3PKIA

Human sirt6 crystal structure in complex with adp ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
ADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPAWDGPRVLERALPPLPRPPTPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-6
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pkiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3pkiA01
4X3OA 1Q1AA 4RMGA 1Z8NA 2Q28A 4J1TC 4C7BA 4D5EA 1PYDA 1MA3A 3PKIA 1OZFA 4JUFA 4L2IA 1M2NA 2Q5QA 4K9NA 5D7NA 5K3SA 3HWX1 1SZCA 4JUDX 2IHTA 1BFDA 4JSRA 2H4HA 1YHZA 3IAEA 4K9QA 4Q9DA 2EZTA 3CLUD 2AG0A 4JT9A 3EY9A 5BWLA 5IMSA 1M2HA 4IAOA 3PKJA 2EZUA 4UTVA 5DGTA 4BN4A 3ZG6A 1PO7A 2JIBA 5K2OA 4GM4A 3F6BX 4C78A 1UPBA 1YNOA 2JI9A 3PDHA 4IF6A 1POWA 1ICIA 4K9MA 4X3PA 1D4OA 5MFZA 2VBGA 4TWJA 1Q14A 1T9DA 5MGNA 1N0HA 1YC5A 2H2GA 4IG9A 1M2GA 1Y9DA 2FR8C 3D7KA 2NXWA 1T9BA 2QQGA 2JI7A 4BVBA 3OE1A 4I5IA 2PANA 1V5FA 4F56A 2UZ1A 5AHKA 3FLMA 4BVHA 5MF6A 4UUBA 2BRUC 5DEIA 2JLCA 4R8MA 4HD8A 4HDAA 4JU9A 1DJLA 3RIGA 4RMIA 1HZZC 4JD5A 1Q6ZA 2VK1A 2FSVC 2H2HA 1O96B 2HJHA 1EFPA 5EJAA 3JWPA 4KXQA 4UTNA 2Q29A 4V1CI 5BWNA 1J8FA 1ZPDA 2JLAA 4GM1A 5FEMA 4V1CA 2IHVA 4K9PA 5MFPA 1PTJC 3ZGVA 4MQ5A 5EJ9A 4TWIA 1SZDA 2IHUA 3JR3A 3EA4A 3GLUA 1T9AA 1U28C 2VBFA 3D81A 1PNOA 3IAFA 4MZXA 4RMHA 4GM0A 4G1CA 1PVDA 2VJYA 4QPZA 5FYQA 1OZHA 2PGOA 4ZP1A 1UPAA 2NYRA 4J16C 4JT8A 4L3OA 3CLTD 3RIYA 3HWWA 2WVGA 2OORC 4QELA 1QPBA 3CLRD 1U2DC 4BV3A 1EFVA 1O97D 2Q5OA 2H4FA 2V3WA 3FSJX 2PGNA 4BVEA 1UPCA 4UU7A 4FVTA 4Y6OA 3U31A 2JI8A 4K9OA 4Y6QA 4MPPA 2VBIA 3GLSA 4K9KA 4MPJA 1YHYA 4KGDA 4RJKA 3ZGOA 4V1CB 4BVGA 4JUAA 4F4UA 4FEGA 4UU8A 1XLTC 4D5GA 4JUCA 3CLSD 3GLRA 4BN5A 2Q5JA 3U3DA 2H59A 2OD7A 2W93A 2H2DA 1OVMA 1V5EA 2EZ8A 2OD9A 2OO5C 1Q17A 1YI0A 2Q5LA 3FZNA 5EJMA 2Q27A 1JSCA 1YC2A 1PT9A 2WVAA 4BVFA 2EZ9A 4RMJA 4KPUA 2FWNA 4COKA 2OD2A 3K35A 1E3TA 1PI3A 2B4YA 2H4JA 4K9LA 4BUZA 1YTLA 4UTXA 4O8ZA 1MCZA 1T9CA 1M2JA 4GP9A 4JU8A 4BV2A 5K6RA 1U2GC 1V5GA 4RJJA 2VK4A 4ZZIA 1OZGA 2C31A 4UTRA 4JUBA 2FN3A 2VK8A 2DJIA 3EYAA 5DGDA 1YBHA 2H2FA 1M2KA 3F6EX 4RJIA 5BWOA 1POXA 1S5PA 4Y6LA 2WVHA 2H2IA 5EJ6A 2X7JA 2JI6A 4UUAA 2QQFA 3E9YA 3GLTA 1S7GA 5EJ5A 5K6TA 4QQ8A 4MPRA 2FRDC 2A1UA 3D4BA 1U31A 4GPEA 4UTZA 5EJ4A 1NM5C 2UZ1B 2A1TR 1PNQA 2EZ4A 4FZ3A 3LQ1A 5EJ7A 4FEEA 4GG1A 5EJ8A 2AG1A 3CF4G 1YI1A
chains in the Genus database with same CATH superfamily
3K20A 1XHFA 3GTQL 2AZMA 2PQ6A 4G07A 4C01A 2XBMA 1V3UA 1A8PA 3UW3A 4KG7A 3E61A 4R40A 4G63A 5B55A 4TRMA 2XCTB 1A9TA 1T24A 5FBWB 2VH1A 4MLCA 2Z6UA 3K09C 3COJA 1QE0A 2E49A 1EJ2A 1EFAA 5EP4A 2X41A 4BLOA 5CDSA 2EQAA 1LNQA 2V8BA 1B2OA 5DBIA 2L0ZA 1BS1A 3PE3A 3MELA 1UP7A 3REOA 4MS4B 1IROA 4JLAA 3DJFA 2HA0A 1T8PA 3CA8A 4KAFA 2XD4A 1HEYA 5ADVA 4PSDA 4ZT4A 2X9NA 1NVXQ 3D8SA 4CIWA 1QH0A 3OAAD 3R3WA 4YRMA 1CEXA 4QXRA 4OQPA 3TLJA 4FHCA 5F9FA 3LCRA 4R2MA 4D9FA 3G5AA 3PNQA 2XF2A 3PR3A 2I4TA 5MN4A 4YDRA 1ZLYA 5F76A 1YO6A 3V8VA 4P4GA 1BDJA 1ZD4A 1I1QB 4PG5A 1ZH6A 1XQ9A 2WMYA 3CN9A 2PYIA 2BRUC 4TVOA 4X61A 3S17L 4MVJF 2BGMA 2J9RA 4ZI2A 3QP9A 1H6AA 2F1KA 2TMDA 1VLMA 3H13A 4GMDA 4LE1A 4O2RA 1N3YA 1B41A 4KO3S 1YDHA 4A8JC 3IV6A 4E5DA 3RTGA 1I32A 1NVEA 2IK8A 2H54A 1DRUA 1HC7A 1T0UA 2NADA 2NXCA 2QX6A 2PD4A 4NCXA 5GZ6A 3ZE9A 3BMOA 4PE5B 4F1WA 3VU9A 3NXKA 4R7GA 1CF2O 3WXMA 3ESXA 2JAOA 2Q1YA 3ESBA 5TC4A 5KNCA 1VSUA 1ZRHA 3EA4A 1JA9A 2ID7A 2SICE 4A2CA 4WZBE 2WSSA 4IZ6A 2I3DA 2QZ4A 3TGPA 1R9JA 4A3FL 1L8LA 2X6RA 4GI1A 1NSFA 3WL6A 4EENA 4PYJA 5AM3A 1YZYA 4KPUB 3PDWA 4DCTA 5AXDA 1QPBA 2Z3WA 4INZA 3T4XA 2WTMA 3T7TA 3T3IA 3VVBA 3IH5A 2V7UA 4J2OA 3COPA 4ZEWA 1BYUA 3EAFA 1FJGB 4JIMA 2AJTA 2Y3IA 5P21A 4XWKA 2A4KA 3ESAA 2DY1A 4JDUA 2P5UA 2IEAA 4FD3A 4D1YA 4B6EA 1E7WA 1KWKA 2EDCA 3MT0A 1VE9A 5ER9A 3B1KA 1DU4A 3T3EA 1GQFA 1UJ5A 4LTNA 5FJIA 3TZBA 3WLFA 4F1JA 4XR4A 3TMKA 3OWXA 4QTUB 1BRTA 3BA1A 3HKEB 4DCCA 3LXXA 3JQ8A 4KVAA 4YLYA 3M4YA 3STXA 4PX9A 5DN6D 1F5NA 1EIWA 5J1TB 3MCVA 1C1YA 1J2JA 2XRFA 2WIGA 1DCMA 3NI2A 1ZMXA 3BKXA 4TMTA 4U7WA 3SICE 2KWIA 3UMSA 4MHOA 4X95A 4TTVA 1R12A 1TD9A 2CV1A 2VHVA 2I4RA 1UC8A 4W4TA 4XWOA 3HEBA 4KO1S 4GOMD 5IW8A 2FMIA 4DZZA 5JD6A 2ZJ3A 3AC0A 3EAGA 4R1SA 4JR1A 4OKSA 1Z06A 3E5MA 3KS9A 1E64A 3GLFB 3KHKA 3EPKA 4O1HA 1RPJA 3LKBA 1I1HA 2F4VB 1SXJB 2H3EA 2CKAA 3OIWA 4PXSA 4TLMB 2FQYA 4A2WA 3EXEB 1KEWA 3LW8A 3NOVA 2ZTHA 1CVRA 2EDAA 1AS0A 1RXIA 1X1AA 3TTSA 4O4HB 1XXHE 2VF2A 3WY9A 5JBIA 3PRHA 3TZLA 5I8ZA 4EYQA 2XDAA 3HI6A 4PBSA 5IZCA 1ONNA 2G4LA 2GM9A 2JLUA 2P78A 2J5XA 1MAWA 2FW6A 1PSWA 3QVUA 4ZAWA 1KOLA 4DTIA 2PLAA 1Z33A 4G1VA 5EY5B 4PRYA 1BX0A 3G1TA 4YAGA 1M5TA 3SEZA 4KO4S 3AB3A 1XTBA 2P9BA 4BNNA 3REQB 3VHLB 1C5KA 4CT5A 5JISA 3GB9A 5CNMA 1N8NA 1XAIA 4MYHA 4NG4A 4Q6BA 4IWXA 3V4PB 3WBFA 4MVJI 5DYNA 3R0IA 4E5KA 2C7VA 4MJ7A 3F7TA 5L7WA 2R79A 3IVAA 4XWAA 4TS1A 5A0FA 1XRJA 4EDHA 1G18A 3COVA 5ALUA 2OCIA 1QZ3A 1TPYA 3PDHA 2JGRA 3G3EA 2JCBA 1IN4A 3CCFA 2AHRA 1TT5B 4H2DA 2H1HA 2YQ4A 5G0SA 5EJGA 1GRRA 1ND6A 1BA3A 1U0TA 2H9YA 2VTEA 5J2UA 3H1GA 4NFYA 4B40A 2CF5A 4J43A 1K75A 1YUZA 3FYSA 2GZRA 5AK4A 4CCAA 4BVHA 3RI3A 1ZJWA 1J5EB 2FN7A 1RWOA 3NBZC 3DPSA 4HD8A 4WZAB 2PX6A 2PKEA 3FWZA 1TEVA 1Y3HA 1YSCA 2F59A 1U7UA 1K27A 1SUSA 2G5GX 2HU2A 3E18A 4M0MA 4XE5A 3DL0A 5ESRA 3ZGYA 3HV2A 4QYTA 4UREA 2P9GA 3KYJB 3P2IA 4UU0A 3U1TA 3WNCA 3O4JA 5JXWA 2FVYA 3N5KA 1UFVA 2GDZA 721PA 2ZANA 5JNRA 3MVEA 3F4LA 1NUPA 3KT6A 1XZDA 4Z3OA 4XZ3A 1NW5A 2VBFA 3HBLA 5ALSA 1J90A 1NJ5A 4GAEA 3U09A 2HMSA 5IFLA 4HC4A 1ULAA 4RZUA 4B3CA 2PZKA 4M87A 4QQFA 1A7KA 2ZXFA 2UXBB 4G81A 1R5OA 4C9BA 1FDVA 2PUFA 1PZHA 1AOXA 4C6SA 1Z6PA 5ALVA 4B3SB 3H2KA 3C5WP 4I3FA 5KSOA 1YH3A 1T8UA 2JZOA 4U7GA 1XMQB 5IH3A 4YUWA 3VXKA 3QFSA 2IQ5A 2M32A 3D3QA 3NGLA 4G0YA 4OUDB 3VI4B 5HM8A 4UBJA 2BTQA 2O2ZA 4KFSA 5KOHB 3ROFA 1T36B 2BJHA 2N75A 3N2LA 1YB1A 2BM9A 1XZNA 2CHFA 2OGUA 2YWBA 2V5UA 2VO1A 4LHSA 3AEKB 2Q5LA 3E58A 4WFN1 4W8GA 5DO9A 4B4UA 4L4RA 4PZCA 1GZ3A 4PGMA 4AHZA 4POGA 2I3ZA 1DAFA 1A9PA 1LBQA 4IKEA 5KAPA 2G1JA 2MR5A 4WNIA 1A2BA 5FUBA 4DR1B 1CB0A 1XPRA 1XEFA 3IB3A 3MRTA 3NTLA 4JOSA 3SX4A 4WEOA 3P8BA 1L0BA 2ATVA 4AY5A 1NVMB 5BSFA 1ZUHA 3ZDZB 1RWMA 1JP7A 3CCBA 1CJTC 1ACJA 1C81A 5J4LA 1TA9A 3MWDB 1QF6A 5K6AA 1KJ8A 3C2QA 1ANKA 5C51B 2A5FA 2AX3A 2JIZA 5ALHA 2AG5A 1G2OA 2ORED 1VI5A 2VUSA 4XUEA 3U3MA 2B1GA 1C4KA 1W1IA 2IL1A 3K30A 4P7KA 2OMKA 2WWRA 2NXJA 3AM5A 5EJ8A 2KLHA 1P9WA 4F5YA 3LY5A 1KL7A 2WKQA 4HDKB 4DRXA 4CEHA 2CBXA 4KQ2A 3FUUA 3IEPA 4LSMA 1MZPA 1U63A 1A3CA 2DH5A 1ZK0A 3Q7SA 3N2YA 1RQ7A 1F8YA 5B4UA 2V1UA 3ZGZA 7GPBA 2IFTA 2BCJQ 4RSGA 4R8SA 4N9QA 4MO2A 1RE1A 5FOWA 1NLFA 5EIOC 1JR3A 1Q21A 5EYPA 4LZWA 3COSA 1OREA 1K5GA 1DO0A 5A3JA 1FA9A 5ALGA 1N2OA 3KXIA 3UGJA 4MYSA 3UPTA 1FEZA 1LKMA 2H1FA 3M5PA 3MMZA 3P52A 4FYWA 3ZD6A 3NX4A 3TDNA 4C3UA 1IUOA 4R2IA 4CF5A 5AQ1A 4QYIA 1OLSB 5JZOA 3AVVA 1E5LA 2EWWA 4M8NE 4QLOA 5U1PA 4ZTBA 3EBLA 2H57A 1QHFA 4AAYA 3VH4A 4FINA 5KWIA 1CQIA 2EERA 3DLPX 3ZCTA 1PR0A 3R3UA 4J4HA 1NXXA 1T6ZA 5L3RA 1RC1A 3GJRA 4FS8A 2R84A 4KFRA 1FK8A 5H4HA 4B6JA 2XJ9A 5DNWA 5TARA 4QECA 3A9SA 2OCLA 4PLWA 5JMTA 4W1SA 3SR3A 5F9HA 2O5JD 2GJSA 3C3JA 1NQUA 2PVPA 2Q9CA 1B0AA 3BK7A 4Z8YA 2NV2B 1G41A 2B61A 1QZTA 4GKJB 4G1UC 3IUEA 3LP8A 4QUIA 4ZAZA 3Q3IA 5B37A 5HJ5A 2C6AA 3GPIA 4NG5A 2R5NA 3QW2A 4RXUA 4TRRA 2AZXA 1QAOA 2DWUA 2F9FA 1KJ9A 1Y7PA 2WD7B 2ALJA 4WOPA 5CB8A 1OXSC 1PVVA 3IAXA 5K20A 2CMDA 1GG9A 3DZJA 2ZI4A 3NVKI 5EUCA 2IXDA 3UJCA 3S70A 1K7FB 3NNNA 3BSSA 2Z2KA 4TMZA 3IP3A 1V4VA 3RS7A 2FEMA 4BMXA 2ZJFA 2G1AA 1SBYA 2QVZX 1TYEB 3PHIA 1ZK4A 2ONYA 4Q3KA 3I2GA 1MBZA 1XJ5A 3CT4A 4RK0A 3RK4A 2C5BA 2FZWA 4LHWA 1J23A 5ITZB 4AL4A 2I8LA 3FPFA 1FP2A 4GU5A 2C5GA 2BM0A 2ODAA 3TWOA 2B4RO 4GBJA 3BSFA 1Y33E 1CQXA 1CZRA 1EHYA 1SC3A 2NYAA 2QENA 2ZWPA 1V1JA 1GPNA 3H5OA 3HCEA 4G5SA 4QU0A 4YRLA 4FXPA 5EKSA 3EVZA 1KDYA 3PKZA 2HA5A 1SQGA 3QF4B 3DOEA 1BE0A 5AESA 4HN4B 2VUML 2OWEA 4K8OA 4R41A 2YWEA 1AGYA 3D2LA 3Q9LA 4CCYA 2H1IA 3GUVA 4EFMA 3BMCB 4HQFA 1Z7WA 5GJCA 3ZX4A 4CXMA 4ME3A 4NEGA 3GT4A 1NAHA 2YIDA 2HXGA 5AW0A 1R0KA 1C3EA 3IQDB 3OEEA 4CMAA 5CB0A 3AF6A 4FB4A 3U60B 3FMVA 3KAKA 1C3XA 1P2UA 2LR0A 4NCNA 5KDOA 2RJOA 4J6FA 1BEUB 1VHQA 3BILA 4WASA 5TPWB 3HVJA 2G8NA 2MSLA 4D8VA 4TLCA 1BGWA 2JEOA 3MK31 4HYEA 3JATA 3GMDA 4MDEA 1V25A 1BHO1 3PC4A 1XVTA 4OBWA 4X71A 2JFQA 1F8XA 1E1KA 4L8WB 4UAVA 1JIKA 4QZVA 1SMUA 1NLUA 3CN7A 4UUQA 2GETA 2FW7A 1ZOPA 2WI8A 3HJTA 2JKVA 4CBVA 2Y6UA 1NAIA 3VZRA 1W87A 2HCBA 1JVSA 4HBZA 4JFRA 4M0FA 5DNVA 2ZSEA 1KH1A 1BQ3A 2HO4A 3VV3A 5TMEA 4LF6B 2Q41A 1ZM2A 5DCLA 3KE8A 4JKIA 4KITB 1FTQA 1GLVA 1FS4A 2VOEA 3DQQA 1O5IA 3DMFA 4IH4A 3ZCXA 3PEVA 1IB0A 3E03A 4Q7KA 1KAMA 1O3YA 2BSXA 3KJXA 1K3UB 4M53A 4OKNA 4BZZA 1KF0A 5LLTA 4AMUA 1P1HA 4XWWA 1U81A 3PFIA 2DX7A 1E3IA 4FR2A 5DSZA 1RXYA 3VU0A 3BFXA 3ZGXA 4CHGA 1AB5A 1JHAA 4TVKA 4YROA 1LB1B 1UXGA 2LTAA 3GFVA 3NGXA 3OE4A 2AQHA 3A6GA 4M6WA 1R8QA 5K8UA 4JOQA 4D8UA 5MF6A 4ENWA 1GLNA 4NS1A 1XDSA 4FMDB 4FWTA 1V7CA 3CW9A 4PLGA 5HGXA 1IWOA 1PJZA 2ERSA 4ZOLB 3L82B 5FH9A 4D26A 1UMBA 3THRA 2I3BA 3KBBA 2Q29A 4RD2A 2NSJA 1H85A 2OM6A 3PA6A 4EJMA 1KIFA 1VCNA 1ZI8A 2ORYA 2IKQA 1N6KA 5FF9A 3QLUC 3U5TA 1HX7A 1MHPA 1Z39A 4X1KA 1Y8CA 2PSFA 2PS9A 2WB4A 4P98A 4WXRA 3RSOA 5HM6A 4AY6A 3SZ3A 2FPGB 3JQ7B 5EWMB 3QE2A 3BM5A 3CJTA 1E6EA 1MB9A 1XAGA 3FCAA 4HZGA 4RH1A 4B6FA 2B7CA 3VPBE 3GX1A 3WKBA 2O5EA 4ROTA 2I2AA 2P9CA 1IY0A 4RD6A 1VPEA 3L5OA 2KE5A 3GH1A 3W0LB 3L46A 1SUFA 1NN5A 3I9MA 2RGGA 2Y2UA 4YAIA 3FSJX 1W94A 3IIEA 4JEUA 4BVEA 3W5DA 2QAJA 3RRMA 4CLRA 3QLVC 1QYVA 4O4LA 2GXQA 2J7PA 4TLBA 1LF0A 1H4SA 2IDMA 4C0KA 4E1VA 5KSYA 4LJ5A 1WETA 1H8ED 2NUTA 3R7AA 2CLKB 5F73A 1O58A 2Q6VA 3I12A 2BP7B 3C7CB 3K5IA 4M0DA 1DT5A 1H9BA 3FZNA 5AKZA 2PMDA 5BRNA 3V4FA 5LXTA 4FZRA 4FOPA 3R23A 4RQAA 5CT4A 5J4YA 1T9GR 1UJBA 3B89A 2H9AA 5B6IA 4FM9A 2O1XA 3AUUA 1A88A 1HQKA 1RSZA 1J0AA 2Q50A 5AI3A 1GTL1 2VAMA 2Y1GA 3CZ9A 4H7JA 5ALTA 3MCAA 1IEXA 3ZWVA 3NANA 4DA4A 4JZKA 2BUAA 3IP8A 1JBEA 5DGDA 2NU6A 4MJ3A 5CYGA 2H2FA 3KSMA 3I64A 3S2HL 1M33A 3BXHA 3W8FA 1S5PA 2LP4Y 3CIFA 3W8NA 5GM1A 5JWHA 3K31A 2P9HA 4RGBA 3I2FA 3F46A 4M9XA 3IEKA 1IK4A 5KX5F 4PTLA 3FFBA 2PHZA 3ZHBA 5IZ4A 3NQ41 2F8TA 4N6NA 4AHWA 2ZRCA 3I5MA 3I9LA 5JPDA 1ZU4A 3IVGA 4UE2A 2FFJA 3AY0A 3BFKA 3I72A 4Z4GA 2QRPA 5EOVA 2MSEB 1SN7A 2O5CA 4BJ1A 1IPHA 1THMA 5KSPA 1BFDA 5IASA 3OLQA 4MV5A 5GVSA 3WOVA 1OI4A 3O8BA 3CVOA 3RADC 3CVVA 5CG2A 1OYWA 3AO0B 4PLVA 4WUTA 2OLKA 1ND5A 1K06A 3EGEA 3RT9A 2PZJA 3WGUA 4DLWA 5JD5A 1OAKA 1KHTA 4NQRA 2IZ7A 1XVLA 4FPXA 4XKJA 3TEFA 4KUHA 1FVXA 1YV1A 1YB2A 3CGWA 1ETUA 1Z7BA 4HX2A 5FFFA 3B6EA 4QA9A 4AF7A 4N41A 5LIPA 1PZXA 1Y9DA 3R5TA 4BE4A 2HXSA 5DRTA 5IXJA 5EIBD 1W4RA 4ZOBA 3Q10A 2X5KO 2YWCA 3OMLA 2B1JA 5EFZA 1TT7A 3LL7A 1P2DA 3JQAB 3GAAA 3GVXA 3OPNA 3ED5A 4R5HA 1SXJD 2BKEA 3H2ZA 4DA8A 1JHMA 3DE7X 1FZTA 1KVUA 1ONBA 1UFKA 4QEZA 4S1NA 7REQB 3O93A 3GPBA 3DBVO 4UBOA 4NE9A 3I2YX 3JD0A 4U9IS 4EG5A 4BQFA 4F38A 4QBGB 2O23A 3ZY6A 1GQRA 2ZPTX 2ZZKA 3UMJA 4ATNA 1KYVA 5IKEA 3U7GA 2CLHB 2FWJA 4G1FA 4G5XA 3T99A 1E2MA 5EUQB 1TYZA 2X6QA 3SQWA 2WHQA 1Y34E 3RUPA 2FFAA 3U19A 4CLHA 1NUQA 2FX2A 3B1ZA 3M6MD 5CFQA 1HQCA 2PWPA 4WBXC 1FNMA 2ZRPA 4K81B 4DM3A 1T9ZA 4Q7QA 2C1ZA 3SDBA 3I4FA 2HHHB 2RAPA 2Q9AA 3A9VA 4PM4A 2JW5A 3ZU4A 2W00A 2J07A 3PFBA 4IWNA 2V9PA 5HCNA 1XNHA 4CU2A 1TT5A 5E3JA 4OQNA 3MCWA 3O84A 3DO6A 4FGWA 4HV4A 2QQ0A 4KAXA 1I5EA 1G9TA 1SKUA 2H2DA 2GN8A 3KTOA 1C7RA 1W2HA 3L7JA 3IHTA 1QO9A 3GMSA 3PUWA 3T9AA 5AVWA 5FLML 1ZCFA 1E4YA 2JH9A 1C14A 1VCOA 4JT4A 3V4LA 1KRWA 1N6PA 2CC2A 3S68A 1F8UA 5GGYA 4TLDA 4A2QA 1AF4A 5D3MB 5E3HA 1D4FA 2H2AA 2O8NA 5FULA 2G7ZA 1QFJA 2PVEA 3P0EA 4WFQA 2PD3A 3TLZA 1EXWA 4ZEVA 4V2IA 2R92L 4JBXA 4FCVA 1T9HA 3GDGA 1TJYA 4RW0A 4WZ6A 5C46F 5GJBA 4GDMA 3LKZA 4BYMA 2AOUB 4TXHA 1ESZA 3VDQA 3QYAA 2XJQA 4CTKA 4MUAA 5JSHA 3NASA 3A11A 5EWLB 3WISA 2QZJA 3ZJUA 1B0ZA 1KZ7B 3KKMA 5CA0B 3I2KA 4U2EA 2FFBA 2QT0A 2RHLA 4PSCA 3CT6A 3RFCA 3PGMA 1JRLA 4TT3A 2WJ3A 4O59O 3JWIA 4HNSA 1WMSA 2GFHA 3SZLA 4ZCPA 3I05A 4N3CA 4E4RA 1PK7A 3GOHA 3HL0A 4HK4A 4I1VA 4BYGA 2SKDA 5KNBH 3BJIC 4LN1A 1WXIA 3L8FA 2AN4A 4CUZA 5IVKA 1K3FA 2W2PA 2B5OA 4UMEA 2C6BA 3CS3A 1GNLA 2GHQA 4ID9A 2GK3A 3ZQ4A 1SA0B 1BEZA 3AX6A 3AI7A 1RHKA 1RS0A 3JARB 4O0LA 1AKMA 4YAUA 1BFKA 2JK0A 1I10A 8ABPA 3EG5A 4JUIA 1JAXA 1C09A 4M0PA 3GGGA 4WKCA 2E37A 3KT8A 1BAPA 3JRNA 2VRCD 4N0PA 2BEVA 3PRKE 3RW9A 1DARA 1QTRA 1LPAB 1R37A 2ZSIA 3JQBA 4LEIA 4DIDA 3U39A 2QS9A 1JBQA 2QRUA 2R47A 3GJ4A 1YMUA 3PQEA 1P1BA 1TRKA 2DXIA 3PJDA 3OT1A 4D4IA 4WSOA 5A06A 2C2HA 4QX6A 3WV5A 4DL9A 1SMKA 4US2R 4HJRA 2V6GA 3GP3A 2VL7A 4HNVA 2PUBA 4M46A 4MUKA 1BCSA 4NPHA 5L45A 3FOWA 3BYZA 1KMNA 821PA 4PNPA 3AWIA 2HWKA 4TPKA 5CU7A 2MYNA 2NUPA 5IYBL 3NG1A 1CW2B 4K9SA 5AUOB 1TGVA 1XXLA 3FFWA 3P0JA 4JJFA 2I80A 4X85A 4YP6A 1RQXA 2QW1A 4ZIRB 1QOQB 4HMQA 1ZPDA 1U0GA 1XMPA 1LFAA 4MYUA 1RYYA 2IEZA 1LNSA 3HY6A 4PGAA 2Q1TA 2EARA 4TRJA 1H2BA 2GK7A 4Y7DA 1LK0A 1JIQA 5M3FL 2PMFA 4MMXB 2IV7A 3TUIC 4HUQA 4K6FA 2XB2A 3KQQA 4AB1A 3PC8C 3MRXA 4YJ2F 3R7LA 5B3KA 5ITZA 5KDDA 5COAA 4W5HA 3W5CA 5BYKA 1ULSA 2PT5A 4Y2JA 2J59A 4JP2A 4PHTA 3ZW9A 4DLXA 2AFHE 4GXQA 1JHXA 2HLPA 3I6BA 4XCXA 1VCXA 1VLLA 1RZRA 5IF9A 1TWAL 4GYWA 4DMCA 2Z9BA 2MJLA 2YMLA 2GN2A 3ZQKA 3DE4X 2GM3A 3EC2A 3EQ2A 3L4BC 1Y7IA 3HG7A 3FYUB 2QPAA 1QP8A 1DE0A 4FIZA 4UEJA 5F9MA 5TDHA 3OHMA 1Y4AE 3UGKA 1NQAO 3LUKA 3KEFA 3G1WA 1NLZA 3PCXA 4J0FA 3IPLA 3AVPA 1S1CA 4PINA 5BN5B 1ZYUA 5G1OA 3N7UA 3M3YL 1QC5B 2D5AA 2HBRA 4L6IA 1SOUA 4ZVTA 2IPXA 3DAFA 1V8FA 2X40A 3LRPA 1TAUA 2BGIA 4UHCA 2KYRA 4LF7B 2OEPA 2RK6A 3ND6A 3P9YA 1C3LA 1MMFB 2H4JA 2YJZA 2QM8A 1M6YA 2YXNA 3C87A 3KZNA 4WJKB 2ONJA 1G5TA 1YZQA 2HWXA 3CR3C 5CVEA 4MP3A 1ZU5A 2HEGA 4YIKA 2WJYA 3KJFA 1SQ5A 3VZBA 5KYNA 1VOTA 3EARA 3ILYA 4D81A 1TK3A 1E5DA 1CDDA 2A0YA 1NVWQ 3DZBA 3G2PA 2X5NA 2X86A 4ACAA 2QB5A 1PL7A 1G20E 1CUGA 3LBYA 3IEUA 1HV8A 4RCZA 3UAXA 1GRVA 4AKTA 4JP5A 3E8MA 3PPXA 3H9QA 8ADHA 1UXKA 1PT6A 4TV9A 1MXFA 4FZ3A 1VPVA 4Y1FA 4HF7A 1DJQA 4CM4A 3UAGA 4GPD1 5BVHA 1U04A 3ABZA 3ICCA 5JCOC 1CU1A 3A70A 3QVDA 4M86A 4X3OA 2NNLD 2IODA 3WA7A 1KPGA 3FCEA 3PC2A 3NNDA 2FEPA 1M7HA 4PCAA 4NZNA 2ZSFA 3EDCA 3I8XA 4FD2A 4X7MA 1OLSA 1BG6A 3SP1A 3WLOA 4Q3DA 1MNAA 1YUBA 1EM6A 2WP0A 3DEKA 4N65A 3VHXA 4BQIA 4ZKDA 2VQSA 5LJLA 2X4IA 3I1JA 4XJXA 2AOXA 1PK9A 3T6KA 3UC9A 1E9EA 3ZE0B 3F3KA 3HKCB 1HDIA 2NAFA 4L5YA 1AVTA 5HK8A 1E8JA 3MT8A 1LQTA 2OV2A 2JDID 3KVVA 2TRSB 2FMKA 3E35A 2ZBVA 3W78A 1E3SA 1GXSA 5JMPA 4DM7A 1E4EA 3AK4A 1PJBA 4U3JA 5IJZA 3F7NA 1LTHR 3ULKA 3H9GA 5J59A 1DBWA 3CPSA 5EWMA 3BHIA 4XDZA 4EHKA 4FR0A 2JBWA 3I9FA 4KBYA 3L06A 2QQGA 5HJEA 2DHCA 1EYZA 4YEDA 3TOXA 4HNAA 2HDOA 2XUPA 3LWVB 4D8WA 1EFPB 1L4KA 4MR8B 2QSYA 3AFGA 2XQJA 2Z5GA 3NAGA 1U0LA 4RC9A 3NUGA 3DLIA 1FLNA 2LGJA 4HVLA 3SQXA 3W5UA 3KJZA 2CVPA 1FRQA 3GRPA 3JQFA 1O96B 2OQRA 3ETCA 1EWKA 3OI7A 3URKA 4MKXA 4IS3A 4P35A 1CXZA 1RJDA 3WQQA 1SXGA 4G65A 4Q24A 1JFFB 2R1UA 2VDQB 3GZNB 3F3SA 3QWBA 4X60A 1UEJA 5K4GA 4C0HA 3BB1A 4RK5A 3QJ5A 4ZYZA 1ECFA 3D81A 5FIUA 5CLQA 3NJ4A 4IJMA 4J4BA 4PV7A 2WB2A 2PGOA 2WJZB 3HDVA 4CCSA 1K8RA 4CLRB 2Q62A 4MR8A 5EVCA 3UTCA 5JAMA 2PKYX 2QVGA 1M8PA 3ESQA 1YCDA 1SHLA 3LDUA 3PD0A 5T6BA 2Z09A 4GPTA 4C03A 1UF9A 1HMYA 1RPTA 3ASYA 3QIVA 3O73A 3ZGOA 1FIUA 1AZSC 1TCAA 3GN1A 4MA0A 5BUSA 5B58C 5FA8A 1Z0UA 4CM8A 1FYVA 3I04A 3LXRA 2EIHA 3ACDA 4IV5A 3GJ0A 1KFKB 2TMGA 1Z6XA 5LP6F 3DT9A 1DO8A 2PPVA 2FR8A 2QN1A 1O89A 3FNHA 4NATA 2FSGA 1JPVA 4NU8X 3O75A 5CTJA 2CB9A 1SUBA 2IXFA 1PAUA 1L5MA 4Q01A 4BFXA 3DVQX 4OQXA 3RC8A 1PGPA 1VJ0A 2CJWA 4HLUA 3RJTA 1JR6A 3JQCA 3GAFA 1KI8A 3R3XA 4G8CA 1T8TA 4MVJG 1ZNYA 5L51A 4MYRA 1OPXA 1TWHL 1K5DA 5KEIA 3EOZA 4B4WA 4E88A 5KJ1A 4CIXA 1Q50A 4NX2A 2RSLA 3HJYB 5JUWA 1GRNA 2QAGA 4O02B 3IUNA 2J9XB 3EODA 3GY0A 3OSUA 5T7BA 1DADA 2QD2A 3OT5A 4OB8A 2OHFA 5J2UF 1UBOS 1E1MA 4JI0B 2VJNA 2C07A 5AI4A 1ZN8A 1YZKA 5J4VA 1TCBA 4FYJA 2VTKA 5ENZA 5FTLA 3K72B 2FAXA 4TXMA 1NBMA 1Q1AA 2F62A 2NO0A 3SEFA 1UK7A 4CG3A 2O7VA 4H31A 1A8HA 3LGAA 2QZPA 1EK5A 2HYIC 1EXNA 4K9NA 3K0FA 2ABWA 4DZTA 2GEKA 4G56A 2CL5A 2VT2A 3I9JA 2Q0HA 5IC4A 2FW1A 3EFEA 4A5SA 2SCUA 4CWAA 3CX3A 1E0KA 2GZSA 3G5MA 4H0CA 1L7AA 5DM2A 2BPOA 2WU3A 3ASZA 1NVAA 2YMMA 1UKBA 3QHQA 3TW6A 1VA4A 5AK6A 5A9RA 1J56A 3UAYA 5J47A 3P2KA 5L8VA 5D1NA 3B13B 4M7WA 1A2KC 1UBHS 2QVXX 3K0EA 4IICA 2LVBA 4ZVUA 3VR6D 3VX3A 2CSXA 4LJYA 3O90A 4WXYB 3RS8A 3HGQA 3L6DA 1GZHB 1TQ6A 4H4EA 3U7QB 5CP8A 3ZWOA 4GT1A 2QE7A 5BPFA 2XYVA 1Q7GA 3MWJA 5IVPA 4UCQA 3AL2A 3UK7A 4BNIA 3LLUA 4XDYA 2GLXA 2ZSBA 3EOAI 3TDMA 4B6OA 4D4GA 5JEDA 3D9QX 5CW2A 5DOVA 1V5FA 3WYAA 3KYUA 1ULBA 4MV4A 4KK3A 5CJJA 5LCXA 2EHDA 4PZ9A 3TYXA 3ACCA 4BBJA 5BW8A 3DTVB 4EUFA 3IOYA 5SYNA 2FPRA 1HE4A 3QVTA 4H6VA 5BQPA 1GA6A 4JCCA 1G7RA 4P2GA 4QUKA 4BTLA 4AF8A 1FFXA 2C84A 1Z7EA 2LKCA 3KUUA 5HOEA 2VXCA 2QN8A 2IKSA 1KI1A 4GZ6A 4EW6A 3ILSA 1R6TA 2EFJA 2RGAA 4O2BB 1Y7HA 2RHWA 4CN9A 4HVCA 3SS8A 1UEXC 1GZSA 1H22A 2J6BA 1AZTA 5F2NA 2C3YA 2DPMA 5I4IA 2I6QA 3KT0A 3PX3A 4XIFA 1UJ4A 2I22A 3ORFA 3QY9A 2JJYA 1R88A 1INLA 4QPZA 1XBTA 2ISSD 1YQXA 1UM9B 4P86A 2R7NA 5EA2A 5H3HA 4RDIA 4AJ2A 5CHYA 4OHVA 4F9EA 1NW4A 3NH9A 3QE4A 4FQ5A 4JC4A 1K0FA 1L7DA 5CXXA 2WT8A 4K46A 5ITWA 3AQ4A 3IUPA 3MGKA 3NBXX 1KQGA 2PWAA 3WMGA 2HHCA 4KAJA 1RKQA 4ZO7A 1M1NB 5EUMA 2C2OA 5EYPB 1V8BA 3IT1A 1MJFA 2QLLA 3MGAA 4EKDA 2ONCA 3G2MA 2XRYA 3TL2A 1FHMA 1PJCA 2J3EA 1BU8A 2XA9A 4PAMA 4CIYA 4KX3A 3IKVA 2OVBA 2DFLA 5DHTA 2WJIA 1KA9H 4JA2A 1P7CA 3ZGNA 1BWPA 3GFQA 1KXJA 3QVWA 4ALJA 5A3RA 1M2JA 1FQKA 3O2NA 4AMVA 4WY5A 5BVHB 3GTJL 4IIUA 4IDPA 3MAJA 3RHZA 1AD2A 1MJGM 1XRLA 2HLNA 3MJ4A 3MWDA 4N3NA 4YUAA 4RK7A 1D1TA 1ST2A 2WHPB 3GTOL 3KCQA 3T9DA 2WG2A 1OMOA 3U9TA 1UXIA 1C0IA 5F7JA 4DWJA 5L3SA 2IXGA 3GCZA 3LTEA 3L4BA 3X1WA 5KQSA 1FFSA 5FBLB 3E53A 4CLEA 4HB0A 1RZUA 4YP0A 4QDXA 2XTJA 3CSDA 1KSGA 1A1VA 3HEMA 2P79A 3HVHA 2GPSA 4PPQA 2P2GA 4RL6A 3PV0A 4GZ3A 2PSJA 3B7GA 4P5EA 2Z2JA 2G9ZA 2YHSA 1CFZA 2XYPA 1IN6A 1A7UA 2GEDA 3HBMA 4Y9TA 2L42A 1PJ3A 2ORVA 3PPIA 2CVHA 2BTQB 5EZ6B 5KOHA 1XK7A 2FSIA 1KC3A 1XI2A 1GL3A 2OXEA 3HA7A 4BWVA 2F8LA 2ZW9A 3Q6NA 3GR6A 4LPSA 3SZOA 4I6EA 1TEHA 3NPAA 1ITZA 4NBVA 3T35A 3MB8A 1B7GO 4HLUC 4ZOCA 4QYXA 3BSYA 3BXGA 1VL8A 3AU8A 3MSUA 2XA1A 1NOJA 3AW8A 2W2TA 4RA9A 5G4KB 1KEUA 1N9KA 4FGUA 4HEA6 1N5IA 4Q3EA 2VTBB 3UVEA 1YJ8A 4UU1A 3MJSA 1IIBA 5DHPA 1SCJA 3NWBA 1S8FA 1CS0B 4GPBA 3L7CA 3SHVA 4DJEC 2XLBA 1QB8A 4YQYA 2D0IA 3M7IA 4M49A 1J8DA 4NECA 4DRZA 3I9V6 1Z8FA 5KCMA 5AVXA 1E4EB 3WXBA 4H4DA 1RYNA 4CR7A 1NYLA 5KX5B 1PR6A 1JL3A 3LUGA 1U98A 3KC2A 3GLGB 2ZUCA 4ENRA 3ZNPA 1EM8A 2VF7A 3OZBA 4QREA 2VT6A 3E9RA 3G9XA 3ORSA 1KTVA 3S1AB 1GYPA 1XTPA 3OECA 2GBIA 4HH4A 3QLJA 3E81A 1T4GA 3Q4GA 3BE8A 2NT4A 3IAFA 2G1UA 4MZXA 1R0FA 1KNXA 1PG2A 2HTFA 2QM7A 1ZY2A 2O14A 3NT4A 3L0DA 4GX2A 2EP8A 5LZ8A 3PHBE 5J2UB 3V55A 4CKCA 2OHXA 1JWAB 1EK6A 1TZBA 4RIIA 2WU4A 4ZV9A 5P8WA 2AMJA 1R2QA 4XR9A 2NVUB 4ZEOA 4W5NA 1WY7A 3EJ6A 4C7KA 4AIIA 4Z4FA 2RHTA 3PG5A 2J5KA 4KR2A 3JQFC 4LDPA 5C80A 4KQMA 4MB0A 5AJTA 2ZR0A 2HCJB 5KNCD 3OJ0A 2GPAA 4G2TA 3HXOA 2QYSA 1BYIA 4EITA 3OOWA 3OPQA 3CW2A 3LLCA 4C0WA 2Q4TA 4IO1A 3LA6A 1N5LA 4B7CA 1XZJA 5TQ0B 4XM2A 3OLYA 3AIOA 3HXLA 1AHPA 1YE3A 3CX6A 3TLXA 3WLRA 5BPHA 5TRTA 5BNWA 4Y1RB 5F3DA 5JJKA 1N0IA 1WQ4A 2G71A 2XR1A 1U3DA 4ZODA 1XZKA 5DYWA 1OLXB 4CM7A 2G9UA 3TW4A 4BFUA 2W6ID 3UWOA 1IZ7A 2XAUA 3WL8A 2Q5EA 1MJGA 4XVRA 3PR2B 2VH5R 3E1SA 5F5XA 3GJSA 3KKNA 4ESEA 2QGZA 2CKCA 1YBHA 1TO2E 1A5BB 4M83A 5H0IA 3RFXA 2WHRA 1D1PA 5FJJA 1N6NA 3PWZA 1E96A 3C5HA 3PUZA 4AJ1A 1MPTA 3MUNA 3E9MA 4X1YB 4UM5A 4ZO8A 3KSBC 5A4AA 1KI9A 5EJ7A 3HUFA 2NZYA 4QC2A 1C8KA 1RHJA 3AXSA 2PLRA 3IO3A 4IHKA 4R1UA 1HT1E 4ZXPA 1G5QA 4KDRA 5IUNC 5LQMA 3LQFA 1F38A 1YVUA 4AHYA 2FW9A 2Y76A 3PXEA 4GR5A 3UJDA 3WHIA 3RCBA 5K7SA 3KR9A 2C57A 5KUTA 4R1QA 2YMQA 2PX0A 2X0NA 1DEAA 2D2IA 2ZITA 2ZIUB 3HA5A 4HAWA 2Z2XA 5D51S 3TKYA 1U5BA 1UC4B 1XCBA 1Y5RA 1L1QA 2B30A 2JA7L 2I87A 3N2KA 3H5RA 4KGVA 3T5MA 5K8LA 2OZKA 3EVDA 3DTVA 1PYGA 3PKJA 4YJFA 4DDMA 3OPXA 3PNMA 5IBPA 5KTSA 4II2A 1ODCA 1D0VA 1KBZA 4TYNA 5GY7A 3S7ZA 4B3IA 1QQAA 3GLIE 2G0NA 1GNSA 1WSAA 2B92A 2WOOA 2ZK7A 3RSGA 1QQTA 3ZK8A 3ND8A 4G0MA 4H16A 2PBLA 3NHYA 1BIFA 3ILVA 2LCIA 1NJ6A 4AMGA 2C4TA 1WXHA 4BAUA 5JYEA 1EK0A 4FI3C 5B1IA 3HM9A 2BFMA 1JEQB 1SBQA 3FYTA 3G0GA 3MLAA 5M5WL 1MOZA 2ZJOA 4IJQA 4C0JA 1JBKA 3EGCA 3TRFA 1ZWLA 1GT91 1P9LA 1VC2A 2PD6A 1GKYA 1L1EA 2ZE8A 3AR5A 2DC1A 3E0XA 3ENZA 4M1OA 2BFEA 4KMOA 3WK6A 3FR8A 4KXVA 1W75A 4S04A 2X42A 5JHGB 4LWOA 2A9OA 4JYPA 4JC0A 1RVDA 2JLCA 3DKPA 4HDAA 1SKYE 4C6TA 1OX6A 3FDIA 2Y4NA 1E59A 3KSUA 4IF4A 3KD3A 1T43A 3WQBA 1N7HA 1T3LA 4IDAA 4GEGA 1MJHA 2Q99A 4CM8B 3I73A 4XTCS 3IVRA 2JVKA 3V6LA 4BB0A 1C1DA 3CH6A 2Q0QA 1NURA 1LDMA 2G1KA 5FLEX 3WL3A 4BQRA 3MTGA 5FUYA 3U7EB 2AOTB 2V6FA 3I83A 1SC4A 3U1BA 3CM0A 2A9FA 4EY5A 1E1QA 1KU6A 1Z35A 2GZDA 4MIYA 4X7PA 4X1IB 3VZQA 3ZE7A 2K2QB 1DOHA 1J24A 3T7JA 2CFSA 4JADA 1H0SA 3QQPA 1WOMA 5IP5A 1U2DC 3C6MA 2ZE5A 4E22A 1M1YA 3H9UA 4EYOA 5FA6A 2R7LA 4F60A 3UA4A 2PTGA 4F3RA 5HQ3A 1LDNA 2VBIA 3U4QB 2PCLA 3O7MA 3VSDA 1VRCA 4J03A 5HNKA 5FWAA 4UMDA 2P5YA 1V9SA 2AOTA 1WU7A 3G8YA 3I1IA 3IUJA 1P3JA 1EA5A 1ZGBA 2FFHA 1E1RA 4MCAA 3R9XA 3K0SA 1LTLA 3FI0A 3WMFA 1KQFA 3WGTA 1FDSA 1JKJB 4E5MA 3NM4A 4PBTA 3ZE8A 5I7OA 5AOCA 1IQ0A 3RAJA 3NBMA 1EHIA 1PJ2A 1P0MA 2IU4A 5JVG1 3B08B 1FJHA 1YAJA 3CU5A 4IIJB 4OKIA 1SH7A 2I34A 3W04A 4OUDA 3WJ1A 4MR9A 2V7WA 4H7FA 4R1PA 1G1MA 2GKSA 5BQOA 4ZJYA 5HXAA 3TMAA 3FYDA 3N6XA 4LW8A 3ZDCA 3ROEA 2AI3A 3RSQA 4YT5A 1KJQA 2PGAA 4YJ3B 4B84A 3ZDBA 2CYBA 3MMXA 2W4IA 4QT4A 1E63A 2MMCA 3PJEA 1H2WA 2WAXA 1YDMA 2HD4A 3IBYA 2PG3A 1U2GA 2E2HL 4BTEA 1OW3B 1KSJA 2D3TA 1YFKA 1IW7D 1ODFA 2EW8A 5JG7A 3N6VA 1STOA 2QIPA 2Q3BA 4WZBB 3INYA 1KQNA 3LBHA 1P2GA 4JS0A 4XW2A 3TIFA 2RGUA 3VNVA 2UUCB 1H4VB 1E7RA 3QUTA 1SWVA 3FKSA 3UENA 1A4XA 3DD5A 4HXFB 4MW4A 4DQLA 4B3TB 1Y8AA 2IZ1A 2KM1A 3FUTA 4HNHA 1XRNA 5D7NA 2ASVA 4G5RA 4QXPA 3MS7A 3INNA 2JHCA 1X80A 3PJFA 1GPJA 4EABA 2PVXA 2JGEA 1R0HA 2XGMA 1DC3A 2AFIB 2GF2A 4P5PA 2JLXA 5KDLA 4PSKA 1LU9A 3NHLA 1NYTA 1YE8A 4ABTA 3QLUA 5K2OA 1DC8A 3P2JA 3PQ8A 4R2KA 1GVHA 3D6FA 4H59A 1US8A 2OL4A 3HLTA 1MAUA 2G0AA 4ME6A 3ME5A 3PPVA 4RELA 2O7NA 1ZISA 4FR5A 4JJKA 4YO8A 5AKYA 4NFSA 3KRTA 5LOVF 2EKQA 1RKBA 5IMBA 4EG3A 4BKOA 2XE8A 1T6BY 1A2QA 2PDAA 2ZSAA 3OJXA 3KZKA 3UB3A 1FX0B 1Z0FA 2W83A 2YY5A 2WE8A 5LZ7A 4ZIRA 2P2YA 4NFLA 2FP3A 3JVVA 1QP7A 3AVTA 1F4VA 1I6KA 1P5FA 2GLUA 2ZT6A 4NJEB 4OSEA 2OCKA 4ZJZA 3FHJA 5JS6A 1FSPA 2H51A 4Q15A 2AA3A 3TD9A 4I1SA 1M54A 4XQEA 4D7AA 4YRKA 4RBNA 1GITA 3VU8A 3GRVA 2ZLBA 5F35A 4R5MA 4A5OA 1TCVA 2B8JA 4C3OB 1CCWA 4J0DA 4N1AA 1J2UA 1TE2A 1KI2A 1R0RE 2Z6QA 3PUXA 1PHPA 4DSZA 1EEHA 2VYVA 5LJIA 1SVWA 4LV6A 1P1RA 2F9LA 3L8GA 3WYFA 5C5DA 5U9CA 4Z1OA 2RGWA 4JL5A 2O8EB 5C5IA 1M0WA 3QXHA 4XA8A 1W8DA 4LBVA 4Q93A 5JD3A 4C4ZA 5IABA 2O2CA 1T35A 3H2HA 1XMSA 4I1RA 2EYQA 1NSYA 4JCOA 4B47A 5ILOA 4XXBB 3SPXA 1CR6A 1KEZA 4QD3A 2R1VB 4EKEA 5C4MA 3OHSX 3IT0A 2Y1WA 4FWBA 4OGKA 3WNBA 4DJAA 4CKCB 3QKSA 3ZLVA 4IJ5A 5JRZA 2PE5A 4W5TA 2B3TA 3H6KA 4GLFA 1WHSA 2J3HA 2XCSB 2Y1KA 1IJEA 4PN7A 1R8SA 4F96A 1VCIA 1FVHA 1T8RA 3LWNA 1P0IA 2AMVA 3PDJA 3HVRA 1FE8A 3B2EA 1SBCA 4XX1A 3VR5A 4I3GA 1HTTA 4X5OA 3FOEC 5IAAA 2IBTA 1BXGA 4ZGGA 2VJDA 5IH7A 4IDHA 3LUPA 4KFCA 1R6VA 4Y1EA 5GOZA 1YJ5A 2LCFA 2GVZC 3LDHA 2XNDD 3NEPX 4G86A 3LKVA 3OUZA 1SFRA 3NLLA 4ZO9A 3MPUA 3HM2A 2CF6A 1K6JA 2YVLA 1UINA 4OYRA 2W5UA 3VJRA 3B2NA 3UJAA 3EE6A 3LQYA 3VKHA 2WFMA 2P7HA 2H4WA 3F90A 3PGLA 4BKQA 3ZJ5A 2MHCA 1H3FA 2CL0X 3HXTA 2X22A 4Y6SA 5TB5A 3F6RA 1QH8B 5THKA 3STWA 5LC1A 2Q8QA 1DX8A 4UTZA 3ESYA 4M1MA 4A0SA 5EJ4A 4IMPA 4HL6A 4BO5A 2WKSA 2BMWA 3CKKA 2KN9A 2CXOA 3W05A 2VLBA 1JEYB 4BEBA 4ZZ3A 4JLSA 2MDTA 1G4AE 2QAIA 5KYUA 3C3MA 3WOHA 1PYDA 4KXLA 4DQDA 2HJGA 4F85A 2WT4A 4ZK6A 3KQPA 4Y7CA 3SZGA 1G63A 1PL0A 3JAMA 1DIAA 1QYDA 4U7DA 4BX9A 1JEQA 4LXIA 3AYXB 1NNUA 2IUFA 4QVGA 4M2LA 1UIRA 5HCIA 5IANA 2WIBA 2DG2A 3FJYA 2OAQ1 2F55A 4DUYB 1MABB 3BWMA 1QHXA 1K97A 2PX4A 2IU0A 1Q7CA 5E4JA 4YYZA 3VR1A 1EWRA 2V1XA 1EFUA 1AJEA 1RCUA 2E7ZA 1ESMA 3LYAA 4QDOA 1MB4A 1VCMA 5A6SA 4FOSA 5CG1A 1I30A 1U9JA 2C8LA 4ZHQF 1LVGA 1RJGA 1VLVA 2MS3A 5E6RB 4DAEA 3O0TA 4AZTA 3C8HA 3PQ6A 3UW1A 3KKKA 1JX6A 3OZDA 4N7MA 1T6NA 1X15A 2JFFA 1OTYA 2QL5A 3NC4A 1I9GA 2UZIR 3IULA 2B9VA 4HGYA 5DLEA 4IEFB 4IHJB 5KO2A 3TQOA 5K3FA 4ESHA 3QPVA 4LYJA 2BEJA 2IGBA 2C2MA 2WE7A 2Y2VA 3OCJA 4ZARA 3FYUC 2CUTA 5IJAA 3CLSC 1S4QA 1F20A 2DLCX 3GYGA 3ITNA 1TZCA 4C1BA 4JH0A 3QG1A 1LVHA 1FTYA 1B16A 2WIFA 3FLEA 2ZIAA 4GPAA 1EVJA 1MPXA 1IPEA 4M6WB 3F1LA 2JD0A 1R0JA 5IJ9B 1II8A 4ZOEA 4IW3B 5EMNA 2WIAA 3BD9A 4CGZA 2QLJA 2I2BA 4HR7A 4UQPA 1NZFA 4ZMRA 4QTTB 4Z0NA 3FMGA 5CM2Z 2IYVA 1FFWA 2YXLA 3E15A 3JD2A 4OQDA 3QRWA 3GV0A 1N2HA 2ZYTX 3HR4A 3LFHA 4GP6A 2NOAA 5LB4A 2V7GA 1L5HA 3EUWA 3LY8A 1R7RA 1EX1A 2BIFA 2X23A 3E3OA 1X74A 1TUGA 2I4LA 1UIMA 7AT1A 3UICA 3EWNA 1CAAA 2X77A 3ANXA 4TL8A 3EVEA 1ATIA 3OLCX 4K3UA 3E9EA 5A71A 1CUSA 1LXCA 4UEOA 4NYMQ 2PGLA 3A44A 4FT4A 3IP7A 4R0NA 4YP7A 4C4TA 1L4HA 1ZRNA 4FYKA 1Q17A 2PRJA 5DBOA 5LLSA 3S2YA 2FSPA 2C98A 2WVAA 1Z75A 5L3QA 5D87A 3LCVB 2D62A 3AZOA 4JJGA 1ZIYA 2E2WA 1NFQA 2M1XA 1R9TL 1YOVB 3KQWA 2GWRA 1PEKE 3ZY5A 2P27A 1ZM4A 1DXHA 3PRJA 1CKEA 3P0RA 3PD7A 1ZHFA 3ZH9B 5I5EA 1DKNA 2GO7A 2WHXA 3ZX5A 4C3JL 3BGVA 3NP7A 2PX2A 2DEUA 1G291 2QZZA 4MDYA 2E4YA 2CK3A 3OE7A 1JSZA 1NLYA 2EEZA 4TMXA 2B3DA 3HMKA 5JYBA 4JIGA 3WTBA 4CUKA 1X13A 3BTSA 3GNQA 4MIKA 1JYSA 3L7LA 3MJEA 4U9UA 1LPSA 1KFEB 3C1AA 1DKLA 4PYRA 2WYWA 3GXBA 1KYYA 2JJ8A 5G4KA 1NNQA 1K0UA 2E0IA 1XAHA 3CPEA 4G9GA 1MTOA 4NBNA 5F5NA 3VC7A 4A8JB 4MQUA 2ZXEA 3R44A 1I6WA 2QN9A 2QL9A 2Z9DA 1F14A 3FY4A 5HOQA 4R2JA 2ZRHA 3GT7A 5F2KA 1LS1A 1XDUA 1U9YA 1RJ9B 3U0BA 2JI9A 5E8RA 2Q4BA 3CLKA 3L84A 5DFAA 4QM6A 1AKNA 5CFMA 3FCXA 1IN5A 3LYUA 1T9DA 1TM4E 5MGNA 4AKHA 1W6UA 3DBLB 3OQBA 1NQOA 4OJMX 3CISA 3TCKA 5HTOA 5F51A 1G17A 3HXKA 4KIGA 4XQGA 4PRZA 1KI6A 4P1ZA 1TIKA 3Q3JB 4XX0A 3IQFA 5IG2A 5IPFA 2J31A 1SVMA 1FS6A 1P1JA 3ZW8A 4WN3A 4NXMB 1USUA 4JBYA 3S6JA 5JAOA 2CJWB 1Q1NA 1I4EB 4I4NA 4PC2A 4KBGA 2BLLA 2I2CA 4U7PB 4W1PA 3D7RA 3R77A 3UUWA 1F0YA 2CZGA 4DVJA 1ZJZA 3DDWA 3NTQA 3GLVA 4B2LA 1AKEA 1YGPA 5AIAA 2HSZA 1MAHA 3E7XA 5T5QA 4RHEA 4BNVA 4BL5A 4B87A 2GZHA 4K2AA 3KZ1E 2WWGA 4NYJQ 4JASB 3MOSA 3ZCPA 1OYOA 2G07A 4U1RA 4N0QA 1PVOA 3N1UA 1FRZA 4RETA 4FX5A 2V6JA 2VN8A 3LP6A 3O3CA 1U8CB 1P19A 3CLRD 2JATA 1F2UB 2YOHA 2X0IA 3IPXA 3ENWA 4YR9A 4C4PA 4KN5A 1UPTA 3LE8A 1H5NA 3Q0IA 1IJKA 1FPMA 4FVTA 2WWYA 3FWHA 2G6TA 4JWTA 4WXMA 3RRJA 1JDVA 2ZRQA 3U62A 4RLSA 4NONA 2XQFA 4JEIA 3F6YA 2P0EA 2ZI9A 5BUCA 3SCZA 1EQAA 1Y3IA 2XNDA 3REQA 4ARUA 4A3EL 1QV7A 4DDTA 5KQMA 1PR5A 3CONA 5CDFA 2R68A 4CM9D 3W3AH 1P1IA 2XTZA 2HA3A 2PSHA 3AUKA 5E7IA 1DTSA 4ZDWA 1P6UA 4O1MA 2W22A 5IJXA 2DETA 3UB2A 4JJAA 3M6VA 1L4FA 2J4DA 5AKEA 5IU6A 2EJBA 3T1OA 1WXEA 2WSBA 3VJKA 1Z8HA 3EEQA 2FCAA 3CEJA 4D9HA 5IM5A 2AW5A 4BVAA 3GJ3A 2BF7A 3WQHA 3W1VA 3ZXSA 1TVKA 5K8TA 2DHRA 2JA1A 4KQFA 5EIOA 4P7BA 4A1FA 1H1TA 3FVRA 4YAEA 2ONKA 1YL5A 3DDHA 3GAZA 1L2TA 1L3IA 2BFCA 1PFQA 4TVBA 4YFVA 2VPYA 1LY1A 5G41A 3MPSA 3QF4A 2OBBA 5FBQB 4LVCA 4QHSA 2G63A 2FPOA 2X9QA 2Q49A 3ZU5A 3S1RL 4RF3A 3EMDA 3R0VA 3O8OB 4R7ZA 3MFQA 2AV6A 1IU6A 4U0KA 2M4VA 1JLLB 3A1CA 5TSDA 1HE1C 2EWMA 4AG5A 3ICOA 3VKGA 4OQ4A 4DLZA 3CZ4A 1Z0KA 1I2CA 2FFQA 3F4BA 2AH5A 4EJ2A 1QIDA 3PIO1 1M2HA 4CEJB 3G9ZA 5A2QA 2BFFA 1NVVQ 2PLFA 1RRFA 3H5LA 4DOMA 3WLPA 3IPCA 5FUQA 2QX7A 3M9XA 3AM1A 2OQ2A 3WYCA 4CLXA 1DCFA 1LJLA 2Y68A 3HE3A 3PXXA 1YNOA 2ZU6A 3SLKA 4LJ8A 2CXSA 4PWZA 4RVSA 3TIVA 4F3YA 2Z8XA 1W25A 3BRQA 1A8SA 4RTKA 1FY2A 1KZ4A 2PT9A 4D3SA 1MGPA 1NI3A 4Q5IA 1MOSA 5EP1A 2I99A 4D42A 3KTFA 3FTDA 4TLAA 3REFA 4HPXB 2JI4A 2FY8A 2P8JA 3VZDA 5A5VA 1D2CA 2VAVA 3TNLA 3L6BA 2FKNA 3DFKA 1Q1EA 5AI0A 4KQEA 4G5OA 5CYPA 3QVOA 4KFUA 3OIYA 1SVLA 5C1DA 1XU7A 1SQ0A 3KLPX 1NUUA 4OFBA 2GJ4A 1DBSA 3B60A 3TE6A 2ZUEA 4LCJA 5F3RA 1H4QA 9MHTA 2OAGA 4Y9DA 3M9WA 4ER7A 4MRVA 4X24A 1SXHA 5JCPA 2IHVA 2QG4A 1R6DA 1OU0A 2WU0A 4H3HB 1VSVA 3VUFA 3G0BA 4X6XA 4DSAA 1SZDA 4AJPA 4BLTA 3KXPA 1U28C 3HYNA 3SYRA 1PNOA 4D56A 4A93L 3K09A 1K7YA 3BIOA 5CR9A 2IUEA 2ZTMA 3OC0A 1O4WA 4W5RA 1KH2A 3UAVA 3N2GA 3HWWA 5I45A 2ZYAA 3SVTA 4BUCA 2GOYA 1XKQA 2JJ2D 3KYDB 3NAZA 5CLJA 4FXOA 4DWVA 4H27A 5JZVA 3W9YA 1COWA 2WB1P 3R9KA 3DNFA 4KJXA 1PF7E 2C00A 4YRSA 1JHPA 1OD6A 3P5BA 4L4ZA 2ADMA 4MS4A 5E2IA 5EIEA 1NXWA 5HR5A 3GLFA 1FNNA 4BU0A 3BORA 3P0HA 2PQ2A 3LQKA 3H75A 3LWQB 3IFSA 3SE0A 4E70A 3JASB 2X76A 3C39A 3V4RA 1GTMA 1NP7A 4S2EA 1DT3A 4D0LB 3AY7A 3VDMA 5H68A 3U26A 4IYRA 4F5DA 5JROA 4HPJB 2YZKA 2W6NA 2PH3A 1R18A 1Y48E 1B1AA 2EEPA 3PFHA 5DHQA 3I5AA 2XEDA 4RHYA 5E9QA 3AVWA 2OECA 1VXOA 3NB0A 3V33A 5J4HA 3AUAA 2WSIA 3OUUA 3HDTA 1DNPA 3Q2IA 3TLEA 3UGQA 2YIJA 2ZJYA 1XQWA 3NCHA 1C0LA 5CFNA 3GP8A 3CX8A 4V2UA 2BGGA 2EWVA 4E6PA 1S01A 1IRIA 4I6JA 4Q4DA 3AHFA 2G72A 1Z26A 3MTEA 3PUHA 4R9VA 4RFLA 3RVSA 3K6SB 4ER6A 3EPLA 1NM5C 1OIVA 1QDUA 1G5IA 2A1TR 2ID4A 4JLMA 3GXOA 4R8RA 3WL4A 4FQ7A 1XZQA 3V8NA 2Q3FA 2Q8NA 1I3NA 3VUEA 1QOZA 4C7MA 4IXDA 4D9NA 2HH9A 3H86A 1XEXB 2ZB4A 3AR7A 3D1JA 2CLLB 4BE9A 2E6KA 3CRW1 7REQA 3VYUB 2JIPA 1P0CA 3FGPA 3PJGA 1JH9A 5GAGc 3MW8A 4PSUA 3WGZA 2JFOA 4NS4A 4LYEA 2ZP1A 5K3AA 4E21A 3ZS9A 4NYJR 1I5RA 1YUMA 1R0SA 1P17A 3KJGA 3WS7A 4DV4B 4AQ7A 1BSVA 1IZ8A 4LXXA 3BL8A 3L9XA 2W6JA 3V8BA 4YPOA 2NU7B 4FC7A 3D6MA 4OBXA 1FDIA 4PYKA 1Q11A 2PSMC 4E4TA 2XKKA 1O5TA 4UZEA 3KOUA 1V45E 3INRA 1RRMA 5F1PA 3V48A 2E5LB 1N6HA 2B6HA 4F1KA 2QK4A 1EWTA 1NBWB 2I76A 2H2GA 3GTKL 5ADUS 4QO8A 3PFNA 2FR8C 2VUHB 3VAAA 2Z1DA 4BUJA 4MRMA 4OK6A 1T4CB 1ISIA 4D0GA 3AL0C 1Q3HA 4TYPA 4IV8A 4O4IB 1VE3A 2VSNA 1TVMA 2A3RA 1QTQA 5KQRA 2GYUA 4YRPA 3WNVA 3UT0A 3KYCA 2FSVA 2AG8A 3GNSA 4IYJA 2AUSB 1J8QA 3RKRA 2PJDA 2ZJZA 1G20B 2C9BA 4FFOA 1EDEA 4LSWA 2I33A 5KTMA 3INTA 2I4NA 3IDAA 1DUIA 4TM8A 4E5PA 1A9RA 4IVQA 2F1HA 2CKMA 2A68D 1R9MA 3AF2A 3MERA 3LK7A 2VJKA 4MAMA 3I1YA 5J63A 3SDZA 2VZ9A 2OFFA 4D9IA 4DIMA 1A9QA 4ZGBA 3L5KA 1OC4A 5EJ9A 3I58A 4S12A 3ROTA 4RULA 5GMOA 3HCCA 4PW0A 4CG2A 4UXHA 5AH0A 2GCGA 1TUEA 2VYNA 3DWEX 4J2TA 5KTNA 2IP1A 3C4JA 5LYJF 3B38A 5FWYA 1DOZA 1H6DA 4DLVA 4WTOA 4D0RA 4PHHA 2I67A 2VDRB 3NTVA 4YV0A 5I7WA 4KV7A 3WK8A 1HM5A 4KOEC 5EZSA 3U3OA 3WLTA 5A9SB 3K0CC 5ESDA 2XODA 2PT7A 3NHKA 1O97D 3QHAA 4ZRMA 1DQZA 5JWOA 3IUYA 5GAJA 2DQKA 1VMAA 3M4OL 5DNUA 3HADA 5AM1A 3LDGA 2ZI6A 4S0XA 1G60A 3OQMA 1YS6A 3KKLA 2DFVA 3O8LA 4WHMA 5DYYA 2NMVA 2ACKA 3J7Z1 1TQ4A 2GS9A 3KLBA 5CFPA 4M7PA 4R98A 1X8KA 1XGKA 3DZHA 4RD0A 2D4HA 2XV1A 5KYWB 3PLNA 3GI1A 3S15L 3DW1X 4KX5A 2IU3A 3D1VA 4PYIA 4KXMA 3S55A 3ITKA 4DSTA 1RYMA 3RUDA 1T36A 2FNAA 5FOSA 4DWOA 1AX9A 4TKVA 5L95A 3IEVA 4BUZA 3OJLA 5ARDA 2HLDA 5A2GA 3AHEA 1R1DA 4FZVA 5I7VA 3N76A 1DV2A 2JIMA 4FYVA 2VHUA 1PR4A 1FQJA 2QTVB 3W5HA 4EQZA 5E4FA 3ECCA 5CHEA 2PFSA 2RCYA 2ZRMA 4MAAA 1WABA 4O1IA 3ELDA 5BNTA 4PANA 3KJHA 1T10A 2QJFA 4ZT2A 2W43A 3O4RA 2QL7A 2Q6KA 4BNYA 5JH7A 3HO1A 4FFLA 3O4VA 1UKCA 3SBEA 3EULA 1N8TA 4KHZA 2AUMA 3N0TA 4HBGA 5H3LA 1L4MA 2ES4A 5JJ5A 4U6SA 5JASA 4HDQB 4C7VA 1H05A 1OJLA 1PG5A 2GN6A 3VHXB 1USKA 4ESOA 1GDTA 2H9IA 2GRAA 1MO4A 4WK2B 4JJ6A 2C78A 2O1WA 3QPDA 3CVXA 4X20B 1QAQA 3SHFA 4ARZA 2WW8A 1Z2OX 4S0ZA 4UE6A 5DIZA 4HZIA 3SEQA 5B7QA 3HXMA 2YY7A 1DQSA 1WE2A 5HKKA 5NLLA 3ER6A 4WN9B 4DR5B 1OX4B 1U65A 3IP9A 3ML1A 1E2EA 2W8ZA 5CVCA 1G8AA 3LH5A 4ZWNA 2XRMA 1WLYA 2QLTA 2V54A 4XEHA 5CT9A 4C78A 4D3ZA 4AFNA 5CEJA 5DM70 1G8PA 1R66A 4UM9B 1VHTA 3LCCA 4G25A 4WCFB 1IU5A 1ZR2A 3II6X 1KYZA 3PT5A 4BVJA 5BSHA 3Q8MA 2E3JA 2AQIA 1HTWA 4QARA 3V7UA 3OM9A 5IC6A 5JARA 2QPOA 1A98A 3Q3HA 5T8KA 1SHUX 3ZHSA 5IF3A 4M1WA 1I0ZA 3WDKA 4AVYA 1GFWA 1S1MA 3T52A 3TD2A 2FMFA 3TXAA 5CAEB 1IN7A 4N8DA 5BN5A 4XIJA 2DR2A 4CF6A 3SK0A 4W5WA 1YA4A 1BJRE 1ZN7A 2IVZA 1UAAA 3D8NA 1BS2A 2XGSA 4I5DA 1A7AA 2XMDA 2ZRLA 2H00A 2PAFA 2Q1UA 3A36A 5E1DA 2GX6A 4Y7NL 1WNFA 2YS7A 5G1NA 1V43A 4L3WA 5AW9A 3DHYA 4L28A 3PCTA 4Z9AA 1M10A 2JLSA 3IMCA 2JGAA 3OSZA 3EZYA 4A16A 1KFJB 1EGAA 4DQUA 2V7BA 4WZAE 3VSCA 3CRRA 1YT5A 3OETA 4F5ZA 4CQJA 2CNLA 2OILA 2QMYA 4KQIA 1C30B 2BFPA 3TFQA 1JAIA 2A78A 3K9CA 3FCUB 4HUQB 3VYRB 1L4EA 5B30A 1EDZA 1YWGO 4I0WB 4MEJA 1QGYA 3MJFA 1F4LA 4Z0HO 4ALLA 1O0BA 5SY4A 1BCRA 5ED4A 5GGXA 4E09A 2O2DA 2H1RA 3Q7PA 2C8KA 2I2XB 2J4CA 2V3BB 1G0NA 2JGKA 4G9BA 4RDCA 4XLTA 5ALPA 1NW6A 2FPGA 5BUQA 1JIVA 4N9WA 4D5GA 1JB1A 1E66A 5DASA 3ELYA 1JJIA 4DT1A 3V42A 1E9BA 3EPHA 5TS2A 1WP4A 5KQLA 4F2DA 1OT3A 3I6ZA 3O83A 2BZGA 3IOMA 2HMAA 2WKPA 4LRSB 5KYGA 2FDRA 2NYVA 1YRYE 3M4JA 4RMJA 3PEYA 3OO0A 3MINA 1KPIA 3TVTA 2ZJBA 5BV1A 5EHIA 1AUQA 3Q0TA 4RKYA 2A6PA 4GP9A 2QYHA 2VJOA 3FUXA 4L9SA 1PZFA 4PZZA 2O8FB 4ZDKA 4X93A 1GEEA 5ARBA 1L7EA 3K0BA 4ML3A 3NVDA 1V7QA 2JIOA 5KVSA 3FPHA 1O97C 1O9GA 4RE6A 4F2GA 2HSJA 4CMIA 2OFOA 2O07A 4XUGB 3AVUA 3V32A 1J1IA 5KI6A 3CSSA 2QQEA 1EFVB 2DFKB 4CIBA 2W7TA 3E9NA 2BELA 2A58A 1QRDA 3A4NA 3BD7A 2H63A 1MP0A 1SKBA 2ZJ8A 3D5EA 4X94A 2ODTX 5EWJB 3QVXA 4EHDA 2VRCA 1G16A 3T38A 4AKSA 5F21A 3BWXA 3QFCA 3FZQA 4C5BA 4MI6A 1UPXA 4LF5B 4R0MA 3UN1A 2WTUA 1RZ3A 4HYQA 4V0ME 1HK7A 4IH1A 2GYWA 3C8MA 1BZYA 4KXXA 4KU4A 1ZRSA 3H8VA 4FQ8A 4YCAA 5I9NA 1ZJJA 1CP3A 2AN5A 3JPYA 4QGBA 4QHYA 3WJ2A 4B8YA 3ADPA 1WA5A 3ZG6A 1W5FA 5MN6A 2DQYA 2ZREA 4CDRA 4IXTA 4X00A 2R44A 2RONA 3GTGL 1JDTA 1KAHA 3I4LA 1DQRA 1GNTA 4LF9B 1FP4B 2HJSA 1C7FA 3H97A 2EW1A 2V0NA 3JASA 4I8DA 4QLBA 3TZEA 1QVWA 3FHLA 3EOBI 1K6EA 4IHQA 2P0YA 2C9CA 4O2AF 3SXUB 4A0QA 4LBYA 2GHRA 3BQ9A 3RT7A 4NV3A 4ZN1B 3DXFA 3EHDA 4D25A 2F64A 3PU6A 1R64A 4HDRA 5ALRA 2ZUFA 3ZXYA 1NNI1 3HCPA 1ZD8A 1DC6A 4K88A 5KYKA 3IXLA 2FETA 3E1KA 3PNSA 2JK1A 3WHKA 2Q2QA 1M2WA 3AIKA 5C8DA 4YAOA 2M1ZA 4HUJA 2CXPA 2K6GA 3UHFA 1ZGJA 4G4IA 3ZN2A 3OQIA 3IUQA 5FO0A 2CVFA 4DV7B 3KQOA 5DE3A 5EL0A 4X8LA 1L3CA 4XM1A 2ZZMA 1KXZA 1RBZA 1Q0QA 2Z1MA 1CQJB 4P4SB 4RA6B 2PK3A 2Q21A 2BFBA 2WJJA 4X6AL 3VR5D 3EVFA 4ZOQI 1AXGA 1TDJA 1VMDA 2W0MA 5EESA 3RZOL 1T8YA 4L6AA 2I62A 4A0HA 4G6ZA 3NTUA 3TNYA 3C6BA 1E9VA 2ORWA 3MOIA 5CIWA 2H5EA 3IAS6 2YJ4A 4CM5A 5I9MA 1I1NA 2Z2YA 4R2WA 4DDVA 2Z04A 1WUHS 4QVKA 5KC8A 5LMZA 1JU3A 4MW1A 1CUAA 2ZBRA 3IT3A 1PJ8A 1P3DA 1EK2A 4JUAA 2FR1A 3QVJA 5EUBA 3QFFA 4Q3OA 3KBOA 1F2TA 1KK1A 2WD7A 4CQMA 3DLBA 4Y6GB 3M3PA 4BOYA 5LQAA 4P34A 1V1RA 3LPNA 3SC6A 4N0DA 2PH1A 4GUDA 1SKQA 2BZ1A 4OHBA 5AK3A 3O2QB 4L0MA 3NZEA 4KH0A 1GL7A 4Q34A 1XQ1A 3WGIA 1NNSA 1X42A 1Z2NX 3V80A 3HRHA 1OWNA 3KXDA 1A8QA 3OZVA 4RYLA 3OLZA 4NI5A 1RKVA 3NYRA 1T2EA 2WKRA 3A7EA 2FPKA 1LPOA 2GD6A 2VJBA 3PI7A 4JI5B 2VK4A 4II3A 1OZGA 3CEPB 1MC5A 3R5SA 2W6JD 4MA5A 4E3WA 1V41E 2Q9UA 2FLVA 4JJ8A 4M1TA 1OR8A 4U8GA 2P3QA 4XYEA 3GDWA 5CDYA 4QQ8A 3WFJA 4Q1EA 2JI1A 4GDFA 5B2FA 4FDMA 4NENB 4JYBA 1OXXK 2I7DA 5ES3A 1N2EA 4K40A 3E7FA 2JLQA 3GDOA 5HA5A 3R5FA 3P27A 1E2PA 2O8BB 5IFKA 4I55B 2FPWA 5I9LA 1F06A 2Y05A 5PNTA 1Y8RA 1GGHA 2MINA 1TZJA 3OZIA 4FFWA 4TL7A 4E03A 1GZ6A 5AVKA 2C7RA 4JBWA 3LZDA 2JFXA 1Q0PA 4UUOA 1U6JA 4XGKA 1B2RA 3OP1A 4HNGA 4US1R 3OO1A 3BDVA 2OM2A 5DZSA 1YHZA 5F2OA 2ZEJA 2PKXA 5HSGA 3A6FA 3S81A 1NG9A 4C43A 1U02A 4MNTA 3PI6A 1XTKA 1UK9A 5ICSA 3TJZA 3A9TA 2CHUA 2JIBA 1UMCB 4GM4A 4PS0A 1WOYA 1JIXA 4N49A 1D5CA 1ZO8A 2Y0PA 4D92A 2I6FA 1NXPA 3RZ6A 1YNSA 3T5TA 1KP3A 1K7SN 2D5IA 2JAUA 3D8TA 4B4VA 4MGYR 1MENA 1V16A 2HL6A 3L0OA 1SCAA 2W0SA 4DEYA 3SI7A 1RBYA 5K3EA 1FP1D 4EATA 2HPVA 3D5TA 4GUAA 1PK8A 2R5FA 2ZTUA 4EYSA 3IILA 2HFKA 1DHRA 3GDHA 2FGJA 1RADA 5K2MA 4WACA 3L7NA 3CSUA 2PSSA 1H5UA 4OLAA 3TQIA 2EF0A 3UEOA 2YN0A 3B51X 4ZYYA 1KEVA 1JZSA 4X7BA 5EFOA 4JD5A 3VTAA 2UUPA 4YTEA 1IY8A 4RQUA 3K6SA 3MFYA 3IQEA 1NW3A 2PJRA 4YHHB 3K2QA 4D4KA 4RPHA 3LFUA 5CX1B 3STHA 3M6FA 3ZCUA 1R0CA 4C14A 4YJGB 4N7JA 4DR4B 2ECPA 3AV0B 5I6DA 3UANA 2R751 3QPBA 4C08A 1JIUA 1NE7A 1VZ2A 3ELUA 4JBHA 3BF7A 1R0ZA 2DQZA 3BHJA 3AIIA 1HEIA 2WF7A 4I81A 2ZUBA 4O5AA 1P8JA 4O3FA 2NLOA 8OHMA 2CDAA 3V4SA 4KQ6A 3T7AA 2E4WA 2VSOA 3TD6A 1W5TA 3RQIA 1SPXA 3M2PA 1K8ZB 2XTMA 3PD1A 1F4PA 3JQDA 1A9XB 4CLOA 3HFRA 1GAQA 1X7XA 2W6CX 3SJZA 2PGDA 2PR7A 3D7NA 3TGWA 1MRSA 2J0UA 3ZEAA 3NETA 4F4JA 2JI3A 3GLSA 4CL8A 1QYRA 1G64A 1BMTA 3RC7A 1WNTA 1W44A 3SC2A 5AVSA 1XTIA 4X1YA 3WB0A 5BOSB 3ICQB 1IDN1 2YFYA 3SSOA 3GLRA 2NO6A 4ZT7A 3DMDA 1I7PA 3MPOA 4YO7A 4RA6A 1ZD3A 4GVPA 4P7FA 3ZWMA 3L0SA 1YRWA 1Q20A 2BMVA 2EZ8A 2CYAA 2FOXA 3FBGA 3HJBA 2XKAA 3JQRA 1N6RA 6PFKA 4M4SA 4XQ0A 3BH7A 4R1NA 1NSTA 1E7SA 2QA5A 1TYBE 5IVDA 4I8XA 4EHAA 1H4TA 3K35A 1XD8A 2N0SA 2ZQZA 2ZVQX 3NDJA 2JJ1A 2W2VA 5HF5A 5K0NA 1W9MA 2ZB2A 1T9CA 2ONZA 3D3WB 3ZI7A 1OI7A 4HMPA 1JSXA 1U2GC 4EUHA 2Q6TA 3A6KA 1EVZA 4YHBA 2B99A 1X8JA 3B82A 4Q9IA 1LEHA 2FN3A 4Y1GA 4BEVA 1Q0UA 1RPZA 4EPYA 5JSYA 3SVLA 2GB4A 4XTRA 3O4FA 4B35A 1WWKA 2XDQA 2BE9A 1JEEA 4QQRA 2G28A 2QQ5A 2IYWA 4ZVSA 4IM7A 5L3ZA 3BERA 2BDEA 2ZSJA 1H93A 1BDBA 2QLBA 1U1IA 3F78A 4L4XA 1DJNA 1A7JA 4RGQA 5C4IA 1ZESA 2PJZA 4WMLA 4X20A 4ARZB 4GVXA 4EHIA 2VNSA 1S8NA 3IMGA 3BA6A 1YJXA 4POAA 1PTKA 3CZQA 2YBDA 4M21A 1FUKA 3S8EA 2P6OA 2E1RA 3SBOA 4AO7A 1PKEA 2HF9A 4O0MA 2GI4A 2JFPA 4NBRA 5LMUB 1W47A 2ZRAA 2WU8A 4FLFA 1CJSA 1QGED 1Z0IA 3CNNA 1ZONA 2EV9A 4P84A 5IN5A 5AOVA 3RVKA 1K66A 3VOBA 4QKQA 3UMYA 1SNYA 2P9FA 1S2GA 1VE1A 1W34A 1XKXA 4JA0A 3BRWA 4WJLA 3DV9A 2EZUA 4UTVA 2YX1A 2WSLA 1TM5E 2Q6LA 4DA7A 3SX0A 3QMMA 2R48A 1HFKA 3FLBA 3L0ZA 1CUVA 1U2EA 1WCXA 2VPZA 1AG9A 2HK9A 3CZMA 1V8DA 2Z0MA 3L79A 3A3YA 2DPGA 2BGTA 1QGUA 4MINA 3ZWBA 5C52B 4YN3A 3CB2A 5IX8A 2JC3A 2IS1A 3QITA 1X0XA 1XEXA 2HA6A 1RWDA 2K2DA 2BEVB 2J8ZA 1I2AA 2JGNA 3CUTA 2I1LA 3QUAA 4DG8A 2GM4A 3IHKA 4Z8XA 5F78A 5HK9A 2ZR7A 2HLHA 1W76A 6LDHA 3BEOA 1YJCA 3ZDRA 2HSDA 3N0VA 2WJ6A 3A27A 3C74A 3FLMA 3HR8A 4X8OA 5AI5A 4XAQA 1XWFA 5KSZA 1SUIA 1EX9A 3N07A 4V02A 4AI2A 1VKJA 3OJOA 2XOKD 1K08A 1JA0A 3KZCA 4MYDA 1XKTA 2FF7A 4DZRA 3CH4B 5HBRA 2XGGA 4DNQA 4D3FA 3LQ2A 1LPBB 5FEMA 3GCDA 3RHTA 3I0ZA 5AKKA 4BPBA 1KP2A 1AU9A 5DHAA 4L7VA 4M55A 2WUVA 4MMZB 4ASUA 1ZICA 2GEVA 4MV9A 3ZGVA 1MIOA 3OU7A 1DBVO 4GYKA 4AYBP 1OIWA 4P4NA 1N3LA 1QIJA 1LQ2A 4DSUA 4HZUB 2XYQA 3BFPA 1SOWA 4I19A 2EYUA 1TGYA 3DKRA 3PB3A 4AS1A 1N0UA 4EDFA 4CF7A 5JMOA 1GFSA 2UVPB 3B7WA 4RHCA 2J3MA 2H8KA 2AUNA 1EGVB 2Q1XA 4Q1FA 3EZ9A 5LA6B 4JVOA 3SIXA 4BWYA 1OHHD 5G0VA 4CDGA 4CTNA 3Q8LA 2ECKA 1ZKDA 1J97A 4KN9S 1SFOL 2VWGA 4GOKA 4OP1A 1L5OA 2EBUA 5ETJA 4MPPA 4MPJA 3P94A 1R0BA 3SKYA 5HJ2A 2XD9A 2IBSA 3WC4A 4BVGA 3E22B 4MDFA 1ENYA 3ETNA 4FOLA 3BTUA 4BN5A 3OFSA 1CT9A 1T3TA 4IKOA 2EFEB 3JSAA 1RWWA 2E1PA 4Y6RA 4JJ4A 4FMCF 4Y30A 1KY5A 2O57A 1XTUA 5ELMA 1CR4A 4NNPA 4GZMA 4DE5A 4ER5A 3SXJA 4D41A 3O82A 4D43A 3CMCO 1QANA 1WPGA 2GBLA 2OD2A 3AGQA 2B8WA 4WKOA 3S2GA 5DYTA 1A69A 1Z0DA 1U7ZA 1YIAA 2QYOA 2AFVA 2BH2A 3R1IA 3RYHA 1L5ZA 2B7BA 1DAOA 3D4LA 4JLUA 2Y8EA 3AJDA 1UZUA 4JUBA 4BQOA 5A4KA 1JJBA 1YZ3A 2MU1A 3I04M 5KNDA 2Z6AA 3G2KA 1BMFD 4Q03A 3GJ8A 3K9FC 2J33A 1UBJS 3K32A 1Y3AA 5DM0A 2NP7A 2HR1A 5EXEA 1RRPA 4YONB 4YMVA 4PZYA 4EGAA 2CUKA 2VSFA 1W85B 3BD8A 3ZLTA 4DUZB 2FPMA 1EESA 1QYBA 5CVDA 2H06A 3UY4A 1WU8A 1E77A 2WPNA 2HRDA 2JEZA 1E5XA 1JAYA 3AI1A 3P9PA 1QM5A 4ARIA 2P67A 4HWRA 4L4SA 1CJKC 5CT6A 3SF0A 5LQCA 2YQZA 2Z83A 2P5TB 2QTAA 4LRQA 2PLWA 3L1HA 1RAAA 1RWQA 3QWAA 2ZYUX 3GEBA 3QXGA 1LDYA 5D1HA 1Q1BA 2P77A 4DPKA 5I47A 2C9MA 1SRQA 1OBOA 2GZ2A 2WPDA 2C9ZA 3B20A 2R4QA 4HDKA 4D79A 4DRXB 2CZCA 4RM3A 1P0QA 1BW9B 3RQSA 4EMBA 1VI6A 5IARA 4ETWA 2CLIB 5DN9A 3DLCA 3N7TA 3ROQA 3PO2L 3OIUA 2AE1A 1QQ5A 1C9EA 2JIRA 1KSFX 4A8JA 1S24A 1C7IA 1WF3A 3KUCA 2WBLC 4N8SA 4PF1A 1XEWX 2BRUA 3ZXUB 1P7ZA 3DMTA 2XOXA 3PUYA 5K3DA 1A95A 1FFAA 3AFMA 2HEIA 1RACA 3LWBA 3R41A 3QZUA 1MXHA 4L78A 4XCQA 2AOVA 5KYVA 1U2PA 2C9DA 4RY8A 2GXUA 3ZDXB 1M6HA 4R2HA 4PO8A 4HRAA 1ZN9A 3GDFA 3UFXB 4G8BA 4O4HA 4W1RA 2HUPA 1BVHA 5CBKA 2G4CA 3IL2A 3UXHA 4AJKA 1QIKA 1SU6A 3LHIA 5AKXA 3U7QA 4A15A 4M37A 3KQKA 1E2JA 4DF3A 3QV1A 3FKIL 4IDCA 4I4TB 3ZQUA 3NHAA 1X1RA 4YBZA 5FPQA 3T12A 2OGWA 4DJJA 4WDQA 1IHPA 5E7JA 1TECE 3P4XA 3FNRA 5FFNA 5IYCL 3ETDA 1RAHA 4LGCA 4CL2A 4HWKA 4C21A 1T9AA 5AI2A 2W6QA 4E6YA 4LJ4A 1RABA 4OJYA 3LHSA 1N4AA 1M34E 3BQMB 1XD2B 3SIRA 4DCPA 2FE4A 5JFTA 2GFQA 4U5QA 3FPJA 1NASA 3LZCA 1OTHA 3QKRB 4XIIA 1U7HA 3ZBTA 5TNXA 4Z7NB 4GMKA 3RAPR 4F86A 5CH5A 3VOAA 4QATA 4AP6A 5C2JB 3D8HA 1C9KA 3E4DA 4JBGA 1KVSA 3B0AB 2YWGA 3ENKA 2D0DA 3N59A 4MQEA 5LYJA 4EIWA 1KMHB 1LD3A 1E3EA 1VSQA 4ZREA 5G0TA 4FYPA 3HNOA 1E2BA 5TF0A 4P54A 4Q9HA 5BRJA 2WFZA 5JS7A 2W2MA 1F2UA 3UK0A 4HGQA 5JQWA 1I2BA 1FX1A 3AFNA 3BH0A 2AQ8A 3CUWA 3FMIA 4MUBA 2CUNA 4XARA 4B74A 5K3OA 3ADKA 1SJ9A 4AYWA 4PO3X 1V1MB 4A23A 1WMDA 2F3PA 2I9PA 2OD9A 3RVRA 1XVUA 4LV8B 2NV6A 2UZ0A 4KDFA 2P68A 2VRBA 1NW9B 1ODHA 1NMXA 4GNKA 2YN2A 2X0DA 1YVEI 4HTFA 1H69A 3AETA 4LZAA 1YTLA 3SZMA 4BEWA 1R0IA 3A3NA