3PKIA

Human sirt6 crystal structure in complex with adp ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
ADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPAWDGPRVLERALPPLPRPPTPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-6
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pkiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3pkiA01
2UZ1B 5EJ5A 4UTZA 4O8ZA 2H4FA 5MFPA 4QQ8A 1OZGA 1MCZA 1S7GA 2WVAA 2Q28A 4K9MA 2B4YA 2PANA 5K2OA 5K6TA 2Q5OA 4BVFA 1YI0A 4C78A 4HD8A 4IG9A 2NYRA 1J8FA 1M2JA 5MF6A 4MPJA 2H2HA 4BVGA 1M2GA 1U28C 2FWNA 4I5IA 4BUZA 1M2KA 4UUBA 4UU7A 1EFVA 1JSCA 1YNOA 4K9LA 1PI3A 2DJIA 4QPZA 1ZPDA 4IF6A 5MFZA 1YTLA 4R8MA 3PKJA 2JI9A 4ZP1A 2JLCA 1V5EA 3FZNA 4UU8A 3IAEA 4KPUA 2IHTA 2VJYA 3IAFA 1SZCA 5EJ6A 4JD5A 2C31A 2VK4A 4MPRA 1NM5C 3PDHA 4COKA 1HZZC 2IHUA 1YC2A 1Q17A 1U2DC 1POXA 1O96B 5K6RA 4FEEA 2Q27A 2QQGA 4TWIA 2VBGA 5FYQA 4X3PA 1U2GC 2JLAA 2QQFA 2OD2A 1SZDA 2H59A 4RMGA 4BVHA 2JI7A 5K3SA 3EA4A 2FRDC 2W93A 2OORC 1M2NA 2A1UA 4Q9DA 5EJ4A 2OD7A 4RMIA 4Y6QA 4BVBA 3GLTA 4K9KA 3ZG6A 2AG1A 1OZFA 2FSVC 5BWOA 4BV3A 2X7JA 5EJ8A 5DEIA 4JT9A 4BN4A 1M2HA 5EJMA 4GM4A 1YI1A 4QELA 1UPAA 1XLTC 4BN5A 3JR3A 5EJ9A 2FN3A 1OVMA 2H2DA 2H2FA 1V5FA 4GPEA 1Y9DA 4JSRA 4GM1A 3RIGA 4J16C 2PGNA 2EZTA 3D4BA 5D7NA 4UTXA 4C7BA 4MZXA 3JWPA 4UUAA 4RJJA 4JUDX 4MPPA 3D7KA 4KGDA 2UZ1A 2NXWA 2IHVA 1YBHA 2H4HA 4HDAA 1Q6ZA 1T9AA 3OE1A 1MA3A 2WVGA 4K9PA 3K35A 1PVDA 1UPBA 2OO5C 4D5GA 3F6EX 4ZZIA 1T9BA 3ZGVA 4JUBA 3CLRD 2EZ8A 4UTRA 4F56A 4L2IA 4GP9A 2VK8A 4BV2A 1YC5A 4D5EA 2Q5QA 2VK1A 4L3OA 5DGTA 1Q1AA 3EY9A 4RMHA 1T9CA 1OZHA 2Q5JA 4V1CI 3CLSD 4J1TC 1UPCA 4GM0A 2Q29A 4K9QA 5BWLA 4JUAA 4Y6OA 2A1TR 1S5PA 1QPBA 1EFPA 1U31A 5EJ7A 1POWA 4MQ5A 5BWNA 4G1CA 4K9NA 1PTJC 2EZ4A 4JU8A 2JI8A 2PGOA 5FEMA 2JI6A 4RJKA 1PT9A 4RJIA 2JIBA 3HWWA 3RIYA 4IAOA 4TWJA 4V1CA 1E3TA 3GLSA 2VBIA 3FLMA 3ZGOA 1Z8NA 4GG1A 2H2IA 3F6BX 3PKIA 4BVEA 2OD9A 5AHKA 2H2GA 3EYAA 4UTNA 2VBFA 4Y6LA 2Q5LA 1D4OA 3D81A 1PO7A 2EZUA 5MGNA 2HJHA 1N0HA 2H4JA 3CF4G 3E9YA 1O97D 4JT8A 3CLTD 1ICIA 4F4UA 2V3WA 3U3DA 1PYDA 2WVHA 3HWX1 4V1CB 5DGDA 4KXQA 1PNQA 3GLUA 3LQ1A 4JUFA 4JUCA 4X3OA 3FSJX 1YHZA 1V5GA 1T9DA 3GLRA 2FR8C 3CLUD 4UTVA 5IMSA 5EJAA 4FEGA 1BFDA 2EZ9A 4RMJA 1YHYA 1PNOA 2AG0A 4K9OA 4FZ3A 1Q14A 2BRUC 4FVTA 1DJLA 3U31A 4JU9A
chains in the Genus database with same CATH superfamily
4WH0A 4KFSA 5JAMA 1R9NA 4KQFA 3WB9A 2FKAA 4DIBA 4E51A 1J24A 5B3KA 5LXTA 1TTHA 4TN5A 1A7UA 1NDQA 3PC8C 4NH4A 4AX8A 5EI5A 1RWKA 2V8OA 5FFFA 3TLYA 1I7DA 4JI6B 3REQA 5GVSA 4QO7A 1NYLA 2HIAA 5COAA 4H7EA 1WCML 2Q1UA 1W5SA 3SI7A 3UO8B 4A2WA 1YZ3A 3E2MA 5HUQA 3GGDA 1IZ8A 4H15A 4RXMA 2BGUA 1I50L 3KT6A 4GX0A 4WPGA 4JS0A 1N5JA 2FFHA 2HJGA 3BFKA 1QV6A 1SVIA 5B5SA 1M0SA 1MEOA 4LVCA 2HLPA 4IG4A 4UW9A 1ZRSA 4B35A 2VC2B 4U7DA 1CZUA 1GZVA 1C9EA 4N9WA 5BWCA 1U1IA 5ARCA 5GJVC 3V3TA 4KZPA 3VR2A 1HT2E 4BC1A 3X3HA 2WUFA 2WUGA 3FYUB 2XZLA 2FUG1 5AW9A 4G4SP 4DHWA 1DWPA 3CMCO 4M7WA 4MIYA 2AS0A 4NZNA 5ELLA 3UF0A 3HG7A 4B4WA 1VJTA 4PLVA 2FW0A 3HKBB 2OV3A 2X6RA 3ET5A 5COQA 1N0IA 1BE8A 2GO7A 3H1PA 4R84A 5LMCA 3WL6A 4D2IA 4FYYA 3CW8X 4DDUA 2A94A 1IHOA 3M1IA 1YI0A 2TMYA 1KNXA 4ZZ2A 2R79A 5F3DA 1L5HA 4Q4DA 1UQTA 1TLTA 1Q1QA 2Y92A 1JG1A 1JL3A 3B5IA 1C30A 3FMFA 3IP6A 1ST3A 3N0RA 3OZSA 4D7AA 5F23A 2CK3A 2GN2A 3QOWA 2NO6A 5KIAA 5KQMA 1T4CA 4NHOA 2HNBA 2QSJA 3P4XA 5KDLA 4YS6A 2KS6A 4AZWA 2JHGA 5AKLA 5UKDA 4IL5A 1PUXA 1V5WA 3R0ZA 3CWZA 5FBQB 1HFJA 4GAEA 2G7ZA 2V9PA 4P7BA 4GSLA 2HWXA 5ED4A 3VNRA 1JALA 2VWHA 1CFJA 4RLFA 4KYUA 2FFQA 4PPYA 5J47A 1VL5A 4K6KA 4OBWA 5C4JL 1KMNA 2FLVA 4LXHA 4RTRA 5E95A 3FVTA 1UOOA 3T1OA 1GRRA 2B2NA 4EEZA 1C8VB 5K8IA 1ZH2A 2QTTA 1M34E 4X44A 2XT6A 2AF3C 2MWMA 2NAFA 5KYWB 2OUKA 4YUYA 1U7XA 2NZ2A 5JXHA 4LW8A 1YVEI 5A4KA 3D5QA 3BFVA 2QYTA 1UXKA 2B4AA 2EGHA 3BE8A 3NUGA 1V1MA 1DRJA 1A2OA 2VQDA 1HLFA 5SZJA 2NLOA 1K7SN 2H92A 1R6DA 3AM4A 3NONA 3QPVA 4LJLA 5D6OA 3TDNA 2V74B 3HH8A 1EGVB 1EU1A 2BVNA 2P4QA 3D8RA 1FVXA 1KAGA 4JAVC 1IY1A 3DHYA 4UPVA 5DK4A 3RSGA 4ZCMA 5HM6A 1AG9A 4UCQA 3IPCA 4CI0B 3W7BA 1ZS9A 3C3XA 2ZETA 2A14A 2QT1A 5FBWB 3U40A 4BMYA 5I4CA 4PGAA 1ZRHA 3MYRA 4OI1A 2OFOA 4UUNA 4N76A 1TKAA 3E27A 4G86A 3U37A 3M6FA 3Q8WA 3ANTA 4QOIA 2P35A 4RDCA 2JGLA 4HDSB 3Q1LA 4WK2B 3SDZA 3CIFA 4DIOA 4BMDA 4M7OA 5B1YA 1II8B 1Q3KA 2SKDA 1DPFA 3EFHA 4CV2A 2GM9A 4ENUA 5BMVA 3AXSA 1L4GA 3VOTA 1KERA 3ZW7A 4D0GA 2RGUA 3VZCA 4RIEA 2QAGB 1KK0A 2ROQA 4GICA 4MPRA 2B7LA 1NQAO 5TMEA 1N9GB 1KJIA 1H23A 1RWXA 1XN4A 2Y93A 1A4RA 4V0KA 4CR7A 4W1QA 5F3WB 1QHSA 1M1NA 1QWSA 3ND8A 2PT9A 2LTAA 3LNTA 4TSFD 1J22A 4RA9A 2WT9A 1POXA 4EOGA 4K9RA 5CCXA 3LPCA 3O3MB 5TY0A 1QU2A 5IVPA 4YRFA 3U26A 3GB9A 3I58A 1CUVA 1NF3A 3QE2A 3H5TA 4JLAA 2W71A 4MKFA 1KYIA 3B52X 2E5WA 2Q27A 3QVXA 4D4MA 4DQXA 5C8VA 4IDFA 2QZ9A 4CV0A 1OUMA 5IWCA 3L02A 2C7OA 3P4UA 3PHGA 1UBOS 5E3IA 2WB1P 4BDSA 2NU7A 1CNEA 1VHQA 2X8AA 2PS1A 1KAQA 2QF7A 3CXRA 3DLIA 3WR5A 2WUVA 5EZQA 4MS3B 3KR0A 1Q0SA 4BS9A 1TTQB 1N3BA 4ACBA 3OCCA 4YGYA 3I1JA 3BSWA 1T2EA 1VSBA 1NTOA 2JI7A 1PV2A 4K6FA 3VO2A 3RRJA 1EA7A 5JDIC 2HXYA 2G4CA 1FP4A 1HNNA 1MJNA 3VBEA 4G5XA 1XZLA 3WGUA 5HRCA 2CXUA 5JJKA 3SDBA 4MEAA 1JG2A 4WZAA 3LPDA 3C7KA 4Y98A 4KBFA 4FGWA 4LGMA 3D64A 3LY5A 2GJSA 2FG6C 1KYZA 3GJ4A 4F4HA 5EJ4A 1UINA 3NTVA 1DB3A 1YTUA 3O38A 4Z2AA 2D1SA 1JKJB 2QTVA 2YUTA 1VYHA 5A7HA 1YRAA 3SVTA 1RM5A 4ND7A 5DP2A 2LV8A 2PX4A 1XVVA 3GT3A 4TZKA 4CBVA 4AUKA 4BVKA 5CB0A 1Z82A 3RS9A 2O0JA 1Z47A 2PKQO 4S1VA 2XVXA 4IEFB 3OM8A 2GVDC 2PTHA 2Z09A 1M67A 3P7MA 4XD7A 721PA 4YIHA 6AT1A 4DV6B 1SFOL 4MQ4A 4ZARA 3S1AB 4AI2A 3JQCA 3GTOL 4WA7A 1USKA 5JSKA 3O5AA 3HEBA 3R0IA 3FZGA 1M2FA 4W9MC 2X15A 4R4JA 2XUGA 1C9NA 1T5SA 4ZVMA 4IQ4A 5C7OO 5D6NA 1JHVA 1NQUA 5CDHA 3FH0A 1M72A 3HB5X 3W6ZA 5TQVA 4G5QA 4F1KA 3AM3A 3ZWQA 1SFRA 1K2VN 1W44A 2QD5A 2R6HA 3DBOB 4NMLA 3TI7A 2R4UA 5C7YA 1JSZA 1PNTA 2PD3A 4GL2A 1W94A 4YT4A 1KH3A 3LQRA 1NC1A 4NYIR 1UC9A 1HF3A 1YI1A 3I6IA 4UEWA 2C5EA 4MW0A 4B34A 1UBNA 3W5CA 3C97A 1D2HA 4TYYA 1XLTC 3LDGA 4J4TA 1NULA 4CMGA 1CJCA 1RKXA 3MFYA 2JFUA 1CUHA 2LKDA 3A36A 3C6XA 1GSIA 4IMPA 1QG6A 3W5HA 3VPFA 1M6NA 4B3SB 1KJZA 1KJQA 4TVSA 5K09A 1V5FA 4JGGA 4OKIA 3BCUA 4B7XA 1NSYA 1RACA 1RYMA 4FKMA 4O63O 4IHAA 4BU0A 4C4TA 3RZ6A 3C4VA 4U63A 3PD7A 4TGLA 4EG4A 2REQB 3VNSA 1WKBA 4C2UA 4BYMA 1WHSA 2ZGVA 5DXJA 4YRRA 4I66A 4EYGA 4Y6PA 3W4JA 5C46F 2EZTA 2PGNA 2WF9A 4ZWNA 3BMOB 5K2ME 3NHRA 1HMPA 4KX5A 4YRDA 3ZIAA 1HDEA 3LPNA 3MC1A 4UJ3A 4XQEA 4ZI3A 4KPEC 3HA3A 4N0MA 4R6XA 2AMVA 3GCGA 1ISMA 2G28A 1TFUA 2XY4A 3AL3A 4B6OA 5BOSA 1BU5A 4P4UA 5B1HA 3AUSA 1VL8A 3F6PA 3SJBA 3UJCA 4BQEA 1W5FA 1RI5A 2CBZA 2H5JA 1ZCJA 2IODA 3ESXA 1IK6A 4KQ2A 3B89A 2JGEA 4O6VA 5G2OA 1JI3A 4QEKA 1K8RA 1YDWA 1CERA 3EC2A 2RHRA 5CNJA 5A9SA 1G7SA 1IL0A 1T9HA 2CK3D 2G5PA 2VT2A 3L9XA 1AIPA 3D6NB 4HY3A 4MPPA 2AI1A 5I47A 2P30A 1DKQA 3JQFA 2XQVA 2UZ1A 4R40A 4GMFA 3OEHA 3VKWA 2MYUA 3BFJA 3DE6X 2XWJI 2IHVA 2IYUA 4EHKA 5BN5A 2FPKA 2Z3QB 2HRDA 3ZOZA 1BFYA 3RRFA 2PUBA 4L5JA 2XA9A 4DXAA 3HCOA 1QHYA 1U0FA 1DBRA 2OAEA 3W77A 3PT5A 1LZKA 2ODPA 1HMYA 1GEGA 4ND6A 1EDZA 1ZSVA 2OGSA 3IERA 3K0KA 1UWKA 3O3CA 2PCJA 2JFZA 3DWIA 1CEQA 2QX9A 1NYQA 4B33A 5T4EA 4D5GA 3AM5A 2PVCA 3ZWMA 4QUJA 1A96A 4ZQEA 1ZRNA 4PGFA 3ZK8A 3QMMA 1NMSA 1BXRA 4RHFA 4WLOA 3F5DA 4JT4A 2OXIA 3T0GA 1JU4A 3SYNA 1SOAA 3H8SA 4TVKA 3MCAA 5AXCA 1C0KA 3GZTB 3T94A 2P3OA 4U2CA 2DPYA 4UVGA 4OFZA 3KALA 3SKVA 3IVMA 3Q9NA 3I9V6 4JX8A 4LFAB 2BE9A 2QM7A 1XMIA 4YVFA 3I4ML 1AN9A 2V96A 1ABEA 3C6BA 4F7DA 4FD3A 2XBLA 1QU3A 3DNMA 2OB2A 3H1EA 5BP7A 1AKQA 1FLVA 2BM9A 4YX9A 3PWFA 2PKCA 3FFBA 2QYSA 4LXGA 4WUTA 4JGIA 1WXWA 2IGTA 2IVZA 2PH7A 3H0EA 1TF5A 3LFTA 4TSRA 1Z45A 2XADA 4O4JF 2FE1A 4WKBA 1HSZA 4P83A 3C3KA 3PQCA 1U3VA 1XZFA 1QVAA 5BYKA 2FB9A 2ZI7A 3P52A 4KCGA 3RGGA 1PR9A 4DZZA 2Y6VA 1Y6ZA 3FJOA 4QOJA 4HDMA 3IESA 5L7YA 2Q29A 4AJ9A 5ITWA 1JLRA 1K7XB 4PAMA 3DVAA 4IGAA 4ID9A 1GZ3A 3KO8A 4HAWA 5KNBD 4ZQBA 3KE9A 2H1WA 3QI7A 3P9KA 5ADUS 3VGPA 3F6CA 3M5PA 2ZB4A 4A2PA 3W78A 1M6VA 1ILWA 3CLSC 3NTLA 4PS0A 4ZYUA 4FSXA 1PWHA 4ZT7A 3UXEA 2C7GA 1NDUA 5J2UA 4H1VA 1TC1A 4OHPA 2PZ8A 1CF2O 2CLMB 1N1DA 2D7JA 2ZB3A 3U48A 3DOIA 3ICEA 4G5SA 4KSBA 4RJKA 2IYNA 3D6TB 1AC5A 2FW6A 1VIAA 1QR2A 2J48A 4EK9A 2Q7DA 2NYVA 3BZBA 3KV3O 4L85A 4QFDA 1P7VA 4QLAA 4DG9A 6YASA 5JQGB 2I87A 4QASA 3H5WA 3E23A 2VJOA 2O1WA 1R6XA 2OCKA 3PX7A 3SYKA 1RWDA 4B80A 5FNVA 3ZGOA 1N5LA 5G0UA 3BDIA 4HNVA 4NBLA 4DR5B 4LS3A 1K6EA 1LBQA 4B74A 5IAKA 2I91A 1UK7A 2QV0A 3H8VA 3RIEA 3EFEA 2HO4A 2J3EA 1L7RA 3BSSA 5AKYA 4H0NA 3V7WA 3UGJA 3ZKAA 5HWSA 2V5AA 3ANNA 1XMJA 4FW8A 1E3JA 3NT2A 3SC4A 4KXFB 5AHKA 2PMKA 3KR9A 1NFQA 4LJ9A 1JB9A 3QK7A 4L5AA 4MP3A 1DJPA 1MHPA 3TRFA 3TSOA 3PXGA 2X3FA 3RHFA 3CN7A 3R5SA 3IQZA 2DJ5A 5DRTA 3VH2A 3VR6H 3NYRA 1KE2A 3Q2OA 4F5WA 2WQ6A 5C1DA 4PBRA 4XGIA 4CI9A 3X2SA 3CT4A 3R7DA 4BE4A 1TYBE 4ZZ0A 3VJRA 3W9UA 3PQ8A 2JLBA 2WPNA 2JBHA 2BE7A 1E5LA 1ECLA 1V8BA 2J32A 1K75A 1C9YA 4M6WA 2ZJ1A 3FNFA 3LPMA 4MWGA 5HIIA 5KMGA 4I1VA 1P0CA 4NBNA 1QUEA 3OIVA 3OJEA 3QFSA 3R5TA 4GXTA 4AHXA 4MW4A 1K08A 1YVDA 3RAPR 4OSOA 3GMIA 3P9CA 1MAHA 3IDOA 5DH9A 4G0XA 4RXTA 3E61A 1KK2A 4YDRA 3STUA 4KL8S 5I7VA 3HCDA 1TPYA 3MUEA 1GZDA 5G1PA 4Z3OA 2DFKB 2F6RA 3V4ZA 1LBHA 3H0CA 1DQYA 3DONA 4A92A 4BOYA 1R4AA 4W5JA 3LRPA 4JDPA 2CFTA 3FY4A 4FQ7A 3CVVA 1DIBA 2OE2A 2G1JA 4IDQA 4FDTA 3L8CA 4KDFA 3E2IA 1BDJA 4H17A 4C07A 4AWXA 3FPJA 3CN9A 4JKIA 1U3WA 4YQZA 3UZUA 1XA4A 2YIJA 4ISCA 1YDFA 3UMRA 3TB4A 3ZZMA 2YXLA 4BKOA 1XMXA 5KWSA 1N32B 3EDYA 3HA2A 4F92B 2QLFA 1ICEA 1RAFA 5A3JA 1ZI8A 2Z8YA 4QBKA 1HQCA 4EF5A 1UAGA 3I12A 4E2FA 1X15A 4RXNA 3BFXA 3I5MA 1I2MA 1P72A 1TADA 3FSJX 2P41A 1V4BA 2E5LB 3VFDA 2B1RA 1AKWA 2PE5A 4ED9A 3NVKI 1N1EA 4ZVKA 3FYUA 3U3RA 4CODB 5L6LB 3SIWA 4LY9A 5AM1A 4F6LA 1TJ3A 2X8LA 4F3TA 3DT8A 5FOUA 3SU8A 4XARA 1Y80A 3HKBA 2OFXA 2J3LA 5LQCA 3OZEA 3GG9A 4UHDA 4FHFA 3ZEAA 3R3SA 1FVOA 3TZCA 1KF0A 1O87A 5BSEA 1D1SA 2CJPA 3CNNA 3GPCA 4AJ1A 2IW3A 2BH9A 1TIKA 1LJLA 3D4IA 2QTWB 3O4VA 3A4IA 2BGKA 4MA0A 4BNHA 1Z6PA 2GF9A 4CQLB 4DC1A 4UTVA 1KO1A 1LPMA 2EKLA 1SHTX 4QVGA 2AGVA 4HT3B 4RVHA 2EZ9A 3EGVA 3PPIA 2BDTA 3LJKA 4RHEA 2GD2A 2JG3A 1HY3A 3T3PB 1R0LA 1XKQA 4MUXA 3DM5A 4MUAA 5B4VA 2DPGA 2PX3A 3REFA 3AVTA 1R9MA 2NXNA 3HCWA 1PU2A 2QXYA 1DARA 3U9TA 1KVUA 2MU1A 4UM9B 3OJ0A 2FG5A 2COKA 5LQJA 1KEEB 2K2QB 3DEIA 5E1MA 2AVNA 2JAPA 1DPGA 3WIUA 1Z0FA 3BA1A 5CEFA 3QJYA 1KI6B 1UXOA 3EZGA 4Q0MA 4O8ZA 3W9SA 2X0RA 4NCHA 4BNDB 3PUWA 3FVQA 4BBAA 4BNZA 5LJLA 1U1FA 1KAEA 1SOWA 1NF2A 3G79A 5KYWA 3HM2A 4TOIA 1GJRA 2YH2A 3ACCA 1V4NA 3R0QA 4Q7MB 4TKVB 1E3MA 3IOEA 2E4VA 1A69A 5MFPA 1L7XA 4RK0A 1VG1A 1VTKA 2BUAA 3T7IA 4FCTA 1KYTA 2GNOA 1QG4A 3QELB 4NV0A 5AVJA 4ZVOA 3RFCA 3BRWA 5I5GA 3RREA 3UANA 3ZKWB 5JHGB 1RZRA 1OJ7A 1HTTA 1W4LA 1RMTA 1O95C 3LT0A 4A3IL 5K0TA 3O8QB 1CUSA 2B1IA 3ZDQA 5EN4A 4LVUA 1JVNA 2C83A 2VT7A 3GFVA 3UG7A 3ELWA 3G0HA 2C1EA 2Q99A 3A9VA 3E7PA 4RIHA 2ZK7A 3L0PA 5H8WA 1GZSA 2Z0MA 1ZNYA 2ET6A 2F90A 2QD3A 3FLEA 4MS4B 4BVJA 3Q7QA 3V7FA 2DERA 3RVDA 5LR6A 2PANA 1WPXA 3I4LA 1ISIA 3CPSA 1OGYA 1P1RA 4JBXA 5DU2A 4N49A 3WQSB 2I76A 1P9NA 2Q5OA 4ZAWA 3WVNA 4G4GA 5EIOA 1EBUA 3LKZA 4HDCA 2QORA 2A5FA 4U7PB 1FNDA 4S0ZA 5EPUA 1BS2A 3DHVA 2ORYA 3GFFA 5DX8A 4BVFA 1Q0TA 4J75A 4D74A 4QT0A 1F2VA 1NXSA 1J2UA 1K9SA 3IIJA 4DB2A 3BQMB 3IQDB 1P5FA 5IH3A 1G2OA 1JHRA 1NY5A 1RLTA 2HRBA 4JIMA 3AEUB 4XA8A 5HZMA 5JS6A 1N9GA 1LXCA 2F8MA 2MMCA 1C8LA 3L7IA 4UBNA 5IAJA 1SC9A 3T9FA 1M2WA 4MX8A 5K8VA 2DBVO 1V25A 3W6UA 3T3GA 4QBHA 1WXGA 1JW9B 3NAQA 1KPGA 2FSHA 1LV7A 1YIOA 3LC2O 4RPIA 1DC8A 1T0BA 4ZAVA 5H0IA 2E1PA 2PU5A 2A69D 3I8OA 4B9EA 1VA4A 1CJSA 2IIBA 4WKGA 1NE2A 1GU1A 1NF8A 5L8VA 2G4LA 4PLTA 1MMFB 5G02A 4DCUA 4HC4A 4L7QA 1YU9A 3F71A 3JAWB 4JLSA 5IG2A 4GBGA 3JD1A 3O75A 2RG1A 2QM8A 2GLTA 3AG5A 3E9NA 2HT1A 1W59A 2EQ5A 2EWWA 3TLMA 5AVKA 1PP4A 2YN4A 3IBYA 5K0GA 5DLQC 4GU5A 5F3RA 4G4SO 3DE4X 4ZU6X 5DGXA 2X4IA 4MS3A 1M7GA 3J7Y1 2RGAA 1ESZA 1Q0LA 4OIMA 4WCFC 2XMPA 1NN1A 1VRWA 3NWJA 4C0WA 1H2BA 1HV8A 2IHKA 4P84A 2AXQA 3ZBTA 3ZN2A 2HV8A 2HQRA 1Y42X 3I42A 4G84A 1P3JA 5G4LA 1ZA2A 4BLTA 4DM3A 3C4QA 1V5EA 2FH5B 3L1VA 2Q9BA 3JVEA 4LMAA 3B8HA 4IKOA 5DLDA 1B43A 5HRUA 1SULA 4XB2A 1JS1X 1YS4A 4D8XA 3GMTA 1FP2A 1F9EA 2B5ID 3EUFA 3GBVA 4B4OA 3P19A 3IQGX 3FBTA 3GLVA 2C29D 2AN4A 4UXIA 3VZPA 4D8UA 4NCBA 2FFJA 1Q0RA 2OCAA 2QNBA 3BZUA 4QLOA 1O0SA 4KNYA 2X86A 5ILQA 2CKAA 4HRVA 4UVIA 1GLNA 4Q3BA 5HKBA 1FOEB 1XRRA 1E6LA 4ILEA 5EIOC 3S2UA 1E3QA 4OJQA 4L78A 1ZHFA 2PZJA 1PZHA 1MVNA 3UICA 4DA0A 3LKDA 1G3RA 4JCOA 4X65B 2VK4A 2NVWA 1OAKA 2PD4A 1YE5A 3TZQA 2V0NA 5EWMB 4BWGA 4CLOA 2HW8A 4GKBA 1E0JA 2PSJA 3ON5A 4Z99A 4U5QA 2C2GA 3GELA 4MCAA 1E5VA 3S1AA 1M2OA 1E5DA 1JHOA 2QAGC 3L8ZA 1B6SA 1VZIA 3AKCA 1EZ1A 1DUVG 2OC4A 4KXMA 4DLNA 4L6CA 4OFXA 4YCLA 3VHRA 2Q3HA 5EE9A 2VTBB 3KIPA 1E2LA 5CXQA 4KJXA 2IHJA 1SH7A 4FEEA 5TEWA 5AKJA 3KYUA 1Q16A 1WF6A 3RABA 4BE9A 4EG8A 5FWNA 5K0BA 3CVWA 5GJCA 1YB5A 4DMLA 3EGIA 3TGWA 1DG9A 3WMWA 1J0DA 5REQB 3M1AA 2EIXA 3S2FA 3L4JA 1CVRA 1JFFB 3GVHA 4D9CA 2AG6A 1MPXA 1S3GA 4CG1A 3SN6A 3I6BA 2V3CC 2W7TA 3WQBA 4OJKA 5D01A 1H6BA 4ZVPA 2N1BA 1SZDA 1Z5ZA 3A6DA 4FYXA 1O95D 3QSGA 4Q7KA 4CKWB 5JECA 1QDUA 2XJQA 3GGOA 4TS9A 3W5DA 3ZCPA 3WQHA 1GPWB 2YRWA 1NP7A 3W0LB 5JNRA 4UREA 2PYZA 4RD2A 4S3MA 1CNMA 4Q3LA 1VHWA 3WLQA 1YFLA 5IYZF 2REQA 1WVIA 3HB1A 2D4AA 2O7VA 3K3PA 3LCRA 3V34A 4AULA 3AB3A 3S5UA 3AY0A 2QYOA 4LGYA 1ZJ5A 2WY2D 2Q1WA 3L6OO 4PZZA 4Y3UA 3BMOA 2YHBA 4QOFA 4DA9A 4REQB 5D1HA 3I5AA 2Z9DA 5B53A 4TV9F 1QYVA 2APJA 1DMRA 2EFHB 4NDAA 4D8WA 4FFWA 2G8NA 2C03A 3CCCA 4PAWA 4PLGA 4DQVA 3EDCA 1O7JA 2E37A 4QODA 2ETVA 2B9EA 3L8DA 3QTBA 4E21A 3PO3L 2A78A 1EJ6A 1I2AA 4I9UA 1VBMA 3N28A 2YVQA 3SBEA 1ADFA 1D4ZA 4JI2B 5JAQA 1N8KA 3HJTA 4PPGA 2GRAA 1R5OA 3NKVA 1EUDA 1Z2OX 2P2LA 1KZ9A 3A1NA 3RC1A 4EW3A 2P77A 3I1FA 3HDGA 2MSDB 3HADA 1VBKA 4INAA 4QIHA 4Q19A 1KFKB 1OLOA 1B8PA 1NQ5A 3OZAA 4OHKA 3KOWA 4ZN1B 3Q87B 4ZDKA 4Q02A 2WD8A 2JCXA 4AHYA 5BSUA 2VUTA 2JDIA 3HB7A 3UIEA 3KQNA 1YZFA 2YZ7A 2QZZA 3GGJA 4G0PA 4KLCA 3KZKA 1RCUA 2HDNB 4PYIA 3S2EA 4IO0A 1VL6A 3NV9A 4E09A 1WXQA 4KDEA 2Y27A 2INGX 3PCRB 2XB8A 2X4GA 4GRAA 5G1NA 3WK6A 1KZGB 4CGYA 4EARA 1HDGO 1IUNA 1GTMA 1XZAA 1SBNE 1ZQ1A 1JJIA 2V7XA 3K92A 2Q5EA 5EXEA 5HBGA 4DR2B 2ZTUA 4GPEA 5GVRA 1RZRD 4OX9B 3FMGA 3LX5A 2VNKA 2D0DA 1KJWA 3TM5A 4KMOA 3F49S 1OTHA 5H68A 2R7LA 3U6KA 4B44A 5LD2B 1JA1A 3K2EA 3NEYA 2BTOA 4JC8A 2BFNA 1N2SA 3Q0TA 1YUMA 2EARA 2GBPA 3MOIA 1XVIA 1WXEA 3ZY5A 1J8DA 4KH1A 1EIWA 1DHRA 2HU8A 5GONF 4HF7A 2BP7B 2ZS9A 3GNSA 2V6GA 2OSVA 3T9BA 1RIIA 4TL9A 1KARA 4DLTA 1SU4A 2X0IA 1BRTA 3HA5A 5KQRA 1KFEB 2O8VA 3SY8A 3FGOA 1JDNA 4EMBA 1GCGA 1QSGA 1SB8A 3EGEA 5HRAA 3VAAA 3BBPA 4H1WA 3DC7A 3H99A 1YO6A 2C9CA 4RSRA 1NJ6A 1C41A 2VYQA 5T8KC 5DI9A 1IXSB 3ZHTA 3AKYA 3NYWA 2VAPA 3WTBA 4IQ0A 3VX4A 5J58A 4LJ7A 5A3VA 3LTNC 4TKZA 1T8SA 3JQGA 4EB6B 4KAJA 4WLUA 2ZJ8A 3QX3A 4MUJA 4DVJA 3EY4A 4YCAA 1FLAA 1EDEA 4TZ6A 3HB0A 2IYZA 3KUXA 3OT4A 4FE7A 3H75A 4NULA 1O9GA 1ORHA 3A1WA 1X0VA 1WCWA 1HH4A 4BP1A 1XXHB 3DZ8A 4HMOA 2QMUA 3CLTC 4TTJA 1BQ9A 3U3OA 5BN3B 1A9TA 4D9KA 2VJBA 5FP0A 3GFSA 4IPTA 2WWVD 2VEDA 4J91A 5LA6F 2HK9A 4KN5A 2QRZA 1PGJA 4FDLA 4C0HA 5AVQA 5JYDA 1BWQA 2C57A 5JQGA 2IV2X 1DAPA 5KYNA 2R62A 4GF5A 2CNOA 1MC4A 1J1IA 1O94C 1OTXA 2V9CA 2VHWA 2W6ZA 1TGVA 1TUGA 2ZRHA 4LJAA 5DASA 5B7GA 4G0QA 2D5CA 1F1JA 3KJIA 7GPBA 2GETA 1P7ZA 3K7AL 3EDOA 2IH5A 1SUDA 2GB4A 2VK8A 1WMAA 2X4DA 2RFKB 3DOOA 1ZXXA 3R9XB 3FROA 1FMLA 2HC9A 5K0FA 3PDUA 1MG0A 4MUHA 2Q5QA 3A6JA 2NSHA 5I9SA 4RD1A 2YHIB 4D92A 1HE1C 3PNPA 2VK1A 6ABPA 1D0VA 1NUSA 5KSYA 5D3QA 1Z36A 2JIQA 2WD9A 1YWGO 4J9VA 5FPPA 4INJA 1YV9A 5DHPA 4C01A 5TVKA 2M6LA 3JQQA 3UHAA 1JR2A 2PA0A 3QTLA 1VLJA 1M5UA 1QOZA 2I7TA 2PRZA 3ASYA 4B4VA 5HIAA 2HBYA 3M9WA 1ZU5A 1Z08A 1JLLB 3D4LA 4JP5A 3O7MA 4X1IB 2IUYA 2IF2A 3B48A 4I9GA 1J2JA 1CRZA 3KKZA 4GOKA 4B73A 1MZVA 1S3IA 5C5DA 1IFXA 4P31A 3SYTA 1HORA 5F9HA 2ZWMA 3X1DA 4HQNA 3FA2A 3IEPA 4KO1S 5EJ7A 3DLBA 1K63A 3H2ZA 1C80A 3GYGA 4PTYA 3U39A 3UMBA 3PLNA 2JCYA 3TTVA 1YJ5A 2XUQA 1V6SA 2HK8A 3GOQA 3HCPA 3KYYA 3H9QA 1EWYA 1I4OA 3MJCA 5JMOA 3QU7A 2XTZA 5DGHA 2OHGA 3F2IA 3SIPA 4AN1A 2XQKA 4NV1A 1BN6A 2JI6A 2CXSA 3TMKA 3GEMA 1X3SA 3FW1A 4ZT3A 5HF8A 3RVLA 3ZVLA 3HYNA 2ONKA 4JYZA 1UDBA 1P73A 1AXRA 4Q05A 5JW6A 1KVQA 4U6NA 3NCHA 3OZRA 1EA5A 4OHYA 3PQ6A 2AN1A 2Q2OA 4QUDA 2ZS7A 5KDOA 1M7HA 3GLSA 3VHQA 5BWBA 1N5DA 1QRRA 2DYKA 4RUKA 4Y6RA 1EG2A 1GQ2A 3FBWA 4DC0A 3BERA 5E1DA 1UK9A 1L7NA 2V45A 5J4YA 4WE3A 1RI1A 1N25A 5KWEA 2WJHA 1ESMA 4GG1A 2PIAA 2IOQA 1FHHA 1PJAA 1XI2A 1JKMA 4WADA 5CYOA 1MA0A 4QFCA 3QNMA 3WB2A 1ZEJA 5KTSA 4WY8A 4TS4A 4M8NE 1L3CA 1ZLYA 2FTKE 3OUUA 1XYGA 2RHJA 5KNDA 3U49A 2BYTA 4GI7A 4RQTA 1YA8A 4ZO9A 3KJQA 1A71A 4LF8B 2FRVA 3CZPA 3BGSA 2QGFA 1I6HL 3DQQA 1E2MA 2BCJQ 3DEAA 4WZZA 5KJCA 2JGNA 4M1MA 4PZ9A 4XCVA 1ZISA 4QDOA 3QVMA 2DBZA 3CJTA 1TXGA 1GZHB 4I9NA 2VNSA 4L4XA 2FR8A 3OF5A 3RAGA 5GIPE 4MUFA 2R1VB 1R7RA 2UYYA 2K5UA 2OHHA 1RWNA 1TJPB 2O7NA 3BJMA 4ZPXA 2D13A 1Z2PX 4ROTA 5FLKA 5BRNA 4CQLA 1G38A 4JOBA 5IAOA 1U2EA 1DVBA 1ACMA 3HR4A 4IVNA 1SQ5A 4UBOA 1IDOA 4IXDA 4ZT4A 1YR9A 3WRXC 3QHAA 2BDEA 2Y1LA 1J8QA 4LZAA 5LUAA 3FRIA 1CUBA 1OKKD 1JHDA 3E03A 3CLTD 4MLCA 1Z6TA 1ICIA 5LBUA 3TS1A 4EVRA 5THXA 1DP4A 2W2QA 4F4CA 5C52B 2O5EA 1QQBA 1FFCA 2XCQA 4HGYA 5D7BA 1KRHA 2FEXA 2JDID 1KEEA 3K09A 3OM1A 4ZAFA 5JR3A 5DM61 3MQ2A 3GFRA 3HN7A 4CG3A 5JU6A 1IZYA 4BNDA 1PQUA 2HRCA 4OHCA 5FUYA 4D6PA 1O94D 3IQIX 4R68A 4V1CB 2QLNA 3PFNA 3CKYA 3C6MA 3GEPA 1PJRA 2NU6B 3ASVA 4V0LA 5K3DA 2C5SA 4GZ5A 4ZOAA 4AO6A 2GJKA 1LX7A 4PAQA 1JT2A 4DMGA 1CLUA 4C7JA 4J94A 2ON6A 3QELA 4G6BA 2B2XA 3TLEA 3ZKWA 3NEPX 4DG5A 2WIAA 2XEXA 1OH5A 3C2QA 2PUHA 2W2MA 4PIPA 2FUKA 4LKOA 3O8QA 1TMYA 4ZC8A 3U7RA 4A26A 2EP5A 3KVVA 3HI4A 3JZIA 3HWSA 3PS9A 4RMHA 2Y4OA 1QIMA 2ZIVB 3MLEA 4EY6A 3PC2A 3QUTA 1CZKA 1WSDA 4U02A 3V4LA 2ZUSA 1PR4A 2V7QA 4QVKA 4BO0A 2OILA 3I34X 1T91A 1GKLA 2RIPA 4ISBA 1PUIA 4XD2A 5ILGA 2UYOA 4XR4A 5JISA 3C87A 3NEJA 4J9UE 3BGIA 3HUUA 1ZD2P 1ZJ6A 3TLXA 2C96A 5JTUA 3ETCA 3R9IA 3LL4A 3WGJA 4XDYA 5HPYB 1YFJA 1PUJA 4UDYX 1UFRA 2D59A 2FR8C 2Z9BA 4JWKA 4E22A 2OV6A 3H19A 5CT9A 4D8TA 3NBQA 2G08A 3CH5A 1TGYA 4NYJQ 3AERB 3TLJA 4QU5A 4A8PA 1QCVA 1QNFA 2EBWA 2BF7A 3DMGA 1GT91 5ALYA 4DBLC 3F5FA 1XC7A 3AEUA 4EMUA 1RPZA 4FEYA 3TOXA 3MOSA 3FSGA 5LB2A 4KXXA 2AJLI 1NVVR 2IITA 1K6XA 1UPXA 3T7JA 3D9QX 1MAUA 2EJVA 3I9V1 2B9VA 1V8OA 3E3OA 3OO1A 4GMDA 3WGTA 2Z6UA 1QP4A 5EMMA 1ZJ4A 4MDHA 2HV9A 1ULZA 4LWQA 3OU2A 2OM6A 4JXKA 3ROEA 5C1PA 2E4YA 3DKKA 1VCNA 1T9ZA 3K09C 4AF7A 4B7CA 4F9EA 4LX8A 5EJ5A 4UOQA 5KNLA 1ZM3A 3JAWA 4DEYA 4DIUA 2R8XA 4GLLA 5C8XA 3QX8A 3WWCA 3KB2A 2XB2A 3DOHA 2I78A 4N7JA 2XF2A 2A2ZA 5LZ2A 3ZZ1A 1JAZA 2WU3A 3GOHA 4J1NA 3AJ8A 1T0PA 4N82A 2HYIC 4OHOA 4CT4B 3FE2A 1U9YA 4NNJA 3DQPA 2X9QA 3LXUX 4N9QA 4MAFA 4ZV9A 1OT3A 1SCBA 4MYHA 4OCZA 5DBFA 4CTMA 1MNAA 3A58B 1XQVA 1T5TA 2BJWA 5FL7A 2OAGA 4ZVLA 1E0AA 5TNXA 5INTA 1ECJA 1XL0A 5TVGA 2HF9A 2ZULA 3O90A 4BCBA 4UNRA 3GJSA 5ALNA 4ZZ3A 3FKJA 2B4YA 1QVRA 3EZYA 4N7RA 2OWDA 4KN6A 2VAMA 5FBKA 5T3UA 3SHOA 2HWYA 1Z0IA 4IV5A 4FU0A 4Y6SA 4XVRA 2Y71A 1QFXA 5IC5A 3LXMA 4FPXA 4LRWA 1PG2A 5BW8A 1IAQA 3FUWA 1RKUA 5EGNA 1G55A 2Y8EA 3G8DA 4UJ5A 4XPZA 4EHAA 2YOGA 5K8LA 5M04A 2O2SA 3ZZ0A 2ID7A 1WDWB 1ZJJA 1IW7D 4AS3A 4Z4GA 5EWMA 4WN3A 5EERA 1NWHA 1J8FA 4NE9A 1KXJA 2BKXA 1SEPA 1U8YA 4Q1BA 4P98A 2D6FA 4H7IA 3P0HA 5MF6A 3MSCA 3T3DA 4RKRA 2D5LA 1OBVA 4AQ7A 5F73A 2Q3LA 3I72A 2OM2A 4JJAA 1I0IA 1DXOA 1X92A 3N0TA 3ZY6A 4I4LA 3HCEA 3O4RA 2QI9F 4LRTB 4X20A 2VTBA 1Y1LA 4LG1A 1OFUX 4R8RA 1FYVA 2UZIR 1H94A 4CTNA 5KQSA 4GX1A 2GN0A 1RXVA 1H42A 1XDZA 2XUFA 3VKVA 4B87A 3I39X 4PNEA 2XJ4A 2CF6A 2YWGA 1DWUA 4PXSA 5REQA 2WHPA 3VJMA 5AXBA 1JFFA 4OQZA 4L1KA 4MW9A 2M98A 2IS1A 2WFMA 1HLPA 2ZPAA 3O1HB 4KIGA 4ALNA 3RS0A 3K32A 5CX4A 5AK6A 3Q9LA 1C3EA 4LHXA 4GYJA 1ZVVA 4B6EA 4IYRA 4ZP1A 4YYEA 1NVFA 2G72A 2Z4RA 4Q9AA 2WMDA 1DXYA 3K0AB 4JNKA 3L4SO 1XRNA 4BNUA 1UPUA 5KNDD 5AESA 2I8LA 4PU0A 1BOOA 3WJ2A 2YCBA 5EZYF 2JCGA 2E48A 2FYTA 2A9FA 5EE3A 4RF5A 2TMKA 3HRIA 1TW2A 3MBIA 4REQA 3WFZA 2PUVA 1PZFA 1VHTA 5I9NA 3EIHA 2G40A 3EDRA 5C34B 3WNCA 2AXPA 3TMYA 4NMXB 3VNQA 1VMKA 1A27A 1PTJA 1NVBA 3SJZA 4RJTA 1LBEA 1U7WA 1VRVA 3QOYA 4WMLA 1VMDA 5DTJA 3ENNA 3C6ZA 2JNWA 3DVLA 2HDOA 1XQ6A 3R20A 1H0RA 5HZGA 2EHJA 1X86B 5AUQA 3AL0C 2ODTX 3DUWA 5JAZA 3PDHA 3ORQA 2XMZA 4YROA 1N3IA 4WXRA 1I51A 1BROA 4L57A 1QK4A 4KXNA 3DZBA 4NF2A 1X1QA 1KYQA 4AF6A 2P7IA 2GT1A 3DZIA 4I1UA 4EGCB 1V2GA 4JOCA 4UM9D 2AW5A 4G0MA 2OG1A 4IF4A 3HOVL 3RJ9A 2HHHB 4HNQA 2PS0A 3WA6A 1SVOA 1MDFA 2X5NA 5TXGA 3DCJA 1TO1E 5K0JA 3G2NA 2JAWA 4TWIA 4C4PA 4CMIB 2GYWA 4QGHA 1KHHA 1OWMA 3H6HA 4AJHA 4F4DA 1QYWA 2B8NA 1NXEA 1WCIB 2AD5A 1JQDA 2OCDA 4RV5A 1G1AA 2IKSA 4XUEA 1PSWA 3IUBA 5DYWA 2HHJA 4BRZA 4AG6A 2CLHB 4EQZA 4E4TA 3OTGA 2WTAA 1IDN1 2BGIA 3FTCA 1BMDA 2H59A 2D2XA 2H08A 5AKZA 1UR5A 4ETNA 3CUTA 3E05A 1KXZA 1IY0A 3IDZA 3K9LA 3RU9A 3WQQA 2ZJOA 2VCHA 2IY9A 4HGPA 2PFSA 3ZS8A 4MEJA 4D3ZA 4J0KA 3H17A 1A0OA 3KYDB 3W6NA 5E3HA 3W4KA 2ZE6A 4A8JB 1XMQB 2HO5A 3KVOA 4KPUB 4DNQA 5JBNA 2AT1A 2DQSA 3JWIA 4J6EA 4Q21A 5TGDA 5L3VA 2F64A 3QNWA 2V7QD 1XRQA 3ET4A 2WWWA 4NBRA 2QIOA 2BP7A 4O4HF 4TL7A 4C04A 2G6TA 2O14A 2Q2VA 4ER5A 5JPDA 2QSYA 4Y0NA 3V46A 2DF8A 4XVCA 3BKWA 4AXXA 2IE0A 1ZCBA 3UK0A 3OQ1A 2QW0X 2XI4A 1KZ4A 2NUAB 1Y3CE 2C00A 1DXHA 2O2CA 3H97A 1BX3A 3GLTA 4DXHA 2XCRB 1H3FA 3JASB 1BKYA 3CEPB 3M4YA 1W36B 4ND8B 1QDLB 1PHPA 1JG7A 1W6RA 1WOMA 2HBZA 3CSSA 3OLWA 3P0FA 4NBKA 3X2FA 1ZK4A 5I7WA 1EJBA 1XDDA 4UM7A 1D1TA 4YQFA 1QBGA 5DM2A 2AWOA 8LDHA 1MRZA 2C1ZA 5JI3E 3E8XA 3FSGD 1KYXA 1C81A 5FWYB 3AJEA 3AF0A 3N76A 1D7OA 1R3DA 1Y4SA 1D1QA 2JFHA 3LQ4A 1VJ1A 5ALMA 1RB9A 1RWPA 3ZNQA 9ATCA 2I2FA 5DLPA 3EEIA 2VNIA 2RHLA 3VX3A 2D8MA 1XXHA 3DL7A 5D3MA 2JGAA 5CFNA 5BN3A 1XTBA 1SKMA 2FZCA 3V9AA 2UYQA 2QLMA 3B6EA 1STOA 2JIZA 2MSWA 2BEJA 2QL9A 3DE0X 2VZ9A 4QFMA 1Z5UA 3VYUB 3RYCA 2HEIA 2WAAA 5IZ4A 3UUGA 3AFGA 4QELA 4WL0A 9MHTA 3UWOA 2COUA 3TNLA 5H5JA 3T3HA 2ZI6A 4PXYA 1NJ2A 4HFNA 2YMPA 4MOWA 2Y77A 1ES9A 3SR3A 4L4ZA 3WO1A 2CF5A 2XVMA 1OXXK 3LUDA 2J67A 3R9XA 1OYYA 4RMNA 1NXVA 4WEQA 3HXLA 3SIXA 5I5EA 2I6GA 3FHOA 1JWAB 4C3HL 4HQ0A 2YQ5A 2YHIA 2YS6A 4PSCA 5FL7D 5HFNA 3BM5A 4A6DA 5HIKA 1ODLA 3LWVB 5IP5A 5LD2C 4JC0A 1LDYA 3RIGA 1G2QA 1TEXA 4AI3A 4OQPA 4BU1A 1CY7A 3B38A 2ZUWA 4BB0A 4NPCA 1J1ZA 3OTQA 4YPOA 1I6LA 1FUUA 4OYYA 7RXNA 1U9IC 3DDOA 3FGNA 4I5EA 5L4SA 1YZKA 1L4UA 4GXQA 5ECYA 4X1IA 5L9AA 1JLLA 2HJVA 3SFTA 4IBOA 3I8XA 1W93A 2ZYIA 4AG3A 2JD2A 2Q6IA 4ARAA 3E9CA 4M7PA 3PDCA 1QFJA 2FY8A 5HMLA 2ZCVA 4B9AA 4U2KA 3U13A 3UV6A 1S02A 3ZI4A 3OWHA 3DFMA 1Q2XA 1FX0A 1JT9A 4EHIA 5C5IA 5IYCL 2FZLA 1QIKA 3AVPA 3T7DA 4C6TB 2I7CA 3OQNA 1XALA 1JJVA 2PLFA 2YV3A 3MTAA 1T0JB 3T52A 4CU2A 3H4IA 4LBWA 4RHCA 3W04A 1IBSA 4QECA 3NOQA 3DWFA 1NP6A 3AILA 1PV4A 4NXMB 3DCNA 1VHJA 2VQSA 3E3AA 3L5KA 4PIVA 5HKOA 1Q3HA 2E0IA 3LRXA 2QTGA 2C2MA 5DX0A 3WP1B 5I51A 4GW3A 1JNYA 1VMAA 3PNBA 2P5YA 1Q57A 3MTQA 3T5CA 1RTKA 2GPSA 1E9EA 1NLMA 1T9BA 3OWXA 3UMFA 2B63L 3GP5A 1I3LA 3GUHA 3JW8A 4QX6A 3CLRD 1JLKA 1AQIA 3D8SA 2O54A 3RKRA 1VFNA 1AT1A 2OV2A 2DLDA 2QVCA 3L41A 4K6GA 5EUCA 5GP1A 2GBGA 5FTWA 3D59A 3IOYA 5B2EA 1T8PA 3SFZA 1VKZA 2BBOA 2H3HA 5DSZA 1L8QA 2C7PA 3AX6A 1SBIA 4PYKA 1CS4C 1B0PA 1E60A 1PS0A 4RM2A 3KDAA 2P9GA 3IPXA 3MS2A 3HCBA 3OJOA 4I50B 4KBYA 5EFZA 1L1FA 2CMGA 4TM7A 4W1RA 4XDZA 3WDMA 2Y05A 4EGFA 3GMSA 4MDFA 2HMTA 4UEOA 2W98A 1MJGA 1XA0A 3ADPA 3JQAB 1Z06A 2I2BA 7AT1A 4GC9A 4OF4A 4W5HA 3HCAA 1DX4A 1XZNA 2YN0A 1N5RA 2RGGA 2FEOA 2VUSA 3PZBA 2R5NA 3RJ5A 1QPZA 4DIFA 2WNHA 1UWVA 2C9OA 3CMMA 4UULA 2A5GA 1BMFA 5FHRA 3LYHA 5IYZB 2IYAA 1LF0A 3LUPA 3SC3A 1HG1A 4P54A 1AO3A 1YL5A 1Z0UA 1IXYA 2R1VA 3SZUA 3AUYA 4B47A 3RANA 1PS8A 1CE8B 3FTDA 3L40A 3LLCA 4EG0A 3MRTA 5ERGB 5KSOA 4HJRA 1IQUA 1MB2A 2I9PA 4W7SA 1N34B 4YCBA 1AHIA 4TV9B 1EXDA 1R6BX 1NU6A 1IN8A 3R6LA 2F1KA 3A3YA 4NC9A 1PFWA 1HOTA 1M3SA 2GUWA 4RVUA 2IYPA 2GYVA 3CRZA 4FFRA 3LNLA 3NOXA 5AP9A 1E79A 1TUBA 3NH9A 4CM3A 2B3TA 1HR0B 2RJNA 3OWOA 4YDQA 2ISCA 4DC9A 4JR0A 2GEDA 2CV2A 2VP5A 2P9EA 3B13B 3SMQA 1M8FA 4K1LA 2IFTA 4PLZA 3R0VA 4F1JA 4CETA 4IIDA 2QN7A 1XBTA 4CF3A 3OE4A 4CLDA 4J7AA 1VG0B 5K0NA 4RNCA 4YRPA 2CYBA 2EW1A 2BGRA 1FUIA 2XSZD 4V1CA 1E1MA 1ZG3A 3GRKA 4CGZA 2WYOA 2WJPA 4QXAA 2BJVA 4UDOA 4Q9IA 2NU6A 2HM7A 2C61A 3G5AA 1PGQA 4OYLA 3OG9A 3PNVA 4PR0A 3EVZA 5B6JA 3OCVA 1NXGA 5IAAA 1PD1A 3LTEA 4CEHB 3HKCB 2Q5FA 3D2CA 1DOZA 1RVDA 2REOA 5DGCA 2HGSA 3B20A 4BVEA 1OW3B 3LO5A 4QQNA 3WLKX 3ZHBA 4AI6A 1F8XA 5P21A 4G36A 3X44A 3KM0A 4E6YA 1RHUA 4QXOA 5FPSA 4X71A 3W5UA 1BC5A 4HVAA 1QZTA 2FWPA 1CUDA 2E4WA 3K9GA 2CJWB 1Q77A 4G4JA 2M4VA 1PBTA 4H1UA 4K1XA 1HYGA 4PCAA 3QKIA 3GZNA 4IJQA 1LX6A 1A9XB 2XB6A 1DEAA 1VC2A 4RD0A 3UMJA 1S2OA 3TG2A 3GBSA 2Z1MA 2MIIA 2QLLA 1O8CA 3P2MA 3ITKA 4G0WA 1ZOPA 1RJGA 2B98A 4RFVA 1VLHA 5C80A 1U2PA 2Y1EA 1THMA 5AKKA 1W96A 2GK3A 3WA7A 3RRMA 4YJ3F 4B81A 3QVGB 3KSUA 3LOPA 4GZ3A 4HQOA 3ED1A 4O4JA 5E6UB 2MSLA 1G0OA 2I3DA 3AERA 3I9FA 5EWLB 5FUWA 2DKOA 3AR3A 3SC2B 3ZGYA 5A6VA 3G59A 1FJ2A 1YFZA 2AYXA 3C48A 1I4WA 3INYA 4OQNA 3TSAA 3UK6A 1F2TB 2BRUA 2PT5A 5AI3A 1YQ9A 4NQRA 2AFIB 1G8JA 5AI9A 5T64A 1W6UA 1FS4A 4C4ZA 2UKDA 1E59A 2VDUE 1E6EA 4AECA 3UH1A 4K88A 1H6AA 5EKDA 5I7FA 3ZU6A 4EL5A 2PGJA 2GSWA 2H5LA 2JIZD 4DCMA 4BO6A 3PPYA 4GRDA 5D84A 1BQ4A 3QF7A 5F35A 1ZLXA 1G6Q1 1FU8A 1L1EA 2DCMA 2EJTA 4I6EA 3HWX1 3NHLA 2X6TA 4DKXA 1ONBA 3EQ7A 4CCWA 4DLVA 4PZDA 2ZBRA 3D0KA 4OIFA 3NHSA 4WFN1 2ORWA 1I32A 2X2FA 4PYMA 3KXIA 2WJ4A 1BE7A 5LQMA 1FE8A 2AI3A 3UAOA 5LA6B 4EEXA 3TRHA 5BVGA 4H1TA 4OXNA 3QVDA 3RGWS 4YLGA 4OI2A 1FSGA 3IHTA 5H81A 3KETA 1FIUA 2JATA 2OHOA 3A9RA 1F8FA 1WXHA 3BWCA 3U4AA 2GAIA 1EP1B 4BLSA 4EX7A 5EXXA 3IQHX 1E6KA 1ESEA 1LSUA 2EQBA 3PD0A 4HLUC 4R69A 5AI6A 4UTPA 5P8WA 2C5AA 3L7CA 3ICWA 3DVRX 4A23A 4IX9A 1K4YA 1U9ZA 1J90A 1GGJA 2CXRA 4GOXA 5ULLA 4BHTA 3U6BA 1XSEA 1Y1RA 3D5TA 4DLXA 1GPUA 1NHWA 1TCUA 2PVEA 3NWOA 1TC2A 2CXQA 5AI8A 4RV4A 5EY5B 1YXMA 5L4NA 3PI6A 2VJMA 1TEHA 3GLRA 3WLIA 3KD2A 2I3BA 4HH4A 4HXGA 4OBEA 3GFBA 4D79A 1BWSA 3EF0A 1N2CE 2H1SA 4D3XA 4KQMA 8OHMA 2NPOA 4L76A 4NFSA 5IMSA 2O8DB 1UKYA 2HADA 1NQVA 2EU8A 2XUKA 2C99A 3CPJB 4IRMA 4RHTA 3TH5A 3UMGA 4FEGA 1QHHA 4B7UA 4FS3A 3W3AH 1S8OA 2DUNA 5C8YF 1QIGA 4U0JA 3IV9A 4HYEA 3W9YA 3LVQE 1X74A 2ZJ5A 1PNOA 1YAHA 2FPIB 1CR4A 1U2RA 3DEJA 4JJZA 4ZI7F 1V5IA 1ZONA 2OO7A 5EC8A 4C30A 3ZDCA 2BRUC 1ZINA 3QSYA 2QD2A 4GXRA 1Q91A 4Q9LA 4AIRA 4D9HA 2Q3MA 3THXB 1SXJE 3TEFA 3G6WA 3ER6A 4AJIA 3VUFA 3NXSA 2QUKA 2X58A 4XCXA 3LSTA 4L0CA 4Z1OA 3EIXA 3OIWA 3UGKA 4EG5A 2AN3A 4NOKA 2BEUB 1ULTA 1TZJA 4LHEA 3I2IA 5LZ8A 3RUAA 3LCVB 5JOQA 2RHCA 1V8PA 2PSEA 3CVJA 4NE2A 4RIFA 3ZCRA 2WAQP 3JQEA 2R8EA 2OHVA 2VLIA 2WIJA 3A1TA 2NU8B 1W19A 3VR1A 4TLAA 5L53A 4BFWA 1JN0A 1DKLA 1I6WA 2FP3A 1A8HA 4A2QA 1Q15A 3HCFA 1YK4A 2K6GA 1QYCA 1XZHA 3HLYA 4HXEB 3TJMA 2X7XA 3CVOA 1EM8A 2BLLA 5JD6A 2X8JB 4X8MA 1H8HA 4KXYA 3K0AA 4GR9A 3WYGA 1EEXB 4HHEA 4XUCA 3AFMA 2W5UA 1OFVA 4GMKA 1UDWA 3QYJA 2G09A 2EW8A 1XZIA 1Y9EA 5KNCA 2A9OA 1C3JA 4QATA 3AEYA 2H16A 3MD9A 1H05A 3VM6A 2OVBA 4OHBA 4C3JL 5ALUA 3B9QA 4LF6B 1BMFD 4BAGA 1WB4A 4Q3AA 4H7PA 3HLTA 2ZXUA 1Y8RB 4BB9A 8GPBA 4ZODA 1NW6A 4HEJA 3TAXA 5HBRA 1XA3A 2Q3CA 1E4VA 3N8GA 4BO8A 1ZN8A 4DT1B 2XYVA 1KVSA 3IJRA 5BR1A 2QU8A 2BM0A 2LZ0A 3GAMA 3IJPA 4A8TA 4Z5XA 3QEAZ 5DCYA 4CMKA 5I45A 2OO3A 1TVKA 4QHYA 1ELOA 3BH0A 4AFNA 3UOAB 3CF0A 1A2QA 3UAZA 1S3SA 1OV4A 3B2NA 5D86A 5PNTA 1E79D 2O06A 3MCZA 5THKA 4PYOA 4CL2A 4G5RA 3QA3E 4FINA 3L4EA 1JR3E 3DTVB 3OJLA 1OBFO 1E0SA 1Q7RA 2JAQA 1GY8A 1Z15A 5C5CA 1NXWA 1L7MA 3S1LA 3IAS6 4HX5A 4P3KA 1LLQA 1U2GA 5CX1B 2KI5A 4R2JA 4BX3A 4CMIA 5DM70 4R1TA 2J4DA 4JB0A 2RGXA 4Q3KA 4YMTA 1WCIA 5CIWA 5DOZA 3FYSA 4RULA 1SVMA 1BH2A 4IF6A 3FUVA 1P80A 2ZBGA 3O8RA 4COOA 4DNXA 5JT1A 4HB3A 4BQFA 2IS4A 3C43A 1MOSA 2LUOA 1SA0B 3C5EA 3QOXA 1UZUA 2FRDA 4CR6A 3OO0A 1H0SA 4LE2A 1IWPB 3STWA 4ESVA 3KYDA 4FFVA 2E6UX 2XQIA 2BR4A 2C97A 4UBKA 1YR8A 2RGEA 2DX7A 4URYR 4A8JA 4BL5A 4KPUA 1SMUA 2XRMA 1GR1A 1JU9A 4RQAA 3BXOA 3P9IA 3KEOA 3K05A 2PZEA 3TRJA 5JYEA 2VN8A 3UMYA 4RK5A 4ZK6A 4J7XA 5ELXA 2D00A 3KOYA 3MJHA 4YGXB 1FNNA 4YRGA 1XD2B 5BWMA 3DBIA 1QQAA 2ZUCA 3D4NA 3TCXB 1E2FA 1SQ6A 2NVYL 1ACJA 2HNKA 5F1KA 3ROQA 2NUAA 2BEWB 3NFYA 4EAQA 3VKHA 3MJFA 4YJ2B 4KKVA 2Z2IA 3JASA 1DG3A 1TQ4A 4C3ZA 3DDUA 4DZRA 1E9AA 3MGAA 1TF2A 4MB2A 4ND8A 2L17A 2ZI3A 2GFQA 4JJ4A 2HCRA 1I4TD 1I36A 4HAIA 1JNXX 3FCYA 4BNWA 1KOGA 1GOTA 1PQYA 1PSZA 2IYVA 3M5CA 3VVCA 1PJZA 5FWYA 1BX1A 4V196 5B55A 3BXHA 1L4FA 2Q41A 2QUBA 3GEEA 3FDIA 4GVLA 5C4IA 4HS9A 5K6RA 4AKGA 2QN3A 1GAWA 3NYQA 1ZVJA 3GNLA 3K0BA 3TLGB 1P44A 1JBEA 3TZHA 2C2WA 5EXSA 5F12A 3HXQA 3ZDBA 4R1SA 3O93A 2ZQYA 3HA7A 1U2GC 1UBTS 4Y7DA 2IWRA 4POAA 4DMUB 1LSSA 13PKA 1U1GA 1XU4A 2C8VA 5DYGA 4N4AA 3S2SA 4S0XA 3QVVA 5F4BA 3C3JA 3NXKA 1SBYA 1VL1A 3T1YB 1RZVA 2JS7A 2HPHA 1L7PA 1NT4A 1VP9A 2JD0A 3KPJA 4GMHA 4Y1GA 2IPOA 2ZRKA 5IC6A 4UHHA 3KKEA 4N18A 1VYVA 4QUAA 2FRDC 4J0CA 3VA7A 3DULA 1ODTC 4U7TB 5AVUA 2P4HX 4JEUA 4R7GA 1MQSA 3BOSA 3FUXA 1CQWA 2YJ5A 4NH0A 2PQ0A 1I8TA 2IPLA 2ODWA 4WERA 4A8JC 1EUQA 4Y2TA 3ZWAA 4K0KB 3U7QB 3SSAA 1HK7A 3F5SA 5FWAA 1S8NA 3FMVA 4EUNA 2BGLA 3RG8A 3EXAA 1PFGA 5JY1A 5CYFA 2VZ0A 4JEHA 5FUMA 4DR1B 2ZSAA 3A1CA 4U2BA 1F3OA 3O4IA 1KY4A 1G60A 4D4LA 3GDHA 4EY7A 2XH8A 1X80B 3TR5A 5IVHA 4GQIA 3GR6A 2A59A 4KE9A 1IRIA 2WEKA 2ODBA 3WIEA 5AVZA 3V00A 4FNOA 2OHJA 3ZZUA 1B73A 1JX6A 3GIDA 2CC2A 1W9HA 2J5KA 2YRFA 4XX1A 3RSLA 2C98A 4LQ4A 1RYQA 1EKXA 2Y2UA 2PYAA 1XAHA 4M46A 4YBZA 3OUTA 3SE0A 3SSNA 2FHPA 3A3PA 3COSA 2YYYA 1V2HE 3QE0A 4KRXA 3RCBA 4KIWA 4M0PA 3URKA 4FZ5A 5SICE 4LF9B 5TQ2B 1J0EA 3NORA 2P9JA 4MI6A 1UBJS 4BMCA 1ISHA 1E3WB 1UBHS 2Z5FA 3EH2A 2ID8A 1RQ7A 3AQ4A 3D5EA 3WIVA 1VG9B 3L4BC 2OCIA 3PQDA 4C05A 1IIBA 4L7VA 3PE3A 1U99A 1OT5A 5FWXB 1LSJA 1U7HA 3KQYA 2GZ3A 1WF3A 1FDSA 2ZIZA 3N8IA 1RM3A 1KQ3A 2GCIA 1VI5A 3A44A 4TMKA 3VR0A 2WPDD 3UXYA 2AF4C 1QV7A 3NTOA 2DEUA 2QL7A 2I4IA 3GY0A 4Z9AA 2H2DA 2VDWB 4JDUA 1IQPA 1PZNA 4NFHA 5EZ5A 1LPSA 4MRVA 2C42A 3KQLA 1R1DA 1ZMBA 2QQEA 3E15A 3H4MA 1ORTA 4C1BA 1G8AA 2IYYA 3QXCA 3EW9A 4HRXA 4EYEA 1A8IA 3M6UA 4QGGA 1DAFA 4FOTA 3MTIA 3IU3I 5LLSA 2BMJA 5ALDA 4XR9A 2PL5A 1BGVA 1FUYB 4U6QA 4BCCA 3IE1A 5FOQA 3V55A 1TVEA 2VJCA 3HRHA 1MH9A 3JQAA 1C7RA 5EIBD 5KVQA 3U19A 3ICOA 1T9QA 1UOQA 1KNQA 4BRUA 2XWPA 2A3RA 2QJRA 1L6RA 1MB0A 1XZQA 1P8AA 3Q98A 4OKNA 4BKPA 1L7BA 3TQTA 4BTVA 4WBNF 2RI0A 3LD9A 1J21A 3G9TA 1WG8A 3KUDA 2E6KA 4I55F 5IYZA 1JEYB 1DFHA 1F4LA 2JLWA 1S4QA 3MWJA 3LLVA 2DPXA 1CE8A 1X7ZA 3D0QA 2ZE8A 2AN5A 1P7CA 5L7WA 4OU5A 4JBHA 1S30A 1BFUA 2GN9A 3LY8A 3D6MA 3H6GA 5ALJA 3DAFA 4TV9A 3UT5B 4EB0A 1RS0A 4Y1EA 2R9VA 2NXWA 4IGKA 4US1R 4UNPA 3RTDA 4TYNA 1G4AE 2OLKA 4LTMA 4RVFA 1DQRA 1JJFA 2VDPB 3KKQA 4N65A 4WZBE 4TV8A 3BCSA 3K16A 2ZBQA 3LHSA 1F51E 1S9HA 4X1YB 1G5FA 4FYIA 4GR5A 2A4KA 3LI2A 3U9SA 1NXPA 2X42A 2VR1A 4HPWA 2P3QA 4FR5A 4LQCA 4PX2A 2RAPA 1ABBA 2C3MA 1RXIA 3DE5X 3M3DA 4AI0A 5KYGA 4M89A 2NNLD 3IYLW 4RELA 4BMNA 4TKMA 4DREA 4F2PA 1P61B 3H4TA 3NTUA 3UK1A 1NF9A 2W2PA 1EBFA 3AR6A 2MS3A 4AR6A 1SKBA 3ND9A 3EIEA 4GP9A 4UVEA 2XJUA 5JLAA 3TCKA 5K7SA 4CEHA 2RC5A 2QA5A 1ZWKA 3HKCA 5CCBA 3ZXXA 1YZYA 1Z6YA 2WAYA 5K5EA 2LWIA 3E6AA 2I9KA 5IAGA 5LSAA 2OP0A 2QX6A 4CR8A 1ADBA 3AJRA 2YICA 4LJ8A 4JI4B 1FDTA 3K1YA 1TLLA 2FZ5A 5K1ZA 2JFBA 2P6UA 4IZ6A 1NI4B 1T1EA 2HU7A 5ALPA 3A31A 4J3NA 3QITA 4E11A 1QFSA 4U3JB 5B1IA 2MSKA 3FTFA 2YWEA 4UHCA 2C58A 1ZVQA 2IYTA 2FX2A 1Y5NA 1MAWA 2VHXA 3FYTA 4K9SA 4MYUA 1QP8A 4UASA 4C6TA 4MW2A 1V9SA 1A9XA 1Y6FA 5IJXA 1JA0A 2IZZA 5TF0A 3K5PA 1N9ZA 3NS7A 4ERXA 3I6ZA 4K9QA 3PLAE 1JPUA 3AP1A 5H1YA 5GONA 2B20A 1U81A 2IYSA 2PJRA 2YDYA 1SMMA 1SIWA 3TDMA 4XWYA 1Q0QA 1L4HA 2F3PA 2HF8A 4N01A 4DJ5X 3O2JA 5E6UA 4OQ4A 2ZT7A 4CV1A 2IU3A 2FEPA 3SC2A 1E3LA 1R8YA 1R16A 4I36A 1TK3A 3B5EA 2BUCA 3VI4B 4P34A 4RNDB 4RKWA 3O9MA 3RWMB 3GLIE 1U3GA 2EZ4A 1F2TA 2QXUA 3TQSA 5HKKA 2Y66A 3NDIA 4AYXA 4DWVA 3NM4A 1NLZA 3TINA 3A37A 4G1UC 4C7VA 1R4ZA 2H8GA 1QYDA 2I55A 1XCPA 2PSMC 4PBTA 4DPKA 2C4MA 4HRYA 3C1AA 3UUFA 2EJCA 4HK4A 3KE8A 5J5VA 3OLCX 4D9MA 1UP4A 1O6GA 3QLVA 2ODQA 3ACBA 1E6CA 3K72B 4F86A 3U9LA 2CLCX 10MHA 2I4OA 1EJ2A 5GJBA 5ADVA 2H31A 5JXWA 3A4NA 3B3AA 4DLPA 4W6ZA 4M0DA 2PRYA 1ZNWA 1SOUA 4BVLA 4RVSA 3G7NA 1E1KA 4HAVA 4OH7A 2WWRA 5FV7A 3GJ8A 1KFJB 3NASA 5LA6A 1L4EA 1KK3A 3B7PA 4IIUA 2CUKA 5EUBA 1CETA 4JLUA 5EZSA 1XAJA 4E5DA 4XJTA 3DLAA 3THRA 3BH7A 4LHVA 3I0NA 3MLAA 3KELA 4JL5A 1WVMA 1ITZA 3VMFA 2H2GA 1P4SA 1RC1A 3LP6A 3P0RA 5BSWA 1Y3FE 1UBGA 1WZUA 3AOEA 3E7XA 1A76A 3NHZA 3WJ1A 5KHLB 3O2QB 1EWQA 1IM8A 5IVIA 2E4UA 4RIIA 1U5CA 3DZHA 2C20A 4N8DA 3X1JA 4CJXA 2Z3VA 1H2RS 1N6IA 4GKKB 2ZTSA 3WLFA 4M0FA 2PXAA 1HTBA 1WDMA 3P27A 5CTJA 3TYXA 1UBCA 3GCDA 4GLJA 5JAPA 2AUMA 3EZ6A 1HA3A 4CEIB 4DGSA 2DTEA 3GYBA 1WNFA 3IDFA 3TUZC 5M5XL 3HM9A 1B13A 2B69A 2O8DA 2Q62A 1SXHA 4QDTA 2RARA 2WKPA 2QVZX 3SOPA 5LM3A 2XF8A 3N8KA 4EECA 4B76A 5FDFA 1IM2A 3VJLA 2G17A 2UZAA 1PX2A 3ROXA 3T38A 4JK3A 1R4MB 2FPIA 2IQ5A 1MO6A 2B30A 5DMHA 3T35A 2H0RA 5KTTA 3L7BA 1QFZA 2DPHA 2BDUA 2DG2A 3DOFA 1Y6GA 4Z0HO 3EULA 1BZYA 1TNDA 3QPAA 5IYDL 4BUCA 5FI0B 3U5TA 3THXA 1L1RA 521PA 2OFPA 1GARA 3BD6A 1NUAA 4V0OA 3RK0A 4EMSA 4G0OA 2NP7A 3SCZA 3HVRA 3QGMA 4NIMA 4W1PA 5LIRA 1O0CA 4B3RB 4KXQA 2V7UA 4PONA 3BIOA 2LCFA 3D7RA 2H7VA 4DGQA 3RLFA 1RRKA 1V48A 4E1AA 2D5BA 1GITA 1QKKA 5BV8A 3EGXB 3M2TA 3V6LA 1YRLA 5K6AA 4LVOA 1D2AA 4OXIA 4ZOLF 2NU8A 2J5BA 2HNAA 3GRZA 4G65A 2M6RA 1RXCA 3L46A 1HE2A 3L18A 1NUPA 3H84A 3PJDA 4QOEA 4CQMB 2DH6A 4KLAA 4KSCA 4WKPA 5DEOA 1Q74A 3WWOA 3Q7RA 2RH5A 4Y30A 4RCYA 2CLEB 5DYYA 5IKOA 3VPBE 1XZJA 3JQAD 4LE0A 4ZOEA 2P9QA 3A6KA 2VDNB 1TYDE 3WBJA 3OCJA 4U2FA 4N8SA 3JAMA 2ZRQA 3WC4A 2ZDQA 3A1SA 2A7QA 2MR6A 3STYA 2CUZA 1B8VA 1GKIA 1OLUB 1GLGA 1O2DA 4NYMQ 4N47A 2VL6A 4XUDA 5KYYB 2JK0A 3R5KA 2BGGA 4ZAGA 4BEWA 5LMZA 1GUBA 3TTTA 1WKVA 2FUNB 1I0ZA 4DT1A 1EQ2A 2WAXA 2ESRA 4DV3B 1XZDA 3M81A 5AXDA 1G6KA 3L43A 4ZOBA 3ESCA 3AH8A 4G5GA 4J0FA 2BM1A 4X8LA 2RSLA 1SOMA 2Z98A 3E18A 3V8QA 4HUQB 3BORA 1I3CA 1R2QA 3MB5A 4IKEA 4IH4A 1NMEA 2X19A 5HEKA 4BO5A 2Y1OA 3BF7A 3RQSA 4DY4A 4O2AB 4E32A 5HIMA 4P0QB 1EQAA 1FYEA 1BFKA 2RGYA 4PFQA 5CLJA 3ILVA 3X1MA 5FRDA 4ZYZA 1W76A 3R44A 4EY4A 3ESRA 3K31A 1F2DA 3BGVA 5DM0A 3GDFA 4RTNA 4ALMA 3DTVA 3BWBA 3JQ8A 1ZGBA 2BKEA 1D6SA 3KJGA 4JU9A 2ACWA 4DCPA 2ZIWB 3DC2A 5DHSA 5KYXB 5CT6A 4YRZA 3NOOA 2OFWA 2EP8A 3GFOA 4IR7A 5AM3A 5CX1A 2I71A 4C88A 3FCOA 3EVNA 3GEDA 2LD4A 3Q72A 2AOXA 3G6KA 3FHLA 4FBMA 1HT0A 3V1LA 4EYSA 1A9ZA 1JLHA 1SIUA 3NWBA 4FILA 4D44A 3EQ6A 3DL4A 3JAKA 1KJ9A 3DMTA 4ESHA 3PF8A 3ETDA 1I7PA 1ODHA 3IDQA 3P0IA 4K8RB 1Q7GA 2D1FA 1SA0A 1ONSA 1N2HA 1IC6A 2CL0X 3HUFA 3ILSA 3MIZA 4GE3A 4HYYA 2IIPA 1QQ5A 3H3XA 4KK4A 4XLLA 3SHTA 1L8XA 5AR1A 2O59A 1V45E 1J2RA 2PGDA 2Z3ZA 3E8MA 1L2TA 5HQ3B 2P2GA 1ZVKA 3SLRA 3EARA 1NP3A 1HYQA 2YZ2A 5FJJA 4J07A 1J9GA 3TD9A 4YCMA 3ADDA 1GZ7A 2F3QA 3COYA 3BIXA 3OU6A 2WFAA 2OGTA 2I3GA 1C3XA 3QQPA 1G21E 3A2NA 4BN0A 1GKKA 5K9ZA 3EUAA 4XGKA 1PYOA 3NI2A 4MUKA 5EMKA 3ANMA 1SBTA 2A9KA 4Z49A 3BX1A 4AP5A 4JROA 1QH0A 4U7GA 4CDGA 2XA1A 2QRKA 3V1TC 4URUR 2JGIA 3X43A 2BEWA 4NK5A 4C03A 1GKUB 2R7NA 4EI9A 3G0IA 4ML3A 3UN1A 1NM5A 2Z08A 4IV8A 5DXFA 2JBWA 4EGQA 4RAOA 3LLSA 3PE6A 3UMSA 3EWNA 5JANA 1YQGA 3G2MA 2WV9A 1FUKA 3NHJA 3R7FA 5JMTA 2HOQA 3GV0A 1MGPA 1XTUA 5C4XL 2TYSB 3C6KA 3ZWXA 1CUGA 1FNCA 4Q3NA 4TYMA 5EUQB 1P4HA 1USVA 3E48A 4MPJA 2O2XA 4AUNA 3CX8A 5HKKD 4E2YA 4YJ3B 1Y7PA 3COZA 3DE7X 3AINA 4RSGA 5ELMA 3RPEA 4F3KA 4QDXA 4BIMA 1PDOA 3AV3A 3OETA 1GQRA 1ODFA 1BOFA 4RY9A 1RYEA 1UKZA 4UU7A 3TLGA 1NG1A 4CF4A 1U1DA 3QVTA 2HSDA 1GQYA 1UBRS 2CEKA 3N0VA 2BBTA 5M5YL 2HI0A 4A8HA 2GNAA 5K51A 1YZHA 2OQIA 2VNJA 5M5BA 1VXRA 3WHIA 1ZD4A 1IJBA 1P1BA 1GRVA 2C77A 3KNZA 2QUAA 1T10A 1XDGA 1YTLA 3OLYA 4HG2A 5G4KB 1AA6A 2L82A 2WJYA 3Q0IA 4OFBA 2PLRA 5A4MS 2DQZA 2Q1XA 3T1NA 2HF2A 5KREA 3AKDA 5L3SB 3TQRA 3WFIA 4YUAA 1B0UA 2IDZA 1UJ4A 1BQ8A 1JTEA 3QWFA 5LL6P 1TM7E 3KKNA 4M8IA 4F4FA 1GADO 1KKLA 4M1WA 1L5LA 3GZJA 4U39A 3STTA 3U7QA 3G2OA 4NV3A 4PPQA 3UKOA 4ZVVA 4BMVA 5EQTA 3TTXA 5CCEA 1ZX1A 3UC5A 2XTJA 4QPJC 4FCVA 3I3OA 3VPGA 3EF1A 1XRLA 2OT3B 1MRSA 1XJ5A 2QLBA 3VR4H 2A0KA 3VDQA 3AFIA 3FZQA 1MTOA 5TQ0B 2CT8A 2BCEA 2YDXA 3K2IA 1NM5C 1WJVA 1WPQA 2GEUA 3RFVA 4QOHA 4W63A 1FTSA 1YC2A 3ITDA 2JI3A 4Y67A 3ZY4A 2QPOA 2WA1A 1N4AA 1VE3A 4U2DA 2FCAA 4PQYA 3OJCA 2X41A 5TQ2A 1L5SA 2IXFA 5CFQA 4NZYA 2C5GA 4D02A 1DVRA 1XF9A 1T5OA 2GAOA 1JIIA 3OJXA 1IOVA 5LQSA 4EL0A 2ADFA 1R37A 1ZY2A 3U60B 4L6AA 2ZIUB 2NYUA 4H4CA 2QPLA 1Z92B 1T2UA 5C8YB 3NDBB 5M2QA 3MWYW 3S1RL 1VPLA 5FWXA 1DKOA 3ABSB 2VWPA 4ZI7B 3DMRA 2BE5D 3WK9A 2DLNA 1RXSA 3MILA 2OKGA 3OHSX 1H1TA 4K7JA 4S04A 1GA4A 1XTKA 3GT0A 1T1RA 4HTAA 4HNGA 1TQ2A 2C6AA 4Z3DA 3RSQA 3CUYA 2F3SA 3B5JA 1GZUA 2AE1A 2VDWA 3S8YA 4N41A 2P0AA 2DRIA 1J7JA 1OMOA 3KYXA 1DWOA 1RI3A 4KTTE 1IBCA 4P7FA 1W4AA 3VMMA 4J0EA 4A15A 3H5LA 4Y18A 4ZVUA 3QLEA 1KY3A 3TQQA 1NBAA 4DLSA 4FN4A 4CL3A 2GJ9A 1BG6A 3R24A 1X7YB 1F2UA 1AQLA 5DWDA 5E2BA 4HWOA 5AM4A 3ROZA 4PG8A 1I3MA 1ORWA 2OD7A 3GO4A 1JEAA 1G19A 2GXSA 2AJDA 3OQJA 3PNYA 2Q45A 4TLDA 3ZWVA 3DPIA 3B3JA 3RTGA 1FQWA 5F2NA 4P22A 2VSYA 1NV8A 3P2EA 1LPPA 4MXDA 1GUZA 3WGQA 5A3RA 3M83A 3VOBA 1JEYA 3EXFB 1U6IA 2Q0HA 1FY2A 1YA6A 3FOZA 3R3XA 1ML3A 3PGKA 1KWGA 5AOVA 5EZYA 4FQ8A 5BXQC 2O05A 2WJ3A 1T5DX 3IXLA 3RTBA 4YMHA 2GKOA 4PPFA 2HSGA 5TPWB 3UT5A 3VDMA 2AQCA 4CT5A 1WCV1 3L2OB 2O50A 4P2GA 4GGMX 2Y1GA 2M6KA 3ZGLA 1EGMB 1ZNZA 1RFGE 2HDHA 3C14C 3LE8A 3OFKA 2Z6QA 2X7JA 2WE7A 4OX9Y 2RB5A 4YXWA 1C7ZA 4YAFA 4ICIA 2YJ4A 4IDAA 1EHCA 1MX9A 1QIFA 1M2HA 3DTVD 4KV7A 2Y1XA 4X1YA 3RARA 4HNUA 4BFXA 3GCZA 1GNLA 3OP1A 1I7LA 3PX2A 5EXPA 4LJ6A 5L3SA 5IBCA 1NBME 1Z0ZA 1PBNA 4I4TF 3DL0A 5BNFA 2GZDA 4AF8A 3EMVA 5JHHB 3H11B 3TI9A 3EAFA 1ZU4A 3OOYA 2VHEA 3VTAA 3AY7A 4QYXA 1Q1ZA 3H2GA 1GQSA 2P9CA 2HMWA 4EHNA 3WDSA 3HXMA 2PT7A 5A4DA 1Z6QA 3WJ7A 1KEUA 4AZ0B 1M0EA 3K53A 4RJ2A 4U671 1DIOB 4IDPA 4MVJP 3KFLA 5B30A 3BCRA 1RPAA 3SSMA 3KAJA 4A73A 3DZKA 3ABQB 3NUQA 3SEAA 4MSUA 2Q3JA 1LS6A 4WACA 4XB6B 5AJTA 3U4HA 3HU5A 1NVUQ 1E58A 2C2HA 1A2KC 4DCVA 1H65A 2ZSJA 4GT1A 1K6MA 1NOJA 3Q7TA 4YTEA 4YWJA 3V5NA 4EKIA 2WM9B 3DO8A 3G0BA 3K6RA 5C3MA 3O47A 1TWAL 3WP0A 5AIAA 1NI4A 1NV9A 4QL3A 4DL9A 1FYFA 1G7TA 1LI7A 3PRKE 3GTGL 3QMPA 4U3JA 2Q6KA 3SS2A 1QYBA 5CBPA 1QTQA 3F9CA 4EFLA 3T1QA 2X76A 2HA6A 3KVRA 3RT7A 3WGOA 2EFEB 2F67A 3IAS1 3ZDRA 3WWDA 3IEVA 4L6IA 3TRKA 1BEZA 3D4OA 3HFRA 4JVOA 4RZXA 4EG1A 5A3QA 5KSWB 3B08B 2QTZA 2FWJA 5HOQA 2WMOB 1WUTA 4NU6A 4KN8A 4O4HA 1X7XB 3FWYA 1ZH4A 1R5NA 4ZCPA 3BD8A 4JUDX 1FRQA 2G06A 3VAZA 2SECE 1Z5VA 4UVDA 2AR9A 4DEVA 1PWZA 1VIDA 3F8TA 4J0HA 5DYTA 3RS2A 3FCCA 3CQZL 1JVSA 2O52A 3O8NA 1A04A 2Q0XA 4AKHA 4JP1A 2FN4A 3FFWA 3WYNA 4QU9A 3MMSA 2H07A 2X6QA 4BKMA 3S2YA 2BSQA 1TIBA 2PBRA 4OP1A 3HN6A 1MU0A 4MCIA 4K9PA 3WHPA 1XMOB 4GQAA 4C0LA 4PSDA 2XGJA 5A4IS 1P2TA 2P2DA 5AH0A 3W5JA 2XITA 3SG0A 4UDNA 3V4PB 2WKRA 3H5IA 1N2GA 1K7EB 2FWBA 1BJRE 3FPSA 4BUJA 1NASA 2IEAA 4C21A 4UTRA 3RNLA 5BNIA 1WEKA 5CA1F 5KJFA 1DS6A 1IG3A 5C1IA 8RXNA 1GDHA 5HXAA 1FL9A 3U16A 2C7BA 1NGSA 5GY7A 3GRFA 4DCGA 3JATB 2ERXA 2WWFA 1N1GA 3OIUA 3FCAA 1E63A 1EPUA 3K6KA 3OURA 1RC8A 4IDBA 1FFDA 1M54A 5HF9A 5FF9A 1Z29A 4FFPA 3CA8A 3QP9A 3OTWA 4BEBA 6LDHA 4RZIA 3D8BA 3PHJA 3OF3A 1QRUA 1ILEA 1GA6A 5JROA 1IAVA 1QZUA 4EB3A 2Q21A 4BB5A 2E7ZA 1U0JA 4MJLA 3SYRA 4DIDA 4V02A 4RA6B 3R9KA 3U62A 4YN3A 2IH2A 2AQKA 4IO1A 5BQPA 1NNI1 1OB5A 2W6OA 3SD7A 3CF4A 4B3GA 3TLKA 1WPRA 3PVCA 3Q7SA 1FTQA 4EUHA 4CEIA 2IOHA 4TTSA 3II6X 3G5LA 4DIEA 2IL1A 1XK6A 3GJQA 1WZEA 2XE4A 1AQUA 1Y1SA 1POWA 4JLNA 2YNMA 3I4FA 4N5LA 2PZKA 5LQDA 4O29A 4PRKA 1A95A 3CF2A 3QPUA 2NT3A 5IYBL 4K40A 2IWHA 1Y7TA 1R4MA 2J5RA 3AVXA 3G85A 2AXEA 1JDVA 2ZT5A 3NPMA 4CKCB 4HAOA 3Q6IA 3V7UA 4H1HA 5HSGA 2X9LA 4XPIB 1DX6A 1WNTA 2AKAB 4MQ6A 4OSEA 1WZ2A 4B8ZA 3WYFA 2ZPTX 2VPYA 4TWJA 4UOZA 3WMXA 1D4FA 3K9BA 4YT5A 4BNYA 4IDNA 3TW6A 4XQCA 4R0NA 5K4HA 3FDFA 4QAQA 5KZMB 3S17L 1WP4A 4E5MA 1C1DB 5B2FA 4DQKA 5JCJA 4N6GA 4G67A 3U4GA 1P0QA 5GGXA 1ONPA 3MT7A 3S2ZA 3OZXA 1A72A 3WB1A 2GEVA 2QUZA 5IW8A 2PMEA 1TU3A 1UJNA 3BG5A 3DF9A 3NHPA 4C89A 4ND2A 4I08A 3UB3A 1GU0A 4WXEA 3HHPA 3A9SA 1HKUA 3EYWA 4C0XA 3LWRB 2H3EA 2V55B 2BFAA 1Y8AA 4K3VA 4Y6LA 3DDSA 1NXQA 1GSHA 4GEKA 4I4CA 2BKLA 3EF3A 1XFDA 1HZZA 2X3YA 1E6MA 2ZJ7A 1A8UA 3NAGA 4JLWA 4W8HA 4FFSA 1GGNA 2J0VA 2KPOA 3CWQA 4V0ME 3SZMA 3UK7A 2PFGA 2H7YA 4Y1RB 1OLUA 5AVVA 2DFTA 4A3LL 2J46A 3HU3A 4FOSA 3C8MA 5KYYA 3BWXA 1OV6A 2X77A 4JJKA 2QRPA 3LWNA 1CRPA 1LDGA 3GROA 4PG6A 2DWPA 3BE5A 2GZAA 3K0SA 2P8SA