 1T5SA 5C3EL 1CUHA 3IMEA 4IHQA 1YONA 4LHZA 4M0DA 3CM0A 4EFNA 3HN2A 1Z17A 4UPDA 4GC9A 3FZGA 3W04A 1NXQA 1P9LA 1WXXA 1RWKA 4UTRA 5LNK6 3E8SA 5E9JA 4BO5A 4G0ZA 1UZAA 4JYBA 1CUAA 1OLUB 3L9WA 2V5UA 2OGSA 1SBYA 4H7HA 1NXPA 1PBTA 2O2DA 2OHFA 5CD9A 1QSGA 2QQEA 2ZPUA 4K6KA 3CZ5A 1LS1A 3T7EA 1QLHA 3N8GA 3ZYZA 2JLZA 2RH5A 1XDDA 1K4MA 5C5IA 3D0OA 2I6TA 3I1FA 4GI1A 2BIFA 3K70B 5F73A 1LBTA 4ND8B 1X13A 2KPOA 4F12A 2ODWA 3HOXL 3P27A 3RROA 2M4VA 4ZK6A 3LBIA 4ZZIA 1E8NA 2JGMA 5IVIA 4CPDA 4MRMA 3UA4A 1JWLA 4KEAA 1WL8A 2PVXA 2W2VA 4AKGA 1UC4B 3D3NA 2H3EA 5DKFA 3HPQA 1M6VB 4IVRA 5FUQA 3R40A 2PMDA 1F2VA 2VS1A 4G1FA 4NZYA 3CX6A 1XEXA 2NZ2A 4PSCA 4W63A 4PAQA 5DNVA 1T2VA 3AF2A 1XAJA 3MJSA 3ZJUA 4GDFA 2YRFA 4R1SA 3CR3C 3SKVA 2F9LA 4LXIA 3RWOA 2I4NA 3ED1A 2WUWE 4I9NA 4H4DA 3D6HA 3H86A 2B30A 3QKRA 2Z4SA 4HNVA 4U7GA 2EP5A 4YJHB 1VBMA 4G9EA 4A5SA 2QRLA 3KT3A 5BUQA 3QVDA 3BMNA 4B8ZA 3M6XA 4FC6A 2HT1A 4DNQA 2J07A 4KQHA 5EY5B 4ZVKA 2FXIA 2AN4A 4OHFA 2VJBA 4E5DA 2XTMA 4QYTA 5LM3A 4P86A 4RVGA 3EGVA 5DM71 4CEIB 2WVAA 3FHJA 3Q7PA 4U7PB 1ZOLA 5FOWA 1ODLA 2BVNA 2I1LA 4GRDA 4M9SA 1FEZA 3ZU5A 3M1YA 3JQBA 3QWBA 1K2WA 3LOUA 4KBYA 5CPBA 2AZXA 4DRYA 3PC7A 1EZZA 3CNQS 2Q5HA 4HC4A 5HFAA 1L8QA 2P4QA 2UYYA 2HDNB 3EIXA 4Y9UA 5TPZA 5HGJA 5BT8A 1JQJC 3OECA 3N74A 1Y63A 2QV7A 4D9EA 1QVVA 1X7XB 1X6VA 2YZGA 1U8YA 3LWBA 5D7NA 4W9NC 3FOEC 3ES9A 4KI7A 3W9BA 2PZBA 1QGUA 1D4ZA 2EW2A 5LD2C 3FYTA 2FEWB 1RBYA 5ED4A 2BUAA 3OMXA 4K9MA 5IM5A 1VP3A 3P32A 3QTLA 4AURA 4BBAA 4D4HA 4DC1A 3KETA 1T9ZA 1UPBA 3QELB 1NV9A 2VL7A 3BIJA 5DNWA 2JAPA 2C2WA 3CZ9A 4R7TA 4OJQA 1LZLA 2IV3A 3A70A 3TZQA 2BBOA 3DMHA 3KLNA 4NMHA 5P8WA 4A0GA 4HY3A 2V7EA 3IHKA 3K53A 3J7AC 3KL4A 3LT4A 2C9YA 4WCFC 3AUSA 3LECA 4C4ZA 3ICQB 1T0IA 1GPMA 2H16A 1R50A 3I8SA 4MDFA 5DM60 5I01A 3E4CA 1J20A 2YHAA 4KDEA 5M5XL 4WXMA 3MJHA 3WJAA 4FYPA 2WILA 4HDCA 5JCPA 4FYMA 3NANA 4C1BA 1PQYA 1VP9A 5CAEA 4V39A 4BBRL 1QQ7A 1PR4A 2PYAA 1G8PA 2OXCA 3SC3A 3VO1A 4GYKA 3IR7A 1PS0A 2D0IA 4PXYA 3CMCO 4S12A 4PRYA 1QZZA 2E4YA 3F6CA 3ZCSA 4CM1A 4F1KA 3P97A 1NJFA 1MHPA 5B6PA 1FLVA 3TJMA 4K86A 1P80A 3H7AA 3FB4A 3WYGA 1Y5NA 1GSOA 3ESRA 3QYJA 1D5CA 5BV7A 3QKSB 2VBGA 4IS3A 1PR2A 5EE3A 3COJA 3IT1A 3S81A 2QG9A 5LJLA 2E2IL 3LA6A 1YC5A 4ARCA 4G81A 4V24A 1DS6A 5AJXA 3FFWA 1K7SN 3GZNB 4XRRA 1HFJA 3L6DA 2B8EA 3B60A 4RPJA 1FTYA 2QLJA 1SOWA 1COWA 3K8QA 4NFHA 1SIWA 1W1UA 2R2AA 2GHRA 3H3JA 4RX1A 4ZPXA 3TTWA 5JAIA 5GIOE 1I6MA 2V97A 3PC8C 2Z2IA 2NUAB 3PKIA 1AKNA 1TIKA 1WPQA 3RAFC 1N8KA 3NVMB 4Y9SA 1BHQ1 1SAYA 1Z5NA 2WKQA 3WNBA 4C6RA 5KYTA 3H0GL 1AKMA 1XQ9A 2YXPX 3DDZX 4UNRA 4BO2A 4UEKA 1I5EA 5KIAA 4JVMA 1SBTA 2AGVA 3ZXSA 4E3WA 1KF0A 1ADGA 2LR0A 3LWRB 1PJQA 3UMJA 5BWNA 3ZW9A 1LH0A 1XDSA 1I2DA 2Y0DA 1VGRA 2QKYA 4CCWA 1ECLA 3UTDA 4H6WA 1GPLA 3AEYA 3T6KA 4GWKA 1P17A 1MOQA 1PT5A 1R3UA 2GAJA 1C0IA 1X9GA 1YKSA 2PBFA 4LPSA 4RVHA 3T9FA 2E18A 4B3GA 3W6OA 2KYRA 4ZOQI 2PY6A 1A9ZA 3JR7A 3K6KA 2WYWA 1SR8A 1VYTA 3HLTA 4H16A 4WBNF 4Y2UA 3JATA 1E2BA 1R9GA 4QL3A 1CZKA 2AKAB 1I24A 3NT4A 1XWFA 1ORIA 3SKXA 5CM8B 1HMPA 3KYJB 1THMA 2GKGA 4LY3A 1RQ2A 2PWAA 3AP2A 1CF4A 2JDID 2YBDA 3LV8A 2QSJA 4RSRA 2WJ4A 5IJ0B 3KBBA 3HA7A 4AQDA 3Q3CA 1PQ4A 5L4SA 5J58A 1U8FO 2I66A 1IG0A 4GE0A 1U28A 3KM0A 3ZDYB 3I2IA 2IEAA 3CPHA 3SC2B 1NVKA 1JAHA 5ALLA 4BZZA 2ZR7A 3HGQA 3B70A 5JSFA 3BN3A 3QY0A 1MJGM 3Q8XB 4M1QA 1DJMA 5C1DA 2FW8A 2G6TA 4HB4A 5T8KA 1P7VA 3M6WA 1U8TA 4FE7A 2EEZA 4BFUA 3P2JA 3ZXUB 5IXYA 1MO6A 4X1IA 1Y0BA 1CIPA 1JSXA 2ZJ1A 5E6RB 3GJYA 1KOLA 3S1ML 2IW3A 1GQOA 1T36B 4B4KA 5KAPA 4KKXB 1JHXA 2OCIA 1OWPA 4MQEB 4OTZA 2EDAA 1HLGA 3FVWA 3B1JA 2I6FA 3N2KB 4P38A 3WJ7A 4TGLA 2QLNA 5KKNB 4W8HA 4LXHA 4WN9B 5LXTA 5DHTA 2PFKA 3KQLA 4ZAVA 1IYZA 1ADBA 2QRVA 1D2MA 4N3BA 4PBTA 4N5NA 2FY8A 2ODBA 3QE4A 2NPFA 2J6CA 3ZCRA 2R1UA 1QZXA 1MC4A 2WKRA 3FUWA 1EE9A 3O8NA 3P9NA 4MMYB 1SVNA 3SLGA 5BVGA 2B5WA 3ABQB 3U3DA 3HK2A 4QGGA 3U48A 5L9AA 3QM1A 2NUBA 4GLJA 4QU9A 2AVNA 1BN6A 1V1JA 2QD3A 2A1TR 3C5EA 3NDPA 4Q37A 4KREA 4ZO7A 3FD8A 3WSVA 4JZKA 4MW7A 3FIJA 1K08A 4LMRA 4DLZA 2DWQA 3JASB 4A8JC 3JYLA 1UK6A 2AMFA 4K6OA 3GRZA 1VLVA 3DBHB 1QXSA 4MZDA 4TT8A 4C3IL 3HC7A 3GU3A 1LDGA 2HNBA 3K30A 3ZJ4A 1NUQA 4UNSA 1RMQA 4BP1A 2IH5A 4XX1A 2PUGA 4CMJA 2CFOA 3ZIDA 1LGYA 5AI4A 5JRJA 3MGAA 1YQ9A 4H6PA 1GPWB 3PNBA 1NY6A 4E6YA 2VKQA 3LHIA 2PN1A 5LDHA 3O82A 2NZUG 1M2HA 2VHUA 4Q7QA 3IIKA 2P5TB 1UJ2A 4BXOA 3GF4A 1EESA 3TL3A 3VC1A 1PTJC 4NEGA 2EWMA 5AK4A 4BVEA 2YWDA 2ZI5A 3LDFA 4BKRA 1ZICA 2I7DA 1QKJA 1SC9A 3AUFA 5KNCA 1ECBA 3DFZA 1G5IA 1GPBA 4BPRA 1Z83A 4EP1A 4EPRA 1RLJA 4DLKA 4PBRA 3PO3L 4M1OA 2IU0A 3S27A 3MQKB 2FWMX 2FJUA 2GI4A 4ZKDA 3B3JA 4DJJA 1FP4A 2J59A 4Q9LA 2AZ4A 2Z3VA 1AQ6A 1EVYA 4W8OA 1L7NA 3ZGNA 4PGFA 3BAZA 3CH6A 3GHHA 3R20A 4JVSB 3U3KA 3WJ2A 1PRYA 1WQ3A 2VCYA 4ZGBA 4F4CA 2YYZA 1XDWA 2ZWAA 5AR1A 3F6RA 2HBQA 1NMSA 1EFVA 3GP3A 1EUCB 5EP1A 3WYAA 1NE7A 1T5IA 4LYYA 3UB4A 3G59A 2GFQA 3QTTA 1KI1A 4QELA 1YAHA 2J3JA 1DBWA 1L8XA 2PFGA 2VH1A 2FW6A 2KN9A 1B4DA 2AMVA 3E2PA 1QYDA 2ZTSA 1KVUA 5EIXA 1G42A 2LCIA 2XE6A 4JASB 5JFTA 5G4KA 3EXAA 4I36A 2UYGA 3EG5A 3L79A 4AUMA 2G1JA 4CMCA 1XU4A 5CNJA 4JC5A 2ZXUA 2JGFA 3DMPA 2M6RA 4CQMD 4D8YA 2P9CA 1L5HB 1NUSA 4FN5A 2IHKA 1T2EA 3IP9A 3KWFA 7MHTA 1NVEA 4YMIA 5F9HA 3EFEA 3QNUA 3OICA 1PFKA 5AUQA 3W2IA 4R8RA 4AHXA 5JZVA 1JNXX 1D09A 2EJTA 3MGCA 1ENZA 1MJ5A 5EZ5A 5I51A 2IE0A 1T8TA 2EWWA 1E2NA 3P0EA 3NONA 2XVMA 3HBLA 4U2FA 4UJ5A 3OUUA 5CLHA 1BDJA 3AY7A 1JQBA 1G1AA 3B1YA 3PDUA 5CVUA 4K87A 2CKAA 1PHPA 4WD3A 5H80A 3TQIA 1G55A 2YWFA 1CNFA 2AEEA 3D2BA 5FBZA 1VFNA 3ZTWA 5KWVA 3ZVNA 2R7NA 2PYIA 4LVUA 5ESWA 1DCTA 3AH8A 1OT5A 3VKUA 3FWPA 1E2EA 1ML3A 3AEQB 4P2GA 4CI9A 4URUR 1AU9A 1HR0B 2DKNA 3HCEA 7AT1A 4WKOA 4NZOA 3ZE8A 1E69A 2WLSA 3QG5A 4TRRA 1CP3A 1KEEA 2VRCD 5EHIA 1CY1A 2FDXA 3DZKA 2XB4A 1CUDA 4YHBA 3DA8A 4CKXA 2VAWA 3L0PA 1EB8A 2BFBA 4LBWA 5AOAA 5HQ3A 1G7RA 2HF9A 3VH3A 5JISA 1I94B 3RBZA 1SHZA 4I4TF 2OE2A 3NHAA 3B1KA 3CRQA 1QK5A 1V5EA 3M1IA 1E62A 4L72A 1TWHL 5EZYB 2F3UA 2ZT6A 1NVVR 2GNPA 3I3OA 5CLIA 2X9NA 2G76A 1E2QA 2VUIB 3HADA 4HDMA 5J4HA 3AJ9A 2JB9A 2B7CA 4A73A 5JMOA 1I6WA 2VC2B 4QJIA 1EIZA 1C30B 2QI9C 1KFBB 4ZT5A 3L4BC 1BN7A 3T3DA 4DMFA 3SE0A 1RYMA 2YY5A 2HBZA 3F78A 3JYHA 4YAGA 1NY5A 2ZUBA 3FFTA 4HAVA 4F6RB 4YUAA 3BHJA 1YB6A 2WTNA 2XVXA 4JNCA 3RRJA 3VR2A 2PE5A 1BMTA 2QMQA 4YECA 3IAXA 1KARA 2E6UX 2HGSA 2YNMA 4C2M1 3FWHA 3FJ1A 4D25A 3DW1X 4TWBA 3CPEA 2CBXA 1TD9A 1JG4A 5DXFA 2ZUFA 4GVXA 5CT6A 4ABTA 1T6BY 5DTQA 1SZPA 2P11A 1NRIA 1W85B 2QN3A 4HFRA 4O2RA 2D8AA 5I4IA 1DQRA 2BFDA 2OO5C 2FRVA 2AD1A 1R0XA 5TGDA 1XLVA 5CFNA 3I0ZA 3SOZA 4UY81 1HH4A 1TUEA 2Q4TA 1TZJA 2BGJA 4BNVA 1E0DA 1SZCA 3OUTA 5A4KA 2G88A 1I4DD 1M8FA 3AT1A 1VL5A 1DUSA 4TL7A 3T9BA 1H2ZA 3DL7A 4P5EA 2ZWPA 3OOYA 4GS5A 4MJLA 4YRTA 3WYCA 2EXXA 4A8JA 4EARA 3BE6A 1QDLB 4YDRA 1OI2A 2DCMA 4YYZA 2YN4A 4WA8A 3RQSA 3R0QA 5AM2A 1OFTA 1DAFA 2HNAA 5JZOA 5FV7A 2ZIVB 4RADA 3CRRA 2IVFA 1P31A 3GVCA 3VKWA 1R4NB 1V3QE 3NMUF 3IA2A 4LRWA 1W6UA 4HWOA 4IGIA 3CNBA 2EFCB 2Q7XA 1F9EA 1DTEA 1TZMA 3DLCA 4Y18A 1BJRE 2OXEA 3BK2A 3BMQA 2YWBA 3LJKA 5SZJA 4DQUA 1F12A 1NONA 1AUOA 2RH4A 2UVPA 4AZSA 4R05A 1GUAA 2FMFA 2WT9A 3AHGA 3I32A 3IP8A 2NGRA 3SN6A 3WG9A 3WP1B 1IM5A 2JBHA 4QFCA 5ES4B 3CQZL 1XG5A 1ZGCA 1FNMA 2A6ED 1YQQA 2UYQA 3NZEA 4P4SB 4Y2RA 3RODA 1LLQA 1G66A 1SN7A 1M72A 1TZKA 5F64A 6CHYA 3TUJC 4B6SA 3JYNA 1GKIA 4MCIA 4YN3A 4N6GA 3D3KA 3ZWNA 1UUFA 1O0BA 1XTTA 2AQHA 4R1TA 1F17A 4HX9A 4IRXA 5B3KA 2FR0A 2JIPA 2DUWA 4BLOA 1GRCA 2FPXA 2I91A 3NKFA 4YP9A 4CXMA 2I65A 2ZKIA 2C4MA 3H5OA 4UAJA 2D1TA 4M6WA 4QIHA 3B6JA 2D54A 3CU5A 4KRGA 3RC2A 3E3NA 3LWDA 4MYRA 1DAMA 4OXXA 5BURA 3GBVA 4Q7EA 3WGMA 5JAMA 4CTOA 4ARUA 2DBVO 1Z6GA 3V46A 5EJ8A 4RKRA 3WVNA 1O3YA 1W0KD 4GC5A 4J4BA 4XIGS 1PUXA 1LNQA 2ORVA 4KWEA 1PNQA 4C0XA 4NCKA 4X6YA 1QFYA 1Y1RA 3BL6A 4QGHA 3H17A 4EYEA 4HK4A 5JADA 1O6GA 4GYWA 3AU8A 1UMBA 4L4SA 4OUKX 1KI6A 1PSWA 4ASUD 5A5GA 1P1JA 1SHJA 3LVFO 4HDMB 5K4AA 3CLSC 4E11A 2PDAA 5HA5A 3JQGB 4QUJA 2ZWOA 5F78A 3L0OA 1R0JA 1FX0A 1ISJA 2IXGA 4BASA 1ZKDA 5FTWA 4ZVUA 2R47A 3DE0X 3GCXA 2X40A 2YV5A 4IDQA 4DXAA 2XJVA 3KOWA 1LSJA 5ESDA 3ZLTA 1TVMA 4BLRA 1Z8NA 1DUVG 2HLPA 5ENVA 5DXAA 2XD4A 3U56A 1V0JA 2YXNA 1SKMA 2A0YA 2WHPB 4WZAE 3Q7SA 5L53A 1BCRB 4LX8A 1DCMA 4GNKA 5HZMA 2JFUA 2C5LA 2VDWB 1CQXA 2HIMA 3CLTC 3LC0A 4KR9A 4HGOA 1M2FA 5K3EA 2BEJA 4X3PA 3D0QA 2AI1A 1N6KA 3FDFA 4M55A 4YJFB 2ZE5A 3EVAA 2O59A 1BJTA 4U9HS 2JEOA 4G97A 4DHWA 5B7GA 4KO8A 3MMXA 5AKEA 1DOAA 1JSRA 2B8JA 3MWEA 4FZVA 4G41A 3TLGA 4WOPA 4F5DA 4HKTA 1C0PA 3HY4A 3WIUA 5EHGA 4JOCA 1AZTA 3M4YA 4TQAA 2GT1A 4DIKA 1A7JA 1OLXB 2YVLA 3GWZA 2QD1A 1SY7A 4R0MA 1NQ5A 1KMMA 5ADUS 1NU8A 3B5EA 1UP4A 1YJXA 2WYVA 2PZJA 1E5XA 1X3LA 1L7OA 1PYDA 4X7BA 1K8RA 4TMFA 5I4BA 2BEUA 2WM8A 1M7BA 3VU0A 3F96A 3CG4A 1P2TA 4Q4HB 2BRUA 4RXTA 3QBDA 3UB2A 1NTRA 5H3LA 4JAFA 1ISHA 1IL0A 3KEFA 2C0QA 3N53A 3QMVA 2NXWA 2F1RA 2WJVA 4JP8A 4MLZA 4UBMA 3RTEA 5K8JB 1IZ9A 5B57C 4BLUA 1D2AA 1A88A 3ECCA 2RHGB 4Q66C 1LVUA 4TXNA 1J39A 1TCVA 1U7OA 3A2MA 3D4LA 3P0RA 5DGIA 4BL5A 3GGDA 4BV3A 2WP8J 4EBFA 2R1VB 3MCZA 2PLFA 4B3BA 3U7HB 1UQRA 3P5BA 4FFRA 3EXEB 3DXFA 2ZS8A 4DFDA 3RYFA 2J7PA 5AVSA 2X9QA 2IUUA 1VKHA 5MF6A 2XQKA 1U1IA 3OT1B 4PYNA 4TTPA 2HOQA 3RKUA 2MCFA 3TNJA 4DR4B 2R62A 4Z53A 5D6NA 2ZKLA 1S30A 1R9MA 2QTFA 4ZCQA 4X20B 1G4UR 3CXRA 2FP4B 3AUTA 4RGQA 4KUGA 3OFJA 1UKCA 2XJPA 3KUXA 3QEBZ 3DWIA 4US2R 3OZRA 2GHIA 2KS6A 1Y6QA 2WF7A 5DYGA 3UOWA 2RHRA 1MZVA 3G5LA 2WQ7A 1V7ZA 1R0FA 3C43A 1Y6RA 3C7AA 1XI2A 4MAMA 1QH9A 4KLZA 4BX2A 2V58A 4M83A 3RI3A 2IYQA 3QITA 3NH9A 1I9GA 1YBVA 4Y30A 1GGHA 4MMXB 1HNXB 3G2NA 5K3AA 4BJ3A 1I7PA 1PNOA 4US0R 3KELA 3E03A 1UCFA 2P3SA 5LZ5A 1WKCA 1L4HA 4NYMQ 3BJRA 2GXQA 1WE2A 4XDHA 3B9QA 3AZQA 5KSYA 1RPAA 1DTWB 4CNQA 4UTXA 1UOEA 2EG9A 4PU0A 3GRUA 3V1NA 1TJYA 5A06A 1PTJA 4PPNA 3W2EA 3IQHX 4NLLA 4LXUA 4MR9A 1BMFA 1QV9A 1Y7IA 3DAGA 3FBTA 1OLSA 3N07A 4ZVTA 3SQLA 3TQHA 2WINI 1CV2A 1ESMA 1GO2A 1N1DA 1S4QA 2WIGA 3DSRA 1QS0A 5F7XA 4JBLA 5TB5A 5HILA 4L95C 3RVKA 4EMUA 3TQQA 4P92A 4BU1A 2ZRQA 2DQSA 4IDHA 2JG3A 2IVZA 1FTSA 3T5BA 3CRVA 2XZLA 4EPTA 1XIVA 3A6LA 1YOVA 2XHEA 3OAAA 2HHCA 2VTDA 3GWGA 3D6MA 1GL9B 3UT6A 2NAFA 4FMCF 1FNSA 1NUHA 5BMVB 5KX5A 2H6EA 1JGTA 1RHKA 4IZIA 1R6UA 2D06A 3RIYA 5CFOA 3BIOA 3F6YA 2VPWA 4EYGA 3USZA 3SZUA 1CG6A 2JH8A 1JR3A 1YRLA 3AQIA 4U5XA 4CWAA 1X7WB 3R3JA 4TLLB 5FA6A 2PXCA 1BDIA 1G21A 1EDOA 3K4HA 1MRSA 1U0BB 4KP7A 4S1WA 5FOSA 4QUGA 1U2ZA 1UJ5A 2NG1A 4A0SA 4X54A 3EDQA 1IQUA 1D4FA 4DABA 3EXIB 2QT0A 1CNEA 1Z33A 1FFCA 3E35A 4AM8A 2CCJA 1XEXB 2Q4OA 4P4TA 2ZRFA 1OFVA 3WQHA 2VXOA 4O8ZA 3OQMA 1CY0A 1UDXA 3FTFA 4AF8A 5AKLA 4RKEA 3EH2A 3AOEA 3C3DA 3OQIB 4N0MA 3UJDA 4B31A 3MD0A 2WQZA 3BJMA 3BXHA 1LVGA 3C14C 3D1JA 3O2SB 2WPNA 3QNWA 1J0EA 3A2NA 3ITEA 1S2OA 4JQZA 4P7FA 3GEGA 1B13A 5IUJC 1UKVY 5KJEA 4FT2A 2W83A 1WETA 1DKRA 1B3BA 3K7AL 1JEQA 3IALA 2LIPA 1NBME 2AEJA 2Q8NA 4AZ0A 2GLTA 4N7RA 4ND1A 3DPUA 4GYYA 3F0TA 4BP9A 2YN0A 4OJKA 2J4CA 2FUKA 5IN5A 1P74A 4L15A 4CL0A 5FAXA 1X8KA 3L0SA 4ENSA 5KVAA 1R0HA 1J1ZA 1DBRA 2WWTA 1BGVA 1H2YA 1JQDA 2UYOA 2W8BB 5HK9A 1G41A 4LSGA 3NTOA 4C3UA 3SHVA 1OWNA 4PLFA 1JHDA 1K75A 1SELA 2GSDA 3BQ9A 4AP5A 2FRDC 3EZ9A 3ZKWB 2IS1A 2J3QA 5GAJA 4PM4A 3N5KA 2AMYA 4UXIA 5HIJA 4YAEA 2WAXA 3C8MA 2AXNA 3NKLA 3RVDA 1NX9A 2XUGA 3Q0IA 3OO0A 5I9LA 2VKTA 1XTRA 3EQ2A 3RRZA 3T9DA 1JWAB 2D2FA 3LX4A 4V0QA 5C8YF 1OZHA 4DA8A 4DEVA 3V4ZA 4J1NA 1DXQA 1PZGA 3SYLA 2NQ8A 3N7UA 1XX6A 4I66A 1J8DA 1SVMA 3F67A 2CKMA 2H00A 3GFOA 3SEZA 3C6QA 1CQJB 1PGNA 2CC2A 2D1RA 5HRCA 4YJ3B 1TE2A 3NEJA 5EWMA 4X41A 2GVNA 5JD3A 3L7JA 4RABA 2RHBA 3V4LA 3VH2A 1RRCA 2RFKB 4GVLA 4G6ZA 4O4JB 4UUQA 4N1AA 4DBVO 4TZ0A 2J9RA 2R1VA 2C7PA 3H1TA 1B23P 4TVMA 1PJCA 5IH3A 2IF0A 3VPDA 2IZ6A 1RAGA 3V1LA 3FGZA 3L18A 1MT0A 3MBIA 2NYDA 5LMZA 1DBPA 5DNCA 4F5WA 3NCHA 4UULA 4FI3C 4YLGA 1WUHS 1H1LA 5BT9A 1HA3A 3P52A 4R01A 4INZA 4C7OB 4WZ6A 3GLIA 2NVWA 3OEWA 4RAQA 2OXIA 3UH1A 1Z0JA 3PXAA 4N4AA 3OKAA 2P2DA 2XCIA 4TKZA 5SYMA 1QRRA 1NWCA 4ILEA 4AROA 3TEFA 4ZIRA 3IDQA 5FPYA 4JH0A 1H2BA 3DOJA 1O03A 1UBOS 5H4HA 3QUBA 2C00A 4OYRA 3VR1A 2VJKA 1ZWLA 1FU4A 3K9GA 4LRSB 4RJIA 1I36A 1X74A 3CR7A 3RASA 2WZCA 4EUHA 4Y0NA 2R7ZL 1KYTA 4FGWA 2F67A 1GN9A 2ZAYA 3A04A 3G0DA 1GNLA 2Z57A 4I5FA 3MUEA 3OM8A 4ENUA 3CT6A 1DX8A 3SR3A 4CF4A 1WBDA 4BNGA 2PYDA 5HW0A 2ID8A 2TSYB 4XTCS 3DDWA 4DIFA 3NW9A 4KH0A 2QF7A 1TVCA 1HDOA 1LSOA 1LQUA 4JBGA 2MU1A 1NXOA 1P4AA 2JASA 3C8HA 2OZLA 5TGTA 1QHYA 1ZUIA 1B00A 4G07A 2ERCA 2BBWA 3B5JA 1IQ0A 1GTG1 5ICSA 5DCUA 2BDUA 4WFJA 3SQDA 3L8CA 4WBXC 3ET4A 1CY4A 1RWVA 2AJ8A 2YWXA 2ZYRA 3O3NB 3DXXA 4MGIR 1N5LA 5BW6B 3X3HA 4PQEA 3RANA 1GFWA 1W8IA 3B6IA 2QQFA 3Q8WA 2XYRA 7MDHA 1X70A 2CZCA 2GNOA 3IRUA 4L9WA 3HBFA 4P0TA 4YTEA 3SF8B 3DL0A 1HLPA 4QTUB 4XGIA 3D3WA 2LVBA 3O8BA 4ZVMA 1CXZA 1FSSA 3PDIB 1Y5IA 4F6CA 3MWYW 4RSGA 1BX1A 1ND5A 1YZFA 1VKZA 3EDRA 3OAAD 4NNOA 3A14A 3V80A 3QEMA 1T9CA 1YJ5A 4CV1A 3AKYA 5IYZA 1VXOA 4ZVOA 4RYLA 1LDNA 2OVFA 4QFDA 1Z0FA 5AIAA 3WOVA 5ABPA 5KHAA 3OM0A 1UWVA 3E9QA 4ZHQA 2INGX 3EWIA 4LZLA 1Q3KA 2GKSA 1ORHA 2G63A 3DB1A 1XRNA 2AWOA 3PUWA 2C95A 3R6LA 5EMNA 1E3JA 3GTGL 1JEYA 4M8SA 4NONA 1DFIA 4HNSA 2J0UB 1T6NA 2FWAA 4BO8A 4ZRNA 3THSA 2ZRNA 1N92A 2V8BA 3O2QB 5CH8A 3V7NA 4LVCA 2VHZA 4ZMBA 5JD6A 2F4VB 4AZ3B 1KDPA 2WYOA 1K7YA 2HI0A 4IDBA 1M3SA 2A57A 3K9FC 4ZDJA 1MQ9A 3FSJX 2R751 3E05A 1Q7TA 2BFCB 4YUXA 1C3LA 5KYWB 4V0LA 5DTJA 4EMSA 2RGGA 1KDRA 2PLRA 4P32A 3W6ZA 3U4MA 5AK0A 3QPCA 3DLIA 3DP7A 5EFZA 1P61B 3PLRA 1XQVA 3G1UA 3BKXA 3SJUA 4DUYB 4Q3BA 3OJWA 4X45A 3I34X 4GLOA 1E5TA 4NYJQ 3GUVA 1QFZA 4F71A 5HJEA 1C1HA 4ZREA 3WK9A 2VYQA 3JWEA 3OLVA 2IL1A 3PFNA 4IMPA 2BE7A 5HR5A 3R09A 5A7HA 2JIDA 3O7MA 2ZR8A 2O2CA 5AO9A 1XEWY 5G02A 4D0SA 5HDQA 2JFQA 1OFUA 2D7CA 4JHLA 3WHLA 4ZFNA 1TM5E 2UXBB 1MX9A 2ZVJA 4L8FA 1EVQA 1LDBA 1RQNA 3N0VA 3CWZA 4D6PA 4F9FA 4F93B 3SDSA 1LFDB 2CFSA 5G0VA 1KO8A 1KTVA 4MDEA 2IHJA 3D4IA 5ALKA 4Q7LA 3TSZA 2YJTD 4FS3A 2VNIA 3I39X 4I55B 3WNVA 3ZZTA 3LWNA 2J7PD 2QQ5A 1ZITA 2BUCA 3MWFA 4FZ5A 4BNXA 3EN0A 3HCFA 3PRJA 4QO7A 4B6EA 4EYSA 4C3ZA 1GRNA 4BV8A 3KZVA 5CM9C 3BJEA 5IDWA 1Z7WA 2FVXA 4ZC8A 4JFAA 1SCBA 3F49S 3IJEB 4MO9A 1KI3A 4WOKA 5I9SA 2JGEA 1V1MA 1T0HB 1PF7E 2F59A 5HWSA 6LDHA 1BQEA 4J7AA 1F51E 1GNSA 1N7IA 4JIGA 3WOHA 1MA0A 2FR8C 3FR7A 5LOVA 3WLPA 4KUEA 4H6VA 1W29A 1CE8A 5FO1A 3QU4A 3WL7A 5GONF 4N0QA 3BD8A 1M6EX 4QT4A 3DLAA 3FOCA 3W5DA 3OE5A 2NU7A 1SUFA 3BDAA 3CUYA 2WP0A 4FWIB 1XLTC 4IDCA 3N2NA 3UJHA 1ZH0A 3WLFA 3F7MA 2FEPA 3RJMA 3T7JA 4DADA 2QJOA 3QMPA 2JD2A 4KUHA 2ZXFA 3IQWA 5E6SA 5B58C 4N48A 4B6QA 4A1OA 2BSAA 3S2ZA 5I7EA 4TSKA 3R0XA 3VDRA 2J6IA 3K6RA 4CUZA 1DI0A 3THWB 4NOKA 1E8JA 2AN3A 1EGMB 3GY0A 1RC0A 4WZZA 5E1DA 5HYVA 3RUFA 1XVUA 3DLPX 1E1NA 5EHQA 1NFFA 4UU7A 3UOGA 1KAMA 1UEJA 4N5LA 4WADA 1SEVA 4YONB 4BAGA 1OLXA 3L06A 4IIDA 2WIAA 3WLIA 1A5TA 1AUVA 3IVXA 3RUDA 1MIHA 2NVXL 3S2UA 3PNSA 5BP7A 2YZNA 5COBA 4EA8A 5K8TA 4U2GA 4CQLA 4YGYA 5GJCA 1KYWA 1CQWA 4RU1A 2QTHA 5ADVA 2Q0HA 1P2BA 1V9LA 1P3JA 2VHCA 3K9HA 4XM1A 1JEQB 1X1CA 4Y2PA 2WFZA 4HTAA 1MTOA 4V2IA 4F0JA 3EPHA 3OP4A 3RT9A 4KBGA 1NP7A 1KI6B 4U6NA 4PYJA 1S01A 4ASUA 1KK3A 5C8DA 3JPWA 2JA8L 3ORRA 3RUAA 3OWHA 4E2YA 2W93A 3VR6D 1L3BA 4LGYA 4QDKA 1ZD1A 2LXNA 5NLLA 3ETNA 3RCBA 1E4EA 1QV6A 2V7BA 3VNBA 2V7WA 3PD1A 4PZYA 4OXQA 4V0KA 2B0JA 4B47A 4D44A 2WF6A 2XMQA 2MJLA 1BEEA 4RD2A 1J0XO 2I6SA 1U65A 1HF3A 3KSDO 3NTXA 3EWSA 4Q0MA 5IJ9A 3IBFA 3MT0A 3KXDA 2YVAA 4JLUA 1YS2X 1DRWA 4CL8A 3E2MA 1E9FA 2LKDA 3F8SA 3ITDA 1U90A 1M7HA 1GAWA 4NV3A 1TEVA 1V3UA 4I6JA 1UFQA 3EARA 5BYKA 1U7WA 2G0AA 1BVUA 1PIWA 2W98A 3U3JA 4EVQA 4FNOA 5IRCD 2NTEA 1ZK0A 2B7LA 2M9MA 3FYUB 4WXYB 3KJEA 2B36A 4CDMA 4P08A 3C5VA 1C0KA 3QXXA 4M99A 3RS4A 4WFQA 2OAQ1 3N0RA 1GTMA 3PO2L 4QE3A 3E7FA 3R24A 3ZGZA 3BSFA 4MVWA 3H83A 5C34B 3TLEA 4C4XA 1ULBA 4KFCA 2WSBA 4S3MA 3LI2A 2QQGA 4JC0A 1TLFA 4GGOA 3NVKI 4RV5A 1UBSB 3ANTA 4C0SA 3TW8B 4E5UA 3H1FA 1QIIA 3RBVA 1AKYA 5FL7D 1Z2CA 4BVGA 2R65A 7REQB 3GPLA 4YQZA 3BWBA 1BA3A 2IX9A 4Q1EA 1YVEI 1GUFA 4Q3NA 2GUGA 2JIOA 5L3RA 4MS1B 1FSFA 3VNAA 4MR9B 4AO8A 5KPDA 2J6HA 3WE7A 4OI1A 4Q1BA 3NHFA 4L5YA 1U2RA 1Y98A 4G36A 4JJZA 4D56A 1I4LD 4RYDA 3NORA 4Q12A 2ZT7A 4MUMA 3PNMA 1H5QA 1Y8RA 3ZHVA 5CA1B 3TE7A 1QQTA 1D6JA 3JQAA 2Q5OA 3KYCB 4Q47A 3HLKA 2JLUA 1GYQA 3G5TA 4FYKA 4ZVSA 4IRUB 4IOLA 5BSFA 1PD0A 2ZI7A 1ANKA 1TKBA 6PFKA 2GH1A 3DTTA 2IYEA 3T0IA 4MKZA