2APOB

Crystal structure of the methanococcus jannaschii cbf5 nop10 complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
EMRMKKCPKCGLYTLKEICPKCGEKTVIPKPPKFSLEDRWGKYRRMLKRALKNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable tRNA pseudouridine synthase B
publication title The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Isomerase/rna binding protein
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2005-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04135 Nop10p Nucleolar RNA-binding protein, Nop10p family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 2apoB00
2APOB 3HJYB 3LWVB 3HAXC 2AQCA 3LWOB 3LWQB 3LWRB 2HVYC 2AUSB 2RFKB 3LWPB 3HJWB 2EY4E 3MQKB
chains in the Genus database with same CATH superfamily
1R9TL 3S1ML 4A3ML 3I4ML 4E6YA 3PKIA 1C09A 3LNLA 1H7VA 1Y1VL 4POGA 4TVMA 4C3IL 1PFUA 1Z92B 2XJSA 4A3FL 4AI2A 1SMWA 1TWGL 2CKAA 2MS3A 1SMUA 5GAEc 3P8BA 8RXNA 2M4YA 4C2M1 5GADc 3H0GL 4ZN3B 3J7Z1 1ZRPA 2Z3QB 3RZOL 5H1Sc 2QL0A 3ZG6A 2CR8A 3GTQL 1NXGA 1OWCA 3HOWL 1E8JA 1P7PA 1SFOL 2E2JL 2C6AA 3KYXA 1B13A 2PYAA 5M5XL 3S1NL 3K35A 4C3HL 1YK5A 3JR7A 4JAFA 3WWLA 5IP9L 5AI2A 2A6HD 4U671 4JAEA 1CAAA 3K7AL 4A3LL 2PPTA 3KYVA 4A3IL 4A3CL 5AN9H 5M3FL 3H3VM 3HOYL 2M4VA 3GTOL 4AR5A 1RYQA 4AR4A 4K9FA 3GTGL 4AHZA 3GTLL 3S15L 1BE7A 1QCVA 3MPSA 1VZHA 1DVBA 1RB9A 1LKOA 2A6ED 3S1QL 1LKMA 5MGNA 7RXNA 3PIO1 3PL5A 5FJ8L 2RDVA 1BRFA 4A3DL 2ZIXA 2O5JD 2R92L 4C3JL 2VUML 5RXNA 5JVG1 2VL6A 1IROA 4XXBB 2AQCA 3MSUA 3PIP1 3RYGA 2HR5A 5M5YL 1B71A 4AI1A 1FHMA 2B63L 2L0ZA 2JA8L 1PZXA 4JAGA 3H99A 2A68D 4B8CD 2AUSB 1DX8A 3FDJA 3RZ6A 1PFYA 3H9CA 1YUXA 1NXEA 4XGHA 5C3EL 1T9PA 1LTLA 4AR3A 4AI0A 5FLML 5M5WL 1S30A 2WAQP 2PMZP 4G6BA 3GTPL 3M4OL 5C4XL 3KYWA 3PWFA 1SMMA 5IP7L 3B0AB 3PZAA 3LWVB 5MF6A 3QQCE 2JA7L 5MFPA 1B2OA 2NVTL 3KYUA 3MQKB 2XJUA 2GMGA 1IU6A 4LHNA 4BXXL 2Y0SP 1TWAL 3NFPI 2ERSA 2PVEA 1QYBA 4GS7D 1OWBA 5K2ME 1NNQA 2R93L 2APOB 3S14L 1RDGA 3FKIL 4BBSL 2H12A 3GTML 3I4NL 4A3BL 2E2HL 5IYCL 4AR6A 1BQ8A 5C44L 1WJVA 1I6HL 4AHWA 2JI2A 2XJVA 3HKZP 2WB1P 2HVYC 3SS2A 1R0GA 5GAHc 1R0IA 3VPBE 1JYBA 1QQTA 2V0EA 4A3EL 2RFKB 1CADA 4LHLA 4TPUA 3LWRB 3PO3L 5EIOC 5IY0A 2M6OA 1YK4A 1TWFL 2C6BA 3LPEB 2NYDA 1B2JA 2XJTA 2V0FA 2XJPA 1IW7D 3IU3I 4POFA 5DM61 3LWPB 3HOZL 3CQZL 1BQ9A 1TWHL 4A3JL 1T9OA 3RZDL 1PFVA 3S2DL 2NVYL 4Y52L 1IU5A 4QIWP 1F4LA 4AHYA 5M3ML 4ME3A 5AI3A 3PKJA 3S2HL 5IYDL 3HOXL 2JI3A 2NVQL 4AHXA 4WFN1 2B5ID 1VZGA 2XJQA 1R0FA 4A93L 3M3YL 2Z3RB 3LWOB 1I50L 3P2AA 1R0JA 1IRNA 3HAXC 1RYTA 4X6AL 2YU9L 2KN9A 4V196 4YWLA 3PO2L 4JADA 3HOVL 1S24A 1S2ZA 3B08B 5MFZA 1VCXA 2NVXL 1YV1A 3QVDA 1K83L 2JA6L 3GTJL 2BE5D 1T9QA 5GAGc 2A69D 2E2IL 1TWCL 2K2DA 2PVXA 4AI3A 1ODHA 4YWMA 3H9BA 3HJYB 3S17L 1Y1WL 3H97A 4A3KL 3KYYA 5DM71 2JI1A 3J7Y1 6RXNA 2PSMC 3S1RL 4AYBP 4BY1L 1BFYA 3GTKL 1LKPA 2J9UB 4Y7NL 2EY4E 3WWNB 2JA5L 4BBRL 1YUZA 1PFWA 2XJRA 2ERJA 1FHHA 1RWDA 4UY81 2M6PA 1VZIA 4A3GL 3HOUL 1I3QL 4RXNA 1R0HA 1WCML 2LCQA 2AYJA 2V3BB 3S16L 4BY7L 3LWQB 3HJWB 5JVH1 5MLC3 5EINC 5C4JL 3A44A 2DSXA 2CKCA 3RZTA 2KKDA 1RDVA 5IYBL 4ZN1B 2R7ZL
chains in the Genus database with same CATH topology
2APOB 3HJYB 3LWVB 3HAXC 2AQCA 3LWOB 3LWQB 3LWRB 2HVYC 2AUSB 2RFKB 3LWPB 3HJWB 2EY4E 3MQKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2APO B;  3HJY B;  3LWV B;  3HAX C;  2AQC A;  3LWO B;  3LWQ B;  3LWR B;  2HVY C;  2AUS B;  2RFK B;  3LWP B;  3HJW B;  2EY4 E;  3MQK B; 
#chains in the Genus database with same CATH topology
 1R9T L;  3S1M L;  4A3M L;  3I4M L;  4E6Y A;  3PKI A;  1C09 A;  3LNL A;  1H7V A;  1Y1V L;  4POG A;  4TVM A;  4C3I L;  1PFU A;  1Z92 B;  2XJS A;  4A3F L;  4AI2 A;  1SMW A;  1TWG L;  2CKA A;  2MS3 A;  1SMU A;  5GAE c;  3P8B A;  8RXN A;  2M4Y A;  4C2M 1;  5GAD c;  3H0G L;  4ZN3 B;  3J7Z 1;  1ZRP A;  2Z3Q B;  3RZO L;  5H1S c;  2QL0 A;  3ZG6 A;  2CR8 A;  3GTQ L;  1NXG A;  1OWC A;  3HOW L;  1E8J A;  1P7P A;  1SFO L;  2E2J L;  2C6A A;  3KYX A;  1B13 A;  2PYA A;  5M5X L;  3S1N L;  3K35 A;  4C3H L;  1YK5 A;  3JR7 A;  4JAF A;  3WWL A;  5IP9 L;  5AI2 A;  2A6H D;  4U67 1;  4JAE A;  1CAA A;  3K7A L;  4A3L L;  2PPT A;  3KYV A;  4A3I L;  4A3C L;  5AN9 H;  5M3F L;  3H3V M;  3HOY L;  2M4V A;  3GTO L;  4AR5 A;  1RYQ A;  4AR4 A;  4K9F A;  3GTG L;  4AHZ A;  3GTL L;  3S15 L;  1BE7 A;  1QCV A;  3MPS A;  1VZH A;  1DVB A;  1RB9 A;  1LKO A;  2A6E D;  3S1Q L;  1LKM A;  5MGN A;  7RXN A;  3PIO 1;  3PL5 A;  5FJ8 L;  2RDV A;  1BRF A;  4A3D L;  2ZIX A;  2O5J D;  2R92 L;  4C3J L;  2VUM L;  5RXN A;  5JVG 1;  2VL6 A;  1IRO A;  4XXB B;  2AQC A;  3MSU A;  3PIP 1;  3RYG A;  2HR5 A;  5M5Y L;  1B71 A;  4AI1 A;  1FHM A;  2B63 L;  2L0Z A;  2JA8 L;  1PZX A;  4JAG A;  3H99 A;  2A68 D;  4B8C D;  2AUS B;  1DX8 A;  3FDJ A;  3RZ6 A;  1PFY A;  3H9C A;  1YUX A;  1NXE A;  4XGH A;  5C3E L;  1T9P A;  1LTL A;  4AR3 A;  4AI0 A;  5FLM L;  5M5W L;  1S30 A;  2WAQ P;  2PMZ P;  4G6B A;  3GTP L;  3M4O L;  5C4X L;  3KYW A;  3PWF A;  1SMM A;  5IP7 L;  3B0A B;  3PZA A;  3LWV B;  5MF6 A;  3QQC E;  2JA7 L;  5MFP A;  1B2O A;  2NVT L;  3KYU A;  3MQK B;  2XJU A;  2GMG A;  1IU6 A;  4LHN A;  4BXX L;  2Y0S P;  1TWA L;  3NFP I;  2ERS A;  2PVE A;  1QYB A;  4GS7 D;  1OWB A;  5K2M E;  1NNQ A;  2R93 L;  2APO B;  3S14 L;  1RDG A;  3FKI L;  4BBS L;  2H12 A;  3GTM L;  3I4N L;  4A3B L;  2E2H L;  5IYC L;  4AR6 A;  1BQ8 A;  5C44 L;  1WJV A;  1I6H L;  4AHW A;  2JI2 A;  2XJV A;  3HKZ P;  2WB1 P;  2HVY C;  3SS2 A;  1R0G A;  5GAH c;  1R0I A;  3VPB E;  1JYB A;  1QQT A;  2V0E A;  4A3E L;  2RFK B;  1CAD A;  4LHL A;  4TPU A;  3LWR B;  3PO3 L;  5EIO C;  5IY0 A;  2M6O A;  1YK4 A;  1TWF L;  2C6B A;  3LPE B;  2NYD A;  1B2J A;  2XJT A;  2V0F A;  2XJP A;  1IW7 D;  3IU3 I;  4POF A;  5DM6 1;  3LWP B;  3HOZ L;  3CQZ L;  1BQ9 A;  1TWH L;  4A3J L;  1T9O A;  3RZD L;  1PFV A;  3S2D L;  2NVY L;  4Y52 L;  1IU5 A;  4QIW P;  1F4L A;  4AHY A;  5M3M L;  4ME3 A;  5AI3 A;  3PKJ A;  3S2H L;  5IYD L;  3HOX L;  2JI3 A;  2NVQ L;  4AHX A;  4WFN 1;  2B5I D;  1VZG A;  2XJQ A;  1R0F A;  4A93 L;  3M3Y L;  2Z3R B;  3LWO B;  1I50 L;  3P2A A;  1R0J A;  1IRN A;  3HAX C;  1RYT A;  4X6A L;  2YU9 L;  2KN9 A;  4V19 6;  4YWL A;  3PO2 L;  4JAD A;  3HOV L;  1S24 A;  1S2Z A;  3B08 B;  5MFZ A;  1VCX A;  2NVX L;  1YV1 A;  3QVD A;  1K83 L;  2JA6 L;  3GTJ L;  2BE5 D;  1T9Q A;  5GAG c;  2A69 D;  2E2I L;  1TWC L;  2K2D A;  2PVX A;  4AI3 A;  1ODH A;  4YWM A;  3H9B A;  3HJY B;  3S17 L;  1Y1W L;  3H97 A;  4A3K L;  3KYY A;  5DM7 1;  2JI1 A;  3J7Y 1;  6RXN A;  2PSM C;  3S1R L;  4AYB P;  4BY1 L;  1BFY A;  3GTK L;  1LKP A;  2J9U B;  4Y7N L;  2EY4 E;  3WWN B;  2JA5 L;  4BBR L;  1YUZ A;  1PFW A;  2XJR A;  2ERJ A;  1FHH A;  1RWD A;  4UY8 1;  2M6P A;  1VZI A;  4A3G L;  3HOU L;  1I3Q L;  4RXN A;  1R0H A;  1WCM L;  2LCQ A;  2AYJ A;  2V3B B;  3S16 L;  4BY7 L;  3LWQ B;  3HJW B;  5JVH 1;  5MLC 3;  5EIN C;  5C4J L;  3A44 A;  2DSX A;  2CKC A;  3RZT A;  2KKD A;  1RDV A;  5IYB L;  4ZN1 B;  2R7Z L; 
#chains in the Genus database with same CATH homology
 2APO B;  3HJY B;  3LWV B;  3HAX C;  2AQC A;  3LWO B;  3LWQ B;  3LWR B;  2HVY C;  2AUS B;  2RFK B;  3LWP B;  3HJW B;  2EY4 E;  3MQK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...