2PMZP

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
43
structure length
43
Chain Sequence
b'CGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 1
structure length 43
sequence length 43
chains with identical sequence Z
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF03604 DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.30 Mainly Beta Single Sheet Rubrerythrin, domain 2 RNA polymerase ii, chain L 2pmzP00
3H0GL 5C4JL 5C3EL 2E2JL 2YU9L 2VUML 4A93L 1Y1WL 4C3JL 1K83L 3GTLL 1TWAL 4AYBP 1I3QL 3S2HL 3I4ML 1Y1VL 3S1ML 3GTPL 3PO3L 5C44L 2NVYL 3CQZL 3HOZL 3HOXL 2JA8L 2JA7L 5IYBL 4BBSL 3HOUL 2NVTL 3PO2L 4A3EL 4A3CL 5IYDL 1WCML 1TWCL 2R93L 4C3IL 3GTKL 3GTQL 4BY7L 4BXXL 2B63L 3H3VM 5IP7L 5IYCL 3RZOL 1TWFL 3M3YL 3S1RL 4C2M1 5FLML 4A3LL 3S17L 3S1NL 3GTJL 4Y7NL 4A3IL 2E2HL 3FKIL 2NVXL 4BY1L 5M5YL 2JA5L 3S16L 4X6AL 5M3ML 3RZDL 3M4OL 3HKZP 5C4XL 1TWGL 2WB1P 4A3GL 4A3DL 1I6HL 4BBRL 2NVQL 3HOWL 1R9TL 3I4NL 2Y0SP 5FJ8L 5M5XL 4A3ML 3S1QL 2E2IL 2WAQP 1TWHL 3GTML 5IP9L 3S15L 3K7AL 4QIWP 4A3JL 2JA6L 3GTGL 4A3BL 3S2DL 4A3KL 3HOYL 1I50L 5M5WL 2R7ZL 1SFOL 4A3FL 5M3FL 3HOVL 2R92L 4C3HL 3GTOL 3S14L 4Y52L 2PMZP
chains in the Genus database with same CATH superfamily
4LHNA 2VUML 4A93L 1Y1WL 2KKDA 4AYBP 5C44L 4K9FA 3MQKB 2AYJA 2JA8L 4TPUA 1T9OA 1QQTA 4BBSL 4AI1A 2NVTL 4AR5A 2XJSA 2JI3A 1C09A 1BRFA 2XJUA 1LKPA 5IYDL 1WCML 1TWCL 5GAHc 3J7Y1 3QQCE 1H7VA 1LKMA 3RYGA 5MF6A 3KYUA 4BY7L 2B63L 1ODHA 5MGNA 5GADc 3RZOL 4AR3A 3PWFA 4POFA 4ZN1B 2PPTA 1YUXA 4Y7NL 2O5JD 5DM61 2AUSB 2PVXA 2JA5L 5M3ML 2JI2A 3M4OL 6RXNA 5C4XL 1TWGL 2WB1P 2PVEA 1I6HL 2XJTA 2A68D 1R9TL 1R0IA 5EINC 1JYBA 4QIWP 4A3JL 2JA6L 2V0FA 3GTGL 4A3BL 2M6PA 2Z3RB 1SMWA 5EIOC 4E6YA 4A3FL 5MLC3 4XXBB 1R0GA 1LTLA 5MFPA 2XJRA 4UY81 2EY4E 5C4JL 2E2JL 2YU9L 4C3JL 3PIO1 4AI2A 2MS3A 5AN9H 3S2HL 3I4ML 1BQ9A 1OWCA 3PL5A 3GTPL 1NXEA 1RYTA 2CKAA 3K35A 1IU5A 3HOZL 8RXNA 4AI3A 5IYBL 4U671 3H97A 4G6BA 3B0AB 2XJVA 1Z92B 7RXNA 4A3CL 2R93L 2C6BA 2DSXA 3FDJA 2K2DA 1CADA 1B71A 1RWDA 4BXXL 2AQCA 3H3VM 3PKJA 1YV1A 4GS7D 3M3YL 3LWPB 3S1NL 1VCXA 4A3IL 2NVXL 4BY1L 4V196 3S16L 4X6AL 3KYYA 3RZDL 1RYQA 2H12A 2V3BB 5DM71 3KYXA 4BBRL 2NYDA 5RXNA 3I4NL 4XGHA 5M5XL 1OWBA 4WFN1 2L0ZA 3VPBE 3GTML 3S15L 1VZHA 1YUZA 1FHHA 1S24A 2ERSA 1IROA 2M4VA 1WJVA 1PFUA 3B08B 4B8CD 2R7ZL 3LPEB 2R92L 4C3HL 1NNQA 4AI0A 4Y52L 1S2ZA 5C3EL 1RDVA 1K83L 3H99A 4YWMA 1RDGA 3GTLL 2CKCA 1TWAL 2QL0A 4ZN3B 1NXGA 5AI2A 1BFYA 1PFVA 2NVYL 3KYVA 3HOXL 3SS2A 3MSUA 4LHLA 2M4YA 3QVDA 1QCVA 1T9PA 2PYAA 3HOUL 3PO2L 1BE7A 1E8JA 5GAEc 1DX8A 5K2ME 2V0EA 4TVMA 3GTKL 3LWRB 1SMUA 2XJPA 2BE5D 4AHYA 3S1RL 4JAFA 1YK4A 1T9QA 2LCQA 2VL6A 3H9BA 3KYWA 3S17L 4A3LL 3GTJL 1IW7D 3FKIL 4RXNA 3HAXC 2KN9A 1BQ8A 4POGA 4A3DL 1RB9A 2NVQL 3HOWL 3NFPI 2Y0SP 1FHMA 5FJ8L 2A6ED 4YWLA 3S1QL 2E2IL 1TWHL 3A44A 1IU6A 5IP9L 3PZAA 3WWNB 1PFWA 1P7PA 4A3KL 3HOYL 1I50L 1R0FA 1SFOL 5MFZA 5M3FL 3HOVL 2A6HD 3GTOL 3S14L 2PMZP 1B2OA 2APOB 2ERJA 3H0GL 3P8BA 3HJYB 3H9CA 4ME3A 3MPSA 5AI3A 2J9UB 2RFKB 1VZIA 1I3QL 1B13A 1Y1VL 3S1ML 2B5ID 3PO3L 2CR8A 2HR5A 3CQZL 4AHWA 2JI1A 2JA7L 3HJWB 1YK5A 1VZGA 3P2AA 1QYBA 3ZG6A 4A3EL 4JADA 4C3IL 3GTQL 2M6OA 1S30A 2Z3QB 5IP7L 5IYCL 3LNLA 1TWFL 2C6AA 4C2M1 5FLML 2GMGA 1R0JA 2E2HL 4AHXA 2RDVA 5JVG1 5M5YL 3HKZP 4AR4A 5JVH1 3JR7A 2A69D 4AHZA 5IY0A 3RZTA 4A3GL 2XJQA 3RZ6A 1B2JA 3IU3I 4A3ML 3PKIA 3LWOB 5GAGc 2WAQP 3LWQB 1DVBA 4AR6A 1ZRPA 1PZXA 2ZIXA 2PSMC 1PFYA 3K7AL 3J7Z1 1R0HA 5H1Sc 1IRNA 3S2DL 5M5WL 1LKOA 2HVYC 3PIP1 3LWVB 1SMMA 1F4LA 4JAGA 1CAAA 3WWLA 4JAEA
chains in the Genus database with same CATH topology
3H0GL 5C4JL 5C3EL 2E2JL 2YU9L 2VUML 4A93L 1Y1WL 4C3JL 1K83L 3GTLL 1TWAL 4AYBP 1I3QL 3S2HL 3I4ML 1Y1VL 3S1ML 3GTPL 3PO3L 5C44L 2NVYL 3CQZL 3HOZL 3HOXL 2JA8L 2JA7L 5IYBL 4BBSL 3HOUL 2NVTL 3PO2L 4A3EL 4A3CL 5IYDL 1WCML 1TWCL 2R93L 4C3IL 3GTKL 3GTQL 4BY7L 4BXXL 2B63L 3H3VM 5IP7L 5IYCL 3RZOL 1TWFL 3M3YL 3S1RL 4C2M1 5FLML 4A3LL 3S17L 3S1NL 3GTJL 4Y7NL 4A3IL 2E2HL 3FKIL 2NVXL 4BY1L 5M5YL 2JA5L 3S16L 4X6AL 5M3ML 3RZDL 3M4OL 3HKZP 5C4XL 1TWGL 2WB1P 4A3GL 4A3DL 1I6HL 4BBRL 2NVQL 3HOWL 1R9TL 3I4NL 2Y0SP 5FJ8L 5M5XL 4A3ML 3S1QL 2E2IL 2WAQP 1TWHL 3GTML 5IP9L 3S15L 3K7AL 4QIWP 4A3JL 2JA6L 3GTGL 4A3BL 3S2DL 4A3KL 3HOYL 1I50L 5M5WL 2R7ZL 1SFOL 4A3FL 5M3FL 3HOVL 2R92L 4C3HL 3GTOL 3S14L 4Y52L 2PMZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G L;  5C4J L;  5C3E L;  2E2J L;  2YU9 L;  2VUM L;  4A93 L;  1Y1W L;  4C3J L;  1K83 L;  3GTL L;  1TWA L;  4AYB P;  1I3Q L;  3S2H L;  3I4M L;  1Y1V L;  3S1M L;  3GTP L;  3PO3 L;  5C44 L;  2NVY L;  3CQZ L;  3HOZ L;  3HOX L;  2JA8 L;  2JA7 L;  5IYB L;  4BBS L;  3HOU L;  2NVT L;  3PO2 L;  4A3E L;  4A3C L;  5IYD L;  1WCM L;  1TWC L;  2R93 L;  4C3I L;  3GTK L;  3GTQ L;  4BY7 L;  4BXX L;  2B63 L;  3H3V M;  5IP7 L;  5IYC L;  3RZO L;  1TWF L;  3M3Y L;  3S1R L;  4C2M 1;  5FLM L;  4A3L L;  3S17 L;  3S1N L;  3GTJ L;  4Y7N L;  4A3I L;  2E2H L;  3FKI L;  2NVX L;  4BY1 L;  5M5Y L;  2JA5 L;  3S16 L;  4X6A L;  5M3M L;  3RZD L;  3M4O L;  3HKZ P;  5C4X L;  1TWG L;  2WB1 P;  4A3G L;  4A3D L;  1I6H L;  4BBR L;  2NVQ L;  3HOW L;  1R9T L;  3I4N L;  2Y0S P;  5FJ8 L;  5M5X L;  4A3M L;  3S1Q L;  2E2I L;  2WAQ P;  1TWH L;  3GTM L;  5IP9 L;  3S15 L;  3K7A L;  4QIW P;  4A3J L;  2JA6 L;  3GTG L;  4A3B L;  3S2D L;  4A3K L;  3HOY L;  1I50 L;  5M5W L;  2R7Z L;  1SFO L;  4A3F L;  5M3F L;  3HOV L;  2R92 L;  4C3H L;  3GTO L;  3S14 L;  4Y52 L;  2PMZ P; 
#chains in the Genus database with same CATH topology
 4LHN A;  2VUM L;  4A93 L;  1Y1W L;  2KKD A;  4AYB P;  5C44 L;  4K9F A;  3MQK B;  2AYJ A;  2JA8 L;  4TPU A;  1T9O A;  1QQT A;  4BBS L;  4AI1 A;  2NVT L;  4AR5 A;  2XJS A;  2JI3 A;  1C09 A;  1BRF A;  2XJU A;  1LKP A;  5IYD L;  1WCM L;  1TWC L;  5GAH c;  3J7Y 1;  3QQC E;  1H7V A;  1LKM A;  3RYG A;  5MF6 A;  3KYU A;  4BY7 L;  2B63 L;  1ODH A;  5MGN A;  5GAD c;  3RZO L;  4AR3 A;  3PWF A;  4POF A;  4ZN1 B;  2PPT A;  1YUX A;  4Y7N L;  2O5J D;  5DM6 1;  2AUS B;  2PVX A;  2JA5 L;  5M3M L;  2JI2 A;  3M4O L;  6RXN A;  5C4X L;  1TWG L;  2WB1 P;  2PVE A;  1I6H L;  2XJT A;  2A68 D;  1R9T L;  1R0I A;  5EIN C;  1JYB A;  4QIW P;  4A3J L;  2JA6 L;  2V0F A;  3GTG L;  4A3B L;  2M6P A;  2Z3R B;  1SMW A;  5EIO C;  4E6Y A;  4A3F L;  5MLC 3;  4XXB B;  1R0G A;  1LTL A;  5MFP A;  2XJR A;  4UY8 1;  2EY4 E;  5C4J L;  2E2J L;  2YU9 L;  4C3J L;  3PIO 1;  4AI2 A;  2MS3 A;  5AN9 H;  3S2H L;  3I4M L;  1BQ9 A;  1OWC A;  3PL5 A;  3GTP L;  1NXE A;  1RYT A;  2CKA A;  3K35 A;  1IU5 A;  3HOZ L;  8RXN A;  4AI3 A;  5IYB L;  4U67 1;  3H97 A;  4G6B A;  3B0A B;  2XJV A;  1Z92 B;  7RXN A;  4A3C L;  2R93 L;  2C6B A;  2DSX A;  3FDJ A;  2K2D A;  1CAD A;  1B71 A;  1RWD A;  4BXX L;  2AQC A;  3H3V M;  3PKJ A;  1YV1 A;  4GS7 D;  3M3Y L;  3LWP B;  3S1N L;  1VCX A;  4A3I L;  2NVX L;  4BY1 L;  4V19 6;  3S16 L;  4X6A L;  3KYY A;  3RZD L;  1RYQ A;  2H12 A;  2V3B B;  5DM7 1;  3KYX A;  4BBR L;  2NYD A;  5RXN A;  3I4N L;  4XGH A;  5M5X L;  1OWB A;  4WFN 1;  2L0Z A;  3VPB E;  3GTM L;  3S15 L;  1VZH A;  1YUZ A;  1FHH A;  1S24 A;  2ERS A;  1IRO A;  2M4V A;  1WJV A;  1PFU A;  3B08 B;  4B8C D;  2R7Z L;  3LPE B;  2R92 L;  4C3H L;  1NNQ A;  4AI0 A;  4Y52 L;  1S2Z A;  5C3E L;  1RDV A;  1K83 L;  3H99 A;  4YWM A;  1RDG A;  3GTL L;  2CKC A;  1TWA L;  2QL0 A;  4ZN3 B;  1NXG A;  5AI2 A;  1BFY A;  1PFV A;  2NVY L;  3KYV A;  3HOX L;  3SS2 A;  3MSU A;  4LHL A;  2M4Y A;  3QVD A;  1QCV A;  1T9P A;  2PYA A;  3HOU L;  3PO2 L;  1BE7 A;  1E8J A;  5GAE c;  1DX8 A;  5K2M E;  2V0E A;  4TVM A;  3GTK L;  3LWR B;  1SMU A;  2XJP A;  2BE5 D;  4AHY A;  3S1R L;  4JAF A;  1YK4 A;  1T9Q A;  2LCQ A;  2VL6 A;  3H9B A;  3KYW A;  3S17 L;  4A3L L;  3GTJ L;  1IW7 D;  3FKI L;  4RXN A;  3HAX C;  2KN9 A;  1BQ8 A;  4POG A;  4A3D L;  1RB9 A;  2NVQ L;  3HOW L;  3NFP I;  2Y0S P;  1FHM A;  5FJ8 L;  2A6E D;  4YWL A;  3S1Q L;  2E2I L;  1TWH L;  3A44 A;  1IU6 A;  5IP9 L;  3PZA A;  3WWN B;  1PFW A;  1P7P A;  4A3K L;  3HOY L;  1I50 L;  1R0F A;  1SFO L;  5MFZ A;  5M3F L;  3HOV L;  2A6H D;  3GTO L;  3S14 L;  2PMZ P;  1B2O A;  2APO B;  2ERJ A;  3H0G L;  3P8B A;  3HJY B;  3H9C A;  4ME3 A;  3MPS A;  5AI3 A;  2J9U B;  2RFK B;  1VZI A;  1I3Q L;  1B13 A;  1Y1V L;  3S1M L;  2B5I D;  3PO3 L;  2CR8 A;  2HR5 A;  3CQZ L;  4AHW A;  2JI1 A;  2JA7 L;  3HJW B;  1YK5 A;  1VZG A;  3P2A A;  1QYB A;  3ZG6 A;  4A3E L;  4JAD A;  4C3I L;  3GTQ L;  2M6O A;  1S30 A;  2Z3Q B;  5IP7 L;  5IYC L;  3LNL A;  1TWF L;  2C6A A;  4C2M 1;  5FLM L;  2GMG A;  1R0J A;  2E2H L;  4AHX A;  2RDV A;  5JVG 1;  5M5Y L;  3HKZ P;  4AR4 A;  5JVH 1;  3JR7 A;  2A69 D;  4AHZ A;  5IY0 A;  3RZT A;  4A3G L;  2XJQ A;  3RZ6 A;  1B2J A;  3IU3 I;  4A3M L;  3PKI A;  3LWO B;  5GAG c;  2WAQ P;  3LWQ B;  1DVB A;  4AR6 A;  1ZRP A;  1PZX A;  2ZIX A;  2PSM C;  1PFY A;  3K7A L;  3J7Z 1;  1R0H A;  5H1S c;  1IRN A;  3S2D L;  5M5W L;  1LKO A;  2HVY C;  3PIP 1;  3LWV B;  1SMM A;  1F4L A;  4JAG A;  1CAA A;  3WWL A;  4JAE A; 
#chains in the Genus database with same CATH homology
 3H0G L;  5C4J L;  5C3E L;  2E2J L;  2YU9 L;  2VUM L;  4A93 L;  1Y1W L;  4C3J L;  1K83 L;  3GTL L;  1TWA L;  4AYB P;  1I3Q L;  3S2H L;  3I4M L;  1Y1V L;  3S1M L;  3GTP L;  3PO3 L;  5C44 L;  2NVY L;  3CQZ L;  3HOZ L;  3HOX L;  2JA8 L;  2JA7 L;  5IYB L;  4BBS L;  3HOU L;  2NVT L;  3PO2 L;  4A3E L;  4A3C L;  5IYD L;  1WCM L;  1TWC L;  2R93 L;  4C3I L;  3GTK L;  3GTQ L;  4BY7 L;  4BXX L;  2B63 L;  3H3V M;  5IP7 L;  5IYC L;  3RZO L;  1TWF L;  3M3Y L;  3S1R L;  4C2M 1;  5FLM L;  4A3L L;  3S17 L;  3S1N L;  3GTJ L;  4Y7N L;  4A3I L;  2E2H L;  3FKI L;  2NVX L;  4BY1 L;  5M5Y L;  2JA5 L;  3S16 L;  4X6A L;  5M3M L;  3RZD L;  3M4O L;  3HKZ P;  5C4X L;  1TWG L;  2WB1 P;  4A3G L;  4A3D L;  1I6H L;  4BBR L;  2NVQ L;  3HOW L;  1R9T L;  3I4N L;  2Y0S P;  5FJ8 L;  5M5X L;  4A3M L;  3S1Q L;  2E2I L;  2WAQ P;  1TWH L;  3GTM L;  5IP9 L;  3S15 L;  3K7A L;  4QIW P;  4A3J L;  2JA6 L;  3GTG L;  4A3B L;  3S2D L;  4A3K L;  3HOY L;  1I50 L;  5M5W L;  2R7Z L;  1SFO L;  4A3F L;  5M3F L;  3HOV L;  2R92 L;  4C3H L;  3GTO L;  3S14 L;  4Y52 L;  2PMZ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...