3PKIA

Human sirt6 crystal structure in complex with adp ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
ADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPAWDGPRVLERALPPLPRPPTPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-6
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pkiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3pkiA01
2H59A 4MQ5A 3CLRD 1M2KA 2JI6A 5EJ9A 2UZ1B 4JU8A 1YTLA 4JT9A 3CLUD 2VK8A 3CF4G 4J1TC 3PKJA 2H2FA 5BWOA 4BN4A 3E9YA 1YI1A 4RMJA 1HZZC 2H4HA 2Q28A 2QQGA 4GM0A 4QELA 5DGTA 1PT9A 1T9CA 4TWIA 2WVGA 3HWX1 4QPZA 1OZHA 2Q5JA 5AHKA 2FR8C 4FZ3A 4UUBA 5D7NA 4QQ8A 2EZ4A 4BVGA 2OO5C 5EJ5A 4UTZA 2JLCA 4JUBA 4MPJA 3D4BA 3IAFA 2EZTA 4JUDX 3RIGA 5K6RA 1QPBA 4JUFA 1YC5A 4G1CA 4R8MA 1Q14A 1OZGA 1Q6ZA 1T9BA 1EFVA 1UPAA 2JI7A 3CLSD 2QQFA 3D7KA 3GLTA 3HWWA 1M2JA 2H2HA 4X3OA 3EA4A 4JUAA 3F6EX 2AG0A 5MGNA 2AG1A 1SZCA 2OORC 2VK4A 3OE1A 4FVTA 4MZXA 1M2HA 5EJAA 5EJMA 4K9NA 3GLSA 1Q1AA 3GLRA 2Q5OA 3FZNA 1XLTC 2HJHA 2VBFA 1ZPDA 2VBIA 1U31A 4UUAA 4UTRA 4UTNA 4TWJA 4FEGA 4ZZIA 4ZP1A 1PI3A 4RMGA 2EZ8A 2IHUA 2A1TR 1M2GA 1T9DA 4JD5A 5FYQA 3ZG6A 1U28C 4I5IA 4K9LA 1Q17A 3RIYA 4BVBA 3U3DA 4BVHA 5MFZA 4V1CI 1S5PA 1UPBA 3LQ1A 3FLMA 2H2GA 4GG1A 4K9OA 3FSJX 4Y6QA 4K9PA 4KXQA 5FEMA 4Y6LA 1MA3A 2OD7A 4JSRA 1Y9DA 1YI0A 4UU7A 2IHTA 4UTXA 1DJLA 3JWPA 2C31A 1POXA 3F6BX 2W93A 3IAEA 2VK1A 4IF6A 3ZGVA 4BVFA 2UZ1A 2Q5LA 4F56A 3CLTD 4KPUA 2BRUC 4BV2A 4V1CA 2EZ9A 4Q9DA 4JT8A 4D5GA 1MCZA 1PO7A 3EY9A 5BWNA 1J8FA 1O97D 5EJ8A 4V1CB 1NM5C 1SZDA 4GP9A 2H4FA 4RJJA 2H2DA 3JR3A 2X7JA 5DGDA 2OD9A 4K9KA 2Q27A 4UTVA 4KGDA 2PGOA 2IHVA 2OD2A 4L3OA 2V3WA 4C78A 4Y6OA 2FRDC 1BFDA 2JLAA 3D81A 1V5EA 3PDHA 4RJKA 4UU8A 1YNOA 2JI9A 4JU9A 4RJIA 4RMHA 4BUZA 2WVHA 4C7BA 1V5FA 3GLUA 4O8ZA 1E3TA 2NYRA 4F4UA 1N0HA 4FEEA 4GM4A 4D5EA 3ZGOA 4COKA 2JIBA 1U2DC 2VBGA 2FSVC 1ICIA 5MFPA 5K2OA 2B4YA 1PNOA 4L2IA 1M2NA 4HDAA 4MPPA 2EZUA 4HD8A 1V5GA 5MF6A 1S7GA 4BVEA 5IMSA 4IG9A 1YBHA 1PVDA 1UPCA 2FN3A 1PNQA 2H2IA 4JUCA 5EJ4A 1Z8NA 1O96B 5EJ6A 3EYAA 1PTJC 2JI8A 4K9MA 2A1UA 5K3SA 1YHZA 5EJ7A 3PKIA 1JSCA 2Q5QA 1POWA 4K9QA 4BN5A 3U31A 4BV3A 2H4JA 4J16C 1D4OA 2WVAA 2Q29A 2FWNA 5DEIA 1YC2A 2PGNA 1T9AA 2PANA 4RMIA 2VJYA 4MPRA 1OVMA 5K6TA 1YHYA 1EFPA 1U2GC 2DJIA 3K35A 4GM1A 1PYDA 4GPEA 4IAOA 4X3PA 5BWLA 1OZFA 2NXWA
chains in the Genus database with same CATH superfamily
2FDXA 3E3AA 3WS7A 2WTXA 1NIJA 1P72A 1UMCA 4OQPA 3ABQB 1NVBA 4PPGA 2O54A 2QM3A 1DBPA 2B8JA 4TZTA 3LC0A 4MV7A 3GQVA 4L0MA 1P7WA 4P98A 1XCLA 3JS5A 3BZUA 2XJQA 1OXVA 4K6HA 5AHKA 5ELMA 4ZOLF 3LHSA 1KEEB 3CF2A 3IPAA 3OZFA 1RYHA 2HT6A 5E9AA 1K7YA 2OO5C 4MQ4A 1Z4OA 2V45A 4C3UA 1SBTA 1GXSB 5CYFA 3DTTA 2JDIA 4X6XA 5CLIA 1XC7A 3OQIA 5JO0A 3DUFB 1CP3A 1EK2A 2VXYA 3ABOB 4FYPA 3TKLA 1EM8A 3DBHB 4Y6SA 3GTJL 3ZI7A 3LC7O 1NXPA 2J59A 3RPEA 2DGDA 4BNGA 3GARA 4Z0NA 1H9BA 2B5WA 4CLOA 1FFWA 3BL8A 3JWGA 3ZW8A 3VMMA 1T9OA 3CYFA 3F5FA 3M83A 3QFTA 1QXSA 5C8ZA 5L8VA 3IIIA 4GQBA 3UFXB 3UUGA 4BS9A 1DFGA 1TO2E 2QE7A 3BJMA 1EJBA 4UHHA 5B1HA 1F7VA 1ZN9A 1PI3A 1AGRA 1RAFA 2HDOA 4NMHA 3M6WA 4QHYA 4LBVA 4EG6A 2W8ZA 4X54A 5AVWA 1Y1TA 5HA5A 1YE5A 4MEAA 4R71A 4KNWA 5ICGA 3FH0A 3PFHA 3DOFA 3KPVA 3FWKA 1JPUA 3QYPA 4A0HA 1IBLB 1G291 3F8SA 4C88A 4BBSL 1C1XB 3JYNA 5BRAA 3ENNA 1X7XA 3UHPA 3ZKWB 1A8HA 2JGMA 4BDTA 3HGQA 2DBRA 3WZ2A 3H9GA 3WL6A 1PJBA 5LYJB 2ZRQA 3A9VA 1W4ZA 3K53A 1KIFA 3JR7A 4GZ6A 4E2ZA 1T36B 5AW0A 1ZKDA 4DGQA 1UH5A 4XEUA 4AJNA 2FK8A 3R74A 3ZD7A 3P26A 6GPBA 1VPEA 5THXA 3OF2A 5J2TB 3HN7A 4BMVA 1UXJA 3I2FA 3BCRA 4NFHA 1EYZA 4Q01A 2CF5A 4XEHA 4BE7B 4JXJA 1QP0A 1ODJA 3NU1A 4CKXA 2JI9A 1O94D 4JJ7A 4DCVA 4EZBA 3LWVB 1KSFX 3GJ8A 4OJKA 5WRFA 3VH1A 2NYRA 1SOUA 2PLWA 3M9XA 5E6UB 1BWSA 2YRXA 5LLDA 4M49A 1RDVA 3FHTA 3ZBQA 1ES9A 1JLHA 1R0GA 2RHLA 3AHCA 2HA5A 3H0KA 4KOAA 3S1SA 1PGOA 4B79A 2KI5A 5EUMA 4TPKA 3TNYA 4AIRA 5IEJA 2IYNA 4ER5A 4MUNA 1U2GA 3WLTA 1UZAA 4KO3S 3PD1A 3CPEA 3LC1O 4XW2A 3GEPA 1CS4C 1N1GA 4FJ0A 4IGAA 4R0NA 4XLTA 5FI0B 3RJ5A 4EA7A 4I1OA 5JYCA 1E66A 1HT0A 4BFUA 5F5LA 3NEPX 1VBFA 1V3VA 4X24A 4AURA 3C1UA 1YS4A 3FVQA 3CLHA 1HLFA 4TTTS 2X0FA 2FP3A 3N6XA 2CV2A 2AUNA 2FN7A 4EUHA 5ELXA 1VJ5A 4HGZA 3RT7A 3O0DA 3LG2A 3PU6A 5SZKB 2I71A 2O5RA 2QTCA 4KGVA 5DBHX 3IA7A 5TS2A 5K4HA 5CGQB 3TX6A 4PG6A 2Q0SA 2W58A 2XX3A 4XM2A 3NGMA 4B45A 1AZSC 3OEED 1LSJA 4DQUA 3GTQL 3D64A 2PSJA 4FX5A 3BMNB 1GN9A 1UP6A 1MEJA 1UBTS 5EIOC 1Y5MA 2F00A 2J5KA 1BQ3A 3LWRB 3AUSA 3K0EA 4JLBA 2W6QA 1Y80A 5CX4A 1G66A 1G8GA 3QKWA 3VAYA 1T6XA 3N8NA 3SWWA 4B8ZA 1A8UA 4PG8A 5LBTA 3UUEA 5TT1A 3UGTA 4RQBA 4R7ZA 1MABA 2A59A 3BQMB 4JUFA 1RMQA 2JJ1D 2YN4A 3MGCA 2A94A 1KBOA 1R6UA 1J4AA 2ASEA 1KL7A 1CDOA 4QASA 2DR0A 1BE7A 4TUYA 3SX4A 4E33A 4EDFA 1ZXBA 4EHJA 4WUTA 4B6FA 4RE6A 4EHHA 5BR4A 1G6Q1 1HM5A 4P4SA 1CY6A 3CCFA 4URFA 3EULA 2YYAA 1X70A 2FEXA 4H7HA 5HZMA 4ZRNA 1R5OA 4LVOA 3TYXA 4XQEA 5CT6A 3B0AB 2CLCX 3I61A 1E4OA 3RRBA 3V42A 4UHJA 1V47A 4XQ0A 3UGJA 4DLTA 1S3FA 4EY7A 4ZAYA 1JDBB 3GRVA 2I3AA 3DTNA 2OC4A 2JFVA 3TLXA 3TO5A 4AMBA 3AM3A 3H1BA 4MTCA 3THYA 4DF3A 5CW2A 2YXBA 1DQSA 3M4XA 5EMMA 1DAIA 1QUEA 1LPAB 1DOAA 3ONDA 4JAEA 1LEHA 3OZWA 1T3GA 3JWPA 2VDVE 5GZ3A 4RS3A 1Y42X 4O8CA 4IF6A 2QL9A 2A30A 3RNLA 4MDFA 5FLEX 1XRNA 1S9DA 4EH1A 5I4BA 2QRMA 3HVJA 4AMYA 4QRHA 4Y2JA 5LJLA 1IM2A 1M0WA 4OQMA 1Z17A 1X19A 4A3GL 3QU9A 1ZVKA 3UY4A 4ZDKA 1HKHA 1JDZA 1XPJA 2V6GA 4NXMB 3PFKA 3Q9SA 4WXRA 4EOGA 1JSZA 1IVSA 3R7AA 3OCYA 4MB2A 3WP0A 4LQLA 3GPBA 4JBGA 1YK1A 5B1YA 2IWHA 1RLTA 4GGPA 4I3FA 1RJDA 1W2GA 4NSNA 1B14A 3SS2A 4A8JB 1NNI1 4IOKA 1NUUA 3B6ZA 3Q6IA 4JR2A 4L4UA 4BYGA 1IVNA 3MJEA 2VT3A 3P9KA 4NAUA 4EA8A 1EXMA 2HMUA 1XPUA 4X1OA 3WBFA 1SVLA 4MVCA 5C80A 2P78A 4FD2A 3E9ZA 3DDUA 5EZYF 5JNVA 4RPIA 1CUHA 3CEAA 5IXSA 3PR2B 2DQZA 4M4SA 1ZD9A 1PZGA 4CFSA 1XG5A 3B60A 3T1QA 5E2BA 1Q2UA 2G4LA 2RGYA 3M2TA 2PD6A 3EJ6A 2NMVA 3NRJA 3P2YA 1XRRA 2V65A 3CM0A 3PXDA 4ZQBA 3VOBA 3LKVA 1ADFA 4V196 3K4HA 4IIJA 3SDSA 1YQ9A 2XDQA 4TKLA 3GVXA 1JT9A 4AJKA 2OSBA 1C4XA 4KXLA 1A9YA 5BV1A 2OZVA 4L9WA 1I33A 1W30A 1DBVO 4NZZA 5D87A 1CNEA 1AUVA 2VBCA 3BA6A 1MX9A 3F6SA 3LVBA 3T0FA 4D3ZA 2IPXA 2O2XA 1CAAA 2YWDA 2C58A 1RYFA 2PWYA 4R8VA 3I0ZA 4EQ6A 3IQGX 3J7Z1 3IXMA 1JEQB 3BF7A 2I54A 5CDGA 3V4RA 3MTGA 4LSZA 4TSRA 5K6AC 3TDKA 2NVQL 3SZLA 3F73A 1IW7D 1MJGA 2FZ4A 1PDOA 4RJLA 1P74A 4IHJF 2AR9A 2Q8QA 3EVBA 5D85A 5CD1A 1L7AA 4HAUA 1R6XA 2YXPX 3BRWD 3T7CA 1OV6A 2R8BA 5ED4A 2GSWA 2OC9A 4O4IF 1OE0A 2FUKA 3H0CA 1E9VA 2J0EA 4I4NA 4IHJA 2SNIE 4FQ5A 4G1CA 4DCCA 3IBSA 4PQFA 2H17A 4EJ0A 4ND2A 1T1JA 4BIMA 2ECOA 1Y9ZA 2MYUA 2Z0MA 3L9XA 4G0OA 4MVYA 4OHVA 3HXQA 1VGQA 3DVRX 3U13A 3V6MA 3QHQA 4ROSA 4MYTA 1QZTA 2KYRA 2OZLA 3OOWA 5KSYA 5K8TA 3UATA 2WIJA 2XTJA 4R1MA 4RBNA 3E7PA 3JQ6A 3S2DL 4JD5A 3RAGA 1PJQA 1R0XA 2CHUA 4H0CA 5BV8A 1Q19A 1Z28A 5GJWC 4KDCA 4Z3DA 2VDUE 5IC4A 2YUTA 3BMOB 4AZWA 2ZATA 4Q48A 3PI6A 5FBKA 3O95A 3T3MB 5JATA 3K0SA 3JYLA 3NHBA 1O9GA 3OLZA 3F6YA 4PLHA 3UT5B 1YO6A 1Q1BA 3K5WA 3CC8A 1DJLA 4Z1OA 1KQGA 5FOSA 2EKZA 5TPZA 2NGRA 3QOFA 4ZT3A 2IYWA 3EQ9A 2V8BA 5EZYA 4B2IA 3SI7A 5A4JA 3N6VA 1XMVA 5TEVA 2QUBA 1RU3A 4Y1EA 3RYHB 1U5CA 1D4FA 3VXKA 4MO2A 1QONA 4BFCA 1FFHA 4OK5A 4CEIA 3TJMA 3THXB 5BR1A 3ADCA 1A72A 2VZ8A 1EIWA 3ZJVA 2MYPA 2X4IA 3ODPA 4NBKA 2IP2A 2JAHA 5EEGA 1RWXA 4UCXA 3HE3A 2ZJYA 4CTJA 4WLOA 1RKQA 1FK8A 3LUKA 1M6HA 4G6ZA 3GMSA 4K1LA 1B6SA 4YEDA 1ONOA 1KO8A 5DXFA 3UKOA 2YHIA 3L6CA 1JLSA 4ZC8A 4JLSA 2CDCA 4S2EA 3WX0A 3ITNA 4FOTA 3EH2A 3GYBA 2VUIB 3T5BA 5AVSA 1FVXA 4A10A 1JJBA 1RWQA 4GRIA 1M5TA 2QHXA 3KZOA 4N6NA 2FSUA 2RIRA 3B89A 2C84A 1GNRA 2GCIA 3GCXA 3HNRA 5TF4A 3R9KA 1Y7TA 4DV2B 3QU7A 4BWYA 1E1QD 2YJNA 1ZK2A 3GD7A 3RC3A 1H23A 2C8LA 4JVNA 1N1MA 4MR8A 5J9FA 3W78A 1XTPA 1E3QA 1Q3KA 2I2WA 2QY6A 1JHOA 3H8SA 4KBFA 3ASZA 5DXAA 1K7CA 2WRZA 3EVDA 4AS2A 3VR4A 2JCYA 2REOA 3HJBA 2EL7A 2R6AA 4GOXA 5J40A 1EFPA 4BMZA 3W6UA 1WL8A 5AI3A 3NIWA 5EQFA 4EKYA 3R3VA 3T0IA 4D3SA 3L5KA 4DSOA 3IEXA 1K5HA 1I51A 1KNQA 1K5PA 1YQGA 3AKDA 3BB1A 3KB8A 4DMHA 3AF6A 3BFPA 1QZUA 3NVKI 1YCHA 4IJMA 1E5VA 4IG4A 1PZEA 2E55A 4C3OB 3NTOA 4BNYA 1TK9A 2ODBA 2QTGA 3A4NA 1E2IA 1VG0B 4GSYA 5LCXA 4L78A 4LI0A 3GK3A 1VFPA 3FJ1A 3IALA 2NXEA 1HDOA 4G8DA 2GQ0A 1P7PA 1E18A 4S1OA 3FI0A 4M7RA 3BREA 4FFPA 1UC8A 5HRUA 1F38A 3RZTA 4I55B 4MUAA 4QO8A 4G4JA 5EAIA 1NVWQ 3A1WA 3EXG2 5AHXA 3TD2A 4CMHA 2FQYA 4MDEA 3KO8A 3M3HA 2WNSA 3K0BA 1JZQA 1BHSA 1VCMA 2XNJA 2XJVA 1QRRA 2H07A 3A4VA 3FE2A 5IN4A 4NJMB 3M4JA 3UMFA 1XALA 1XZBA 4MUGA 4B3FX 4O63O 1J2YA 1DBRA 1OIXA 1L0BA 1UKBA 221PA 1PN3A 2XCIA 3ABZA 4KH1A 4OGKA 2QN1A 4PAQA 4RIEA 1UKZA 1OT3A 4HGYA 3B3GA 4AMGA 1L4YA 4D9HA 1NKTA 5JR3A 1C9DB 3GJRA 3MWDA 1CETA 1UXKA 1XD8A 1NMXA 3IDQA 3PCRB 4DARA 3GTOL 1P31A 2QVGA 5CTAA 1FP4B 4AUKA 4CV0A 2PXCA 1I9GA 2OT3B 3IP3A 4PO9A 2J9GA 4NATA 3G6KA 1E5XA 1YDHA 3HXMA 2IYAA 4D9GA 3IVMA 4X45A 4WDRA 3RW9A 3SOPA 3UMMA 2JFPA 2I6GA 1KO7A 4FYMA 3VZCA 5KKCA 4J0KA 4BASA 3N76A 4OJQA 4TM8A 3X2FA 2P6MA 3TUJC 1Z4NA 3N7TA 2B5VA 3D6NB 3U4QB 4YJFB 1GCGA 2V74B 1IPHA 1PTJA 3A9SA 4JS0A 3T3PB 2I1WA 4RANA 1SIBE 2ZIZA 2DOKA 3NDIA 2W48A 4GP9A 1MHPA 1FS4A 3OZXA 4RDXA 1FXWA 5BT9A 1Y3FE 3U19A 2O8BA 3G13A 1K2WA 2P8SA 3K6SA 3MWEB 3RS5A 5FT9A 4DVJA 4YHHB 2W2NA 3QFHA 5IVDA 2Z57A 3AGQA 2OV8A 1IBSA 2PBLA 4ILKA 1BXGB 1QB8A 2IXEA 5E3JA 3EF3A 4J0FA 1X7YA 4R51A 3ZH9B 4G1MB 2VBGA 1EQUA 2KW5A 1ICIA 4ZI7F 1JF8A 5LWHA 2B4AA 1RHMA 3UMGA 1V5GA 3QV1A 4TV8B 1E0JA 1SEVA 2QL0A 5ECDA 2OYSA 3T9EA 3T3EA 4CKBB 2G25A 3GJ4A 5BNZA 1YK5A 2IZ6A 1EFKA 1ORRA 4JVLA 3IMKA 2XWBF 4BUCA 3G5UA 2J67A 3A06A 3OIUA 1SXJD 4KJXA 1D4OA 1G41A 1NSTA 1TE2A 2V0NA 4HMOA 4I1SA 4GW3A 4IY1A 1ABFA 5SYAA 4HQRA 3S1AA 3U3XA 5K0EA 1KEUA 2MSLA 4GM1A 4C4ZA 1ZD2P 4CQMB 1TO6A 3OIDA 1ENOA 2GZ2A 1R7RA 1TZBA 1TD9A 1KZ9A 3H19A 1VMKA 1KS2A 2ZJ0A 3NZEA 2O6HA 3PKJA 4MSUA 3CR7A 4J90A 2MS3A 2JJMA 1YZQA 5DO9A 4CIYA 4D42A 1M67A 4HLQB 4J2OA 2I9KA 4ZDJA 3HCNA 4GX1A 4RPHA 5JCPA 2NXNA 2DCUA 4FZ3A 3CJRA 2GN8A 2HHHB 3CSDA 5BN5A 2IEDA 3W2GA 4ZC1A 2R7ZL 1JBKA 1KYZA 1QE0A 1O0CA 1EWQA 3GEEA 1Q7RA 2GJAA 2QPTA 4YN3A 1USGA 1SK8A 3A4MA 5B2FA 2HHJA 3BD7A 4ZT7A 2IUUA 3NTRA 4U5QA 4WESA 1EB8A 4RORA 5IZCA 4PWZA 5ERGB 1T15A 2FA9A 2QU7A 1Z47A 3D7SA 5JBNA 1T1SA 1D03A 3RIYA 1B2LA 2D3WA 1Y48E 3R6GA 2VJOA 1H0RA 3BRCA 4RE5A 5J4LA 1CUAA 3C3DA 3VO2A 5LA6A 4M38A 4WNIA 4Y2XA 3A58B 4OBXA 4H31A 3DUFA 5CA0A 2C96A 3S2GA 3G2OA 5A7FA 4B3SB 3WKEA 3CTPA 1WCWA 2X3UA 2XUZA 4CKBA 4TRNA 3ACCA 1E96A 1AS2A 1U5BA 3E84A 2GM9A 1QDLB 1T10A 4FGUA 1IUPA 4XDYA 3A0UA 4EM6A 1YVUA 2GR9A 3OM1A 4I4CA 2C4NA 1QK4A 2ZBPA 1E5TA 4L2IB 4CG1A 2NTEA 3LCMA 1N0WA 2FZCA 4FLFA 4Q9HA 3GPDG 3VPXA 4CN9A 1SH7A 1CYDA 5BORA 1PL0A 4I19A 4W7IA 4CIXA 3TQIA 1UZMA 1F9AA 4IZHA 4C06A 3BGIA 1X42A 4EHKA 1RQGA 4YT8A 2H57A 5L45A 1OH8A 3PUVA 4L76A 2ZZNA 2Z3ZA 3LOPA 4FBLA 1XAIA 3TAHA 3P4YA 3H86A 2Y71A 1SRRA 1IMJA 2QVZX 2VK2A 2XOEA 3AY7A 5TQJA 3U9LA 4DMUB 3W5DA 3NCTA 1JJFA 2AN9A 5EZQA 4OHUA 3RVKA 3VSCA 2P4HX 2C8KA 4R1PA 4O1HA 4FU0A 1V7QA 1ESMA 1WRBA 2EWVA 4Y2VA 4FKZA 3OP1A 1ZIDA 1HEYA 3RFTA 3JAMA 3J7TA 1G4UR 4JP2A 4AO8A 5KCZA 2QTMA 2ZVJA 5LA6F 1C0IA 3H1FA 4K87A 3NWJA 2R9VA 2W2VA 5LKRA 2DKOA 4UU0A 3FYUC 1KI7A 2HYIC 4BEVA 2FR8A 1F4VA 3CRRA 4B6RA 2WPDA 5CYGA 5RXNA 3DBLB 2P7HA 1MN6A 2WYVA 3HUUA 4F4UA 1SB9A 1Q15A 4LHEA 3R3SA 3UJ3X 1J56A 5DM71 3N0XA 3JQAB 4BLWA 1T5TA 3OSUA 3D4NA 4RA9A 7ABPA 3DZDA 2HPAA 4RFLA 2CY0A 4QPPA 4BNXA 1PD0A 2NYDA 2WHPA 1Z4JA 3ESAA 3L0CA 1ZM9A 4RPCA 2EKBA 3G0IA 2EJCA 4WN9A 2FTKE 1O96B 1I94B 5JXWA 3HEAA 1Z6AA 3EGCA 3UB2A 1RRFA 1W1UA 3ANXA 1Z06A 2GPJA 2O7RA 5F2KA 1X7GA 4AN0A 1NJ1A 1UDBA 2RMKA 3NFYA 1MOQA 4XYEA 5A7HA 1AA9A 1NY5A 1NQAO 2JIPA 3MJVA 4EPVA 1DG3A 4UW9A 5G40A 4EHBA 2JS7A 5AN9H 2WIGA 3BJRA 3WYGA 2ID4A 4WY2A 4IX1A 1V7PC 1DRKA 1Q6YA 3OU6A 4WD3A 2Q6OA 1MJNA 1I7PA 3TW8B 3HJGA 3TZBA 1KWGA 1DKRA 2Q2OA 4XOIA 4ZRMA 4Y2TA 1JMVA 5EMLA 4MVXA 5EKXA 4CM9A 4DIKA 2J3JA 4UVIA 1B8VA 2MTBA 4ZAZA 1KJNA 5BUCA 4OXKA 5FOQA 1UBKS 3FNGA 3DZBA 3O84A 4OHZA 4FGKA 4HX2A 3B6KA 3UPTA 2X76A 2GESA 3QU4A 1WTCA 4J76A 3Q85A 3WBKA 1AKMA 2ADOA 3EGOA 3EXIA 1FFXA 1H1LB 2IGTA 1AV6A 3Q7IA 1MFPA 2BUAA 1KJYA 5K8LA 1WUIS 2O2DA 1GYQA 2ZIXA 3G0DA 4NJEB 1ZJJA 2R6GA 2SKEA 5JS8A 1EFLA 2VVTA 3DP7A 1LZKA 1PK7A 5HWSA 3DULA 3P19A 2JGEA 3NW9A 3PTAA 3OQOA 3MWFA 1QB7A 3FOAA 3PC8A 5K4GA 3GLTA 2QT9A 2XA9A 3WMRA 3QVOA 1Z34A 2A0FA 4FMDB 2O14A 3MZ0A 4RD1A 3MGAA 2G7MC 2A5YB 2WM9B 4H7JA 2QV0A 4N39A 3WFIA 3COZA 1KI1A 2V03A 3RUDA 4FMCB 1UT5A 2VDWB 2ZRIA 3FGNA 3I9V1 4TSFA 3T54A 3B85A 5ESXA 3T9AA 4UTNA 3KETA 1UBLS 3AHJA 4TTQA 1LPOA 3ED5A 5I8ZA 1KIAA 2J08A 1I2ZA 2DFKB 4YV2A 2WG2A 1AKEA 1QCYA 2JCSA 1ILEA 1XWIA 3P0RA 4MCAA 1U98A 3KC2A 3KXPA 4YP5A 3U4MA 2C4MA 2HSDA 4MW6A 2Y77A 2IRWA 2WD7A 3U9TA 1XNQB 2FMFA 1H22A 5HZHA 4QICA 4DPMA 4LDAA 3NHKA 1M1XB 5HKKD 2H9AA 2ZYWX 3ELUA 3E9NA 4OHXA 4JT2A 4PYNA 1W0KD 3VSAA 5F7XA 4RK7A 4BQSA 3I0MA 2LKDA 1U3TA 1XELA 2BEKA 4F6LA 4NQZA 2XXJA 1OASA 3PC8C 2BFEB 4EEXA 3GUHA 4JMLA 3PIIA 4BZXA 3BH7A 5AW2A 1ZJWA 3LBAA 1FSZA 2ZBUA 4GZ3A 4F0JA 1N1DA 1SUSA 2D5AA 3IOBA 5DBGA 4CR6A 3VZQA 5E7IA 3TQFA 3HVHA 3T95A 4YT5A 2PZEA 5G53C 1EFVB 1VL5A 4L27A 1C1YA 5HILA 4L5YA 4TRRA 2ONKA 4B0PA 1MDFA 5CCEA 3WWLA 3GL9A 3F2VA 2CLMB 3DQZA 2QRLA 4TLCA 5L3VA 2Q7DA 1Z88A 4AUEA 3IKVA 1LXCA 3MF4A 4MW9A 4XYBA 2VHQA 1SAYA 2CNWD 2ZTHA 2ZSJA 4AJ1A 2ID7A 1HRKA 1OBOA 1EHYA 5AJWA 2Q7OE 3ZHCA 4DUYB 3OQJA 4ZCQA 1U8EA 3G88A 2RJOA 2GERA 2HNAA 4FFNA 5IAKA 5BN4A 5J4HA 1L5QA 2WQ7A 4JVMA 1T2CA 2R25B 3P20A 1TD1A 1KY3A 1XRJA 4Z53A 3H04A 2Q3CA 1QJ4A 1IY8A 4DMRA 4OK6A 2W6ZA 3EIUA 3V8QA 4ZKDA 1ID1A 5ITVA 1NJ2A 3L7OA 1OFHA 1XZFA 4B87A 3IQZA 1F4PA 2GHQA 3F4BA 4FFBA 2FZWA 1B43A 4EA9A 1VG9B 3UJNA 1KJ8A 2AEJA 1Q7EA 5DEOA 2P5YA 4G01B 2A2ZA 1IHOA 1TM7E 4RMJA 1DRJA 2PAFA 3EQ2A 4F3TA 1C1DB 3BE6A 4Z5XA 3QVVA 1T6NA 2FSHA 5D7NA 4FS8A 1CHNA 1SXIA 4MP6A 4OPMA 5BSRA 2G9NA 3S2EA 4HWPA 3VGPA 5JWRA 3O94A 1WXIA 2OXIA 1MFZA 3UK1A 3VC3A 3DE6X 5GADc 4QULA 1U7UA 2ANBA 3UIEA 2PJDA 4PS1A 1XIVA 4D0RA 1SCJA 1I50L 3WGGA 4DC1A 4EF6A 4TYPA 4ARIA 1IRNA 2XBMA 1FHMA 1LV8A 4XVCA 1QFZA 4BO4A 4YMHA 4TWRA 4A2PA 2D1TA 1Q74A 2HD4A 2W2KA 2IUSA 3F98A 4NF2A 5ESDA 4U39A 5FOVA 5JS6A 2O57A 1UOEA 4YBZA 1LDMA 1TU0A 1AE1A 1RLOA 3BHNA 1V8ZA 2AHRA 1KO1A 1SOVA 3C3WA 3DCJA 3O2QB 1IE3A 2PKQO 4DCNA 4CN8A 1HF3A 1Q20A 2OHHA 2RK4A 3SHTA 3WIBA 3QA9A 5EMHA 5L4LA 1DDIA 4MWZA 1R0JA 2QD2A 4KWCA 4CKYA 2BGRA 4ONEA 1SC3A 2R6ZA 2YOFA 1FP1D 3CZ4A 4PXSA 2CNOA 3FOCA 1RM3A 4LA4A 2KX7A 5JG7A 3WL8A 3X43A 3VZBA 4D99A 4BO9A 1CQXA 2MJLA 1PEAA 1T4CB 3PS9A 1MBZA 5FWXB 1MVLA 1KVTA 3VDRA 2VTEA 3WWEA 3SKYA 5DI3A 3OLCX 5CTJA 3QMPA 4ME6A 3EB9A 3O8RA 1WCXA 4Q15A 3PFWO 4C4RA 1SXJB 1Q7CA 4CLXA 2HSEA 2RGXA 4RVNA 5K01A 2CXSA 2DC1A 2XF8A 4KLRA 5K51A 3IOMA 1OFUA 5JNWA 1UANA 3U26A 4AKIA 4MVJM 1DQNA 3Q40A 2H5JA 3JRWA 1EBBA 4ZVPA 3ZW9A 1UBNA 5DU2A 3TNLA 1TECE 2IVZA 3WV4A 3WYEA 3I4FA 3JQBA 1JIIA 4RZQA 4UBMA 5EE5B 5CPBA 3CUYA 2Y0BA 1CY8A 1LFDB 5G4LA 2WTAA 3WRVA 3BD9A 1Z2DA 2NV0A 1FNMA 2OVFA 2V7UA 4BBRL 2B2CA 1S1CA 2P4SA 4N12A 3HXTA 4O4IA 3ZIAA 4C4PA 2RCNA 2WSSD 4JGGA 1E4EA 4BXOA 1ZRNA 3OQVA 2J5QA 1E98A 3MXTA 3U17A 2ODWA 3BXXA 2E2JL 1F17A 3KZCA 1KQNA 5KKNB 1Q2XA 1ATIA 2Z9BA 1FRFS 6NULA 2J3LA 5GGYA 3H6HA 4MS4A 5EJ6A 1KYYA 3ZWPA 1RMTA 1SC9A 2P9EA 3EFBA 4L28A 3T9CA 5BPHA 1P17A 2DT8A 4NFLA 3ZYCA 2ZT6A 1GO2A 3O6VA 1KE2A 5KAMA 3OQ1A 3SE0A 3T5GA 1B6RA 4REMA 5T7BA 3VUEA 4MPRA 2FEPA 2HA2A 3GT3A 1RWBA 3K35A 3D4OA 1L5NA 1V11A 2AD5A 2A57A 1E3WB 4O4LB 1SUWA 2ONCA 1OX4A 4MQ5A 1RXWA 1S0UA 1XDSA 1ZM3A 1N6RA 1XPRA 5GINE 3RANA 1L8LA 2EG9A 1T0PA 4LY9A 4BB9A 3KKZA 1HZZC 2CC2A 3CR3C 2CUKA 2HKIA 4PNHA 1XTZA 4WOPA 2NAPA 5AH0A 4GBMA 5K8JB 1P8AA 3I58A 1DKLA 3ZHYA 3P45A 1UMBA 2HRBA 3BDVA 3K30A 4G2TA 5SZIA 3RFUA 3ROKA 2J32A 3T38A 1R0KA 2V0CA 4AZ0B 2B9VA 1VCOA 4LSMA 3FOBA 1NBME 1TGVA 4CFYA 2EFDB 3PPXA 3V1MA 2OCAA 4M0PA 2HDHA 1ABEA 3RFFA 3RYGA 3TTYA 3G2IA 4YCSA 4N3NA 4PN7A 2Z3VA 1KJIA 4KQ6A 4G1EB 5CITA 1P3Y1 4ETWA 5LP6B 4Z4EA 4HFNA 1FRQA 5AKLA 5EESA 4A3KL 1I30A 1ZMBA 2X6QA 2XODA 3QZUA 2DWPA 1G98A 2R6HA 2VF5X 3C3CA 3K1AA 4G8BA 4MPDA 3ZLUA 3ZWBA 1NBEA 2FAXA 4P32A 1Q7TA 4OGLA 3OEHA 4K3VA 2XCUA 2D1FA 2FWIA 2N1MA 3ZUPA 4EI8A 3LP8A 1OWBA 1V6SA 2OA0A 3C4QA 4A3FL 1RT9A 1BFUA 2VUSA 3E5MA 5CVEA 3VYTB 3WIOA 3WIUA 4UPEA 1H7VA 4KU4A 1NNLA 4NR0A 3W0LB 2FFHA 2Q5FA 4FDTA 5KYTA 1SQ5A 1QF7A 4LUCA 1KVQA 2DP4E 1RZUA 2O1EA 3FSJX 4OKNA 3SSOA 2UV8A 1FTGA 1I1OA 1XFDA 2NU7A 2Y05A 1XA0A 3JXEA 1W52X 2PUBA 3K2QA 1V16B 4JHLA 2DUWA 1AHPA 1HLPA 2GARA 2EJBA 1BJTA 1YZKA 4KPUA 4W4TA 4ZWNA 2F9MA 3OA0A 5A0TA 5JH7A 3WWYA 3ANMA 4YO8A 2BKAA 3EGVA 1ZEMA 3CNEA 5EJ8A 1ADGA 4A3IL 1K66A 1RRVA 2X23A 2B99A 4JKOA 1UK6A 1HEUA 3CX3A 1SELA 5ALJA 2ZFUA 4MRAA 2C5BA 2YHSA 1OWOA 5K3EA 4A91A 3LRPA 1W5AA 4Q16A 2QI9C 2FRDA 1R5JA 3MGGA 1ZW6A 5DZSA 1BXKA 3U3KA 2WVHA 2ZAGA 2W6PA 3A6LA 4UNPA 1W581 2A6PA 4TUYF 1V5FA 1O2DA 3QWFA 3DL2A 2YV2A 1DX4A 1W5TA 3RLFA 1KQPA 2ZDGA 5HKOA 5HOEA 1KEVA 4BVJA 5ICFA 5LP6A 2IE8A 2B78A 3ICOA 3QP9A 3CCBA 3SS9X 3HOUL 3DAGA 2VZ0A 4QDJA 3KUDA 3ZWNA 2UYCA 1J90A 1FNDA 2EYQA 2FDRA 1MHTA 1IBMB 4RDIA 3QFRA 2WT9A 1PNQA 1SU7A 5A4DA 1QP7A 2R66A 5JROA 4MA0A 1DAPA 1Y1RA 4UXJA 1SKYB 4LVUA 4IPTA 3RH0A 3U5TA 3I1IA 2R8EA 5DE3A 3T4UA 4XLLA 2AKEA 2VTKA 3SFVA 3DWEX 5I51A 1ORHA 3LQFA 4HVLA 4ZGGA 1ESEA 4FUQA 1OXBB 3K71B 1EBUA 1XHEA 5K7SA 5KVCA 4YWHA 1XD9A 1H3FA 3VR5H 4GUAA 5J1TB 1HE2A 2EJWA 2VNAA 2X22A 3NVMB 2FUNB 2H59A 2BOVA 4H6PA 4JX8A 5EJIA 5K0TA 1I3OA 3VU3A 4TWBA 3ZXSA 3H97A 3GZNB 4EDHA 3AX6A 4K1XA 2I0FA 2EHJA 3OQ6A 1RC0A 2F6RA 3TN7A 4QJIA 1JECA 1YQXA 4GVXA 1LTLA 5DHQA 3SIXA 5EE3A 1GKYA 2CSXA 2CK3A 4TSKA 3JQEA 3C5CA 6CHYA 3OU7A 1TT5B 1Q0SA 4UE3S 2JANA 1HT2E 1RYZA 1YK0A 2B8NA 2FVYA 1O57A 1FQWA 1Q3HA 4AJLA 4BTLA 3TNDA 1N8NA 2O52A 4F5DA 4Y2UA 1E2GA 2FX5A 3I6YA 3GEMA 3M3PA 2WVJA 2X0DA 1FEZA 3A9RA 1N0VC 4H1TA 3NHAA 4PEVA 4PO8A 4X8OA 4Z6KA 3TOSA 4YQEA 3T1VA 5JXJA 3BXHA 5M5BA 3AM1A 4KQ9A 3D7KA 4RK5A 1RPJA 2PUDA 5IFKA 8AT1A 4O4HB 1XHFA 2OHVA 2P2NA 3GAZA 4FHEA 1NJ8A 2Q3JA 3EASA 3KD2A 4XUDA 1CERA 5H1Sc 2HTFA 2OHJA 4YMGA 3WK8A 2Z3WA 2DE0X 2VS1A 4LRYA 4KQGA 4ZHQB 4QQFA 3RYIA 3A6DA 4YJDA 3U7GA 5JJLA 4WASA 1RBMA 5CFMA 5HKBA 3OLVA 13PKA 4RCZA 3REGA 1XXHE 3EXFA 3ZVNA 2B83A 3EPPA 1RIFA 4R3NA 3JYQA 1V9SA 1O97C 1CUGA 4S1NA 1LDNA 3ZY3A 1L4BA 2VSYA 1YR8A 3MWDB 4B6GA 4Y6LA 1TMYA 4RETA 3UENA 1MP0A 1XDWA 3LT0A 4TQGA 3ONFA 5FPTA 2NOAA 4EI9A 2A69D 3U4CA 3T5AA 2AYJA 1CUXA 3GRRA 1U8FO 4LYJA 1WKCA 1Z5NA 1JQKA 2QUHA 2VPXA 3JD2A 5FQNA 5IDXA 2IF0A 1U11A 1VP3A 2XADA 5TE9A 2VPQA 4QOHA 1TUIA 2GMGA 3C8MA 4G0XA 2BGIA 4Y9TA 1P1RA 1XN1A 2WOJA 2OCYC 1DC3A 3QFCA 3FRIA 3VOSA 1OILA 4H0FA 3EQ7A 3FDJA 3ER9A 3QF4A 1S4QA 3A04A 4F5WA 3TXXA 4ZYYA 5KAPA 3IR7A 4Y0AA 4KN9S 3D9QX 3DZHA 4NCIA 5IKXA 2WP0A 4UMEA 3DOEA 4M1WA 3WGUA 3GU3A 3OM0A 4ANFA 2Q3LA 3E58A 1EFRA 2MINA 4MKZA 4EBFA 1T26A 3BKWA 2XSZA 4IICA 4GXRA 4QGAA 3PUKA 2MSWA 3QPUA 4IG9A 4Q1AA 4NX2A 4JJ6A 1OFVA 1OBCA 2OXRA 4NBNA 1R3DA 1NA5A 3K16A 5CNJA 3U4IA 2A1UA 4YCAA 2Z04A 3PKIA 1E7MA 3Q72A 3TM4A 1Q57A 2VAWA 4M87A 5U4QA 2GMWA 1G8YA 2BFFA 3BTSA 5C35A 4LF8B 1TMOA 1IN6A 1BH2A 1TTHA 3RVSA 1HR0B 2XGJA 4DE5A 1O96A 4WXYB 1E3JA 4MV8A 1J99A 2VH1A 1QGDA 2A9OA 1OU0A 4XASA 1CUCA 3M0EA 1TEXA 5GM1A 2HA3A 3CEMA 1J5EB 4PAMA 4NOLA 3WKAA 4IVRA 4WLNA 3AETA 1E60A 4WADA 5D3MA 5HIKA 1C8VB 5H5JA 4J49A 2QD1A 4V0LA 1IEWA 4YVFA 1CQZA 3E7DA 3AUJB 4NZ9A 1LUAA 1Y3CE 3KSAC 1RCFA 5LOVA 2ZSHA 4O1MA 3O8NA 5G0UA 2Z8ZA 1BDJA 3ZIUA 1I01A 1J1IA 4GKVA 4XWKA 3H13A 1BKDR 2P27A 4IZOA 3DSRA 4MLZA 4UJ5A 5CURA 4PPNA 5DN6A 4TMVA 2A3RA 4ZICA 1G20B 5A4FS 2COKA 2W9XA 3AUUA 1D8TA 1ZNQO 2PIAA 1XAHA 4CF3A 3CBGA 3OETA 4BIIA 4S35A 4QOJA 1L7RA 1QRTA 1H94A 3NG1A 4HB3A 3ZBUA 5IK2A 4AF7A 3AEYA 4O3FA 1LI7A 2H29A 2QUKA 4XPIB 4B9EA 1PJ4A 4PC3A 4YRMA 1W1IA 2A84A 3DDOA 4GP6A 5J5VA 3UK6A 4FYJA 2B30A 4CNBA 2BM1A 4M1QA 1GFIA 3DDCA 3C6KA 1MPTA 2E6UX 4P83A 2GASA 2KS6A 5KYUA 1UQTA 2PH5A 5IASA 5EINC 3F5MA 4KLNA 1IQ0A 1LTKA 5LB2A 1Z26A 2A1TR 4DJJA 3RK1A 2WABA 1GZHB 2GCOA 3C98A 2ZXEA 1JR3D 1U9CA 3EXHC 5K0SA 3LOUA 2E4YA 4LXQA 4X9XA 1NAIA 1ZOLA 3B08B 2UYHA 4DS3A 5C44L 5CB8A 1N5DA 5HFAA 4DQXA 1XVTA 1P60A 4Y1RB 4LHVA 2VF7A 3G0OA 3DXYA 4IUDS 4ZCTA 3RKRA 1USIA 3D4IA 3UJ9A 4AR5A 4GZ5A 4Q05A 3UF0A 2CXHA 2F4NA 1YFLA 4UDOA 4RHCA 1FYEA 1LI5A 3IDFA 4QFCA 2DLNA 5AI2A 3IHWA 4GS5A 5JRJA 3IP5A 5L4SA 4Q12A 3KLMX 4WA8A 2INGX 1NC3A 3ZYZA 2JHGA 1FXUA 5GJBA 1JA9A 1QVWA 5J5CA 4D80A 1U3UA 5LOVB 4YPVA 2XZTA 2QNRA 4ZZ2A 1N2OA 3NAQA 1T5BA 3AV0B 1FCJA 4UHDA 4G86A 4CMBA 2PVSA 3OKAA 1G5PA 2EATA 3TI9A 1K88A 4NZOA 1QK5A 4L07A 2RBEA 1G21B 2XVMA 3U3RA 4G56A 1VCIA 2XWJI 5DGIA 5FLYA 2J6CA 1BDIA 1JIKA 1V43A 4FEEA 3SCZA 2V7TA 4DA0A 1GPLA 2O1WA 1FJXA 3PVSA 4Y7NL 4UBOA 10MHA 4BZZA 3IIJA 1PBTA 1VYVA 1ZVJA 2EZUA 1E1DA 1E9AA 2JIRA 3O2JA 3Q7RA 3O4HA 1RWNA 1G64A 2YBEA 3C3YA 1FF9A 2VH5R 3L93A 1TYCA 3LA8A 3QTBA 1T1IA 3I2YX 2IZ5A 2XT0A 1L6RA 3EYAA 3QBJA 3STYA 1QYWA 5KYUB 1M66A 5HZGA 2XAAA 2EL9A 3FXAA 2IS6A 4PZ0A 4UCQA 3LXRA 2O8FB 1M8FA 4JNKA 3RSOA 2RAPA 4KV9A 4GYKA 3JRXA 3NETA 4CL3A 6LDHA 4ALMA 4WK4B 1SCUB 3MIZA 2ECFA 3M8KA 5BSTA 1KTIA 4NS1A 5K03A 1PWHA 2FCRA 3ETCA 3OHMA 4LZAA 3RIEA 1YL6A 5KDDA 1CRPA 2ZUWA 1R0LA 1V3UA 4FW8A 2H1IA 2ZJ2A 5H82A 2ZTLA 3RV3A 2Z5GA 5IP5A 3W5JA 2UZ1B 1CJTC 2FXVA 4EJMA 3CF4G 1M8KA 2H2FA 2MYNA 3B1VA 2XQFA 3P0JA 4P4SB 3ZWAA 3A8TA 2ZR9A 4DQDA 3OKPA 1DBWA 4ESHA 2DHRA 1DV2A 4GLBA 4BO3A 3MOSA 1C81A 1ZYUA 2LTAA 2A9KA 3G0HA 3WISA 2HIMA 3IEKA 2GKOA 5C2JB 5AVVA 3VDQA 1D2CA 1UBMS 2EX0A 4IIYA 2Y1CA 1VZ3A 5E1OA 5A71A 1CBUA 1JQEA 5C37A 3UMCA 1I7DA 2FG5A 2JZNA 4LPKA 4J2HA 1DBSA 2R3SA 3LWZA 5JWOA 1QQBA 2IVFA 3GFFA 4JUDX 3KQWA 3I64A 5DX8A 3UHOA 4JAFA 1GTL1 5K45A 1QQ6A 2AOXA 3EXHB 4ARSA 2FGJA 1OUMA 2QW8A 3FSGD 5A5FA 2Q0HA 4XD7D 1T9BA 2EBHX 2ZYIA 4KE7A 2OE2A 3USZA 1SBYA 2RD2A 3L41A 2XMDA 2JL1A 4FBMA 1EEHA 4PSCA 2QUIA 4BBJA 4PZLA 4N3GA 2P3SA 1AOXA 1FTNA 1P19A 4AY4A 4D74A 2C9BA 4YK7A 4ENQA 1EVZA 1BEUB 1E2PA 1H4VB 2WMDA 3CT4A 5UKDA 2IS1A 5ETJA 4QJBA 4BO1A 1RYTA 2BDEA 2PMFA 3EUFA 5IZ4A 3LLSA 1NG9A 1XLTA 1H3NA 1PGPA 4UZFA 3HLKA 6Q21A 3BICA 1G2IA 4GG1A 3AFOA 4DT1B 5INTA 4M7WA 3KAPA 1TLLA 5EWMA 1DKPA 1BAPA 5EP1A 4CUKA 2ZIFA 3HRIA 3WKBA 1BD3A 1O6BA 2GM4A 2VP6A 4EKGA 4I46A 2CW5A 4R9UC 2K7FA 4OB7A 4RA6A 4AY3A 2L42A 3HUEA 3FMFA 4A7PA 4D8VA 1COWA 4R3UC 4D8WA 3AVOA 3KALA 2P0YA 1GVNB 2LNDA 1KBZA 3HCCA 1P0PA 3QLJA 3K94A 2AVDA 2R11A 3GGOA 5CYPA 5FWXA 3RRYA 3PCXA 2BHTA 3IEVA 3QW4B 1P4JA 3MBOA 4NMLA 3UYKA 3AF1A 3I3OA 3R8XA 4EEKA 5JS2A 4CEJA 3HXOA 5C8DA 2FRVA 3QIAA 4QFBA 1C9JA 4TLDA 5EZ5A 1V6AA 4HNQA 3B3QA 4J91A 2FSGA 4MYUA 4DRXB 2I6FA 4P92A 1G8MA 4HBGA 3TQCA 3C6XA 4LYDA 4V39A 4RW0A 4IYJA 3VVLA 5KC8A 1AY0A 3AVVA 4ER6A 4M83A 3CLUC 5ALFA 5CB4A 4DMFA 4FSHA 1R8YA 1C3LA 1XMOB 2SBTA 2Z1DA 2D8MA 5IXYA 1QOPB 2DQ4A 1ULSA 1R16A 5BN1A 3BGVA 1PR4A 2YWGA 5DTMA 4YREA 5K2ME 4J0GA 3VX3A 3W05A 4BKMA 4XDGA 4C3ZA 2VDJA 3LH5A 2GEDA 4D9JA 1DAHA 4GVLA 4JIMA 4M0CA 3JY6A 4HAZA 2BTQA 5JQGA 1Y8ZA 1AT1A 1BCRA 1CE8A 1GGNA 3A05A 3ZHOA 1G59A 2GJ4A 1TM2A 3OFKA 1NAHA 3S29A 2AKAB 1WSAA 2D1SA 3QBDA 2OV3A 4MS4B 4P4GA 3KZMA 3UFBA 4QAJA 1LLFA 1Q84A 3KQNA 2F3PA 2X8LA 3OKFA 1NWCA 4AU1A 1EHIA 1GVHA 3Q7TA 1U8AA 2AN1A 1PT5A 2BBSA 3OM8A 4KRGA 3AR5A 4NZYA 2WWWA 1B93A 3MMSA 3WSWA 5ADVA 3KVVA 4P8RA 3N39C 5BSHA 2CEAA 3BBPA 4LISA 1WXDA 3EIHA 4X1KB 1XVIA 4BNTA 3TBKA 5EE0A 5KBYA 1GUAA 4ZCLA 2CL7X 3BXZA 3ZY2A 4CI0B 2FFAA 4F8YA 5K0ZA 2H8KA 1OZ0A 3JQQA 4G5SA 4R68A 2B8TA 3IV6A 1AUOA 3OX2A 2Q3HA 3IAXA 2H4ZA 4CIDA 3BZBA 3ZHTA 4FOLA 2L69A 3S8EA 5DNVA 1QGOA 4GR5A 1OCEA 4HKTA 3DD5A 4V0MA 4NHEA 3VR1A 2H0AA 3MA0A 5BQ3A 2J7PD 1H6CA 1EWKA 1Z2NX 2XBLA 1J0XO 4MKFA 1I1QB 1XK7A 3N8DA 4MWGA 4RV9A 4AMUA 4DV7B 2G5CA 3F90A 1H6DA 4Q3EA 3E53A 3W6PA 4DQ0A 3LYHA 5B7GA 4MZXA 3VBCA 1ZK4A 4NDAA 4D26A 2J09A 3D6MA 1U28A 3QWBA 5KVSA 4LV5B 3P8BA 5FPPA 5K3CA 3WTCA 3EG9A 1A0OA 1GFZA 2BEVA 3HZRA 4OMDA 3S27A 1NZJA 1NVFA 1ENZA 2VDNB 2YW9A 4YQFA 3P1JA 2I7CA 3OSZA 3S6JA 4I5DA 3VDXA 1Z82A 2ZLBA 1TWHL 3GEGA 2C6BA 3Q5GA 4YPFA 3ZXXA 1P0MA 1QHXA 1U4NA 2XV1A 2D5LA 3CX8A 4IZIA 3PF8A 3C4JA 4GI1A 5ARDA 4XLZA 1T36A 2QTHA 3MAAC 3KFXA 1M7HA 2WOOA 3HCDA 4HSEA 3DE4X 4MVJG 4BFWA 4U6QA 1E0AA 4E94A 4O02B 4WKGA 3L0OA 5ISMA 4LNUB 4L74A 3KKMA 2YINC 3VQTA 4DCOA 1E4VA 2B1QA 2DX7A 4Z7OB 4YCJA 1HYGA 2G9UA 5FBZA 5HQTA 1C29B 3O7WA 4QDOA 3EY9A 3EFOB 2C97A 3PGMA 3PQ5A 3TFQA 4C7MA 2DPGA 1R0HA 3KBOA 3I9LA 3WB0A 1TZCA 1VP9A 1JTEA 3MQ2A 2GK4A 4IOJA 3GZJA 5KVVA 4HAWA 2K4MA 5I47A 3KDAA 4Q9KA 4OATA 3NS7A 3UWSA 2R6R1 1LPPA 1JEYA 1V1RB 4QFDA 2PR2A 1XZGA 4QGSA 1FC0A 1PZXA 2JEYA 4BRZA 2JG3A 2CLFB 1J0CA 1MAHA 3HXLA 4OA5A 1N3YA 2DM6A 3B2NA 5JZSA 4UUMA 2NO1A 4JAVC 4C0SA 2XEXA 4JLKA 1SBQA 1VGRA 5CJJA 3ZHXA 3PZAA 3P2EA 4ACAA 4JEIA 2YV3A 4PQYA 3HB5X 3EG9B 4LGVA 1WJVA 1TWAL 3VH3A 1Y1VL 3SU8A 5GIPE 1BGWA 5J4KA 2AQKA 3H16A 2LCFA 3L04A 3RUEA 1PFVA 2WV7A 4LE0A 2W2XA 3TLGB 4R3WA 2WUDA 1JHAA 3TRJA 4ECEA 2B20A 3CF4A 3OIYA 2YZNA 5C1BA 5LM3A 2HF7A 4YUVA 1OWCA 2ZJ8A 1A5AB 2M1XA 4EAAA 2C78A 1YR7A 3I45A 3LF1A 5B3AA 5AW4A 4ZCPA 2YYYA 2CGEA 2IOFA 2RFLA 3N0TA 3LVFO 3IX7A 4ALNA 3DWGA 3HZZA 1X74A 1AKTA 1VLZA 4X1YB 4UMVA 1LTQA 2NVUB 3C1OA 2GAIA 2H4HA 1YBAA 2JIDA 3NBKA 1JEOA 3O92A 1PWXA 3GGSA 5EPUA 1OGYA 3DM5A 3TRFA 4LYHA 2DFNA 1TUGA 3BWBA 2V98A 4Q82A 3V48A 4WBNF 2YHAA 3VR2A 2WSIA 3ZHVA 3KEQA 3JASB 1Y4UA 4G26A 1W5EA 5IVKA 1KBQA 3E1SA 4YJHB 2ZR8A 4AECA 3OT5A 1DSSG 3MTQA 5EIBD 5JJ5A 2ZULA 1TYEB 4LC0A 5KDOA 5KTYA 2KBEA 3FTCA 4BKRA 1C8LA 1YU9A 2HIHA 2QPLA 3KE9A 3OMXA 5NLLA 3K6RA 3RREA 1MTZA 1IFXA 3D1VA 3JWIA 3LDAA 3P4UA 1KI8A 3SZRA 3R6TA 4E15A 2EW8A 4GXTA 4A3BL 1P62B 2YMMA 4GI7A 5CDSA 1M2HA 3IHTA 4MAFA 2NAFA 3T3HA 2C7OA 1DJNA 2WKSA 1ZL0A 2VH2A 5JSZA 3GUZA 2GYWA 3A31A 3MWGA 4BO0A 1X7WB 4UMDA 3OMLA 5I8WA 4BX2A 1K8XB 3VPAA 4A92A 3CVOA 4H4EA 4CM9D 4QYWA 1FJHA 1RQ2A 4RSGA 5CNKA 1E2FA 2ECKA 1Q0TA 1C2TA 4DSAA 3FFAA 4TL6A 4EL5A 4MKHA 2EP8A 4X85A 2D5BA 1E0KA 3PWKA 3KD3A 3P9QA 3ZQKA 3ND9A 1H05A 4LDPA 2ODEA 2CEKA 1T6YA 4I1VA 1H8ED 3AJRA 3PEFA 3PGJA 2NVUA 4J1SA 4KQMA 1WZ2A 4U9IS 5LXTA 2I7VA 3M6FA 1PDWA 3RVRA 1U63A 4EX7A 3O75A 2WIBA 2P5UA 3NANA 4IJ6A 1E77A 4MXDA 3FNFA 4ZEXA 1PF7E 4FDMA 3WKDA 1SVKA 4GDMA 2BGUA 4PC6A 2JFNA 3B9RA 2YIVX 1AVTA 2R93L 1XWFA 3O2NA 4IWXA 1DIAA 1EWRA 3S55A 4BLTA 2JLAA 4DG9A 4DR6B 3WTBA 1ZRMA 2HZ7A 2A0XA 3GBVA 2J4DA 1RPAA 2PBRA 1JFSA 5CA0B 3M5DA 1HL3A 3IE2A 1GWNA 3M6VA 1J06A 1CVIA 2PM8A 2XLBA 3SC4A 3GHYA 3M82A 2VJDA 2FE4A 2J1LA 3PVCA 1FLDA 4Q6BA 2LCQA 4ITRC 1S2ZA 1W4RA 1WD7A 3KOXA 1TFUA 2X42A 3UICA 1U0SY 3AHHA 1JIXA 1Z63A 4UQPA 3GJ5A 2XEDA 2B4TO 1U1EA 3A1NA 1PKXA 4IKOA 1MC4A 1XVLA 1VE9A 1KE1A 4Q3KA 1XF9A 2JLYA 3LPMA 4IDAA 3L8ZA 4KUHA 1JDPA 3E9QA 5YASA 1LB1B 2AXPA 4A5SA 4BO7A 2RJ3A 5JZ9A 4ACBA 3FKQA 2C7PA 2CBXA 1P2VA 1U2GC 4I3GA 1JEQA 2VJLA 1X9IA 1I3KA 4CKZA 2XJ9A 3V4LA 3KYWA 3D8HA 3CLRD 1WULS 4O2RA 3QFFA 2Z58A 5K0GA 4B82A 5A3JA 4M36A 4RL4A 4KVAA 2VT7A 3I2GA 3Q11A 1J24A 3CH6A 1OC2A 3DOOA 4MWBA 4QPZA 5EJEA 4OLBA 5IAOA 1NXTA 1F8UA 1RWKA 3P2KA 1G0OA 4XWOA 3EF1A 3W4KA 1VTKA 2HU8A 1I4OA 3WIVA 4I9GA 4D3FA 1LF5A 5K0FA 3VPHA 1XCOA 2VYVD 3B1KA 4FC7A 1OD6A 5KYNA 2ATCA 3AETB 4Y9UA 5A4AA 1HWYA 1KMHA 3TTVA 2V4ZA 4DADA 1KDYA 3DEIA 3PXEA 2QMEA 1L4GA 4YRNA 2QTLA 2W11A 1CRZA 2JLSA 3NXSA 3VZSA 2A7QA 4BO5A 1ZJ5A 4P5DA 3CSSA 3SJZA 4B46A 4G37A 2QMYA 5EZ6B 3O03A 3H5OA 2ZWAA 3R6LA 4NOKA 2XIJA 3A1VA 4AKHA 1LQUA 2SKCA 1GAXA 2P62A 5BN3A 4U7DA 1T5IA 5GVRA 2CLHB 4JP5A 2VBFA 1ADYA 2CJFA 2J0UA 2QRPA 3L18A 1MW9X 2H1CA 1EK6A 1GTMA 1KDRA 3A1TA 3ID6C 5SYMA 1NL3A 4MVJA 3Q8MA 4WZZA 3JATA 3TWOA 3Q41A 1XJ0A 4ENSA 5EHXA 4CEHB 1VE1A 1X1DA 2ZWOA 1PLLA 2QRQA 4OHBA 3TOXA 2Y1WA 4BNDA 3FTFA 2HIAA 3SR3A 5KOJB 1R37A 1VKNA 3QI7A 5FI5A 1QCZA 4PYOA 3TW6A 4UNRA 4YJ2B 1R64A 4QBKA 4WXMA 1VKZA 4CEIB 5ALIA 2C9ZA 1JG2A 3K0HA 1G8KA 1CQJA 3KR2A 4RGVA 2DB3A 2CXXA 2WIFA 3IVAA 4HLNA 1JB9A 2IK8A 4DBVO 5A3RA 9MHTA 2PJUA 3K0AB 3K9QO 4FQ8A 4AJEA 1DOZA 1YI8A 2AI3A 2QVCA 5AKKA 4LWPA 4D2IA 4DTIA 1P2TA 1WAMA 2V0GA 2EZ9A 2XVYA 1XU7A 3M6IA 1KORA 3SBDA 5C5EA 2BZ0A 1FTQA 1K7XB 2MOKA 2DFTA 3MN1A 1CIJA 4NYIQ 4WXEA 4YP7A 1VBNA 3BB4A 3TL2A 1KQOA 2ILTA 5KVAA 1X0VA 1JDTA 3ROTA 2VQEB 2NPIA 2WKQA 3OJOA 2OSVA 4G4SO 3B13B 1FYFA 4OAQA 3HKCA 4PPFA 5L3RA 3BE5A 2NU8A 5KPJA 3TG2A 4KE9A 2HWYA 3S44A 3MAJA 5HHTA 1F6BA 1M34B 2QOEA 3KJZA 3UG6A 3RVBA 4EHNA 5HOQA 5ICSA 1ZUNB 3LHDA 4LG1A 3R24A 3T7JA 5LBIA 3BIJA 2COUA 3GV0A 1U1CA 5JVH1 1UK8A 4M1KA 2DAPA 2QRVA 3B70A 4X7RA 1E62A 2HCTA 1RKUA 2QR5A 1EGQA 1A5BB 2ZSKA 1YSCA 1VL1A 1YZTA 1DFHA 1H2WA 1Y63A 3KYUA 1O3YA 4HD8A 4CM4A 2WG0A 4ED9A 3RAFC 1WDMA 3G79A 4XE5A 2VWGA 2L19A 2VJMB 4WLVA 2QP3A 3IEMA 2ZRCA 4P3NA 5AJZA 3AP3A 4DMCA 5JS1A 1ZMTA 1PVVA 3PGVA 1OAOA 4YAUA 1L3CA 5JIBA 5LWQA 1EHCA 2W2TA 4KX5A 3ZIAD 1CUSA 5GQSA 2I91A 3JVIA 2EFCB 2GN4A 3CSUA 1VC2A 4HY3A 1YT5A 1KKUA 3R41A 4UDYX 2C4KA 3QVGA 3N07A 9GPBA 3GT0A 3UUFA 1YASA 5EI5A 3UJ7A 2DRIA 2Q0QA 3CLVA 4FLEA 2IYRA 1N2XA 3UMJA 4CLHA 1KNXA 3AXSA 2GEKA 4GU5A 3ETEA 5GY7A 4C0WA 3CW8X 4FYHA 5JJIA 3BILA 1OLUA 1QMGA 1P8JA 2AQCA 1UUFA 3GYGA 2Z4SA 4X71A 4YQZA 3ILXA 1UBJS 2GZRA 4KFUA 4PGHA 1ZSVA 1GLVA 1FTYA 2B3DA 5E1BA 2XD9A 3HA2A 1H4SA 5KCMA 3TBFA 3U7QA 1P2BA 1UJNA 1AO3A 2F4VB 5AHOA 5HM6A 3V8RA 5CT8A 4PGMA 4TLLB 2YFKA 4EJSA 2VTBA 3QEMA 3CVVA 4U5XA 3WGZA 4D3YA 1FUYB 5IAGA 1ZDMA 2QAGA 3VC2A 4N0EA 3WDLA 1MRNA 4CTMA 3N58A 1GKLA 4CXMA 4B48A 2AG1A 1I4DD 3PUHA 1IIRA 5AI5A 3BWDD 3AEQA 3CNBA 2ZYSA 4YRGA 4Y18A 5CFZA 1Q95A 2WU1A 3GVCA 3PLRA 2CDNA 1F5SA 5BSKA 3TSWA 5GZ1A 1AK1A 1BD4A 1Z07A 5FWYB 3TCXB 5A6SA 4WKPA 2AV6A 4DZZA 5EHGA 5CLLA 2JA6L 4RK0A 1WPRA 5H02A 4AF6A 4E2XA 2ZAMA 1T1RA 3I32A 4YAFA 3RSLA 3AWIA 3KG2A 1I2DA 3TSCA 3AMVA 2FUEA 1DZ3A 3W7VA 2B35A 3S0JA 3W3AD 3IDOA 4QNNA 2CLKB 3L43A 3AR6A 1Q0ZA 4KWIA 3O3MB 4X41A 5EMKA 5H1YA 3BTOA 2A9VA 4ZV7A 2WFMA 1FZQA 2AL7A 2ZG6A 3D5EA 5FWNA 1G0NA 3DE0X 4CL2A 3VR0A 3KRTA 4OK3A 1ZQ1A 2YU9L 2WWRA 4NG5A 3TECE 1GU1A 3PQEA 3BM5A 4LJ5A 3I0NA 1YV1A 2P11A 4O2BF 2OO5A 5AOCA 5CFQA 5DGDA 4DKJA 2IHKA 4DG8A 2VL6A 2NVYL 3A2KA 5EFZA 1W34A 1UDXA 3NBAA 4AKTA 5CT5A 4JI8B 3R44A 1TB4A 1Y6RA 3JD4A 4QA9A 1ZICA 1Z7GA 4Q19A 3AF4A 4YRPA 5CA1F 5AVUA 3JZIA 1DU4A 2GD0A 3D6UA 4WY8A 4DUPA 4DQLA 5C5IA 4FFBB 3VHLB 2Z2KA 4H3VA 3SN6A 2CT8A 1C0EA 1SHUX 1BMTA 2OGZA 5DTEA 4EUNA 2WD9A 5DXJA 3BIXA 3HOYL 2PV7A 4FC6A 1CDDA 3UK2A 4DLNA 1TAUA 5C4JL 2A35A 1IXYA 4A8HA 2IJGX 2YH2A 3GDOA 1QPZA 4CKCA 1VZ2A 4Y2YA 2ZB2A 5CXXA 3ZDBA 2F1JA 2VDKB 1PTJC 2FJUA 3URKA 5H80A 4WUVA 3DT8A 3ROFA 5HKKA 2XMPA 4PIPA 3FPBA 4I66A 1U0NA 5U4XA 5D3ZA 1OIWA 4G9BA 5K8VA 2H3EA 1YC2A 5TMEA 3ZVKA 1YULA 1RVDA 2G67A 3IVGA 3L8DA 4HZUB 1NT4A 1NVVQ 1GCUA 2X2EA 4KC0A 4W63A 4LJYA 5GM2A 3D5QA 2VAVA 3KU4A 1RCTE 3VBEA 3WFZA 4KIJA 1DC4A 2Q99A 1SRQA 3UNXA 5IM5A 4JT9A 3TPZA 2Q21A 2JGDB 1QHHA 4G5XA 4M60A 1RBYA 4NU5A 1KH3A 3G9QA 4LAFA 1SXPA 1BROA 1QGED 3FUCA 5KTTA 2WJJA 4BJ1A 4JLMA 1BS2A 2WJGA 3TLCA 3JZDA 5KNBA 3QWAA 1R4NB 1X8XA 2AIRA 2Z83A 3IBFA 2H1VA 4OM7A 2Z2XA 3K0KA 5B6JA 4PHCA 1GKKA 1TX4B 1THGA 1W88B 3GLHB 4GAEA 4HH3C 1RI1A 3KOWA 3PFNA 3UXMA 1MORA 1M9NA 3H3XA 3L82B 2W6JD 4G5GA 1Q6ZA 2FZKA 3WLSA 4FMBB 2PXHA 3K0FB 1PW5A 4XVUA 1KPHA 2RK6A 2V6JA 1JQJC 3N7AA 2H92A 1XJCA 3C4VA 3QPBA 3EXHA 3MTEA 3W8DA 1DOHA 1T8RA 5JC8A 2PUTA 1Y5RA 5LLTA 1KKLA 1TZMA 2FN9A 1JHQA 1IWBB 4H16A 4FN5A 2XQJA 1DVRA 3TLBA 1CQIB 4K9LA 2P5SA 4C0LA 3C3KA 4KRYA 1R5NA 2KBFA 4OCZA 3AB8A 1K8RA 4MYCA 4P81A 3UAXA 1XTTA 1UADA 2GS9A 4NBSA 1Y6GA 3C6ZA 3PFCA 4AR4A 4D43A 4ARZA 3E1GA 1PS9A 3KBBA 1JVNA 3K7EA 4Q34A 4MDHA 2FQQA 2O9JA 4DM3A 1E0SA 3M6LA 1E4YA 5IWAB 1SUPA 1DADA 1MC5A 2JLUA 2JGDA 3MOGA 3QLVA 3FZQA 2Y1EA 3O3OB 4DB2A 2Q49A 4BO8A 1BN7A 3G02A 3N6RA 3TJZA 3GNLA 2JFUA 1B71A 5TJ9A 5B58T 4ID9A 3L8MA 1SZDA 1ZONA 2B9EA 5KYWB 3CEPB 1B7GO 1TM4E 2PUVA 3ZNQA 1SKAA 1VKOA 4Y6PA 2ZJ4A 2QS9A 4HH0A 1T3ZA 4PGGA 1ADBA 2PS0A 2IDZA 5AUPB 4PSVA 3M1LA 7MHTA 1PT6A 1Y7PA 1YRLA 3DXXA 1A9TA 4V02A 2CMGA 4KQCA 3ZU5A 5BNWA 5DRYA 3L0DA 4KACA 1I2BA 2L0XA 1EMDA 4HNAB 4C7BA 2D2XA 4K03A 3GH1A 3WGOA 5BVGB 1E3WA 1FTWA 4O4LA 4WK2B 1WEKA 2JGLA 1ONBA 4MW4A 5AQEA 3SJUA 5BW8A 2JI2A 4NU0A 3PUYA 5BOSA 3D7NA 4IM7A 4JP1A 4KQIA 5FI3A 4MHTA 4IVQA 2J5XA 3LS2A 2NO0A 5I7SA 3ABSB 2B37A 4WAUA 4AK9A 3QX9A 2EAUA 2A9RA 3G3EA 3OT1B 5CK4A 2WWGA 4KPGA 5J2UF 4YFVA 4LKOA 5JECA 4P0PB 2UZ0A 4B31A 5KJEA 1GCIA 1MTOA 3QBEA 3QFSA 4B34A 2P0AA 1RZRA 1PG5A 5CB4B 3QNMA 1DQRA 1SURA 2ALJA 3PXUA 4G89A 4RH1A 4REQB 2JFZA 3DOUA 3S17L 4TLEA 2OQVA 3LQKA 5HJ5A 3ANYB 4PE5B 3HWSA 2J6BA 2Q41A 2Z2ZA 4HNUA 1M1YE 3E3LA 1LRKA 4P53A 2PK3A 4HPJB 3G2MA 4DIDA 4DSUA 5DNWA 4A9AA 4AY6A 2E3JA 2ZB7A 1WMFA 3S68A 5HIJA 1KDVA 1YVEI 1FYXA 1A7KA 5CW1A 3THWB 2X8JB 3ASVA 2BLNA 3U39A 4B3RB 1Y7LA 3DYIA 3IAS1 4G24A 5CNMA 2QLMA 5ALWA 2G5PA 4L6IA 4B1FA 3RYCA 1JG6A 2GBLC 3LQ2A 1P2DA 4GE3A 1W2WB 2W6ID 3AL2A 4Y2HA 4J4TA 1UBSB 2R5FA 3OPNA 3MWYW 1IJBA 3U16A 3OP4A 1D6MA 4JAGA 1L4HA 1BGVA 2EX4A 2EGHA 2NU7B 4BXXL 2D1QA 4UC0A 2NO4A 5AK0A 3V1LA 1U3GA 2RH5A 1LX6A 4GOKA 3RU3A 2HLDD 1Y9AA 2SCUB 3EBPA 5D2CA 3SBOA 4JBWA 1K68A 4JJ4A 2N75A 3CJQA 1N5RA 1W36D 4Z2AA 4H15A 4OUDB 1KEPA 1PK9A 2JIZA 4I4IA 4P80A 4EJFA 1I4WA 3T3IA 2W7TA 3D8RA 4EPYA 6YASA 3KLNA 4OHYA 2WYWA 5DX1A 3SXUB 3M70A 1C8KA 2BJHA 1UDCA 1EWTA 2G9VA 2A6HD 1E1KA 1F8GA 1NVVR 1PLJA 3LTEA 1NNQA 3HNPA 4R01A 4BQRA 4BVBA 5CDFE 1QDEA 4WFIA 5IHXA 1LI4A 2PSHA 1CZLA 1VZGA 2GHTA 3DTVA 2D0DA 1A9XB 1XQ1A 2DWQA 3L5OA 1WE2A 4I50B 3JAKA 3TXYA 2PD3A 2QGZA 5ECGC 5JJKA 4KXNA 3UB4A 1F3LA 4I6JA 3A4IA 4XH9B 3TGPA 1HSOA 2WYOA 4QJ5A 3R7SA 5M3ML 2JKZA 1Q1EA 4KN6A 5C32A 1G8JA 2AC4A 2WUFA 4OTZA 4XM1A 3R6WA 4BC0A 5JPDA 3KL2A 3SDBA 4OHCA 4RK6A 5TMPA 1WXQA 3AP1A 4EQ6B 5CD9A 3H0GL 4NENB 3OICA 4PX5A 3L06A 3MJCA 4NONA 4TMWA 3AIKA 3TW4A 3G2JA 4MA5A 4AP6A 2DUNA 2ZI9A 4K40A 2ZJOA 2D7CA 2PZFA 1HDRA 3ABIA 4I55F 1ZU4A 1NI5A 1FBNA 4Q7MB 3WMXA 2ARKA 4H7EA 2RAFA 5IC5A 5L4NA 1JU4A 1RLJA 4S04A 1CR0A 1MNQA 1THMA 1RAIA 4FFSA 3T7EA 4D4KA 5LN1A 2BGJA 2CHEA 5CB0A 3NATA 2R8OA 4OXYA 4PX2A 4MUEA 2W6CX 3DP9A 4QXPA 4NH0A 1DX6A 4V0RA 5FPHA 4U63A 4ZQCB 4OFXA 1T5HX 4TVSA 521PA 4DR4B 1WZUA 2GNAA 1YBMA 1L4UA 5H4GA 7MDHA 4KPFC 4YUWA 3CO5A 4UPVA 1I2CA 3R0QA 2IV7A 5MGBA 1YZGA 1QFYA 2JLRA 1OIVA 3KJHA 3N86A 1Z6GA 1LK5A 3AB3A 5HZKA 4LIPD 3KUUA 2P6OA 3LWBA 1P6QA 3BKXA 5DHAA 4CV1A 4BMPB 4B2YA 3MPSA 2FG7C 3HO8A 1FSPA 4CTKA 1SCAA 5AK6A 4E1AA 4MJ7A 1M1UA 2R4UA 3CKYA 4HWRA 4LMBA 3TRIA 3HVRA 4JOCA 5JMWA 1L9XA 4O08A 2AMYA 3FOEC 5EJ9A 1NX9A 1NRWA 1Z0SA 5DTQA 4ZQFA 2I87A 1QHEA 5EL0A 3L4JA 2ZUVA 2EQ5A 1OA1A 1I4EB 1SC1A 4YALA 3BXOA 1NTOA 4A5OA 1OFUX 1K08A 1DRUA 1T43A 3HP1A 4COOA 4A2CA 3CKMA 2QL7A 2G80A 1NJSA 2Q2WA 4F4FA 3FFTA 2PRZA 5AICA 4MUIA 5JRDS 5TMDA 3THXA 1CUVA 2DKNA 3ZQJA 4KB5A 2TSYB 3Q8WA 4GMXA 5G4KA 1W48A 5HJ2A 4B7XA 4NE2A 5EYPA 2X4LA 2NZXA 5DDIP 2VLBA 3IULA 4JP3A 4LYFA 3SSAA 2BGWA 4B6QA 1WMBA 4KPYA 3O9VA 3FMOB 4KCGA 5LQCA 3PXCX 3AHGA 2CFTA 2PL1A 2YOHA 5IJ9A 4G07A 3SYRA 1L5FA 1E7WA 1MQ9A 1NBHA 4ZU1X 3EA4A 4I6EA 3GP5A 4OREX 3NP9A 2AS0A 2B7BA 2WB2A 3HR8A 2MSCB 4B4DA 2VHZA 2FPKA 1J42A 4ZU6X 1YA6A 1OTYA 1VG8A 4PR3A 5HF8A 2HZBA 2ZI3A 5HIMA 3U3MA 2CDBA 3DB2A 3DVAB 4MGHA 3UKDA 1C1HA 3OE4A 5H16A 5JNSA 1LLUA 1HNXB 4CVNA 2PQ2A 1O77A 3ICQB 1WQ4A 3GLIA 3TGLA 2QWXA 2CMKA 1G9SA 3N8GA 5ALXA 2A9JA 2ATEA 3IUSA 2DSTA 3L49A 4J9VA 3S40A 3FPLA 1KRHA 5IP9L 4RKEA 3SPXA 1VYUA 5HFNA 3AVXA 5B5SA 3FJOA 4WJLA 1MH9A 4CWAA 1EFDN 2CCJA 1L8AA 2PL9A 1BCSB 4WFN1 1TW3A 2GPAA 2MSEB 3DW1X 3Q3JB 4I2VA 3U7JA 3RS2A 3WLNA 4KQJA 4UD6A 4P82A 4UVDA 1E69A 2Y27A 1GSIA 2V7QD 1LQTA 2JCGA 1P5FA 2XMQA 2Q6LA 4AZ3B 1QQAA 1I7NA 1T4GA 4GKJB 2EY4E 3R5TA 1RPNA 3QY9A 4KKXB 1P1BA 5J2UB 2Q4BA 1YJAA 3QQPA 4GOND 1K6EA 1FLAA 1M2EA 2IQ5A 3MD9A 5CX1A 2H1HA 2X4DA 2Y4OA 5FBVB 2GZ1A 3WGJA 4KK3A 4C78A 3P27A 5G02A 1XGKA 3D0RA 3C2QA 2HSWA 3GQBA 1FDRA 3KM0A 1NBWB 4IIUA 2KLHA 3SP1A 5JYBA 3C85A 1X86B 3GLUA 5EHQA 1M2VA 1WVIA 1J0AA 2AOUB 1C9NA 5A9SB 5C1PA 1J7JA 3QE2A 2WUWE 3V8MA 2PYDA 4AWXA 3TLZA 2JJQA 2XYRA 3B8EA 1DL5A 2B36A 1XTVA 3BDIA 5D6OA 4UEJA 4TYNA 1G6OA 3F5SA 3FDXA 4NBWA 4K2HA 4OQLA 4G65A 3T9FA 3N53A 1D4AA 3H2ZA 5JAHA 5IVIA 3EBLA 3ON5A 4UCFA 4A8PA 5FBWB 4FR2A 1DEXA 1D5WA 3F6CA 4DVGA 1D2AA 3HJAA 1UFKA 4IDOA 2X9NA 3KCNA 3IJEB 1Z4IA 3PGLA 1KQ3A 2ODPA 4IDFA 4QBIA 4TKUB 3GLIB 2FDCA 2W6JA 2J5BA 2RHCA 3VU1A 1C4OA 4NTZA 1SPXA 2H63A 2HMYB 4CDMA 4IIDA 1KJJA 1W8DA 1SPBS 2XDYA 3NEAA 4HG2A 1TT7A 5EY5B 1U3CA 3QXHA 3WRYC 4E7OA 1ECPA 2UDPA 3BWMA 1PYDA 4TKVA 3DWFA 3H11B 2ZKLA 4V0SA 2M4VA 2QD3A 1N6IA 1NVKA 3DB1A 1WUTA 3RV4A 4ENTA 3EF0A 2IIPA 5DB4A 3AZOA 2NM0A 4PV7A 3TZQA 1SCBA 2PIDA 2D0IA 3N5KA 5LKAA 3D54D 1GRCA 2GVDC 1F0NA 3D8TA 4G9EA 4YJFA 3P9XA 2NNLD 4G0YA 4GYYA 5AXAA 1NBMD 2NUAA 2QY9A 1EG7A 4HNHA 5CIYA 1N92A 4RHTA 1C3VA 3T1TA 2A33A 1E2EA 2YYZA 5DNYB 1IONA 4GXQA 4QWMA 2IEIA 3VR3D 4UE6A 1HTBA 5CFPA 4L4SA 1ZCFA 3BEDA 4YTEA 2WB4A 5IF9A 1PGNA 3I9NA 3WFJA 3FUVA 3RSFA 4AQDA 1OLUB 1H1DA 4WKNA 3VKHA 5B2EA 5LZ4A 5AW5A 3EQ8A 5IAEA 1ODTC 1YDEA 4P2BA 1YAHA 3ZCVA 3NBQA 2GTHA 2OFPA 4B33A 5DHFA 1RE0A 1RI2A 1T8SA 2PA3A 3KEMA 2R62A 2GF0A 4FEYA 4G5FA 4IWYA 5T4FA 3BZWA 4EI2A 3U0BA 3NTLA 3B7WA 4EJSB 3VFDA 4C89A 2F17A 1JEJA 2VHCA 4IMJB 4ZQHA 3VKUA 4GGOA 3VO1A 2PEZA 3EISA 4G1BA 2JFGA 5CVDA 5AKJA 5ALDA 4UHFA 4BP1A 3NIFB 1GNLA 4W1SA 1UPFA 2CJWA 4MR9A 1NKVA 1SY7A 1YE3A 1YZHA 3IBGA 5ALQA 2VNKA 5EP2A 1WQ3A 3O8DA 4OGWA 2C5EA 1JHPA 3G23A 2WD8A 2F8LA 3HM2A 4XXHA 5JNTA 5CM9C 5CMLA 2A5DA 1T8YA 2NQTA 1JBEA 4J8PA 4KLZA 3DJFA 3G9XA 4RVSA 2FE1A 2OYCA 4YQYA 1YVPA 4DYHA 3DEFA 1MO2A 2O1XA 4C4YA 1QFXA 6REQA 3P9SA 3EFEA 1C8BA 1FU8A 4G1FA 4HADA 5MN5A 1WW3A 2R00A 1ETHA 2QUAA 3CZ9A 4YRZA 2YWRA 1R8XA 1NHGA 4U00A 3DKPA 4JENA 3BIWA 3SLRA 2OM6A 2AJDA 2ZJ6A 3AFIA 1R0FA 3CZMA 4EPRA 3AESA 2RFKB 4OYRA 3H2SA 4UTVA 2XE7A 3IUEA 1VLHA 4Y6OA 1DDGA 3DTVD 1Z4QA 3GGGA 1PJ3A 3BAFA 4RFSA 1STOA 2H48A 2IITA 2A5GA 1K6JA 2A68D 1Y5IA 2IYPA 4FNGA 3FMVA 1G4AE 1K5GA 4LJ7A 4UDNA 4ARUA 4Z8YA 2JD1A 2I62A 9ATCA 2OBXA 4I9NA 4FDUA 1V8PA 5AM4A 1SMMA 1B0AA 1KAOA 2A9PA 1MGOA 1C3OA 4UAJA 1EM6A 2JIZD 3IELA 2BISA 3Q9NA 2X7HA 1ZWLA 1GQQA 2ORWA 1PJZA 1IY2A 1GUFA 3BRWA 1DWUA 4JT4A 3U3JA 5C4IA 1XQVA 1D2HA 2C7RA 1NW8A 4BQPA 1YKGA 1R10A 2EEZA 3H9QA 5K3SA 4MUYA 3KAJA 3TL3A 1M0EA 1CFZA 1SCKA 4RKWA 4XXBB 3IKJA 3QA3E 5EWLA 4W5QA 1G2PA 5IM4F 3HH8A 3MM4A 1BQ4A 4GOLD 5A3SA 4QG3A 1ISMA 4JDUA 1UFVA 3FN4A 2BBWA 2FMUA 1GT6A 1L1RA 2VHJA 3PE6A 4Q9JA 2D13A 1SK9A 2GAFA 3T35A 2JIOA 5C8YB 4DJ5X 3VUFA 3H83A 1JP7A 2CFCA 4D0SA 2NACA 1L5LA 2I29A 2ZJZA 1T13A 2GGSA 3CE6A 5L3SA 4WNAB 5AMXA 5L6LB 3E9MA 1BE1A 1NLMA 3GRCA 2ZIGA 3PRJA 2QVYX 4FFOA 4HF7A 2YVKA 3LT2A 5MHTA 3TZEA 4R54A 2ZTVA 4R41A 1H85A 3A26A 3GA7A 1YH3A 2QRNA 1II8B 1N57A 2ZAIA 3GOHA 4IVPA 4IS3A 4S1TA 3C0KA 1M2OA 1Z2AA 1J97A 2WJAA 5FWDA 3K6SB 1A9QA 2X1LA 3FKJA 1TEZA 1XOIA 4PRLA 2R7LA 1Q0LA 4DT1A 1RQRA 1IWOA 4IFBA 3DAYA 2RDVA 2ZBEA 1E58A 4WXPA 4HQOA 2Q45A 1OZGA 4NCAA 1LZLA 3SZUA 1CB7A 3PNLA 4JJFA 1X1EA 3P9YA 3NYWA 2EJUA 4LRUA 4RDHA 1EDOA 3JVEA 4K3UA 1ENYA 4KI0A 3EZ7A 2I6TA 4G5QA 1ITZA 1ZM7A 5D3KA 4LJLA 4E70A 1U31A 1MC8A 4XR4A 2WT4A 5AR1A 2QTZA 5IF3A 4WV3A 4AO6A 2CKCA 1LDGA 2TMKA 1GFSA 2VWQA 3F7MA 4LYYA 1Q7BA 1IHXA 3UK7A 2RG7A 4KG7A 4D6YA 1A77A 3K4QA 3LKZA 4G0VA 3Q0EA 2CFOA 2RGWA 1RTTA 5GIOE 4U9HS 1S5PA 3SC6A 3U4AA 5CXQA 1HPLA 3S1ML 2YICA 5FFFA 2NUTB 3W9YA 2YY5A 4IDQA 3VR6D 3A70A 4HTAA 3T1HB 3EXAA 1J9ZA 1RP7A 3JRNA 4RGBA 1Z0DA 3LLCA 3QBTA 1E1QA 1RJFA 2BLLA 4G36A 3TQSA 3AQ4A 3M6MD 4U7HA 3Q2IA 3DBIA 1OYWA 2AR7A 4CMJA 3GA5A 3BRSA 2OPHA 5ES4B 3U56A 3ZCXA 2XZLA 1LKMA 3QG1A 1RABA 1XEWX 1D6NA 4RY2A 3LUAA 4YIKA 4KNYA 1TXGA 4OB8A 2WTEA 4UAUA 3K9CA 3R1IA 2JCXA 2O4CA 4JOQA 2RE8A 3SHFA 2W8BA 5LYJA 3UCEA 5JAPA 1GFWA 4C29A 3NHRA 4WEQA 5HBRA 3DONA 1HTTA 3H4TA 4R6XA 2WHQA 2QQ5A 1CX9B 3EGXA 4Z2YA 3HOZL 5FADA 5FDFA 3T3NA 1U1DA 4KIWA 1YF3A 3U49A 2IBMA 5AD1A 2M4YA 2ZYDA 2XJUA 2V7GA 3AUYA 4JLUA 1P0CA 2FX3A 5AESA 3DOHA 4JLOA 2JIBA 4EJSC 1QRUA 4B4VA 4PTLA 3CIFA 4M3NA 4QARA 4G1VA 3ZZTA 4ZZ3A 3UPUA 2D54A 1Y6JA 4AHYA 4Q03A 1A1SA 2AW3A 4HXFB 1XNHA 5DSTA 4HNAA 1HA3A 5I7VA 3QSYA 3HCEA 2Y1KA 4BEWA 1QIKA 4WCVA 2JGNA 3LUCA 3U3ZA 4BX3A 2PUGA 1YQTA 5I9SA 4D97A 5FCDA 2Q5CA 2XTAA 3L2OB 4FXPA 2UUOA 4TXNA 5BW4A 3L9WA 1YE8A 2BSXA 3NT5A 4Z4IA 2VJPA 2AW5A 1DC7A 1JG7A 1KDTA 4Q1FA 1HDEA 3FVTA 4HTFB 4PR0A 2RHBA 4BU0A 4W99A 3CWCA 1OVMA 1QAOA 1W87A 3TSZA 4L5IA 1F48A 4RXTA 2II6A 1W49A 4HRXA 3L8GA 5AO9A 5HTKA 2WJYA 2QW1A 2BGMA 2EBWA 2IZ0A 5FXMA 1CG6A 2PT7A 1BQEA 4AG3A 3G1UA 2P90A 4Z4FA 4ZJYA 2GEBA 1MB9A 2ZBVA 1G20A 5ENDA 4YP9A 5TNXA 2X5OA 2Q5JA 3KELA 1KMMA 4XQCA 2QAJA 4A3JL 3OJFA 3ZE2B 2R0QC 9LDTA 5C7OO 4FYWA 3VKFA 1S2IA 4YP1A 2Z30A 2GYVA 4LZOA 1U2SA 4J6EA 5HMLA 4AVYA 4DCSA 2W2QA 1XNRB 3LZDA 3PD0A