3PKIA

Human sirt6 crystal structure in complex with adp ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
ADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPAWDGPRVLERALPPLPRPPTPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-6
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pkiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3pkiA01
3GLTA 4K9NA 3CF4G 2WVAA 2VJYA 3CLSD 2JLCA 1QPBA 4JUAA 3GLUA 2H4HA 3LQ1A 4K9KA 1PT9A 3ZGOA 4F56A 4GP9A 2C31A 5BWOA 1YHYA 2VK1A 2H2FA 4IAOA 1EFVA 5DEIA 4HD8A 5K3SA 4UU8A 4QPZA 2PANA 1T9CA 2VK8A 4JSRA 1M2JA 4FEGA 3CLRD 2AG1A 4GG1A 1D4OA 2H2HA 1O97D 2Q28A 2JI9A 1HZZC 5K6RA 4UTVA 2FRDC 4BVGA 3PKJA 1YI1A 3HWX1 4RMJA 1POXA 4BN4A 4RJIA 1U28C 2V3WA 4Y6LA 4UUBA 3GLRA 2FR8C 1OZHA 5IMSA 4Q9DA 4K9LA 5EJMA 3IAFA 4RJJA 5K2OA 4BV2A 2Q29A 1Q6ZA 4ZZIA 1Q14A 4IG9A 2EZ9A 1T9DA 4JUDX 5EJ8A 2UZ1A 4V1CI 4C7BA 4QQ8A 4QELA 2JLAA 3OE1A 4HDAA 5DGTA 3F6EX 2IHTA 2OD7A 3D81A 3ZGVA 2W93A 4Y6OA 1S7GA 4GM4A 4L3OA 4KGDA 2X7JA 4V1CA 2Q5JA 3FLMA 2AG0A 2H2IA 4V1CB 4BV3A 1MA3A 4JUFA 1MCZA 3PKIA 4FVTA 4BVBA 3U3DA 1V5GA 2VBGA 4JU9A 3D4BA 3D7KA 5DGDA 4BVHA 1O96B 1T9AA 4J16C 4UTZA 4K9OA 3U31A 4GM1A 5D7NA 2VK4A 1Z8NA 2B4YA 5AHKA 4UUAA 1V5EA 4UTXA 4UTRA 2OD2A 4K9MA 4IF6A 2PGOA 1M2NA 2Q5QA 4COKA 1PVDA 3HWWA 4BVEA 1SZCA 4ZP1A 1YHZA 4JT9A 2VBIA 4Y6QA 5MFPA 4TWIA 2OORC 2IHUA 5FYQA 3JWPA 2QQGA 4FEEA 4RMGA 2JI8A 2JI7A 1U2GC 2JIBA 2EZTA 4MPPA 2H59A 4JU8A 2H4JA 3F6BX 1YC5A 1UPCA 2FWNA 4K9QA 4BUZA 4MQ5A 3ZG6A 4D5GA 4KXQA 1OVMA 2UZ1B 5FEMA 3RIGA 2OD9A 5EJAA 4MPRA 1M2HA 5MF6A 1N0HA 2NYRA 2WVHA 4JUCA 1YNOA 4UU7A 4JD5A 1U31A 1OZFA 2WVGA 4MPJA 5EJ4A 1U2DC 1YC2A 1PNOA 2NXWA 1PYDA 3RIYA 2JI6A 2PGNA 2BRUC 1Y9DA 2FN3A 1SZDA 3EY9A 2A1TR 1S5PA 3K35A 2OO5C 4JT8A 1XLTC 2H2DA 2QQFA 2EZ8A 2Q5LA 1M2KA 3GLSA 2FSVC 4RJKA 4X3OA 3CLUD 1NM5C 1E3TA 1Q17A 1DJLA 4FZ3A 3FSJX 1YI0A 4BVFA 2Q5OA 2Q27A 4MZXA 2DJIA 1T9BA 1J8FA 3EA4A 2EZUA 1UPAA 5EJ5A 3CLTD 2H4FA 3EYAA 1PTJC 1V5FA 1JSCA 4K9PA 5MFZA 4RMHA 5MGNA 4L2IA 3JR3A 1YTLA 2H2GA 5K6TA 1YBHA 4UTNA 4C78A 4F4UA 4GM0A 4BN5A 1PI3A 1UPBA 4I5IA 1EFPA 5EJ9A 4KPUA 1BFDA 1POWA 5BWLA 4JUBA 4X3PA 3PDHA 4R8MA 4G1CA 1ZPDA 2EZ4A 5EJ6A 1PO7A 3FZNA 5EJ7A 1PNQA 4GPEA 1Q1AA 4O8ZA 1ICIA 1M2GA 4TWJA 4D5EA 5BWNA 2A1UA 2IHVA 2VBFA 3E9YA 3IAEA 2HJHA 4RMIA 4J1TC 1OZGA
chains in the Genus database with same CATH superfamily
5EPUA 5L7YA 4W7SA 2OA0A 4C1BA 3GLTA 3K96A 1ZMBA 3PA8A 1ESCA 5CA0A 1ZP6A 4X8OA 3ZZMA 2XVAA 2XGOA 1ESZA 4IIHA 3GH3A 3I4CA 3S6JA 2ZJ4A 4UBLA 1E4YA 3W3AA 4EHBA 5IN4A 5IM4A 3FMFA 5J4LA 2VJOA 3LCMA 2BSQA 1CFZA 5HK8A 1F9EA 1ES9A 2I3GA 3ZVMA 1JLMA 3KYXA 4KX5A 3G13A 1EFDN 1F0NA 3T94A 4C5BA 3DMPA 4L0QA 5ALOA 2EFGA 5TMEA 2AI2A 1UJ4A 2A0KA 4AKHA 2Q4EA 1SMKA 3CJQA 5K0ZA 5T8KC 3ZI7A 1AN9A 2YHSA 2PAFA 1SKBA 5FHRA 3SNKA 2EKBA 4K88A 4GKJB 2WTXA 3WO0A 1WZEA 1FX0A 1TU0A 1QHHA 2VA8A 3LA8A 1HYBA 2VK1A 4Q00A 2FG7C 4COOA 1IZ8A 1GV0A 3CX4A 4KXNA 5THKA 1O96A 4F5EA 2ZI4A 4AQDA 4O59O 1WJGA 1LFAA 4Y9TA 5C34B 1Q22A 1AC5A 1RP7A 2QV7A 2BDTA 2EFCB 3KSRA 4C04A 4PHHA 3U5ZB 2HKIA 2VQDA 1C8LA 4UU8A 4JR2A 4RAOA 1IATA 1LLFA 3O03A 3IP9A 3UHOA 1KXJA 2G82A 3KTAA 4AF8A 5IF9A 5BSGA 3KZVA 3I1FA 1XMXA 3B89A 3U1TA 2P5TB 5AVZA 1GRRA 4YAKA 2B1QA 1RM4A 3JD2A 4MROA 4CMHA 4DVGA 1TK3A 3IJRA 3ICCA 4FE3A 4H7IA 4RVFA 1K9SA 2F00A 1UWLA 1JHQA 5CVCA 1DO8A 1JSRA 1YD7A 4MW6A 4O4HA 2GKGA 1Q20A 3B9RA 1UOQA 2INGX 4HAWA 4KRXA 4RPCA 2DECA 2GILA 3AKYA 1B3BA 5RXNA 4QGFA 5SY6A 2D0DA 1Y0BA 4B44A 3W1EA 1O9GA 4DQKA 4JLAA 4TZTA 2RHTA 2YV3A 2ZYHA 4LRWA 5SY9A 3WDMA 3CNNA 3MILA 3PZBA 3JQGB 1GFIA 4FONA 3PKJA 2VK2A 4BLUA 4D0NA 1KVUA 3DQQA 1QCZA 3WGMA 1PT5A 3LK7A 1VGVA 4AIIA 4G1BA 4NYIR 1G5TA 4BN4A 1L0BA 1G3IA 3PGJA 4LN1A 2JLBA 2DFLA 1SBHA 5LBTA 4AP6A 1TECE 4RANA 1RRKA 2C1XA 3VVCA 7ABPA 4Y0NA 1RRGA 3KKNA 4JYPA 1KP2A 3K53A 3KL2A 4RXUA 3ZLVA 4XX0B 4ZYYA 3HRKA 4K9RA 1G2IA 4AHYA 2ANBA 4DR4B 1JZQA 1BHQ1 3RFUA 2WA2A 3N8GA 5DHTA 3RC1A 1CDEA 1NR5A 3SQOA 1PX0A 3AUUA 3SHFA 3V46A 4ACBA 3TLEA 1OYOA 4FFMA 3ED5A 1U2QA 3AUTA 3BCUA 5IMSA 1U6JA 3SDSA 1XNQB 1R6AA 5HJEA 3FCAA 3L7OA 4CTJA 4ALNA 3H84A 1EVYA 3H8VA 2ZE5A 4KPUB 4XD2A 1N2CE 3BSFA 3PJRA 1E4EB 3E7PA 5THXA 2B9VA 1T8PA 3SZ3A 1JIXA 1II9A 4OJQA 3ZJVA 1NIPA 2ASVA 1XJQA 2E4AA 4RXNA 5ALSA 5CM8B 3AXTA 5FWYB 3QUAA 4KREA 3L6DA 3FPKA 3ECCA 4P5PA 3F6SA 3R6WA 4YJ2B 1WF6A 4REQB 4E2WA 4PANA 1MB2A 2Q2WA 1QWSA 1Z7YA 3I1JA 3AK4A 3UK1A 1OA0A 1Y7LA 5CDSA 1RRMA 1O58A 4OQPA 4OSEA 3PXEA 4INPA 1HBJA 1ZGGA 5FFMA 1E64A 4IHQA 3V8EA 2EVWX 4KGVA 2C4WA 3DPSA 3EEIA 1F8FA 4CMEA 5LXTB 4G0VA 4ZK2A 1U0OC 2PSDA 4TYPA 4EY7A 3F3SA 5AXCA 3DBVO 3WLPA 5KMGA 4DB4A 4B45A 4BY1L 2PGXA 1MMFB 2QTMA 5KAMA 1Y4SA 3Q5DA 4JVOA 1YUNA 3IA7A 1HRDA 2AUSB 3OX3A 3K0SA 1NGSA 1FYXA 4WUVA 5DWVA 1HNNA 5KQPA 5JNLA 3UV7A 2VSFA 1IBLB 5DLYA 1MX9A 1NYQA 1B16A 3T7JA 3S17L 1UT8A 1GN9A 1SA0A 2R7KA 1KIAA 3JQAB 2A9RA 2C98A 2FW7A 3F71A 1IAQA 4XIIA 5JT1A 2PUCA 2BFEB 4Y9UA 2JA6L 1XAHA 2ZVDA 4X90A 5G1NA 3M4YA 3ZV7A 1CETA 2Q9CA 5LNK6 5LU8A 1R66A 1TW2A 5IPFA 3PFFA 1H4TA 1X7WB 5FPYA 2JIPA 2CMFA 4QDXA 2D5CA 3DMNA 1CEQA 4KE7A 2IXFA 1RR6A 5H59A 2QP3A 2WJ3A 3KQVA 1C50A 2CXNA 2I67A 2R92L 4RTPA 1SUFA 3RF7A 4L9SA 3THOA 2UUBB 4GOOD 5ALWA 3F74A 1NXQA 4BTEA 1Q1BA 4DBLC 5IX8A 3TF5A 1WRBA 1IVYA 1L7PA 2CDNA 1T5LA 2OYSA 2QRVA 5EP1A 4WECA 2XADA 1VZ2A 1CWUA 1O94D 4RIIA 1XX6A 4UZSA 4YWHA 2VHUA 1A27A 1J23A 2GN1A 3D7SA 3OEEA 4I55B 2PSFA 3GMTA 1IWBB 3EFHA 4PBRA 2WJPA 4TV8B 1X8KA 5F76A 3E9EA 5ULLA 3UK2A 3ZK9A 4I4TB 4KC0A 2A4KA 4NBVA 4ZAZA 5ELLA 4M0EA 4ZT7A 3IJEB 4KXMA 3FOBA 2E4YA 4G5QA 2B5VA 3GPBA 3P4XA 3WG9A 3M4XA 5FJ8L 2WWRA 1FDRA 2QIOA 5GJBA 1Q0QA 3R9IA 1B74A 2GFQA 4EHIA 5LXTA 1N3BA 2W2VA 3B2NA 4CCYB 3UOWA 2IVFA 3IVMA 2ODPA 3L7NA 1D6MA 2WG0A 2YZGA 2V7WA 4LX0A 4XM0A 1P17A 5C7IO 4B6QA 3B6EA 5FCDA 1TK9A 2AK2A 3RVMA 5LP6B 1X7GA 1WL8A 5EMLA 4ENPA 5LDDC 4EZIA 3VNVA 1TUBB 2PKQP 3I5XA 5IYZB 1OKKD 4QPCA 1CCWA 5K7SA 3PD0A 2HDHA 2JCGA 3D6UA 3D0OA 2QI9F 2XGGA 3N07A 4X7BA 5KJ6A 5A5DA 1EDOA 1FFXB 5CEEA 1GTRA 1R4NA 1NQWA 3P9IA 1C9NA 4IBOA 2J6HA 2QXTA 2V7UA 5ALNA 4AJ2A 4DR3B 4LWZA 4EI7A 3LDFA 1A5TA 3G9XA 2KS6A 4GMXA 3UMYA 1KYXA 1O2DA 3K72B 1H2FA 3OCZA 1X7YB 4IV8A 4OFBA 1ZNWA 2BFDB 2P3LA 1KO5A 3P2OA 2O3SA 1MF7A 4M7RA 1ZOIA 3DEKA 2BFBA 3MMPA 2ZBGA 1Q7GA 3VU1A 4M9CA 2O9JA 1K4MA 3BXOA 5TF4A 1W47A 4PSDA 1P0IA 3CG4A 1CUXA 2DPGA 3CMCO 4HWGA 4LOKA 4EX7A 3P9KA 2W2LA 5KC9A 5BMVB 4F5YA 4EJFA 3MINB 2YU9L 1GGEA 3NO4A 2AOTB 5EIOA 5FO0A 5C3UA 4A26A 3VTFA 1HQDA 2EG5A 1EP3B 4ZAGA 1LS1A 3QF7A 3Q1LA 4QSMA 4AECA 2O1WA 4XXBB 2NQ2C 3U7FB 1EQAA 1XNJA 3ADKA 2G4VA 1Z4QA 4FHEA 5GZ6A 1UM9A 1Q3HA 4H7HA 4IXNA 3GQVA 2FPUA 3H4IA 2CYBA 5DHSA 5DW3A 5HFNA 1CS0A 2AF4C 1T8WA 2YC2C 3V8BA 3RKSA 1D2RA 5EFOA 4Y2GA 3PX3A 1W85A 5CIWA 1VIYA 4DIOA 5KB3A 4FB4A 4MW2A 1B26A 2ZJ0A 2Y4NA 1MB9A 3AR7A 3LKVA 1DEXA 4GDFA 1M1YE 1PZGA 2BL4A 2GN9A 2ZJ6A 4QPJC 3R3SA 1ODCA 5AK4A 3V4FA 3ZCVA 3OFKA 4YJGA 2BOVA 1IRXA 4TYQA 4AJIA 4MVJP 4WBNB 2WU4A 2YHUA 1U63A 3A1CA 3OZBA 5F2KA 1KZ7B 5FEMA 2ZKLA 3SXJA 5IJ9A 3U37A 4MUXA 2X6TA 3K5IA 3R5JA 2C4HA 4AMBA 3EY4A 4EYKA 1FMFA 4GLJA 4M76B 4ZQFA 2IKSA 2Y0DA 4PXSA 4TROA 1IN8A 1Z25A 1EGHA 3RVBA 4C6HA 1SXQA 3OFND 1IK4A 3RRJA 1N1MA 3NYIA 4DMGA 4D3YA 1T6ZA 2QG4A 3Q1KA 4P38A 5EHZA 4PC3A 2W2KB 1W35A 3CFYA 5KTNA 1IN6A 4WLUA 4IEEA 4QTXA 3OX1A 2AE1A 2OQRA 3WB2A 5GTDA 2G17A 3ZWBA 3PWZA 1IUPA 2QG9A 2DY0A 4B3FX 3HUFA 2WKSA 3I0MA 2D1SA 1I6LA 1Y63A 3GGOA 4KE6A 3L7DA 1XCMA 2P75A 3FTCA 3FRJA 4LY3A 4U2BA 1K6XA 2DQ4A 4ZO4A 3EXFB 3ZY6A 4CM1A 4Z49A 2HNBA 3WGOA 1MG0A 4XWGA 1NHGA 3T4UA 5A3SA 3WK5A 1BC5A 5ENDA 3T9DA 4HT3B 1ZGCA 4QXQA 4NTZA 5J1SB 4G89A 1RRCA 5LP1A 2ZPUA 2PX8A 121PA 2HXGA 4FQ5A 1PL8A 3ZYZA 1TLTA 1PSDA 3L4EA 5ICGA 2XHEA 1XYVA 3QUCA 1KEKA 1ID8A 1X1EA 2RH4A 1AS3A 4FCVA 4G0OA 4TL6A 5G4KA 5MN6A 4WZAE 3S99A 4HWKA 3THRA 4EA7A 3TZ6A 2WJJA 4ZOCA 3FDJA 1F2DA 4YY3B 1E1DA 3PPYA 5DSZA 5BY2A 4A6DA 1FFHA 2HHCA 3MWFA 3O1JC 2W8ZA 4FHCA 3N8HA 3FIUA 1GZ6A 4IM7A 4UM9D 2QQFA 2QZ9A 1XMIA 2I54A 4GVXA 4WBSA 5I9TA 5T4BA 5TQJA 3RVPA 4CM9A 4D6PA 3PFKA 2WF8A 4QM6A 2Q5LA 1OAAA 1JKJB 2DYKA 1V7PC 2ST1A 3B3QA 2XT0A 2IF2A 3GNSA 1Q1QA 1U3VA 4O4IA 3PDUA 2CEKA 2FQXA 1U2GA 2A7QA 4HNAA 4Y2VA 4F3KA 1TUGA 2IODA 3SPXA 3WWEA 3D1VA 3H1TA 1F4VA 1R5OA 4YHBA 4BJ1A 1MRZA 2Q49A 2V74B 3BJEA 2IU4A 3N8KA 1EAYA 3IRUA 4PS1A 5CDFA 1AZTA 2RDMA 3JS5A 2CKAA 5JS2A 3ULKA 3PX7A 2QAIA 2PXHA 1JG1A 2Z1NA 4QYIA 2QZJA 1PP4A 1GRVA 1P1FA 4BCDA 1T8YA 3OEYA 5H83A 2Q27A 3TOZA 2ZUTA 4DYDA 1R15A 3MEQA 4CR8A 3DUFB 3OCXA 5EZ5A 4F04A 1Z5WA 5C4XL 2O6HA 2E4ZA 3AR8A 2Z6QA 1T9BA 3IBSA 4YB8A 1U7ZA 3RGWS 3ROEA 5JQGB 4BO1A 1UPUA 1CIVA 4POAA 1GL9B 1BHO1 1LGYA 3QI7A 3ST7A 1FJ2A 3QVSA 3UC5A 3ZV3A 1BCSB 4H3SA 3FKQA 3WC4A 1J0AA 3RT1A 2Z56A 1LQTA 4II2A 2GXUA 2H4FA 4PCAA 5DM4A 4MKIA 3LPMA 4D3ZA 3PSAA 2HTEA 3WL6A 4E30A 2B37A 1PTJC 2DWPA 2E4VA 1WVGA 2Q99A 4HYQA 4J4HA 4Y2PA 2DLDA 1Z88A 1H5UA 2H6EA 4EA6A 3U80A 1BXRB 1GY8A 1EX7A 3RVDA 1BRMA 1VBNA 4GICA 2WUWE 2D54A 3D7RA 3NW9A 3OZEA 2ZBUA 4LX8A 1M8KA 2VDPB 4UDNA 4UE6A 1U8TA 5I7SA 2GJ9A 1PUXA 4XJSA 5EUQB 3QFFA 4A2CA 4TVOA 4EUSA 4IMPA 1ZD8A 1L7BA 3SJCA 5ICCA 1DRWA 5I5GA 3OQPA 1XA4A 3QLUC 1NBOA 2GJKA 1QLWA 4EYSA 1Z2PX 2ATEA 2FMFA 4A0HA 4JB3A 5HQ3A 4NWIA 4LYGA 1TZJA 2TMDA 3OIGA 3NV9A 2Q0XA 1Q7TA 3IQWA 2CNKA 4IQFA 1A2QA 5U4QA 2PQMA 3IDQA 4I5IA 1Q6YA 1RJDA 2QJTA 3AFHA 3B9QA 3LAWA 3LVRE 2NUPA 3VNRA 5LP6C 5I7UA 4HMPA 2PZBA 2AEEA 2VAPA 1JIUA 1LWNA 2BT4A 5I7AA 4BBAA 3K70D 3QEOA 4KV9A 1J2JA 1ADYA 3CLHA 4LDPA 4UM5A 1WVIA 1JR4A 1N57A 1Y34E 4YACA 5F1YA 3V2HA 1SVWA 4YQEA 5I45A 5LQMA 5EIHA 2NQ8A 1FHMA 4X7PA 2HV9A 1LVHA 3CGGA 4P2GA 4F45A 4C43A 3P2MA 4JWKA 1G21A 1ZK1A 3UJPA 3EMBA 4ZV9A 4ARIA 3FGOA 1FNCA 2OVBA 1PO7A 3NH6A 1DI0A 3OQIA 1DXQA 4HEA1 1ZD2P 5D7BA 3ZK8A 4AZWA 1XMJA 1TVEA 1XZDA 2XRFA 3I2YX 1FYEA 3PNYA 3OTOB 2B6NA 3C7KA 4JSYA 3A10A 1AXRA 2QL9A 5BSUA 2CCJA 2YJGA 3BUSA 3KBBA 3Q9SA 4Y1EA 4AMUA 4CF5A 4ZMSA 4QT0A 3O93A 1JDUA 1YS1X 4LQLA 4X41A 4YO8A 3HC7A 5BNWA 4CMAA 2FH5B 2HAEA 3FETA 3IT2A 3QX9A 4LXYA 4UAGA 4E15A 5K20A 4L5JA 3VYVA 2Z4RA 2B6HA 1BXZA 3EQZA 3KDAA 3QF4B 1NLYA 4X1KA 1PWZA 3ADCA 4CU5A 1XQ9A 4OATA 1Q0RA 5KIAA 5T6BA 5KTPA 3IVAA 1B2OA 2AJCA 4XE5A 5L3ZA 4EPYA 1LCIA 3D3NA 4G81A 4O1IA 4RKFA 5T57A 4RMIA 1GPDG 4HHEA 5EFZA 5IAEA 1Z0DA 3PCTA 1HE4A 3E1GA 3HV0A 3QUQA 2VP3A 2I6FA 1GPMA 1UK6A 2BGGA 1S4MA 2ZLBA 3QUBA 3VKFA 5JUWA 1JQAA 5HCIA 4QUJA 1JB9A 3BTOA 3CUVA 5DHAA 3R77A 1P0FA 2QI9C 1V35A 2WVAA 3C0KA 2NWQA 3OJWA 5EZYF 4DXDA 3AVOA 4EI8A 4NLLA 1CLUA 2FZLA 4B46A 3CLSD 4KK3A 2NSHA 5JRZA 2YZMA 4IEFB 3FTQA 1PWXA 1JIKA 2OP1A 4EB3A 1YJCA 1URPA 1P80A 1R4ZA 2DKOA 2QVXX 2BD0A 2QKYA 3KHSA 3MTIA 1ZUIA 1OC4A 2IUTA 2W2QA 3GL9A 3B1ZA 4G1MB 4OXXA 3HOXL 5TARA 4O2BB 4BX3A 3JPWA 3ZCSA 4M8IA 4Y6SA 1BRFA 4R0VA 3R7FA 1NY6A 3V34A 2R6ZA 1T35A 3KYBA 2V8BA 3A1TA 2EIHA 1FPQA 1Z5OA 3TXYA 1E5XA 5CAEB 3HGMA 2JVKA 4D4GA 5C0OE 1K2VN 4M53A 1UZLA 1DX8A 2LIVA 4RM2A 1Z12A 2ZRFA 3S81A 1X7ZA 1A8IA 4IFIA 1UFKA 1W4CA 1G2OA 3OLVA 5TJ9A 1T1GA 2JH9A 1V39A 2YXDA 2B92A 4RPJA 2CV1A 1T2VA 4AJOA 4HEJA 3S1NL 1AHNA 4WKGA 4R2LA 1C9MA 4M0MA 2SCUB 4MWEA 3DEHA 1L6RA 3MAAC 3A11A 1V2GA 3K1TA 4H31A 4RD1A 3TAUA 4BB6A 1VJRA 1TVCA 3DDNA 2NO4A 4FXOA 13PKA 3IAS1 3HZHA 3MCUA 4GPZA 1ZIPA 3ABOB 3PE4A 2RHJA 1CULC 4P53A 2YJNA 1SOWA 1YA8A 3GLHE 3I45A 4K6CA 3RS9A 3ZV5A 1AV6A 5JJIA 2RHCA 4L4XA 3D4LA 1YCFA 4K2HA 3DCYA 4W1RA 4C3ZA 2VDKB 4YI5A 1JALA 1YB6A 3AONB 3TRJA 2O8BA 1S3FA 2ZB8A 5HGJA 4HH1A 2ODTX 3BX1A 2IZOA 2QORA 3GJXC 4GP7A 5K3OA 1YTUA 4P7KA 2LWIA 2WTBA 2Y4OA 2HA5A 3AVPA 1W94A 2AVDA 4A2WA 1JV2B 3WHIA 2QUHA 2BH2A 3KWMA 1HG0A 3CYFA 1Y37A 2D74A 3EEYA 2CR8A 4MCHA 2ONZA 4IOJA 2FN8A 2HI0A 4FHDA 3NEJA 4IIUA 2O48X 2YHIB 4N40A 4WA7A 2CLKB 3BQNB 4WCVA 4Z9XA 1D09A 3I42A 5FPPA 1E9RA 4O08A 4EELA 2HLHA 4XSGA 4ZAXA 3BMQA 2HSGA 521PA 1PU2A 2G72A 5BW8A 1U28C 1WDMA 3BE5A 3ZJ5A 4AC9A 1MV8A 4ETNA 2O3TA 3DB1A 1OFTA 2C29D 1X19A 5KVCA 2IC5A 1XWIA 4PSAA 2J67A 4RHCA 3KHUA 3S29A 4D9HA 2PD4A 1N9ZA 4IDPA 3W6ZA 2EL7A 2BUCA 4Z9AA 4Y9DA 1JUDA 1KDRA 4I50A 3ZDCA 1RP1A 2JA1A 1PJTA 2YVQA 4N0PA 3JRXA 3S7ZA 3TEFA 4RDIA 1NYLA 2EFHB 2W8BB 3H19A 4BY7L 3C74A 3IBTA 5LIRA 1B8PA 4IV0A 3DF7A 4MP3A 4BLWA 3HKEB 2J9FB 3IP5A 3ZWWA 2PD6A 2P9QA 1Q6ZA 5K3BA 5B2ZA 1Q0SA 3G2IA 3T7SA 2GYYA 4LRTB 5BWMA 1NONA 1FYDA 4MP6A 5I9LA 3F8SA 3THWA 4EJ0A 4WZBE 4DREA 1Q92A 4PRLA 1H1DA 3DXFA 3SFTA 4M8SA 1YULA 2NMVA 3O2NA 1RLOA 4MR9A 4ZOBA 3HZZA 3HOZL 3DDHA 3NC1C 3QQPA 3TSWA 4NZPA 1YK5A 3OCYA 1LPOA 3LCUA 5HXAA 4QELA 3KZNA 5IW8A 1M6YA 1S96A 3RD5A 3T5PA 2NZ2A 3V8RA 3VTAA 3EQ7A 4DUYB 2O57A 3FYUA 3H2HA 5EUCA 5HIKA 3CB4A 4IILA 2RCNA 2VSOA 1QTNA 3EFOA 2F67A 1KK1A 2VXBA 3SQLA 3QHQA 4YT8A 1WV1A 3BB4A 3I6IA 2CMHA 5D84A 3CVXA 1VB3A 2XODA 3GRYA 1V16A 1VJTA 1AKMA 1BU8A 3IH5A 3EEOA 2HTFA 2FUG6 4DV0B 2DUNA 4A3BL 2VRBA 4UNIA 2HQBA 4G1UC 3N2GB 3CVYA 4EYEA 4TYWA 2GJ4A 3MSUA 4KNYA 3IUYA 2Z5GA 3OE4A 1RZRA 4K05A 2R66A 1FRFS 1OI4A 5DP1A 3C7AA 3TQFA 5CA0B 4MJ3A 1DJMA 3F49S 5E95A 1Y9AA 3IEXA 2YYYA 3QVLA 3ZK7A 3HU1A 1PX2A 2FY8A 3J81k 1AKWA 3DMHA 3O2QB 4PHFA 3VC3A 4NHEA 1GU0A 4BNYA 4V1CB 2JGAA 2XNSA 2B1IA 4DQUA 2X5NA 2JVJA 3D9QX 2YIJA 1YRAA 2XNDD 4NPCA 3SIRA 7MDHA 1ADGA 2B4AA 2DE0X 4Q1EA 2XQIA 3WR5A 5LD2C 2X7HA 3IPLA 3FDFA 3RUIA 3MA0A 4OQ4A 4BVBA 3GLFE 1S1CA 3BXHA 2Z3RB 3D02A 5M34A 1W36C 3U4IA 2YASA 3IMCA 4PLGA 4BKRA 5IHPA 1JR3D 3I5YA 2FEMA 1QHHB 3EZ2A 4RIHA 4CV3A 1O96B 1T9AA 2WTAA 2DBYA 1T43A 2RHDA 3ZDBA 3FHLA 4G4JA 4KFUA 3TD2A 1P2VA 1KPGA 2HDNB 5T6MA 4DT1B 3H2GA 4KGXA 2GPYA 3LQ2A 3V1TC 1U8AA 3CZCA 4FDLA 4NBNA 3P0FA 4R3NA 2OLEA 4TQGA 3DZFA 3KTAB 3Q2IA 5FF9A 3AO0B 5CVJA 2HWWA 4QBKA 1Z8NA 1EXMA 4X1IA 2AOWA 1EX9A 1RBZA 4XVHA 3FR7A 3O8NA 5D00A 1NQTA 1PR6A 1V5EA 3FWPA 3L9XA 3LO5A 1EDDA 3OVMA 2PS3A 4GAEA 2O0KA 4JAFA 1GCUA 1PUJA 3W06A 1NAIA 5KKAA 2OE2A 4O4HB 2GUGA 5AKIA 1B42A 4B1FA 2F9LA 1P1CA 3LC0A 2I1LA 5I5EA 3PGMA 2GN8A 3PNMA 2G83A 2DFKB 4LZPA 4IDGA 5DOVA 4CHTA 2XZLA 1W4RA 1SBNE 3W8EA 3ZZUA 16PKA 2JNWA 4LDJA 2YUTA 5THQA 4YLYA 3KLMX 1LC3A 2R8EA 3HYLA 4N6OA 3SE7A 4YMGA 4YRDA 3I4LA 1T8SA 4YRGA 3NPAA 2FQYA 3KYWA 5AVVA 4TWBA 4EO4A 1GUYA 4HPWA 1W7AA 3HCAA 4I99A 2ACKA 1G2QA 3G02A 1R3DA 4JJGA 4FEEA 4IVQA 4XCQA 1ZM4A 4QNRA 3NVAA 4OLJA 4YJDA 3QM1A 2A1IA 5HK9A 2QR5A 3ACDA 4GBMA 3E8XA 3BIWA 5ECYA 4OFZA 1QP8A 1LI4A 2R8OA 1FPMA 1CUDA 3AFIA 1ZGJA 3LBYA 5JNTA 2GO7A 4M87A 3UM9A 1V8ZA 4JC0A 2ZIGA 4U5QA 2BBOA 4KWCA 1VJCA 1RDVA 1LDNA 4Q9KA 5BN1A 5JHGB 3QVVA 4CQJA 3ICEA 2HIMA 2DR3A 5J4HA 4UKDA 3PQ7A 3I5MA 3HR4A 2IOYA 2D8MA 2PGJA 1GAQA 1PBNA 1Z15A 5DBEX 4ZAFA 5EMJA 5AUOB 3WWYA 3R9WA 1NQVA 4RSMA 4JKIA 2VUTA 1N8KA 4RE5A 3CBGA 3K71B 5L3QA 1P1IA 1I3QL 1OXSC 3DV2A 3PITA 5H7XA 5J9FA 3ROMA 3ZHZA 4NDZA 4NNJA 5U4XA 2ZRAA 3ZHVA 5BQFA 3ZG6A 2A9PA 2DY1A 3OZ7A 4L78A 3NONA 1ADJA 1BVUA 3K9CA 4YAEA 1JXAA 1T0HB 3F6RA 4Q4AA 2IK8A 4JLVA 3QFRA 5AFSA 4YN3A 1QX3A 3X1KA 3CVWA 2P77A 3BB3A 3WK9A 4D4LA 3SLKA 2C3YA 5DH9A 2NAFA 3VSAA 3QWAA 1QC5A 4G0ZA 1N0HA 5DYNA 4JP1A 4B82A 2YWGA 1KZ4A 1JILA 3NBUA 2JA8L 1NF9A 2QX8A 2QROA 1W0KD 1SPXA 3EZLA 3GEBA 3LVFO 3G7SA 3KEOA 2FB9A 4S2EA 3VGJA 4Z54A 1DHRA 1H2RS 3G68A 1U98A 1I30A 1EDBA 2GNOA 3L6EA 3T1QA 2HO4A 3DE1X 2Z98A 4UREA 2C7VA 3BTUA 1X3SA 2V7GA 1SA0B 5M3BA 1U2DC 3TW4A 4ZGBA 1YFJA 3AB7A 1NUPA 3TSCA 4A6XA 4E12A 5EG5A 3F8TA 5KJ1A 4QE3A 3TEMA 2LW7A 4JKOA 1THTA 2VWPA 1NVTA 1YUZA 1JTEA 3CWQA 3DP7A 3RTDA 3ZWYA 1DO0A 4B4WA 5TSDA 3SYMA 2ZIAA 4EARA 3RADC 4B9AA 1MO5A 1B2JA 3H9CA 2AD5A 3D6NB 4FGSA 4ZQEA 5AM1A 3U1VA 3OKCA 3ZE9A 4EQ6B 1C7FA 4E6YA 2Z5LA 3MS7A 1VXRA 3LWBA 1ZXBA 2BM9A 3SR0A 2GETA 4XYBA 1U0JA 1C30A 3FWZA 3BFXA 5IY0A 3HI6A 2ORYA 3EGVA 1N6RA 3NM4A 4XUCA 4B3CA 3WZMA 1EXNA 4PO1A 1NMQA 3O4HA 1BZYA 3D2CA 1U7DA 2O6LA 4B2LA 3E81A 2HNKA 4MW7A 5KJFA 2P62A 2MT9A 2W58A 3B20A 3GFGA 1FU8A 3S5JA 2P9GA 3WXBA 4EYQA 1QAQA 1V6SA 2GCIA 2MU1A 1TCAA 4GR4A 3KLBA 4OI4A 4I08A 4YAFA 5CM9C 4IHAA 2F8LA 5CDGA 1U5BA 1JBQA 4OGFA 4JT4A 1RXCA 4F6CA 1T9HA 4QTZA 1A8SA 1MVLA 5KQRA 1KS2A 4J0CA 2E37A 1U11A 3MB5A 2YV2A 4MRSA 3GDOA 4YLEA 1X15A 2FPLA 3U4CA 4X24A 2C9MA 4Z3KA 2QLNA 3DKKA 4LTNA 1PK9A 2FZVA 2OHIA 5A5GA 4ASUA 2UYQA 5TB5A 3OZTA 3JSAA 1MJHA 4WOPA 5C1PA 3EZFA 4PRYA 1NXVA 3KOYA 1C0LA 1COZA 1UXHA 2HWYA 4JL5A 5ALQA 3O1HB 1R4NB 3OCJA 5JO0A 2UYCA 1C5KA 3AZOA 3EGDB 1B15A 3HBAA 2EHJA 3PG5A 4P1ZA 1R6TA 2APOB 2I3BA 1LBEA 3S44A 2J33A 5DFAA 4URFA 4D92A 5IASA 3LP6A 1QF9A 1P45A 2FF5A 4H0CA 4XM1A 4EFLA 5KTTA 3ZDRA 3RUEA 1TM7E 2HIGA 3MMXA 3RZ6A 2OAP1 3IHLA 1RQLA 3H1FA 3JQAD 3KE9A 1XOIA 3N70A 3PIDA 1TW3A 2ESRA 4GXNA 3IT0A 1U9JA 2BFBB 5LKRA 2C5SA 3DYVA 3GAMA 4IMRA 1PZNA 4MLCA 1NC1A 2OCDA 2ZAOA 4OSPA 5GJWC 4MCIA 4BIIA 4BXXL 1IYZA 2A3NA 4RPKA 4CYMA 1T1JA 2WTEA 1K9VF 4HDSA 4RGBA 1TA4A 2VEDA 5H4GA 3BWCA 1E9EA 3E5MA 3ELWA 3HBMA 1W96A 3R0ZA 5DNCA 4G5GA 2CYCA 4DLSA 1I3CA 2BGIA 1R00A 3KXIA 3ZWXA 1L4EA 2A0UA 1XLUA 3G2JA 3N7AA 4BP3A 5B1YA 4UBIA 5BRJA 3VZCA 5IWAB 3Q7SA 2VTBA 4LWOA 5CYPA 1WSBA 2HF2A 4RK4A 1UQTA 3FFXA 5KWIA 1DMSA 2M32A 3UBMA 4DV1B 1FW8A 1UM9B 4LYHA 5DXJA 1KQPA 4GR9A 2H9AA 1C1XA 3BCSA 2Q5EA 3G2LA 3JQRA 3BCRA 4NYJQ 4QUGA 1SHZA 4YV1A 1SH7A 1W1IA 3CJRA 3WNQA 1GGHA 1OBVA 1W85B 3JPYA 1OF1A 3QPDA 3OI7A 3G5LA 4JC5A 4CN9A 1QG0A 4E32A 5K0TA 3X1DA 5C80A 5KSZA 2YV5A 1M2OB 3H5IA 4BP9A 4E94A 2CFTA 1KR2A 2VRCA 3PQEA 2FWIA 1XG5A 5C8DA 1YBAA 1WXXA 2WC1A 3H8SA 4LSZA 5BSMA 5DTEA 5JH7A 3ZGZA 5JAUA 4UNNA 3HQ4O 4Q1VA 4BU1A 3A4MA 4XGQA 5IJ9B 1VA4A 2WICA 2NYUA 1DRVA 4FEAA 2QB5A 3EA5A 4ZKEA 3HHPA 2HSDA 3QU2A 4B47A 3CR8A 2AFHA 3IHKA 1MVOA 1FFDA 1YAJA 2H06A 4PZAA 3D8SA 2RDVA 1YDHA 2FETA 2OCPA 3E8SA 3UATA 3VX4A 2UVDA 1G4HA 4WNYA 4AY3A 1N2HA 5EZSA 1FP4B 4HRXA 3AZQA 1TEHA 3PBKA 2ZRHA 4MWDA 4BO2A 3TW6A 4O8ZA 4WLOA 3AY7A 1W9HA 3T1HB 2B0CA 4I1RA 1SQSA 2CL5A 4LGYA 4XB6B 2V6MA 4C2AA 3QKRA 4DLZA 4EAQA 2F4VB 3W4KA 3G2KA 4P7GA 4U0KA 3A44A 3KLNA 4V0MA 3VSCA 3VZRA 6ADHA 1BE8A 1R0XA 1KWKA 1XZQA 3W7BA 1FXSA 4HFRA 3OJCA 1WCXA 4JA2A 2BGJA 1I9GA 1L4KA 2O52A 4CLRB 5IFLA 2FMKA 1A8QA 4PZZA 4DJTA 3VVMA 5BP7A 1TQ2A 3VI4B 5E4TA 4HXYA 4F12A 4QICA 2CNDA 3U6BA 2XCQA 2A7XA 2FEAA 3KR2A 1XZAA 2VHWA 1XUOA 4UQOA 5HG0A 2BFAA 4DLLA 4AY2A 4Q3BA 4C0WA 1VZ3A 3BHJA 2GBCA 4PGHA 2NV0A 3SJBA 4HCJA 1KQOA 4QPNA 1E2GA 3KBOA 3SX2A 4KKXB 3E9NA 4BGVA 4MARA 5G4KB 3IQEA 1YR1A 5DGIA 3M34A 1UJ5A 4N01A 4WRRA 3QXCA 1PZFA 2V7QD 1K7CA 3JQ9C 4NYMR 10MHA 1QYCA 1YOVB 2HCFA 2GM9A 1E3SA 2ID7A 1DS6A 3OZFA 4QBIA 4Y2SA 4LOJA 4W63A 4MGIR 1REQA 2X3YA 4Y1FA 1KQNA 4MV1A 3RM3A 2RGCA 2WF6A 1P1JA 3IMKA 3BIOA 4IDDA 5ILQA 5J5VA 3WLAA 4NEHB 3HL4A 2E2WA 4DBVO 2J5QA 3ACCA 3ZGOA 5KYUA 4O4IB 3LFTA 3MJEA 3KT6A 2WWYA 4CMEC 5IYCL 1JLKA 2E5WA 3GJ4A 1BQ8A 1NXXA 1YHYA 3FSEA 3OIDA 4HNAB 3SF0A 4BGUA 2KSQA 5I7WA 2B34A 1I5RA 4LC0A 1E79A 1RE0A 1XL0A 3LQRA 2IPAB 1B8NA 1I01A 1FMJA 1W59A 2C3UA 2ZYAA 4IGEA 4QYIB 5HUJA 1EGVB 2YXPX 1X1TA 1S2LA 2FZGA 1C7ZA 2YZ7A 2PSHA 1DKNA 2G28A 3RVRA 1GU7A 3TS1A 421PA 3R5TA 2BV3A 2KWIA 3PGA1 4ND7A 3HNPA 5I9BA 2JDIA 2HMWA 3R0IA 4YJHA 3PC8A 2BLNA 4G2NA 2PMFA 4PINA 3IP3A 3PQ8A 3IPXA 2BF4A 4KITB 4QRDA 1GPLA 3T5GA 3KPVA 3N0VA 2RH5A 3PR1A 4UOEA 3ZE8A 2AMFA 2G07A 1T6NA 2I55A 2OXEA 1Y1RA 1ZL0A 1R6VA 4HWSA 4YXWA 2V97A 1ZICA 3ENKA 1O0CA 3DL0A 2J31A 4GG1A 5DKFA 4NKRA 3UMVA 2P0YA 2CNBA 6YASA 5DM60 3DC2A 3LYHA 2MYNA 1U0LA 1EQUA 1GP2A 1NBMD 4ZZ2A 4G0YA 3WS7A 3QPCA 4DIBA 4MB0A 2AOVA 5REQA 1VL2A 3QXHA 3TLBA 1Y1VL 4P7JA 3QE4A 1QU3A 1MOZA 2A0FA 1OWLA 2PGDA 4CU2A 2JI3A 1O0SA 3HGTA 4E7PA 3S2DL 3NC4A 4RIFA 4L07A 3TTUA 3WXMA 5I7HA 1H9CA 5B1EA 4RKRA 1EAMA 1WCIB 4C0QC 4CMIA 5HQ3B 2VDRB 1TUIA 1HDZA 4MP8A 2MHCA 1TCUA 5BW6B 2GVNA 3NCHA 4NJEB 2DSXA 1N2CA 2P30A 1PJBA 3ZIUA 2OHFA 1G6HA 3GRFA 4I8XA 4X1YA 4D97A 5IKEA 4D3SA 1AMUA 4Z4EA 4N0EA 2NUPB 4BBSL 2HWXA 3RAJA 5EWLA 2AKYA 2IYPA 2PLAA 3EHDA 2Y2VA 1J21A 2V5UA 1I13A 2WYUA 3NTVA 3OM0A 4EHKA 1KWGA 3QIVA 2ZI6A 1HDRA 1JEOA 1HTWA 3E18A 4BE7B 4CT0A 3P2KA 4C6RA 1Q0UA 1QQBA 1TMKA 1PKXA 3AIKA 1EJ0A 2P3QA 3VR4A 1EGQA 5FIUA 3GOHA 1G21B 4WJLA 4OHMA 2X23A 2EOAA 3EZ7A 3OQIB 3OAAD 3NIWA 2QVCA 3HKBA 1OLUA 3AY0A 1GUDA 4J2HA 3TIVA 3ADBA 5JNWA 3EUEA 5JDCA 4N7RA 4Q6BA 4ZI3A 1WNTA 5CDUA 1XTVA 3QEAZ 1DJNA 2QN2A 1JFLA 1L5MA 2W43A 4QLBA 2P35A 5FUQA 4EBFA 4D46A 1BE0A 1ZH2A 4RIGA 1FP1D 1IDOA 1A4RA 4NS1A 1JQLB 1WCYA 2O2DA 3LUJA 3ZOKA 2ZXUA 2VNIA 1BMTA 4C89A 3RAFC 1RS0A 2DH6A 1VPWA 3BQMB 4KQMA 2C4TA 3ABIA 4I9FA 4NMXB 2WKWA 3F98A 1WXQA 1O03A 3F6EX 5LZ7A 4X1KB 3LBIA 3LSYA 1XEXA 2OV2A 3INGA 5EIOC 1RYEA 2NTNA 5AD1A 5BR1A 1Y81A 3DE0X 1PJLA 3PX2A 4A6PA 4NCXA 4HOYA 1FSPA 4XUEA 5AT1A 2VHXA 2OLJA 1MKYA 5LA6B 4NNPA 3PNLA 2I29A 1JA1A 1RI2A 2CZQA 3V4VB 2QPLA 1KZHA 1CVRA 1DQZA 1SQGA 4CKCA 4LXHA 3M4OL 1NLZA 4URXR 4AF6A 2QL6A 4CMJA 2AN5A 1LJUA 3WMRA 5BURA 4OI0A 3AVVA 2WF7A 4RGYA 1TEXA 3HS3A 2ILVA 1FFCA 5C4IA 1U0NA 3TSOA 4OHKA 4FMCF 4P0TA 1GGMA 1RIFA 3K15A 1XALA 4FFBA 4LF6B 1RU3A 3GVIA 1OFHA 2AKAB 2Z8ZA 4NEGA 1TAUA 3O8CA 5ADVA 1XTZA 4K3UA 4R2WA 1Q0TA 1OXKB 3RCBA 2NQTA 1L5SA 3OHPA 1NA5A 3QEBZ 2BE5D 2OCIA 2HU8A 1T3SA 3NHMA 3T5AA 1XTQA 2A1TS 3NP9A 4G1EB 5ARDA 3JTMA 1IN7A 4OUDB 1UOOA 3HDGA 3VR3A 3S1ML 5AOVA 1GKYA 1CR4A 2XIQA 4K5QA 3U3ZA 1GNQA 1ZESA 1T24A 2FLWA 3H75A 2PV7A 3T3IA 1X7ZB 2B94A 3KC2A 3NAGA 4YS6A 4D4JA 3TLKA 2XZOA 3HXTA 2XJRA 2ERXA 2PCJA 5LQAA 5LU9A 1W36D 1AT1A 2KBFA 4L0DA 1AQNA 3NXSA 2AOUA 2J4CA 1STOA 3C1UA 2OQ2A 4TT3A 1ZSNA 1I4WA 1K86A 4G07A 3WADA 1YBVA 5D7NA 2JLVA 1OT5A 4HNHA 4FHGA 4KAXA 3V9PA 2RHGB 4DCGA 4ZV4A 3B0AB 1TKRA 1YR7A 5AW2A 5IC4A 2J6CA 3W2GA 1XZGA 4XWAA 4BKQA 4BQEA 1V37A 1UBOS 3IELA 3MT0A 2ZTMA 2OYRA 1EM6A 1RWMA 3JYNA 3GJTA 1B6TA 4DUGA 1P9RA 3KEQA 1A97A 3QXSA 3UAOA 2FFRA 1L4BA 3MG9A 2BFPA 1P8JA 4RO0A 4PZEA 5HUQA 4I9NA 4RENA 1NPTO 3IAUA 4BVEA 1ENZA 4HQ6A 1GPUA 3F5FA 1YHZA 3GDGA 4JT9A 3GFSA 4OQNA 1V47A 1VC2A 3REFA 2VDUE 1QH8A 2DHDA 2HA3A 2PG3A 5GVSA 1AMNA 3WGIA 4IX1A 5LYYA 3F9RA 2FFHA 2QN7A 2HGSA 5FEUA 4TWIA 3HJNA 4BFZA 4B71A 2L18A 3U7QA 5BVHA 3G17A 3CQ9A 3B6MA 4JP3A 3JWEA 4P93A 4BWVA 4M8NE 3BMQB 4AJJA 2M6LA 3FMVA 3FBWA 4YDQA 4FYYA 2IBTA 1U2GC 1W5AA 4YGYA 2RAPA 1ZM3A 1RQ7A 3CSUA 3R6LA 4PO8A 4F97A 2GXSA 3O73A 1QO0D 1P2GA 3IOBA 3OJOA 4A23A 1Q7CA 2LP4Y 4B33A 3QLEA 4ANFA 4M37A 3GOQA 1DGQA 3A9CA 1GLNA 1V3UA 1R9NA 2OAGA 3SDZA 5AYVA 3AILA 3TQHA 1BS1A 3LPCA 1M1YA 5BN4A 2QVBA 4JASB 2ZWPA 1D1SA 2GCEA 4AU1A 3E5RA 4KR2A 1RKXA 4HNUA 1LH0A 3KCQA 1HUQA 4TWZA 4Q7EA 2WAXA 5IKXA 3ZDDA 2FTKE 1P4RA 2W6QA 2HFJA 1FLDA 1RI1A 7REQA 1QFZA 4RHFA 4R16A 2GBFA 4RPLA 4YRJA 1Y5MA 2ZJAA 3OZDA 2NZUG 3THWB 3QE9Y 4HQKA 1QMPA 4DZZA 4S0XA 5IYDL 4GDMA 4UPVA 3STHA 3PQ3A 4C03A 1YONA 3W78A 4TL7A 2BYTA 4G0XA 3ORRA 4MR9B 1FE8A 2C2GA 4IS2A 1OILA 4FYKA 3VZQA 2NUBA 1XF1A 1SBCA 2OCXA 2Q3CA 3GJ7A 4KWIA 4L73A 4DDVA 1GG8A 2CBXA 5YASA 3EMDA 2FPOA 1O4WA 3KG2A 3OF5A 5ESRA 1IUNA 2DLNA 1V7ZA 1KMMA 1Y1QA 2EKPA 3QVMA 3FYUB 1LTQA 2IH2A 1NXEA 1C9KA 2D3WA 1KMNA 3E82A 2F1JA 2I7VA 2NZYA 4Q7MB 5F64A 4BCCA 3PSHA 2QM0A 1DEKA 3C1TA 3R6DA 3WYFA 1JAXA 3I73A 1XDGA 3U39A 3GLIE 2GTIA 3TL3A 1GQFA 3PUZA 2Q3EA 2AHRA 2E9SA 2J30A 2P6MA 3AM5A 3CG0A 3L0BA 1CUWA 3EN0A 1PEKE 4KQIA 2X42A 4D4HA 1C1DA 4C0KA 5EJ4A 2FA9A 1SUEA 1EINA 2QRGA 3D4PA 5ABPA 1QTRA 1BA2A 4UPDA 3W5SA 1THZA 4LHXA 1JHXA 4R7TA 5CXSA 2OMKA 3DFFA 3AERA 3QLVA 1YJQA 2WT4A 3BMXA 1NV9A 4GLFA 4GPIB 4I4IA 5FTWA 3K2EA 1NATA 721PA 4W5TA 3AYZB 1KO7A 4WZAA 3DFKA 3O83A 4B17A 4EHHA 3O94A 3N39C 3KFVA 2RG7A 1XQWA 3BXPA 4D80A 2C4VA 3K0HA 1T3ZA 1YL6A 3Q0TA 1K75A 2VP4A 4LTMA 1ISMA 1NVEA 2Q1WA 2WJIA 4JQSA 5E7QA 2QAGC 1UZAA 9LDTA 2G9NA 1YZVA 4OP1A 2M4VA 1OCEA 1LBTA 4DTCA 1W34A 1EG7A 3LKBA 5GM1A 3FROA 4OGWA 1W5EA 4OJNA 5EKSA 4BMDA 1P3DA 5JATA 4EWLA 4CEHA 5FR1A 2H1VA 3W5HA 1W4ZA 2R2GA 3AF5A 3FZYA 3PHIA 4F38A 2Q2QA 4YRPA 1I33A 2X13A 4DSOA 2HNAA 4XH9B 4QXRA 1KI8A 1OGIA 1A5ZA 2FGKA 1QIFA 3GLSA 3I53A 3L8EA 4M1TA 3URMA 1YASA 4CPDA 1E3DA 4QBHA 4UVEA 4BMZA 1G8YA 4D9KA 1ZU4A 4JBYA 4F91B 1SWVA 4I4CA 3SDBA 4Q7KA 1TIPA 4G8CA 3WMEA 2Y0CA 1P60A 1L8OA 4PYKA 4EF4A 4LBVA 3DZBA 1DJLA 4MO2A 1VMAA 5JPIA 4ZI2A 2VRWA 1FVOA 1MC4A 2WNSA 1A4IA 3G8CA 2EDCA 4W4TA 2AMYA 4WD3A 1W5BA 1WZUA 4X1IB 5BR8B 4EJMA 5TMPA 3HA5A 2VYVA 4LY6A 5EA2A 5FNZA 4YONB 1MQ8B 2H1HA 3GFFA 5MDHA 2JD0A 1OT3A 3JYQA 4NCIA 4Y98A 5JFOA 3TX2A 2F3SA 2I6UA 4D99A 3FIJA 2XWBF 3T9FA 3MAJA 1RPNA 1K8QA 3M1IA 2DERA 1KRWA 2GCPA 1MR3F 1TK2A 3A58B 1DEHA 3MTBA 4LI3X 4O2RA 3FTFA 4P4GA 1HEUA 3DT8A 4RELA 1I36A 3BF7A 1EDZA 2GLTA 4HZGA 2PY6A 3L4BA 4O5OA 2G88A 2ZJBA 5I9NA 1T0BA 2Q3JA 3RIEA 3BIJA 4PZDA 1TI7A 2AC7A 2OV8A 3L0OA 3TZHA 4BVLA 3HYSA 1IHPA 4DCSA 1S2GA 2G40A 2XDQB 4MRMA 2F1RA 1M0TA 3BE8A 3BRWD 1KO8A 1SBYA 1IPFA 3ND5A 4K9PA 1E1NA 4IIEA 3GZJA 4MEJA 4QQFA 4DJFC 1GTG1 4R3WA 5DWQA 5AWFC 4L2IA 2I8LA 1X6VA 5C4MA 4Q3KA 4BN0A 3PT5A 3PRYA 3IDOA 2GK4A 2BEVA 1FUEA 2JCSA 3ETLA 1NVKA 3MUNA 4PLTA 4U9UA 4DCJA 4XAQA 4DCCA 3IMGA 3KAKA 4CLDA 2P1ZA 3UNXA 5F52A 1Z4OA 1O8CA 5TGDA 2XCLA 1E5LA 2YY7A 2OYCA 1QH9A 1M83A 1SY7A 2AHOA 3C8UA 3HY3A 2XMDA 3STYA 1RJ9B 4C88A 3FBGA 5M2QA 4OXNA 4C01A 4V0SA 3UHPA 5IJZA 4F2DA 1S0UA 1QGYA 1GCGA 4FEYA 2RHLA 3PZAA 4JY7A 4WI1A 3KQUA 4LVUA 1I5EA 2AI3A 1XMPA 1PV1A 1BJKA 1SKYE 1SRRA 1SULA 4E5KA 1B1AA 5L3QB 3LY8A 2NW6A 5KZMB 4DNQA 1AGRA 4EG8A 2QN3A 1NU8A 4N3GA 4PZPA 3VSBA 4OM8A 4U2CA 4I4TF 4X20B 4LDRA 3BA1A 1L9XA 4NNOA 5EHNA 4Q4AB 4DMFA 3FZNA 4M7OA 4D8UA 1KYYA 2QNRA 4MIOA 1HQKA 4AKEA 4AF7A 1N6IA 1RBQA 1S3SA 4UVGA 4ZRNA 5TPZD 4LDAA 2YMPA 1QC5B 1SVLA 3CZ9A 3BG5A 1EZ4A 4KIUA 4G3XA 4MS1B 1SXIA 3HKZP 3A1EA 4UARA 3W6OA 1NJSA 2C3OA 2RCYA 3DO8A 1OIXA 3NWPA 4PF1A 3G89A 4U7TB 2GHQA 4YDSA 5K0LA 5DLPA 4AZ3B 1ODKA 4M89A 1Q1AA 4RW0A 4ROSA 1JFTA 3A4NA 2WDPA 4LQDA 1FS4A 1E9VA 1R8JA 5ALKA 3SLRA 4ESOA 1G291 4TWJA 2D2FA 1ORTA 3Q3CA 4GRAA 4JNCA 1B8OA 2CWDA 4CEJB 2RIPA 4HAVA 1XVVA 1SUAA 1XDSA 4M1KA 4OX9Y 3F0TA 1GT6A 3QFSA 1AUVA 2OGWA 1HV8A 2L69A 2JJ2A 1TKAA 4LW8A 5JS1A 1DARA 2DHCA 1DFIA 3IP6A 1ZJYA 2IYTA 4OF4A 4TVKA 4RTKA 2AL7A 2MJLA 5KQSA 1Q15A 1J1IA 3NHFA 5IULC 3NRCA 4FR5A 4G4IA 4E3WA 3TTSA 2E4XA 2P4HX 1SXGA 2JFFA 1J22A 2RFKB 5TEVA 6NULA 2HF8A 3JAWA 1M5UA 3AV3A 3PYXA 2QVLA 1Z6GA 5DASA 3WLHA 1M72A 2UXCB 1PS0A 4LQCA 3NEYA 1CDDA 3Q3HA 3KM0A 1KI4A 4EGCB 1J2YA 3VOAA 3TTVA 4LRXA 4II3A 4RVUA 2YKGA 3GO4A 5DU2A 3BB1A 2I03A 2O3RA 3U26A 1C30B 4YAGA 3NHZA 1Q19A 1F2VA 2OILA 2P5YA 4ZI7A 3A6KA 1DIAA 5DLDA 1TFRA 1TXGA 4ENRA 4PZUA 3ORHA 2QX9A 4JADA 2DTXA 3GVXA 2PUGA 1JDNA 2PBLA 3GRVA 1FQJA 1N8TA 1FDTA 1PGPA 4HZUA 5IBRA 1T6BY 2RGDA 1D1QA 2HOQA 1TZBA 3OLYA 4IIFA 1M10A 4D9GA 2PVSA 3TJMA 4CIBA 1WTCA 4F56A 2B78A 3WAKA 2WIGA 1U5BB 2R6DA 4E5MA 3NB0A 3WI7A 5E6SA 2FOLA 4MYRA 1DBQA 2WPDD 3FYUC 4MRVA 4EI2A 2P9EA 4OBWA 3BRQA 1KFBB 2O4CA 4QJ4A 4IJWA 5CLIA 3VAAA 1GNSA 1RWVA 3F7NA 3B5JA 1QS0A 1NASA 3WKCA 1Y6FA 2TMGA 2JG3A 2XJQA 2EDAA 3OEWA 2DVMA 2XMBA 1WOMA 1JU9A 4TMZA 3GLHA 2J9RA 4JXKA 4KVFA 4V0KA 2H48A 3UIEA 4WBNF 5JADA 5C5DA 2IEYA 3H5RA 4MJLA 4MQFB 1UXGA 3CH7A 4UVDA 2Z3VA 2IZ6A 3L46A 2LDBA 5HF5A 2EW8A 2Q7OE 2I2DA 1SJ9A 1S8NA 4FS3A 1OH5A 5HIMA 4WEQA 4RWEA 1XTTA 2VL7A 4FEGA 3BVPA 4N82A 2H1RA 4TV9F 1JEYA 3K6RA 3T6KA 5JWRA 1E6KA 1PT8A 3LG2A 3LHKA 1P7WA 3DGEC 1NAHA 1QVZA 4Y9SA 2ZUDA 2XI4A 1NKSA 2DFVA 4I19A 2GFIA 1VHDA 3ROTA 1RAAA 2ZJ5A 3IIEA 4S1WA 3T0GA 5FL3A 2C4UA 1FSSA 3CCCA 3F9CA 4PV7A 2TECE 3TVYA 3E7WA 3EGCA 2JBAA 1R6DA 1Y6ZA 5TX7A 1EWVA 4HDSB 1XKTA 1GZDA 3HE3A 1GQ2A 3K1AA 3C3KA 4PLWA 5FL7A 5B7QA 4H7PA 2GEFA 3KZCA 1HY3A 4XCXA 1DJOA 3NBMA 1RCTE 4MQEB 1CQXA 4LXGA 3KTFA 4YWJA 3T9BA 1P2DA 1JQ5A 3IAXA 4R51A 4UUBA 4S35A 1IEVA 4A3FL 2WUEA 1T1EA 5U9CA 1C1XB 3OEED 1G42A 3ETGA 3RAGA 1SMMA 1C8BA 1AGXA 2XW6A 1SHLA 4OHWA 4RNDB 1Z5ZA 4EGAA 5HUHA 2KB0A 3PDCA 4RY2A 5TRTA 5J2TF 2GZHA 1GEEA 1CP2A 3U49A 4A1FA 2A5FA 3C41J 5DHUA 2WG2A 2YW2A 4BDSA 2WU1A 3FPEA 1YR6A 5TGZA 4WZBA 3GTJL 4FNOA 1L5NA 1JE0A 3A36A 3P9YA 5HVNA 1AH2A 2PZEA 3T7DA 3CS3A 3T06B 1RQXA 4NULA 2OP0A 4PO9A 4PGGA 2BFFA 1NXGA 2EZ9A 4EITA 5I51A 4RTQA 3PC2A 2NT3A 2ZT6A 4CM8B 4A4DA 1OYVA 3GZ4A 3GU3A 3UAZA 5I48A 5AI2A 3P45A 4Q6WA 1XVIA 2MSEB 3JAKA 1MV5A 3WWNB 4HAZA 4FFSA 5LYJA 4UNRA 2NU7A 4G67A 3L84A 2YFQA 3EULA 3N74A 3TJRA 1KZ1A 5TDHA 2I1VB 3RR2A 3U7IA 4OGLA 3SQXA 4ZANA 3HYNA 2WWIA 4PX2A 5HTOA 1V48A 3PFWO 4JBNA 4DBLE 3ML1A 3TWOA 1NNLA 3UWMA 3HLTA 1I2CA 1HR0B 3HY6A 4AX4A 3MJRA 2X3FA 5INTA 4OKIA 2D62A 3QKRB 5LQRA 2BKEA 3PC3A 4IW3B 4CV1A 5AVTA 3NGLA 1P4HA 1VLZA 2J3KA 3KQOA 2VSXA 5KVSA 2C97A 4B6SA 4IY1A 2RGGA 3VPCA 3KQLA 3WLMA 1YXMA 1Z8FA 1FSZA 4L3WA 3EZXA 2OD7A 5D85A 2PMCA 1ZSVA 1U1FA 2W2LD 3A1VA 4UEKA 5GADl 1HA3A 2PYIA 5C8ZA 1UINA 3FVQA 3QBEA 1H2EA 4LMBA 1NN5A 4ZV7A 3RJ5A 4X62B 3E8MA 4OAPA 1CUZA 4RFSA 3IHWA 5GADc 3ZX4A 4IFEA 2HMVA 5JECA 2XIJA 4KGDA 1I1QB 4AI0A 1DSSG 1N7IA 1OE0A 4CQMA 4BFVA 1ZKDA 2WE7A 3Q7IA 3QJGA 4HTAA 3EA0A 1XEFA 1AUQA 3KU4A 2MTBA 4YC7A 3KJIA 3GLFA 3SD7A 1P73A 5HF6A 4B43A 1JQKA 3OZCA 3LYUA 1REQB 1LBQA 4DR7B 3B8EA 4MVXA 1LRLA 5EMKA 4RJLA 4XD7A 3UA4A 5FWAA 4CDMA 3VPBA 3H6GA 1HPLA 1WD5A 2I78A 3HZRA 2ZI7A 3OLQA 5D3ZA 1RJWA 1DQNA 2PZGA 3RUDA 3IQFA 2WSLA 3D7KA 4D25A 3WFJA 2IE8A 2GLXA 2AUTA 4MO9A 3VR5A 3BK2A 1WOYA 1HL7A 1QIJA 1BKYA 3R4VA 3GJSA 4N5IX 4UUQA 1T2AA 3V7YA 1P29A 4PGMA 1DZIA 3PNVA 2I34A 2NVOA 4E5VA 4PQGA 5IUJC 2XGMA 2YNMC 4DY4A 3CLRC 1K97A 4FDUA 1DLIA 4JI4B 2CXSA 3MJHA 3WTCA 2I2WA 3ROGA 3MVEA 4LE2A 2CDAA 1ZD3A 2VOEA 3ANMA 3D1JA 3GEEA 3HP1A 3KKKA 3R44A 4J9UE 2ZWMA 4AP5A 4POOA 1IJEA 1L7RA 1RPAA 4YJHB 4CBVA 3TW0A 1G9TA 2FQWA 4CTKA 4EA9A 5AHKA 4AKSA 5IUNC 2WHYA 2V0EA 3FOWA 4RH0A 3A0UA 3H86A 5A03A 1DRKA 2C5LA 3FX2A 1EFLA 5LQKA 3CF4A 4UTXA 3JQ7A 2JAHA 3V8QA 5T7BA 2C78A 4WSOA 3FXAA 4IUDS 4MI1A 2VS1A 5CFPA 3WE7A 4AY6A 2X0IA 5JCPA 3EIHA 3IKLA 4GI5A 4CKZA 3GUVA 1N78A 1L6IA 1I2MA 2YXNA 3AUYA 1TWHL 1RI3A 1WM1A 4AICA 3KALA 4DC0A 1PVDA 3PJFA 4GH5A 2QTZA 5C53B 2V4UA 2XDYA 1VPTA 3L8FA 4HEA6 1PYGA 3KTOA 3SC2A 2LCFA 1PVVA 3D3QA 1LEHA 5AXBA 3TYXA 4CF4A 4KRYA 3RSHA 5K0BA 5DYIA 1UBMS 5REQB 3II6X 3H5WA 2QK4A 1TZKA 3FAZA 1YRQA 3L0IB 5FPQA 2AWNA 3UHAA 5SY4A 5I9IA 2IHUA 1P44A 5DBFA 5DJ5A 2GYWA 3ZTYA 1KYWA 1S2IA 2PH7A 3A3NA 3A1SA 1CB0A 2EFJA 4AG3A 3H2BA 2XXJA 3PFNA 1D6NA 5A2GA 4CTMA 3DO5A 3L9WA 2WFMA 3T3HA 1DQSA 2CVPA 1YB1A 1UEXC 4OMUA 1N2CB 4CKEA 1PS9A 4KR3A 4X1YB 4ZN1B 1EX1A 4REOA 2JIRA 2D1TA 5EWLB 1VE5A 3IUSA 1IHOA 1KEZA 4L8VA 3TM5A 5GM2A 3N8DA 1F2UA 1W87A 3TQRA 1Y6GA 3AQ4A 3KJNA 2EBFX 4V02A 2ZOSA 3A3KA 2AJDA 3PT9A 3RS3A 2QRUA 3DE7X 1ONSA 2O0HA 3M5PA 1RLUA 4DADA 1G5IA 2LRHA 4AJ4A 1XTUA 4TRRA 1EHCA 4P3OA 5JCOA 1PD1A 2YIDA 4K9SA 3HKBB 4UM7A 4YGXB 1SUBA 3DAYA 4R1QA 8OHMA 4PIVA 3X1WA 3RIGA 2MINA 1UKZA 3H4TA 1LPSA 2MYTA 3Q88A 1MN6A 3VH1A 4EYOA 1Z6XA 1BXGA 1JYFA 1XLTA 3DONA 3T3MB 4PC2A 2WJYA 4DJAA 4RZXA 4MUMA 3GG2A 3VPXA 5KOIA 2PYAA 2WVHA 4GX5A 4IZOA 4C1NA 1GTSA 4KNVA 4J1NA 3RVQA 2K7FA 2OENG 2C0PA 1KEVA 2CFRA 3ZHBA 5AUPB 2LXNA 1ESMA 1QDEA 1S1MA 1UC4B 3K3PA 2F4NA 5CLQA 4YJFB 1DX9A 4RZQA 2Q5CA 3OG9A 3U7QB 4YQYA 2QVGA 3VC1A 4W7HA 2YWCA 3GPDG 1QBKC 5KYWA 1ND6A 1DV1A 2C2HA 4KO1S 2Y3IA 1WDTA 4US0R 1OAKA 4ZEWA 1PSWA 3TZBA 4LRQA 4ZQBA 1OU4A 1K68A 3IPRA 2P4EA 2NAPA 2VAWA 4K6HA 4CKCB 2QN9A 3INTA 4GX1A 4MWOA 2RAUA 4G23A 3RIYA 2XZTA 4GOXA 1F1BA 4DQ0A 2PGNA 3P32A 3IAS6 4KRFA 1WSAA 3V7NA 1RNLA 2Q3MA 1JDZA 2IS4A 3ZJ4A 1UBCA 2NZXA 5KBYA 4FB5A 1FDWA 1SKQA 2PJDA 4N18A 1TYEB 4FR0A 4MYUA 4FYXA 2BM0A 2Z2KA 2J0UA 3D4OA 4FFBB 1P5ZB 1IY0A 2C07A 2OCYC 5EIXA 4M22A 4C0JA 1YUXA 2WHEA 3DSRA 4C3HL 1EI9A 3T54A 4E14A 1J56A 1SEVA 2CLIB 1YFZA 4BP1A 4MLPA 2P6OA 4XRRA 3LZ6A 4KDEA 5K8CA 4EG5A 2WD7B 1NX9A 2Y9MB 2X6QA 3JWGA 1F0YA 1ICEA 1FFWA 2B35A 5ITZA 4B6PA 4OLHA 2GCNA 4AN0A 2MSNA 2FLKA 1R3UA 3A2KA 3EIFA 4TYYA 1ZONA 4CIWA 3W3AH 2GZ3A 1MENA 3L77A 4PC7A 1UBEA 2YV4A 3OJXA 5DI3A 3A3YA 3EAFA 3T7IA 1SXJE 4DC9A 3PWKA 1TJPB 3UMMA 3ANTA 3OZVA 1NVAA 2IY7A 2AOUB 3Q5EA 1EUQA 2WM3A 4OB7A 1NPYA 5FHQA 1YE8A 1GZ4A 4FZ3A 3FMGA 3UYKA 3UJ8A 3UJBA 2QE7A 2JARA 2UUOA 1ZYUA 2D5IA 3A2MA 2GBLA 3BIXA 3I92A 2G5PA 3MBOA 2D5AA 3PGVA 3QP9A 4FDVA 4MX8A 4P33A 1DKMA 2IYXA 3QVKA 1G98A 3UAVA 5JVDF 1E1RD 2BR4A 5DO9A 4ZU3A 2PNJA 2V65A 3BXGA 4EJ2A 1SVIA 5FAXA 1E7SA 1PJRA 4WXMA 1DBWA 4CL8A 5KNCH 1K5HA 3BM5A 1EESA 1GUFA 4X63A 1PJSA 1NUQA 4HAUA 3MTEA 4ENUA 5I8WA 3A1FA 4RTJA 4IHJA 2VUSA 3CT6A 4FHFA 4M1SA 1NJ1A 3OA2A 1QIEA 4MWGA 4YJ3A 5AVQA 4HNRA 1ZHOA 1E1LA 1NMXA 1QH8B 2IDMA 3SZOA 5B36A 5C8VA 1ZEJA 3EF3A 5H80A 2A6PA 3V6MA 3TECE 4X92A 1OMOA 1PN3A 2FK8A 3OX4A 1JQBA 3R9KA 5JJ5A 2WKPA 3TRKA 4D8XA 2QX6A 2RFLA 4LEIA 2EV9A 5H81A 5KHLB 1E6UA 3CSSA 4BAUA 4YCBA 5B7GA 4EHDA 2LV8A 4B09A 5IAJA 4K1LA 1CQWA 4W5JA 3OBBA 2GLUA 3DZKA 2HSJA 1TVMA 1TAQA 4QU8A 5CA0F 1JAZA 3RNOA 2QYSA 4MYCA 4UW9A 3T1OA 2OB2A 1ESEA 1MPTA 1AGYA 3DKIA 4G36A 3FSGA 4B6OA 4E5SA 4RF3A 4URWR 2DG2A 1DXYA 3IAM6 4AZ0A 4DKJA 4YRBA 1ACLA 1PLJA 4XGHA 2R8BA 1ANKA 3QMVA 5BN4B 4WXRA 1R37A 2VJDA 3QHPA 3ZPXA 3HVJA 1SIOA 1FC0A 2QD2A 1FFYA 5DM61 3ZJYA 1ZLXA 3RYIA 5KHOC 1X87A 3I01A 1BFDA 3EIOA 3L6UA 4IDQA 3PC8C 1HNWB 2FZ5A 3DF9A 7REQB 4LQ4A 3MHPA 4OQQA 5TQVA 4BDTA 3RSCA 3FAKA 1IY1A 3QYJA 2NU9A 3DULA 2NU6A 1NFQA 3I34X 2ZCUA 2NSJA 3IUJA 3NOOA 2ZUSA 1LRKA 1RWXA 4ND1A 1N5JA 4PWYA 3O9VA 5A3RA 2DSNA 4ZAYA 2F1IA 2WK1A 4BRUA 3O3CA 4HO1X 4PHCA 4MQ6A 4HNSA 1J6UA 1VBFA 3JYHA 1JEJA 4OGGA 4ZAWA 2ZM6B 1F0KA 5J4YA 2XBUA 1RLMA 3AVYA 1TD9A 2X2PA 3MJDA 4JLJA 2UKDA 3IEIA 2A9OA 3TLYA 4FZJA 2HFKA 2ZUFA 4JEIA 2DOKA 4P54A 3UJNA 3QXXA 2P78A 3ROZA 3NJ8A 2LCQA 2A1UA 2Q8NA 2ZTUA 3CWCA 1NKVA 5AVOA 2NO7A 2DHEA 2QXYA 1RYBA 3QWHA 3TRFA 5BV0A 1GTMA 4TQAA 3TXXA 5CCXA 4NEQA 4Y2TA 3WK8A 4UNPA 4C06A 2A94A 3T12A 1JVNA 3NX4A 2XZPA 4PZ0A 2QOEA 3TAXA 1NJGA 3WISA 1R9TL 5AW3A 3AERB 4DQXA 2BN4A 3SWWA 1NI3A 4AR6A 5FH9A 5BWCA 5JI2E 5CNMA 3I6MA 4WZAB 3G3EA 1HSZA 2VZEA 5CYOA 1N36B 5E4FA 5CITA 3ANSA 1Y42X 4DIMA 5JQWA 2HN9A 3TUIC 1DWOA 1KGDA 3D8BA 3LGXA 4NBLA 1NBIA 4H1VA 4IL5A 3TW8A 1S8OA 5TVKA 3WLKX 4X94A 1A9QA 1RFLA 4F46A 5FI3A 4DA6A 3ZDXB 5DB4A 1FS6A 2IV3A 1GGJA 1XHEA 3QKSB 1UJ6A 5M04A 2CHQA 1NY5A 1NXOA 4ML3A 5K4GA 3TNYA 3NEAA 1P1RA 3OC6A 1EA5A 2FPPB 1K0FA 4GO1A 4Z1OA 4BJ6A 1X74A 3M81A 3H11A 3NLLA 4G8BA 2C00A 3N8IA 5GONA 3UMBA 1Z83A 3GCZA 2VLIA 5H8WA 4ZVQA 4EVRA 3UK0A 2P3OA 4N0MA 2VNKA 4EPWA 5LLTA 4LXTA 1EFVA 4R7ZA 5DEIA 4NE9A 1NOKA 1GCAA 1ZK3A 4MVJH 4BQPA 5IKMA 1EUCA 1SUWA 4D1YA 1NVDA 1YZNA 1Z5VA 2ROQA 2PHZA 3I09A 3PHHA 1E8DA 3MPUA 4WPGA 4BZXA 2Y0SP 3U3XA 1F6WA 3FUXA 4PYMA 1DKQA 3WTBA 4ZYUA 2AMVA 1FEZA 4DARA 3DWGA 3EXEA 3I12A 1GQSA 4WN9A 5SV2A 2N0SA 2X9LA 2SICE 2Q9UA 4CMCA 2HLDA 4PQRA 2IGTA 2H4ZA 3U9TA 1JLHA 3DL7A 4OXYA 4DPMA 4JEMA 4BPRA 1SCQA 2XTJA 1SVSA 1DO2A 4LJ5A 1IB0A 1XEWX 1J1ZA 2QYOA 3OTWA 4JBWA 2J9XB 4PZCA 1CEEA 2DBQA 2ZJ8A 1Z9BA 4PN7A 1VJGA 3V97A 3N3AC 4G5FA 3DTNA 2Y68A 4OPMA 1O97D 2EARA 4U9HS 2BM8A 2ISQA 3L05A 4GE0A 4I7EA 1E6EA 1RZRD 1H3EA 1YDFA 2Q5IA 2QIPA 4PCLA 3G6WA 3P2AA 5EUBA 2XEXA 4OI1A 4UTVA 3FOZA 2VDQB 1KXZA 4MRMB 3W9SA 5TXGA 4IGIA 2IT1A 5DLEA 2UZ4A 3HH8A 1LPNA 2O2JA 4L8LA 1YGYA 3F1LA 4KQCA 1CIJA 1Q11A 1YDWA 3K16A 5M29A 2VCEA 2V6BA 1AQYA 1AB6A 3HBJA 1DX6A 4C7OA 1ZAKA 3MJSA 1KEUA 3QFHA 4HC4A 1G9SA 4HQOA 4RDCA 4BC0A 4ESEA 1UBRS 1VCHA 2FPGA 3NOQA 2RGBA 1L7OA 3F3YA 1U1GA 2VNJA 4Y2JA 4J29A 2AFIB 4OHYA 4F60A 1ML3A 4F2GA 3WAJA 3WLJA 1JHYA 1PFGA 4DSNA 3DB2A 4IH1A 4PZLA 5KX5A 1YQXA 4B6GA 2Y1LA 3G0HA 4Q9DA 5A4DA 5C35A 1QIDA 2GI4A 2CCGA 4XSVA 1T5IA 1DE0A 4C7VA 1CJBA 2EX4A 2YJZA 3PE6A 3SHTA 3KYIB 4JODA 4E2XA 5MLC3 4FZVA 4RJJA 4CKYA 1OX6A 1CG6A 1TF2A 1J2RA 5CT5A 5HR5A 4AURA 4D82A 1JLRA 4R2HA 2RBEA 3PD1A 2CB0A 3H3VM 2QR2A 3ETHA 2Y67A 3N6RA 1MJGA 1W76A 1W8IA 2AMJA 2AX4A 4P4SA 3RHTA 4AKIA 3BFJA 1R9GA 4BQQA 1WW3A 3A70A 2P9YA 3NKFA 3UG6A 2UZ1A 4Q9NA 5LXTF 1SPBS 4OG2A 2BISA 4XLTA 5JNVA 4JZYA 4AY5A 3PWFA 3O2SB 2O2YA 2CLCX 3IDAA 2VYCA 4IF4A 4DSUA 5L3SB 1G2PA 1AUXA 1E9DA 4U7WA 1CK4A 4I1IA 3RFCA 4H1TA 3PCRB 5EE3A 1TIKA 2QXUA 4AROA 4N6NA 4RIEA 1MB0A 1SCNE 3N2NA 2J0EA 2XZDA 4K28A 2WJHA 4WLVA 2O8DA 1SIBE 3IGFA 3HADA 1JFVA 1QQTA 3P2EA 4JL8A 4C20A 4G9EA 1KY5A 2D7JA 4GFDA 4CT5A 3IP7A 1AKNA 3NGXA 4Y52L 4JC8A 3HYRA 1LDYA 3I9LA 3QYPA 1CR2A 1Y8QB 1ZRPA 1FMLA 3EISA 4EO9A 1XZFA 4OHRA 4L4UA 4X6AL 1QK3A 1WY7A 5EMNA 2Z3WA 3AEYA 3VHXB 3WO1A 3ZGVA 5C3MA 1O87A 1PDVA 1UODA 3L0SA 4LJYA 5EGSA 5FJJA 4WVFA 5DVZA 5DW0A 3JAWB 4G5YA 1YQGA 5LZ4A 3W5CA 4L4RA 3KOOA 4BNFA 4KQEA 1I2DA 1OOEA 3C3WA 2V0NA 4I6GA 4Z51A 2A9QA 4CODB 1RHUA 2X4GA 3FLMA 2AG0A 3FNBA 4AVYA 1E3MA 1VA5A 2EWVA 2DWCA 1NW9B 2OBFA 1PFVA 4ZI7B 2Q0SA 8ABPA 1Z13A 4AHWA 5KTRA 2NP7A 1Z2NX 2XV1A 4B7CA 4IVRA 3AHFA 1YV1A 4CUZA 4RTLA 2I80A 5A5FA 1MCZA 2VPIA 4HZUB 1TO1E 3DL4A 1LF0A 5E4JA 2BP7A 2N46A 4I1OA 1IN5A 4G84A 2M6SA 4QA9A 3V8PA 4JP5A 2XJUA 2BR3A 4JU9A 2VQ6A 4B8ZA 4F3CA 5K0GA 5LWQA 3NNSA 5E6SB 3ZE7A 4EEZA 4H1HA 2WD8A 3VA7A 2AR9A 4GWKA 4DDKA 1R6UA 1ZSYA 3FLBA 3LDHA 3PNOA 3L82B 3G23A 3SR4A 1AK9A 2JANA 2Z30A 4Y6GB 2VHZA 7GPBA 1EWQA 3HB7A 2ZAMA 4A82A 1QS0B 4QYTA 2GYVA 3AKEA 2EHDA 1Z92B 1Q2UA 1WB6A 3GROA 3MYRA 2BMVA 2EG9A 1HKHA 2V0CA 4O4LA 1B93A 4EMTA 1BA3A 3AIOA 1A5BB 3W9UA 4FYVA 1NBEA 1OH8A 1HRKA 4ZZ3A 1JTFA 3HVKA 3LDUA 1VKNA 2P40A 4HPXB 3K9GA 1GILA 2OL4A 3BAFA 1EEXB 2XNCA 3OZXA 1RAFA 3FWYA 3PQFA 3HR7A 3QLVC 4M21A 3QQ5A 4WOCA 4UTRA 1JH8A 2EJWA 4HQNA 4IF6A 4Q24A 3JSXA 1OWBA 1SEPA 3QFCA 4IKOA 2H31A 3ADPA 1W1UA 1JDBC 1F12A 2R8YA 1M2NA 2R8XA 4XA8A 2Q5QA 3EDMA 3L0YA 4FDAA 1N25A 4L5BA 5JS6A 3K9WA 1UL1X 1H05A 3GZTB 4JH0A 1K7XB 3TD9A 1AQUA 1Z39A 2O20A 2P2LA 3OFJA 3VR6H 2JBAB 4Q5IA 4ZWNA 1YJXA 2YIMA 1XTSA 4NCHA 5MFPA 3TINA 2HEIA 3CIOA 2ANCA 1VKOA 1Y6JA 2B99A 3C6BA 2JATA 4YTEA 5K0CA 1C1YA 1PR0A 4K8OA 1G7CA 1RHQA 2XF2A 3U2QA 2J09A 2IFTA 1IHUA 1DKRA 1JXMA 3HVUA 4PRKA 1Q0HA 3FNHA 5F3RA 5BNZA 3KDPA 1CY8A 2UZ0A 3ZDZB 1UDRA 1VBMA 1E7QA 5AQEA 1MW9X 5K99A 3RUHA 1TB4A 4BO3A 4DCOA 4UVIA 2CXOA 3AR6A 3G9QA 1H94A 5JJCA 3ENWA 5MGBA 4UUMA 1WU7A 1YC5A 3K8QA 3QY9A 5JD6A 1VPLA 1U2PA 5JZSA 4A3IL 1E5TA 1ZH8A 2C61A 2FPMA 4WZBB 4EF6A 1F8GA 4DSAA 1VSVA 2QD5A 1GFSA 1E59A 2R1TB 3IKJA 4ASUD 4BUZA 1Z2DA 2V7TA 5AKGA 5D3MA 2ZB2A 3CQZL 3IBFA 2D2EA 3M3HA 3ZHTA 4PLPA 3TGPA 2I2FA 1RHJA 4Z5XA 5JFGA 3U44A 4YRZA 4QG3A 5KTYA 1YNSA 1E2QA 5HWSA 2QSZA 3JAKB 3LX8A 4XUDA 1V4BA 1GZUA 3BC1A 2PUWA 4KBGA 2NU7B 3RTEA 2GK6A 2VUML 3CRZA 1V8DA 1KFKB 2SECE 4RDXA 4UQPA 3QPBA 4KHPB 1KMHB 1FP2A 2W11A 1P7VA 5CNJA 5EIBC 1SC4A 3GLIA 3ZS9A 5FTMA 4PAQA 1JN0A 4OBEA 4EATA 3WZLA 4RZ3A 3T5BA 1KEWA 3ITKA 4HF7A 1VKHA 4P3XA 1H9AA 1Q50A 2F3PA 2ZSUA 3B6KA 3DE4X 1C4WA 5E0OA 3SEAA 3U3RA 3ZN2A 4BFLA 1FTYA 2IBMA 4XGNA 2B2CA 2PTGA 1OR8A 3DOEA 4FFWA 1FUIA 3U60B 3EEFA 2AYYA 2VJNA 3I0ZA 5BXQC 1ZJ6A 1WD7A 4RVCA 4ER3A 2JH8A 2I71A 2Q46A 3RLIA 3RJMA 4QO7A 4R3UC 2PX3A 1A71A 1SC6A 4EOGA 4QTYA 4X3CA 3B51X 2J0VA 3KUCA 3ZXIA 2DQYA 1XC7A 1SHTX 2IHYA 1Q95A 3JWJA 4HFNA 3USZA 3GLVA 1V1RA 3OOJA 4ND2A 3FLEA 3P9SA 4WKBA 3W34A 1TYBE 2IDJA 2RG1A 4QUEA 5AKLA 2BTQA 2FXIA 1CY6A 1VG8A 2EFYA 2K87A 3CSDA 3FNQA 5DBHX 3X1JA 1MD9A 2HEGA 4OLFA 1CUEA 2QLBA 4Q21A 5DXFA 4CQMB 3SEQA 2CLSA 3TVTA 3LDGA 2CNWA 4Y18A 4W99A 1SKAA 3FCXA 2Z1DA 4G25A 2PU5A 4V38A 3CRMA 3PL5A 3A6GA 3ICPA 2W6MA 2J3MA 4BWFB 2Z0MA 3CO5A 2F55A 4L76A 4I2NA 1XT6A 3VTZA 1KR5A 3B3JA 2G67A 3TIGA 3UN1A 4AX8A 3LWQB 4YRAA 1Z2AA 3DXXA 1USVA 3IMEA 1E1YA 4L0MA 2VRCD 4C7JA 4B7AA 1QXSA 4KH1A 3QGMA 4PE5B 3EPPA 3ZVRA 5B58C 1LPBB 5DE3A 2B0JA 2C4NA 2PUHA 2PBZA 1E3TA 4FCWA 4JENA 4C5CA 2ZUEA 2VJCA 4PG6A 1KSGA 2Y6VA 3IOMA 4EY5A 4N7JA 4YMIA 2PWAA 3EFBA 3VO9A 2ENWA 3ND9A 4RULA 1DAHA 1ZJZA 4NG4A 4H1WA 3ILXA 3A4TA 4RYLA 3V4LA 3F6CA 3TNLA 4L4ZA 6REQA 2O2GA 3X1XA 1Y3HA 1LX7A 1P9WA 2AFRA 4HS4A 4I2VA 2HUNA 2NU8A 4K0KB 3C5HA 2I6SA 3BPSA 3HO6A 3O8OA 2EFDB 3G7UA 3P7MA 2GD2A 4HDMB 4QUDA 5BQXA 3IS3A 2QPOA 1RQGA 4JVNA 3K94A 5CU7A 3EFEA 5CCDA 3JQ7B 3KOWA 3OJFA 3SM3A 4EENA 1JPUA 4ZEMA 1CJVC 3ASUA 4TTPA 4L6AA 2D59A 3GTML 4Z9FA 3K8YA 3UV6A 3KQWA 5EP3A 4QGHA 3BDAA 3C43A 4B7XA 3DEYX 1MH9A 1VFPA 2CXUA 3CLTD 4LZOA 1M73E 1GYRA 1MFPA 3W2FA 2I4IA 3EAQA 2QMOA 3ESXA 4G5XA 4MINA 4B80A 1XZKA 3KT0A 3TOVA 1Z4MA 4C2TA 1MQSA 1Q2XA 3PE3A 5IP5A 4WCFB 4QBTA 3AJ8A 4FXPA 5I01A 2A4MA 4CDGA 1RXVA 4FPXA 3WLEA 1A7AA 1XV5A 2R00A 2R5NA 3I8XA 3UB2A 1NG9A 4HFJA 4H7DA 5LA6F 3N2YA 5FNVF 4Y7DA 2JFGA 5CX4A 4EGJA 4QGBA 1WABA 1VHQA 2FG5A 4GMHA 4I36A 2HCRA 3BGIA 3EWNA 1OLXB 2CEAA 3MGKA 3VPDA 4QFDA 4R41A 5A4IS 3P94A 4L7QA 2FW9A 2PVEA 4R6XA 2VYQA 4FZRA 1IU6A 3EVGA 1SR8A 1HDEA 4JXXA 2A9FA 2O0MA 3LNTA 5MN4A 1B0PA 3BHMA 3ETNA 5B1IA 4DCUA 5IANA 3UW1A 1D0IA 3R20A 4AMZA 3UXHA 2RJ3A 3HWRA 2BDUA 4YDHB 1E79D 1KAQA 2VPXA 1L5HA 3QVTA 4ZYXA 3N76A 5KNBA 1H69A 2J4DA 3TQOA 2Z8YA 2VDLB 3AFGA 1JYBA 1JA0A 2XJTA 1K1EA 2WINI 3HDVA 3Q6IA 2OG2A 4BE4A 3DTYA 3OKFA 4K3VA 3NWJA 1YS9A 1VMDA 1D7AA 4ALJA 1O4VA 2ZBFA 1O57A 1VOTA 4DA9A 2JDID 2ZBPA 1EFHA 2ZWOA 4K46A 2F1OA 4GQBA 5EJ7A 2GH1A 1RM3A 2PL9A 1CF4A 1XVTA 1RMYA 2HMAA 3G0GA