4POGA

Mcm-ssdna co-crystal structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
255
structure length
255
Chain Sequence
b'SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
molecule tags Replication, dna binding protein/dna
source organism Pyrococcus furiosus
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
total genus 57
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pogA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pogA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pogA01
1SROA 2QA4A 2OCEA 1QZHA 4RMFA 1LKMA 4R4OA 4LF9Q 1PH4A 1Q8KA 3CD6A 1RWDA 4YWMA 4QGUA 3J81j 3J7ZC 1Q86C 4P72A 2EQSA 5DLQE 4B3MQ 1XNQQ 2Q2HA 4IPHA 2HT1A 3GTLH 1L0WA 4A3LG 1NMFA 3GD7A 4IFDI 4O2DA 3RLFA 5AI3A 2N49A 4GNXA 2HR5A 8RXNA 2E2IH 2JA5H 1HNZL 2A8VA 1PA6A 4GNXC 5C0XI 3KF8B 2R7DA 1FVIA 1XTDA 3GTMH 2OQ0A 3S17H 4AIMA 4IJLA 1J5EQ 3S1MH 3GO5A 1PVOA 4P75A 3CP0A 4A3JG 1Y1WH 3HOYH 4X62L 3PF5A 2QGQA 4X65L 3FKIH 3M4QA 2IX1A 1JJGA 1M1KC 3PO2H 1KRSA 1N8RC 1VQBA 3CCEA 7RXNA 4JC0A 5LMNQ 4O0AA 5IP9H 4DR3L 3U4ZA 4JBWA 1NMGA 5IWAQ 3M3YH 3L7ZC 2JA8G 4C3IH 1XMQL 1K73C 2R7ZG 4AR3A 2Z0SA 1RYTA 3PWFA 3RYGA 1D8LA 3OTOL 2OQKA 4A3MH 3H3VH 2NZOA 3UDGA 1FJGL 2V1CC 3S16H 2I5MX 3IRBA 4A3BH 3CF5A 1WCMG 4JI8L 3W5OA 2UUBQ 4BY1G 1IXRA 1Q12A 2KCMA 3J7A5 5E7NA 4GKJQ 1S24A 5AJ3Q 4BBSG 3PCOB 4PZ7A 3J81c 5EAYA 4DV6L 4DR2L 2OTLA 1BE7A 2JE6I 3PUWA 4GOPA 2K52A 3SS2A 2YU9H 1I94L 1PFSA 4NXML 1K83H 2ZJQA 2PI2E 2B63H 2YYZA 1TWFH 4K0KL 2I0QA 1SE8A 2UUAQ 3TEHB 1CAAA 1YNXA 3K7AH 2ID0A 5M5WH 1JMCA 3KLWA 3T1YL 1X6OA 5M5YH 2VQFL 1C09A 3A44A 1VQMA 2VQEL 2N78A 3PF4A 2F3IA 5IT9c 2YTYA 1IL2A 2F52A 2KHIA 3M4OH 1KL9A 1Y1VG 4JI3L 1VQHA 4PZ8A 2RDVA 4C3HH 3HOXH 4C2MH 1KIXA 2R92G 3S14H 3PUYA 4XIGS 4C3JH 1E3PA 2V3BB 4OX9L 3KFUA 1DVBA 2UXCL 4KLKA 1FHHA 1EIYB 1VQAA 4LFAQ 4OWXB 5LMUL 4JYAL 2R93H 4JI6L 1WFQA 4X66Q 4UY8C 4TQUS 1VS0A 1N34L 4IJHA 2ATWA 2MFIA 1CSPA 4FDBA 2N8NA 4DR4L 1NY4A 4JI0Q 1VQ7A 1CKNB 4A3DG 4HJ8A 1I6HH 1RDGA 3CPWA 5BR8Q 1VQPA 3KYUA 1E8JA 4P74A 2H5XA 2C35B 1C7YA 1UE7A 4L5RC 1VQFA 1ZRPA 3HOVG 4LUZA 3H3VI 1BRFA 2BH2A 3BU2A 2VW9A 3I7FA 3K80C 3RNUA 3I4OA 4DV2Q 1SMWA 3PGZA 4DR1L 1H7VA 3TREA 3KOJA 2KENA 3M9BA 1K8AC 1XMOQ 4OWWB 3W1GA 4RXNA 3CCVA 5AI2A 1OXUA 4HIDA 5JJKA 3L0OA 4GLVB 2NN6G 5AJ3L 2ZTDA 3UE1A 5FJ8G 3I55A 3KJPA 1NJIC 4X66L 2JA6H 2PVEA 2LXKA 4GN3B 2E2HH 3I4NG 5LMUQ 3J81i 1VQDA 1FJGQ 1VQLA 1H95A 1VCIA 3AYHB 4UPAA 1JJ2A 2BA0A 1G51A 3J80i 1PYBA 5IYCH 5HY6A 4AQYL 4NXNQ 1SMUA 3VDYA 4TPUA 3SGIA 1MIUA 1VQIA 2MO0A 1WOCA 3EN2A 4JI2L 4IFDG 3TS2A 4A76A 4QY7A 1PH3A 3U58A 4DR7L 3E9HA 2IY5B 3HOWG 2JQOA 3PUXA 5ELNA 3A5UA 1KC8C 4DR7Q 1R9TH 1W2BA 1A63A 4HIOA 4JI6Q 1E7ZA 2KHJA 5M3FG 2HHHL 4A3DH 4GOPB 3KF6A 4GKKL 4A3JH 2MO1A 1T9PA 2ZTEA 1Y1WG 3KYXA 4LWCA 2LXJA 3S2DH 4JBJA 5M3FH 2UXCQ 3RR5A 5M3MH 4L5SA 1Q1EA 1TWAH 3RN2A 1PH8A 4WJ4A 2BA1A 3I2ZA 1BBWA 1OXTA 1T9QA 2ZJRA 3QVDA 2JA5G 1YZ6A 1L1OB 3CCSA 4OO1I 2IX0A 3E0EA 3GTOH 3G48A 4BXXG 2PI2A 4AH6A 1N36Q 1JT8A 1X3FA 3DM3A 4IPCA 1G291 3CCJA 3PV0A 5H1SE 2AMCB 3OTOQ 1U5KA 1VQOA 2E5LL 1K3RA 4LW1A 4LFCL 4NXNL 1T9OA 4DV2L 4DR1Q 4A93H 3GTJH 1QVCA 3OYYA 4ALPA 4LF5L 5J3BA 5LMNL 3STBC 3CQZH 4UP8A 4B3SQ 1E24A 1RIPA 4DV5Q 3CC7A 4YWLA 4K0KQ 4JI5Q 3G71A 5IYDH 1LTLA 3HFZB 4GLAC 3CAMA 1B2OA 1CUKA 4JI1L 4DK3C 4JI0L 1NBWA 1V43A 4DUZQ 2K50A 1N33Q 2PVXA 3PUVA 1AH9A 2K4KA 4LF7Q 1UE1A 4A3CH 2A19A 2NVYH 4LF7L 2RF4A 3RZOH 5FLMG 1GM5A 1VCXA 4HIKA 3CW2C 3E9IA 1YJ9A 5IYCG 4IOAA 1A62A 3EBEA 4OX9Q 3JC63 5C4JH 4B3TL 3UE0A 1LM0A 2K5NA 4POGA 4JG2A 3KDFA 4BXXH 4AR4A 1CSQA 1WCMH 2K75A 2R7FA 1B13A 4GN4B 4YCWA 4X64Q 4A3BG 2OTJA 4YY3L 4A3IG 1HR0L 1R0JA 1E22A 2WB1E 2GVBA 4DNIA 1IBML 1CKMA 1W3SA 4JI4L 4LFBL 2UU9Q 1VQNA 1WI5A 1KD1C 3UDFA 1V1QA 4AYBG 1CKNA 4A3IH 4A3FH 2JA8H 3TRZA 5JJLA 1KQSA 1O7IA 2VQEQ 5GAEC 4DR6L 2R93G 4ME3A 3I4MH 5LMNW 3F2CA 1NE3A 3PO2G 1KHIA 2F4VQ 1EOVA 1DGSA 1N36L 1HNXL 2NN6I 3ULLA 4HJ9A 4LF5Q 2R92H 1EQRA 1LKOA 1OXSC 4YCVA 4X64L 3BZKA 1UE6A 2JA7H 1YUXA 3KDFB 3CCMA 1XPRA 2GMGA 1GO3E 2BH8A 1IROA 3T1HQ 2CWAA 4YWKA 4GKKQ 1CADA 3NENA 4BY7H 3GTGH 2FXQA 4HIMA 5JEAJ 1R0GA 4A3LH 4GKJL 5ELOA 4BBRG 4LNQA 1BKBA 3ICEA 2LSSA 2GN5A 4DUZL 2KBNA 1PH5A 1PH7A 1K0RA 2E8GA 4JI1Q 4RG1A 1KRTA 1QZGA 5GADC 3DLLA 2HQLA 1XMQQ 2UU9L 5FJ8H 2JA6G 4JI5L 2UXDL 3H0GH 4JI2Q 1YHAA 1SN8A 1VQGA 3UDIA 2R6GA 3PIOA 4DR3Q 3JC66 4A75A 3RZ6A 1I3QH 1YV1A 5IE8A 1YITA 4JV5L 3PSIA 3PZAA 2LCQA 3F8TA 3FHWA 2ZTCA 3ER0A 1R0HA 1T9HA 1L1OA 3S1NH 3JAMi 1E1OA 2VNUD 3RZTA 1SRUA 5K36G 4POFA 4A3MG 1OXVA 1S2ZA 1Y1VH 3F1ZA 3LGJA 2JA7G 2MS3A 4GNXB 3Q8DA 2K5HA 2Q2UA 1EUJA 2D0PA 4R4QA 1N33L 3PO3H 1S72A 1SFOH 1VQEA 3HKZE 1EYGA 1YK5A 1V9PA 2WP8J 1YUZA 3PO3G 3M85A 1FHMA 1RL2A 5C0XG 1M90C 4JBKA 4BY1H 1N32L 1I5FA 1XJVA 3K8AA 1C9OA 2Z6KA 2UUCQ 1SMMA 4JOIC 1U0LA 3CMEA 5C44G 2D0OA 1B2JA 3CPFA 3GTKH 3I4MG 1Q81C 3J80c 2AKWB 3KYYA 1YEZA 2L15A 2IHFA 1VQ6A 2ZJPA 2NVQH 2K5VA 4UP7A 4PMWA 1AE2A 4LF8L 4IOCA 4HJ5A 2VS1A 2DSXA 2YTVA 2HIVA 3NELA 4JI4Q 4LFBQ 5C0XJ 1X9NA 2KKDA 3HOZG 2Q2IA 2PMZE 4JYAQ 5JJIA 3PIPA 4LUVA 5FLXc 2A1AA 4DV4Q 2GVAA 5C3EG 1IBKL 4B3RL 4L5TA 4B3TQ 1DX8A 5M5XH 1HR0W 4A3KG 4BBRH 1PH1A 4P73A 4H02A 2JEBI 4UP9A 1YIJA 3HOUG 3K7UC 3I56A 1UE5A 4GOPC 1X54A 1VQ4A 3KF6B 4P71A 2AWOA 3HOXG 4AR5A 2WAQE 2B29A 4DUYQ 4DK6C 1QUQB 3KJOA 1IZ6A 4R1JA 3JAMc 3EIVA 1B71A 4DV5L 1YJWA 2UUAL 1HH2P 3CC2A 2JK8A 1YK4A 4LUOA 4EX5A 4IO9A 1EFWA 1MJEA 3AEVA 5RXNA 5GAHC 4MNOA 3OW2A 5IP9G 3ULPA 4DV6Q 5GROA 1BVSA 2XTIA 4AYBE 1A0IA 1CKOA 4BA1I 4DV1Q 4A3GG 3FKIG 2N3SA 1IBLL 2I5LX 1SR3A 3GDEA 3A5ZB 1PYSB 3HOYG 3L2PA 3AQQA 2YTXA 4XTCS 4LF4Q 1JE5A 2RHSB 1Z9FA 2WAQG 3CCUA 1K8GA 1VQ5A 4AR6A 5IY0A 3A0JA 3KYHC 1A8VA 1XNRQ 3HOWH 2NVTH 3PUZA 1BQ9A 3HOUH 3F2BA 4PG3A 2HHHQ 1FGUA 1HNWL 5GQOA 4A3EH 2DGYA 4DV0Q 4OO1G 1UWVA 4X6AH 4JBMA 4DV7Q 1E1TA 1N9WA 1BBUA 2I5HA 1YHBA 1IRNA 3MXNB 4DV7L 1R0IA 4OONA 1N34Q 1QUQA 2CCZA 5IP7G 4DV0L 3GTPH 1Z47A 3WWVA 3S1QH 3F2DA 1N32Q 2EXDA 3I4NH 2UXBL 4Y7NH 1XPOA 4LFAL 2K14A 4A4IA 3CXCA 4B3ML 3M7NA 4A3FG 1XNQL 4R4IA 4BY7G 3D0FA 4MZ9A 4YCUA 1LYLA 4DUYL 1R0FA 1S3OA 1SMXA 2IHEA 3FP9A 4AQYQ 3S1RH 3RLNA 4DAYB 1WYDA 4QQBX 1X3EA 4R4TA 1QVGA 4LF4L 2QL0A 1I50H 4IPDA 4JI3Q 2YV5A 1VQCA 3S24A 3ZJYC 2JEAI 4QL5A 2UUBL 2VY3A 1RB9A 1D7QA 2DUDA 1IBLQ 2D62A 5IYDG 2OWOA 2XGTA 3BZCA 4DV1L 1EQQA 1P8LA 5IP7H 3H0GG 2VQFQ 1PH2A 1XMOL 2ES2A 3T1YQ 2ZM6L 1Q1BA 3JC62 4JOIA 1WJJA 4QJFA 2KCTA 3HKSA 5GAGC 1YI2A 1IBKQ 3S15H 1G6PA 1KAWA 2MQHA 2IT1A 1L2FA 4DAMA 1XNRL 3KYVA 1B70B 3A74A 1Q82C 1PH6A 4JI7L 4IFDJ 2UXBQ 2CFMA 2UXDQ 1JYBA 3KYWA 1BFYA 4GS3A 1X56A 4X65Q 1YBYA 5BR8L 4LF8Q 3CCRA 2KN9A 3CCQA 4KI0A 4TVAB 1Q7YC 2VUMH 1NNQA 1HZAA 3NBHB 2CKZB 4DR4Q 4J15A 2K2DA 1X65A 1FL0A 3BJUA 1HNZQ 3HKZG 4EQ5A 1HNWQ 1QCVA 3UDXA 1LKPA 4A3CG 2PNHA 1VQ9A 3GTQH 3M4PA 3T1HL 4Y52H 1AE3A 1J6QA 2B3GA 2RCNA 3RLOA 4A3GH 2EIFA 1YHQA 4LF9L 4B3RQ 4NB3A 2M4YA 4OWTB 2WFWA 1S30A 4DV4L 1HZBA 1VQJA 1YVCA 3AFPA 4PZ6A 4HJ7A 5C4XH 1JB7A 4YHHQ 2CWPA 4DR5L 1HNXQ 1X55A 4DKAC 1S40A 2F4VL 4APVA 1EWIA 2MNAA 1QVFA 3NEMA 5C3EH 1YJNA 4LF6L 1RDVA 1Y14B 1VQ8A 4DR6Q 4MTNA 1BQ8A 2NVXH 2PQAB 4LF6Q 2PYAA 1I94Q 3RZDH 2JJQA 1X3GA 3AFQA 1MKHA 4KHZA 1B8AA 1GKHA 1EIFA 5IYBH 2UUCL 4JV5Q 1OXXK 4YY3Q 4GN5A 3W1BA 5FLMH 1PV4A 2VZAA 1B7YB 1SLJA 4NXMQ 3D31A 4A3KH 1ASYA 3G4SA 4BA2I 3CMAA 1HZ9A 1UEBA 3S2HH 1PHJA 5M3MG 1TWCH 3U50C 4DR2Q 4KHPQ 3K0XA 4DV3Q 1TWHH 2B63G 2AWNA 3TS0A 4L5QA 2AHOB 2Z6KC 1HJPA 4JI8Q 1Q46A 2JA9A 1GD7A 4KHPL 6RXNA 1LUZA 1TWGH 3H15A 2QEXA 3TQYA 1PH9A 3HOVH 1IYJB 2CQOA 2RHQB 5IYBG 3MEFA 1OTCA 2Q2TA 4BBSH 3MPSA 4JCVE 1C0AA 4WJ3M 2HIXA 1K9MC 2E2JH 2Y0SG 5IWAL 2VL6A 1XPUA 4R4CA 4JI7Q 4K9FA 4A3EG 4GLXA 5C44H 1TXYA 3CC4A 3U4VA 4B3SL 1KXLA 3RN5A 1P16A 4NPSA 3G6EA 4DPGA 2VUMG 4LFCQ 1HZCA 2NZHA 1MJCA 2WB1G 4IPGA 2ZM6Q 3K81C 4X62Q 1VQKA 2R7ZH 5C4XG 2E5LQ 2ASBA 2PQAA 4OXPA 1ASZA 1IU6A 1J5EL 1L1OC 1QYBA 3ERSX 3STBD 1IU5A 2ALYB 3HOZH 5HGQA 4HJAA 1JJCB 3CCLA 1IBMQ 3ULJA 4QIWE 5JEAG 4YHHL 4DR5Q 3B6YA 1HR0Q 4A93G 1NTGA 2Y0SE 4DV3L 1GVPA
chains in the Genus database with same CATH superfamily
2QA4A 1QZHA 4RMFA 1LKMA 4C3JL 4AYBP 1Q8KA 4YWMA 2EYLA 3J81j 4QCLA 1HA5A 4B3MQ 5DLQE 4K5WA 2JSOA 1L0WA 3GD7A 5AI3A 1JR0D 2N49A 3CRLC 4GNXA 3E5SA 2JA5L 2E2IH 3KBXA 1FVIA 3NBHA 2OQ0A 1J5EQ 1GUWA 5KRUA 1Y1WH 4CBVA 3HOYH 2WAQP 4HCSA 2IX1A 2L4NA 2FFKB 1I3QB 3LPEB 2KVMA 1K73C 2R7ZG 1SE4A 2M6PA 4ZRZA 3GTQB 3S16H 3GTOL 4A3BH 1ICWA 3PMFA 1WCMG 5C5MA 5I9OA 3CF5A 1GHKA 1TWHL 2E2HL 4BY1G 2UUBQ 2KCMA 5IIFA 1S24A 2PMZP 1EZ8A 4BBSG 1SEBD 4DR2L 5EAYA 4DV6L 3LWOB 1EY6A 4GOPA 2QDLA 3PUWA 5NUCA 1WTVA 1V1PB 2YU9H 5E3FA 4NXML 4EVOA 2ZJQA 2B63H 3K5NA 3MSUA 3EFXD 2UUAQ 4Q0FA 5ELFA 1CAAA 5M5WH 2SNMA 4KD4A 1JMCA 2L55A 5TSSA 3KLWA 5C3WA 2N78A 4A3CL 4XGHA 5IT9c 4A3BB 4OIKA 2KHIA 2XJVA 1XTCD 3IFTA 1Y1VG 4E6YA 5IP9L 3HOXH 4C2MH 3S14H 3ND9A 3PUYA 4C3JH 1E3PA 2UXCL 4KLKA 1NUCA 4LFAQ 4RHRA 3PL5A 4UY8C 1TS5A 4TQUS 1XWEA 2R7ZB 3E3XA 2HQEA 1CSPA 2DNCA 1KABA 4A3DG 3CPWA 1VQPA 2M2LA 4BBSL 1C7YA 1VQFA 3URYA 2JA7L 3BS1A 3H3VI 2BH2A 4LF5Q 2VW9A 3I4OA 5CV5A 4DV2Q 3TDQA 5IGDA 1HRJA 3S14B 2JP1A 3M9BA 3CCVA 4IQZA 3KK7A 4GLVB 3I55A 3KJPA 3TP7A 4X66L 2LXKA 2ERSA 5LMUQ 5C3EB 1VCIA 3D3RA 2BA0A 3GTGB 1PYBA 3SXHA 3EA6A 4AQYL 4RA8A 3SGIA 2IJ0A 3HEJA 3EN2A 1B1ZA 2B5ID 1NNXA 1S5ED 4G57A 2IY5B 1UAPA 2NB0A 5IT9E 1KC8C 4MHEA 1ZKOA 1JORA 4HIOA 3SR1A 4JI6Q 1A6XA 5EPJA 1EY5A 1K3BC 4A3DL 3HP3A 4FXKC 5D65A 5FO7B 2MO1A 2LY7A 3KYXA 2E75C 2LXJA 1D7QA 3RR5A 4L5SA 2M00A 3HOXL 4UY81 3RN2A 1PH8A 1TWAL 5LHY1 2BA1A 5CGKA 1T9QA 3WDNA 5JPMC 3PQIA 3HOVB 4DA2A 1VZGA 1STGA 3E0EA 3G48A 4N9TA 5EBDA 1JT8A 2JI3A 1X3FA 1Z7TA 4R8IA 3GV6A 1PTOB 4LW1A 1WTXA 1AZPA 1EWHA 1QCBD 1SNMA 4DR1Q 3H91A 3GTJH 4ZUIA 5LMNL 3CQZL 4BY1B 4QIWP 1E24A 3S1RB 4DV5Q 1KDAA 4HEDA 3CC7A 4U673 3PIO3 4GLAC 4V196 1CUKA 1E2WA 4CKCA 4BBRL 1V43A 4DUZQ 2SOBA 1AH9A 3IU3I 1UE1A 3RZOH 3WWNB 1MSHA 1VCXA 3JAME 1CQFA 4IOAA 1A62A 4OIJA 5C4JH 4JG2A 4BXXH 1HQRD 4A3GB 4C3JB 4EQPA 4AR4A 4YCWA 5D3DA 4GN4B 1HTLD 4Z9CB 4YY3L 1I4RA 1E22A 3A56A 2H4OA 4HTHA 3CRKC 4XQNA 1S5DD 4JI4L 4LFBL 1WI5A 3HOZB 4A3FL 3UDFA 3T13A 2JA8H 5KYIA 5GAEC 3S1MB 5LMNW 5CC4A 1NE3A 3PO2G 2EE1A 4JAGA 1PTOF 4CDEC 3J7AV 2NN6I 2XIWA 3MTSA 2B2UC 2JA7H 1YUXA 2BE5D 2PO4A 5JOBA 2BOSA 1K8MA 5IGCA 3VYTA 3T1HQ 4F8MA 4BY7H 4ZYSA 1R0GA 2AUJD 3K59A 3I90A 4BBRG 4G6BA 1BKBA 2GN5A 1SYFA 1NCVA 4CKEA 1ZYRD 2B2YA 3C2PA 3HG9A 4ZKBB 4X3TA 3PKJA 1LT4D 2HQLA 2UXDL 3NSWA 3L3OC 4JI5L 4JI2Q 1SN8A 2R6GA 1TWFB 4A75A 1U4PA 3RZ6A 4QIWB 1LV9A 4RCNA 3PZAA 3FHWA 2JA7B 1E2ZA 1T9HA 2VNUD 2A68C 4POFA 1LABA 1WVLA 1EY8A 5FLXL 4A3MG 1S2ZA 3LGJA 2MS3A 2PZTA 1QOHA 1EUJA 3H9CA 4HMJA 4QMGA 4S3SA 3PO3H 1S72A 1SFOH 2R93B 4DXGA 2WP8J 1BR9A 1PRTB 5M3MB 1EY0A 5C0XG 2MHVA 4BY1L 4JBKA 3VA7A 2LFNA 3K8AA 4J1MA 4JOIC 3DWAA 3GTKH 2IHFA 3QOLA 4PMWA 1AE2A 3FMCA 3SK5A 3GTPL 1ICFB 4JI4Q 4LFBQ 2K04A 5K5PA 3WOEA 3A54A 3LWPB 1QNKA 2CW0C 2LMCB 4CGYB 4KK7A 3FPPA 4LJZC 4B3TQ 4TKOB 2LS01 4DAYA 4H02A 2C5CA 3MXPA 2Y0SP 3I56A 5IP7L 3G6JB 2AQ3B 4P71A 1RTOA 4AR5A 4BY7B 4OEMB 1TY2A 4WFN3 3I73A 2UUAL 2B63B 1HH2P 1MI2A 1ET9A 3MC0B 5C0XH 4L63B 4MNOA 3VR2A 1ONLA 2VUML 4DV1Q 1TIID 2PW7A 2I5LX 1PFYA 1PYSB 3L2PA 2BE5C 2V0EA 3NBIA 2L0ZA 3O13A 1IL8A 5IOCA 1A8VA 1QB5D 1XNRQ 4DK1A 2NVTH 3HOUH 3Q22A 2E76C 1STAA 3D4RA 1TWGB 1HNWL 4A3EH 4BBSB 4OO1G 3T16A 4X6AH 1EL0A 1PYWD 2L12A 1YHBA 1IRNA 3MXNB 4OONA 1N34Q 3FDTA 2CCZA 5IP7G 3GTPH 1Z47A 2FMCA 1V8QA 1N32Q 4Y7NL 1F9SA 2UXBL 1PFBA 4B3ML 2RQXA 3HOXB 3CQZB 1H9SB 4BY7G 1LYLA 1R0FA 1SMXA 3FP9A 2L9HA 1K28A 3S1RH 2F1MA 4QQBX 4QUFA 1X3EA 4R4TA 2DJFC 2QL0A 5M5XL 1I50L 1PTOH 2QEJC 2YV5A 3S24A 1KNAA 5EIOC 4DN4M 3GTML 4IUQA 4CJ2C 1TS2A 1VF5C 2OWOA 2XGTA 4DV1L 3H0GG 2VQFQ 3H97A 1PH2A 3T1YQ 1WJJA 4QJFA 5GAGC 3HKSA 1I4PA 3J80L 2MQHA 1X3PA 1WCMB 4DAMA 1B70B 3A74A 2DY7A 5EQ0A 4JI7L 4IFDJ 2CFMA 4XYOA 1JYBA 3KYWA 4X65Q 1X56A 2EZVA 5COYA 3NHHA 3ONAB 4LF8Q 4LAAA 4KI0A 1A2TA 1HZAA 4DR4Q 1U9RA 1SNPA 3NTHA 1LKPA 4CJ0B 1TWGL 1EY9A 3M4PA 2WB1B 2B3GA 1PZID 2ENBA 1MGSA 2XJTA 1JB7A 4YHHQ 4DR5L 4J6HA 2F4VL 4APVA 2MNAA 4RGOS 2HCCA 1BQ8A 5C3XA 3RZDH 1X3GA 3RZDL 3AFQA 3F2UA 2HUGA 1GKHA 5IYBH 2UUCL 4JV5Q 1OXXK 1B50A 4TSSA 2G9HD 2KHSA 1B7YB 4G7OC 4A3KH 3G4SA 4A3KL 1UEAB 2B39A 3U50C 4DR2Q 4KHPQ 1D5MC 2RSOA 3VR5A 2B63G 1DYQA 2SNSA 6RXNA 2IW3A 3TQYA 1IYJB 2EVBA 5E4WC 5IYBG 4BBSH 2YU9L 4EQNA 3MPSA 4JCVE 5BN5A 1F9PA 4M1UB 1TWFL 2VL6A 1SDFA 2F0TA 4K9FA 4R4CA 3CC4A 1DCZA 3U4VA 3G6EA 4DPGA 5EJWA 4NXNQ 4IPGA 2ZM6Q 2PYKA 4X62Q 2L11A 3P20A 1BOSA 3NTIA 1S5CD 4HJAA 1FGBD 3CCLA 1DONA 3ULJA 1HTPA 1LT5D 2PSMC 5JVH3 5IGEA 1BCPD 1RWDA 4A3GL 3R93A 4QGUA 4P72A 3S1RL 4A3LG 1VMPA 5CORA 1H9KA 1NMFA 4X3UA 2JA5H 1I6HB 5C4ZA 1PA6A 5C0XI 2R7DA 1XTDA 3OSOA 4IJLA 3BYYB 3CP0A 4AI1A 1STEA 3PF5A 2QGQA 4X65L 3M4QA 4FF2A 1A3UA 1JJGA 3S16B 1QQTA 5IYBL 1N8RC 3CCEA 7RXNA 4JC0A 1GJXA 1BQQT 3U4ZA 5FLML 1NMGA 4V0BA 3H0GB 3OTOL 3H3VH 3PWFA 4FXGC 2NZOA 3UDGA 1FJGL 2V1CC 4A3DB 1R9TB 3KLRA 3L9AX 3W5OA 1Q12A 2ICIA 4GKJQ 5E7NA 1I4GA 1EU4A 1STBA 3OIPA 3PCOB 2JE6I 3EJIA 2MUYA 3HOVL 4JAFA 3LNLA 1II3A 2NZ1D 1K83H 3BVGA 4KY7A 4K0KL 1B3QA 2EYJA 1EYCA 1GOZA 1S5FD 2PZWA 1EIGA 4L8JA 4P2CB 1C09A 3A44A 1PMRA 5DEHA 1E0BA 2YTYA 2F0MA 2F52A 3M4OH 1KL9A 3DEPA 5JVH1 4RGMA 4JI3L 3MZ5A 4KKUA 2JI1A 4PZ8A 3Q23A 3S2HB 2RDVA 4C3HH 1ENAA 2A68D 2KEDA 1FHHA 4OWXB 2K5WA 1SFOB 2R93H 4CJ1B 4LMQD 1MD2D 2A5HA 1O78A 1I4XA 1N34L 4PV1C 2ATWA 4FDBA 3SDZA 4NW2A 4JI0Q 1VQ7A 1CKNB 4NP5A 4HJ8A 1I6HL 1RDGA 2K33A 4WJWA 5LL6S 5BR8Q 4P74A 1MSGA 2H5XA 3GQBA 4N8FA 4L5RC 1DD2A 1ZRPA 3HOVG 4LUZA 1BRFA 3BU2A 3TP8A 3K80C 1SMWA 4C1NI 3KOJA 4OWWB 4J8QA 1XMOQ 1JWMD 5AJ3L 2ZTDA 1RJTA 3UE1A 2JA6H 3K35A 1LTAD 5EINC 4GN3B 5M9OA 3SK4A 2I07B 1B9NA 1VQDA 1X32A 1FJGQ 1H95A 4XQJA 5C4XB 1JJ2A 1TY0A 4K2LA 3H99A 2F0KA 4KN7C 1RTNA 1MIUA 1A3VA 3C3LA 1SXTA 3LX0A 3HJWB 3QR8A 1PH3A 1BUVT 1QE6A 2HDMA 3E9HA 1YNJC 3PUXA 2L1BA 5ELNA 1W2BA 2EY5A 1TWHB 2FHTA 1A63A 2RDHA 2KHJA 3U9OA 4GS7D 4GKKL 3BZDB 4A3JH 1T9PA 4JK1C 1TS4A 4JBJA 4A3JB 4ZN3B 2NYZD 3J81L 3HS0C 2ZJRA 4JW0A 3QVDA 3CCSA 4OO1I 3GTOH 4C56C 2PI2A 2R93L 1N36Q 2NTSA 3R2TA 4IPCA 2EDGA 3CCJA 4FYDA 3PV0A 2F0GA 2G9DA 4IURA 3ZYYX 5ELDA 4A93H 4I7AA 2X6LA 3FRPB 1ILQA 3STBC 2PZUA 3CQZH 1FR3A 1HUNA 4A93B 1ML0D 4E6IA 4JI5Q 5IYDH 1RKNA 2VB2X 4RHSA 1LTLA 3DWPA 1DOLA 2CVRA 1Y8PB 2KCCA 5A2QL 3GTPB 4JI0L 1NBWA 1SMYD 3PUVA 2Q8RE 3GTOB 4LF7L 3J7YW 3K6OA 3AU7A 1GM5A 1YJ9A 4HIKA 3E9IA 3R2IA 4OX9Q 2EOTA 2H1EA 1HHVA 3UE0A 4POGA 2A6EC 5IODA 5D14A 4X64Q 2K75A 1WCML 1JQYD 2KUMA 4R8NA 1KNEA 1HUMA 4RH6A 1HR0L 2F0SA 1R0JA 2WB1E 1XXGA 1CKMA 5JJLA 4M8AA 2XVSA 4AYBG 1CKNA 1T5EA 4C2M1 1EFID 1O7IA 2VQEQ 2R93G 2JA5B 1O7LA 4FP5D 2F4VQ 1EOVA 4DXFA 1DGSA 3X3MA 1JICA 4HJ9A 2R92L 5FKAC 4YCVA 1Q90A 5IYDL 1HFNA 5I9PA 3S2HL 1SMYC 1KDBA 3OMGA 2EXZA 2CWAA 4YWKA 3N6RA 2EY2A 4GKKQ 1JCKB 2B2YC 1EOTA 2NVXB 5ELOA 2JA6B 3CU7A 4LNQA 2QCPX 5BN4A 3GTMB 1BCPC 2LSSA 3DHQA 1IKLA 4FXDA 1PH5A 1PH7A 4UAIA 1K0RA 4JI1Q 2HVYC 5GADC 3DLLA 3NQIA 2H12A 4I7ZC 1XMQQ 2UU9L 1LTGD 3WOFA 2JA6G 3W3AA 3JAML 1VQGA 1MHWC 1I3QL 2ZXRA 2WKCA 3NFPI 2B2UA 1YV1A 1YITA 2A69D 1PTOD 2LCQA 3GTJB 2C6BA 4C3HB 3DWQA 3ER0A 3NXWA 4CKBA 1R0HA 1BCPB 3U9SA 1L1OA 3S1NH 1E1OA 3RZTA 5A2QE 4F7XA 5K36G 1OXVA 1SE3A 1R9TL 2JA7G 4FNFA 5EKKA 5JEAH 1SFOL 2ICEC 1EYGA 1V9PA 1CA6A 1AFPA 2TMPA 3M85A 4KTAA 2XNAC 4BY1H 3CKIB 5C4JB 1XJVA 1N32L 1U4LA 2J9UB 5C44G 2D0OA 3GTKL 3CPFA 1VQ6A 2Z9HA 3BVZA 2R7ZH 2ZJPA 2NVQH 2DSXA 3NELA 1Q8IA 4X3KA 5C0XJ 3GTJL 2PMZE 3PIO1 5EGTA 3VYRA 1E2VA 2HDLA 4DV4Q 3W2DA 1U4RA 3FVQA 1SYGA 1IBKL 5CMDA 4B3RL 3NPPA 5IT9L 1G2SA 1JC7A 2PMZB 5I6YA 2G5DA 5M5XH 4FF3A 4A3EL 2JEBI 1CZGA 3I70A 1YIJA 5GAHc 3J80E 1SAPA 2B2TA 1UE5A 4K6LA 1X54A 1W6JA 5CV8A 4ID6A 3HOXG 2WAQE 4RKBA 1STNA 4DUYQ 1QUQB 3KJOA 2E74C 2I46A 3S9WA 4AI0A 3CC2A 4LUOA 4EX5A 1EFWA 2KOLA 5G3LD 3SE0A 5GAHC 2XWBB 4AHZA 5I2YA 3ULPA 1BVSA 4ME5A 1IBLL 2N3SA 3GDEA 2Z8LA 4N9PA 3MFGA 3VA5A 3Q0AA 3K58A 4CDCC 4LF4Q 3BDCA 4XT1B 4ZN1B 2E2JL 4C2MB 1PFWA 3MXUA 4Q5VA 4DV0Q 1P7PA 1H9SA 4DV7Q 5AN9H 5DAUA 1N9WA 1BBUA 2I5HA 2F0QA 1RCVD 4DV7L 1W6KA 5CR3A 1QUQA 2F0UA 4DV0L 2Z6BA 4RWSC 2JYOA 3WWVA 1K0SA 2EXDA 4IUTA 4LFAL 2K14A 4A3FG 1XNQL 4R4IA 1O7ZA 3K5MA 1CI3M 1FYCA 1TWCL 4DAYB 1WYDA 4IPDA 2CKCA 3ZJYC 2RSNA 5MLC3 2KA7A 2VY3A 2C9OA 1RB9A 1F2MA 3S1ML 3BZCA 4IZ8A 4K8JA 1XMOL 2ES2A 1Q1BA 1IBKQ 1G6PA 2K05A 1CZWA 1O7YA 2NVTL 4OL7A 2UXBQ 5GADc 3KF8A 5CV4A 1YBYA 3OWFA 3CCRA 1Z6HA 3TZDA 4KJNA 4TVAB 1Q7YC 2CKZB 2XN9C 4AHXA 1D1IA 1X65A 1FL0A 3BJUA 3AB9A 1HNZQ 2NVQB 3DM1A 4A3CG 1EU3A 1NSNS 3GTQH 2CKAA 4G4KA 3M3YB 3T1HL 1J6QA 4IN3A 2EIFA 3R8BA 1YHQA 2PPBC 4B3RQ 4OWTB 1SNQA 1PLFA 1HZBA 1VQJA 1YVCA 5C4XL 4HJ7A 1IYUA 2CWPA 1LTSD 3A7AB 1QVFA 4X3SA 2NBFA 1YJNA 5JPNC 1RDVA 1Y14B 1TKWB 1VQ8A 2CW0D 4LF6L 4IFDH 2NVXH 3LWVB 1XX8A 4JAEA 4HR7B 3Q24A 1MKHA 4KHZA 1FNWA 5MFZA 5FLMH 3I4NL 2D5DA 1B3AA 1Y8OB 5CV6A 3CMAA 1HZ9A 1PHJA 3PO3B 4DV3Q 2MP1A 2EJGC 2IL8A 4L5QA 2AHOB 2F3WA 2EYHA 1PZKD 2Y0SB 5DNFA 4JI8Q 2JA9A 4A3EB 1LUZA 2QEXA 4OHJA 3H15A 2CQOA 1OTCA 2FINB 2Q2TA 1C0AA 1K83L 2N88A 2RA4A 5FK9C 4DK0A 1K9MC 4JI7Q 2F3VA 3A7LA 2PQEA 4B3SL 5C44H 4ULLA 1KXLA 1HZCA 1S5BD 3R3OA 3K81C 5C4XG 4CHTB 2E5LQ 2PQAA 4OXPA 1Y69U 3NUCA 2JA6L 1L1OC 1SNCA 3ERSX 1MBYA 2ALYB 3HOZL 1JJCB 4LK1C 4IUVA 1IBMQ 4BWGB 5JEAG 3B6YA 1HR0Q 4A93G 2KQ3A 4V190 2Y0SE 3DMUA 4DV3L 1GVPA 1SROA 3S14L 3QG1A 4U671 3I3CA 4DNRB 4R4OA 5KYLA 1PH4A 2Z3QB 3CD6A 5CV7A 3NP8A 3J7ZC 1Q86C 2EQSA 2HT1A 4O2DA 5DM63 5EKIA 2HR5A 1QILA 4FVMA 1HNZL 4U68A 1LTID 3KF8B 3MXNA 3GTMH 3S17H 2VB3X 4G7HC 1PVOA 4P75A 4A3JG 4X62L 1O80A 1PZXA 3TP6A 1VQBA 5C44L 1QWYA 4O0AA 4JBWA 5IWAQ 2RCFA 4KD3A 2Z4IA 2AUSB 3DXJC 4RGNA 1VZHA 4XYQA 4AR3A 2Z0SA 4A3MH 2OQKA 1EIHA 3PO2B 2I5MX 3IRBA 1DOMA 3BDOA 1SNDA 4A3BL 2ZXPA 5C4HA 3J81c 2QW7A 1IW7D 4KV6A 3LWUA 1BE7A 1PDQA 3ERQA 4A93L 2K52A 1I94L 1PFSA 3KLSA 1BBXC 2D2CC 2PI2E 3TSSA 2WACA 2NVTB 2I0QA 3HJYB 1SE8A 2RVLA 4JADA 2B2WA 1YNXA 2ID0A 1B53A 1NR2A 1SJED 5M5YH 5M5YL 2EYOA 3S17L 2Q8IB 5KIXA 1RODA 3PF4A 5M5YB 2F3IA 2JN4A 1TWCB 1CM9A 3PO2L 4A3JL 1VQHA 1D5ZC 2TSSA 1J9OA 5DM61 1DVBA 3DUZA 4JYAL 1DZ1A 2CHBD 2E2IL 1VS0A 2MGSA 2MFIA 4DR4L 4DGZA 1I6HH 3KYUA 1EWCA 1B44D 2C35B 3KUPA 4DU9A 4EGVA 5C44B 1AZQA 1ESRA 4JPBW 3RNUA 1I94Q 4DR1L 3K7AL 3PGZA 3NWTA 1H7VA 2KENA 3EVQA 5FOBB 3W1GA 4DFAA 5AI2A 2DNEA 4HIDA 2NN6G 1NJIC 1EZ6A 2SEBD 1NXGA 3H6MA 3AMUA 2K28A 3J81i 4KKSA 4GZYC 1VQLA 3AYHB 2A6HC 1KTKA 5IYCH 3VDYA 1FD7D 3HOWB 2PPTA 3SVMA 2B63L 4JI2L 4IFDG 3TS2A 1JWUD 5I2XA 3U58A 2JXMB 3C1FA 4DR7L 3HOWG 2JQOA 3S17B 1B9MA 4DR7Q 1R9TH 2WIIB 1TR5A 1F2YA 1E7ZA 2HHHL 1HPCA 2IPKD 3TBIB 3FDJA 3S2DH 2ZTEA 4LWCA 1B2TA 1JE4A 5C4JL 5M3MH 1CT1D 4AYBB 4WJ4A 3RMHA 3V05A 1BBWA 4Y7NB 1K83B 4H44C 2JA5G 1YZ6A 1L1OB 3S16L 2IX0A 4BXXG 3K5OA 5H1SE 3OTOQ 2E5LL 1VQOA 5LL6X 2MPMA 3CHBD 4LFCL 1T9OA 4DV2L 1JOOA 3OYYA 4ALPA 4LF5L 4ZUJA 2WINB 5J3BA 4B3SQ 1CHPD 2Z1CA 1RIPA 3TP5A 5CBAE 4YWLA 2K6AA 4K0KQ 3G71A 3I4LA 4XQQA 3K5LA 5FLXE 2L0CA 4JI1L 2K50A 2PVXA 3HAXC 4XXEA 3NWSA 3RZOL 1G2TA 2A19A 3SK6A 2QKIC 3OHXC 4ZK9B 5FLMG 3CW2C 2RDGA 4AI3A 1YNND 3JC63 2NYDA 4LHNA 3A55A 4B3TL 3ITPA 5E1FA 1JOKA 2K5NA 1X3QA 4H0LC 2R7FA 2Z3RB 1B13A 4A3IG 4DNIA 1RD9D 2DY8A 2GVBA 2KCNA 2UU9Q 1VQNA 1B4OA 1KD1C 1V1QA 2NVQL 2K03A 1Y8NB 3J7Z1 3F2CA 1Y1VL 1HNXL 3ULLA 1A15A 5KNDA 1EQRA 2AQ1B 1LKOA 4F88A 4X64L 1UE6A 1LTRD 3CCMA 3I91A 1XPRA 2GMGA 1GO3E 2BH8A 3MHBA 4FF1A 4BY7L 1CADA 5F2DA 3GTGH 2FXQA 3MAQA 4A3LH 3ICEA 2EY4E 4NMZA 3PKIA 3LNNA 4RG1A 1KRTA 1LO5D 3H0GL 3GV3A 4FF4A 4K2KA 4QUCA 3PIOA 4HSPA 3JC66 4JV5L 2YU9B 1IKMA 4MTKA 5KGUA 3M4OB 1PRTC 3S1NL 4A3IL 5JVG1 2AUKA 4IUPA 2OF1A 1OWBA 1S4ZA 3H9BA 4GNXB 3Q8DA 2K5HA 2O2LD 1N33L 2Q8TA 3HKZE 3P8BA 1SJHD 2EYMA 5J39A 1IHZA 1RL2A 1M90C 3TZUA 2KJXA 2Z6KA 2UUCQ 1WTQA 1U0LA 5JAVA 3CMEA 5K36H 3I4MG 1Q81C 2JA8L 2AKWB 3J80c 2A6ED 4C3IG 1JB3A 1TQOA 4UP7A 4LF8L 4IOCA 4HJ5A 2VS1A 2YTVA 5G3LF 2ZXOA 5M5XB 2KKDA 2Q2IA 2V4DA 4JYAQ 5JJIA 1SYCA 4LUVA 1BXTA 2GVAA 4KJOA 3VYUA 1JWSD 1WTOA 4JVZA 4DNTB 1HR0W 4A3KG 4KMUC 1PH1A 3HOUG 1OO9B 2B2VA 3K7UC 1PXUA 1ENCA 4ZAIA 4GOPC 2E2HB 4KHVA 1VQ4A 3KF6B 4A3FB 2AWOA 2B29A 3VR4A 4DK6C 3HOUB 1SYBA 2XRSD 2X69A 1B71A 4DV5L 1F4LA 1YJWA 2JK8A 3NTKA 4IO9A 3AEVA 1PZJD 5RXNA 5ELEA 3HOYB 3S2DB 3B0AB 3TMEA 2QDBA 1PTOC 2A69C 4DV6Q 4BA1I 2XTIA 1A0IA 3I8ZA 4IUNA 3A5ZB 2NUCA 3H3VM 3HOYG 3AQQA 3FEWX 1VF7A 1L0XB 2XRQD 2YTXA 1GUNA 3CCUA 4TRDA 4AR6A 4C3IB 3A0JA 3KYHC 2PW5A 5KNCA 3PUZA 2F0NA 1YNJD 3F2BA 2BDNA 3G7LA 2A73B 2HHHQ 1FGUA 3K57A 4A3LL 5GQOA 1GUTA 1Q3LA 4ODGA 1EQTA 3VYSA 1E1TA 3J81E 1AN8A 1RYQA 1R0IA 3RUZA 2K32A 1G8ZD 1STHA 5FJ8L 3S1QH 2V0FA 3LWQB 4Y7NH 4H13C 1XPOA 3I4NH 3D0FA 4MZ9A 4YCUA 4AQYQ 1T5XD 3A8KE 1I50H 4JI3Q 1VQCA 2B8FA 1SSOA 5IYDG 1EQQA 2JA8B 4KKTA 3HOYL 5IP7H 4WORA 3QOJA 4KY6A 3JC62 4JOIA 1VDZA 3LWRB 1KAWA 2NN6H 2O5IC 3KYVA 5T1IA 1Q82C 1PH6A 3MVVA 3MXGA 4GS3A 1BFYA 2CH4A 2RFKB 3P1HA 4RFBA 4XT3B 2F03A 4A3ML 5KNBA 2KN9A 4B9WA 3CCQA 5EPKA 2VUMH 3JR7A 3NBHB 1LT3D 2AQCA 2GA4B 3MQKB 2O4XA 4O42A 4R9WA 3IFDA 1QCVA 3UDXA 2XJPA 2PNHA 2APOB 3I4MB 1FNUA 1AE3A 4ILWA 4Y52L 4Y52H 3RLOA 4LF9L 3PIP3 5J1ZA 2F0EA 2WFWA 4PQXA 1S30A 5KEEA 4PZ6A 1EYAA 4DAPA 1H9JA 4UHVA 4K8IA 5GAEc 1EWIA 2R61A 1STYA 2J0TD 1GXDC 4DR6Q 1F77A 2EPBA 4MTNA 1G91A 4LF6Q 2PYAA 5J22A 4ZLTF 2CH4W 4ZKCB 1EIFA 3S1NB 4PMBA 1QNUA 4GN5A 5T1GA 1PV4A 4NXMQ 4BA2I 3VR3A 5M3MG 3HZXA 1TWHH 2WB1P 3TS0A 2Z6KC 1HJPA 4KY5A 1GD7A 4KHPL 1YNNC 1TWGH 3I72A 1VZIA 3HOVH 4IUUA 4K14A 3MEFA 4XXBB 2HIXA 2E2JH 2Y0SG 5IWAL 3NQTA 3BYTB 1XPUA 4OO1H 4A3EG 2K5QA 2OEOA 4O1NA 4HSVA 1P16A 2B2TC 5HGTA 3RN5A 4NPSA 4IALA 2VUMG 2NZHA 1MJCA 2PNRC 1A3TA 3QQCE 1ASZA 1M8AA 1IU6A 2QF7A 1J5EL 2DN8A 1QYBA 1IU5A 5HGQA 3RZOB 2N55A 3D6CA 1OWCA 4QIWE 4YHHL 4DR5Q 1NTGA 4XDXA 1BF4A 2OCEA 3KBGA 5AFWA 1C8CA 1BO0A 5E4XA 4LF9Q 2ZT9C 4RKLA 1UNSA 4B08A 1C4QA 1XNQQ 3GTLH 2IWHA 3VR6A 2E2JB 2Q2HA 4IPHA 4IFDI 3RLFA 8RXNA 2A8VA 4DF7A 1CQVA 4GNXC 4LHLA 3QIAA 1TT2A 1HQMC 4AIMA 3S1MH 2A74C 1WTRA 3GO5A 3WWLA 1KLGD 3FKIH 3M4OL 5D3IB 1M1KC 3PO2H 1KRSA 2IX3A 5LMNQ 5IP9H 4DR3L 3OWEB 3I4ML 3M3YH 3L7ZC 3SHLA 2JA8G 4C3IH 1XMQL 4C3IL 1RYTA 3RYGA 1D8LA 1RHPA 4B8CD 1V1OA 2HD3A 4JI8L 1IXRA 3J7A5 5AJ3Q 4OELB 5C5LA 4PZ7A 2WV6D 2OTLA 2A6HD 4RCOA 3SS2A 2YYZA 1TWFH 3GTLL 3MWYW 5M5WL 3TEHB 3K7AH 4AHWA 3P2AA 3T1YL 2F0FA 1Y1VB 1X6OA 3TN2A 2VQFL 5C3EL 5I4DA 1PFMA 1VQMA 2VQEL 2NVXL 1PFNA 2ZIXA 1IL2A 2CR8A 3ZG6A 4TVMA 2ERJA 1PFUA 1G6ZA 1KIXA 2R92G 4XIGS 1PRTF 2V3BB 4OX9L 3KFUA 1PRTD 1GHJA 1EIYB 1VQAA 5LMUL 1GUOA 2F0OA 3MFYA 5CBEE 3H09A 4JI6L 1WFQA 5EKLA 4X66Q 4IJHA 1I50B 2N8NA 4NDXA 1QJOA 1NY4A 2KEEA 1R4PB 1CHQD 1NXEA 1Y1WL 1E8JA 2X6GA 5EPLA 1UE7A 3FKIL 3D8GA 4ZCKA 4OGQC 3S2DL 4K5XA 1Z92B 1UUPA 1RF2D 3I7FA 3S2HH 3M3YL 1XNRL 3TREA 3I4MH 1K8AC 4RXNA 1RDPD 1OXUA 5JJKA 3L0OA 2L5TA 5FJ8G 2K1BA 1LT6D 2PVEA 3M4YA 5HURA 2DJGC 2E2HH 3I4NG 2VUMB 1D6EC 2E2IB 5ISRA 1IW7C 2VXWA 4UPAA 5GAGc 1XYIA 1G51A 3J80i 3HKZP 2JI2A 5HY6A 5JJZA 2XJSA 4KN4C 1SMUA 4TPUA 1VQIA 2MO0A 4QB4A 1WOCA 2NTTA 4A76A 4QY7A 2R92B 4B9XA 1J8IA 1U4MA 1KLUD 4L6TB 3A5UA 1NR4A 3OIQA 1BDOA 2XJUA 5M3FG 4A3DH 4GOPB 3KF6A 1Y1WG 1ZXTA 2UXCQ 5M3FH 1KDCA 1Q1EA 1TWAH 3I2ZA 1OXTA 4N8X1 3OOCA 5FO9B 5M3FB 3PIP1 3IAYA 4AH6A 5L37A 3RZDB 2B2VC 3DM3A 2RDFA 3QJYA 1EEID 1G291 1ESFA 3C1EA 4I65A 2AMCB 5FO8B 1U5KA 1K3RA 4NXNL 4RGTA 2XJRA 1QVCA 4A3KB 5MFPA 1ZEQX 4UP8A 4EQOA 5IGFA 2R3ZA 3HFZB 3IKJA 1V1PA 3V96A 3RD4A 3CAMA 1B2OA 4DK3C 3A8IE 2KECA 2Z4HA 1N33Q 2WKDA 1D1KA 1GUGA 1D5XC 2K4KA 4LF7Q 2NVYL 4A3CH 2NVYH 2M9VA 2RF4A 4FO2A 4CDDC 3EROA 5IYCG 5BN3A 3EBEA 5M3FL 4C3HL 5M3ML 1C48A 2M4VA 1LM0A 3KDFA 1FNVA 1WCMH 1CSQA 3FKIB 4A3BG 1DXMA 2OTJA 4MIUA 3UI2A 1Y1WB 1A2UA 1IBML 1W3SA 3V2TA 4HAEA 5C6AA 4A3IH 4A3FH 3TRZA 1KQSA 4DR6L 4ME3A 4HCEA 3P7JA 1L0YB 4A3IB 1KHIA 2B8GA 1NAPA 1N36L 3E6ZX 2R92H 1OXSC 3PO3L 1R4QB 3BZKA 3KDFB 1I4QA 4AHYA 2OXPA 2HCIA 2K01A 1IROA 2F0PA 3NENA 2EJMA 4HIMA 3OPOA 3ND8A 5JEAJ 4GKJL 2F0HA 4X6AL 2CQAA 4DUZL 2KBNA 1ODHA 1ILPA 2E8GA 3LWEA 1QZGA 5M5WB 2EYPA 3S1QL 5FJ8H 5IYCL 2QILA 2AQ2B 1YHAA 3H0GH 3MEHA 3UDIA 1ZYRC 4DR3Q 1I3QH 3SEBA 5IE8A 3PSIA 3F8TA 3IL8A 4K6DA 2FMMA 2ZTCA 2F0WA 4C3JG 3JAMi 1SRUA 5CV9A 1BNZA 1Y1VH 3F1ZA 4QF4A 2Q2UA 1LTBD 2D0PA 4R4QA 1VQEA 1YK5A 1WTPA 3B08B 2J7ZA 1YUZA 3PO3G 4PMCA 1HCZA 1FHMA 1CFMA 1ET6A 1EY7A 1I5FA 1C9OA 1SMMA 3KLSX 1B2JA 2J4XA 1AW7A 1DM0B 4C1NK 2F4IA 3KYYA 1YEZA 2L15A 4ABNA 2R7ZL 3M7GA 2K5VA 2F0VA 4WRDA 3OMCA 1H9RA 2HIVA 4PNYA 1X9NA 3BG3A 3PIPA 5FLXc 2A1AA 5C3EG 3GTLB 4L5TA 3HOWL 1DX8A 3FPUB 4BBRH 1F2ZA 3GTGL 3K0YA 4P73A 3D6WA 4UP9A 1F9RA 1WJVA 1TU2B 2BCOA 1IYVA 3T51B 2MJ8A 3A8JE 3S15L 1TS3A 4BXXL 1IZ6A 4R1JA 3EIVA 2P5ZX 1I4HA 3JAMc 5JVG3 2EJFC 1YK4A 2C6AA 1SE2A 4DAVA 1MJEA 2F0DA 2O5JD 4RAUC 3OW2A 3T53B 4F87A 5IP9G 3QO2A 5K2ME 5GROA 4AYBE 4A3GG 1CKOA 2D9UA 1D2BA 3FKIG 1SR3A 5A35A 4H7BA 1KAAA 3T4AC 1EYDA 3GTQL 2FJ2A 4XTCS 4HN7A 3HOZG 1JE5A 2RHSB 1Z9FA 2WAQG 3NE5B 1LLRD 1K8GA 5IY0A 1VQ5A 3MA2B 1EQVA 3HOWH 1PFVA 1BQ9A 1SYDA 2AYJA 3BDLA 4PG3A 1DOKA 1I6VC 2DGYA 3HKZB 1UWVA 4JBMA 1K8OA 2RKSA 4NKLA 5MGNA 3K7AB 1LACA 2OT2A 3F2DA 3QB3A 1F2LA 4A4IA 3CXCA 3M7NA 2EYFA 2K7VA 5ELBA 3T56B 3X3NA 4DUYL 4G7ZC 4WFN1 1S3OA 2IHEA 4BS9A 1H9MA 3RLNA 1QVGA 4LF4L 3E0JA 2JEAI 2EY1A 4QL5A 2UUBL 3H3VC 1CTMA 2DUDA 1IBLQ 2D62A 1CA5A 1P8LA 5DM73 3DEOA 3J7AF 5H1Sc 3GTKB 1ENFA 2ZM6L 2RBMA 2KCTA 1YI2A 3S15H 3SK8A 1WD0A 2IT1A 1L2FA 3BVMA 5DM71 4ZQ3A 3S15B 2UXDQ 3D4WA 2E2DC 4MN3A 5BR8L 1HA6A 3D4DA 4K5VA 1NNQA 4UDUC 4J15A 2K2DA 1SYEA 1VMCA 3HKZG 1GUSA 3NK9A 4EQ5A 1HNWQ 2B2WC 4BBRB 1VQ9A 1M4VA 5I6WA 3QWNA 2RCNA 2XJQA 4A3GH 1SNOA 2NWGA 4NB3A 2M4YA 3HGBA 4DV4L 3AFPA 5C4XH 3H94A 1QG7A 1HNXQ 1X55A 4DKAC 1S40A 3NEMA 5C3EH 3VPBE 5EBCA 1HXYD 4C3HG 2PQAB 1EEFD 2JJQA 5ELCA 1B8AA 4A3MB 3J7Y1 4YY3Q 1LTTD 3W1BA 4AI2A 1AEXA 2VZAA 1TWAB 3HRZC 5IGBA 2K5DA 1SLJA 3D31A 1ASYA 2M6OA 3Q6SA 1BCPF 4HMIA 3C46A 1UEBA 1TWCH 1SBBB 5MF6A 3K0XA 1CK1A 2XWJB 2AWNA 5IGGA 3EQLC 1WD1A 2SDFA 2EY6A 1Q46A 2F0JA 2PCFB 1PH9A 2BDOA 2RHQB 4WJ3M 2F0LA 3P75A 5CYUA 1F9QA 1WTWA 1TVXA 3S1QB 4GLXA 1TXYA 3HOUL 3I4NB 2WAQB 4LFCQ 1HFGA 2WB1G 3GP7A 4YIJA 1VQKA 3OW7A 4CDFC 2ASBA 2LKVA 2XSCA 1WTHA 2O5JC 1AP0A 1EY4A 2F0IA 3STBD 3HOZH 2NVYB 1JOQA 1DJRD 3N52A
chains in the Genus database with same CATH topology
1SROA 2QA4A 2OCEA 1QZHA 2PSMC 4U671 1LKMA 4R4OA 4RMFA 4LF9Q 1PH4A 2Z3QB 1Q8KA 3CD6A 1RWDA 4YWMA 4QGUA 3J81j 3J7ZC 1Q86C 4P72A 2EQSA 5DLQE 4B3MQ 1XNQQ 2Q2HA 4IPHA 2HT1A 3GTLH 1L0WA 4A3LG 1NMFA 3GD7A 4IFDI 4O2DA 3RLFA 5AI3A 2N49A 4GNXA 2HR5A 8RXNA 2E2IH 2JA5H 1HNZL 2A8VA 1PA6A 4GNXC 5C0XI 3KF8B 4LHLA 2R7DA 1FVIA 1XTDA 3GTMH 2OQ0A 3S17H 4AIMA 4IJLA 1J5EQ 3S1MH 3GO5A 1PVOA 4P75A 3CP0A 4A3JG 1Y1WH 4AI1A 4X62L 3HOYH 3PF5A 3WWLA 2QGQA 4X65L 3FKIH 3M4QA 2IX1A 1JJGA 1M1KC 3PO2H 1KRSA 1N8RC 1VQBA 3CCEA 7RXNA 4JC0A 5LMNQ 4O0AA 5IP9H 4DR3L 3U4ZA 4JBWA 3LPEB 1NMGA 5IWAQ 3M3YH 3L7ZC 2JA8G 4C3IH 1XMQL 1K73C 2R7ZG 2M6PA 1VZHA 4AR3A 2Z0SA 1RYTA 3PWFA 3RYGA 1D8LA 3OTOL 2OQKA 4A3MH 3H3VH 2NZOA 3UDGA 1FJGL 2V1CC 3S16H 4B8CD 2I5MX 3IRBA 4A3BH 3CF5A 1WCMG 4JI8L 3W5OA 2UUBQ 4BY1G 1IXRA 1Q12A 2KCMA 3J7A5 5E7NA 4GKJQ 1S24A 5AJ3Q 4BBSG 3PCOB 4PZ7A 3J81c 5EAYA 4DV6L 4DR2L 1IW7D 2A6HD 2OTLA 1BE7A 2JE6I 3PUWA 4GOPA 2K52A 4JAFA 3SS2A 2YU9H 1I94L 3LNLA 1PFSA 4NXML 1K83H 2ZJQA 2PI2E 2B63H 2YYZA 1TWFH 3MSUA 4K0KL 2I0QA 1SE8A 2UUAQ 4JADA 3TEHB 1CAAA 1YNXA 3K7AH 2ID0A 5M5WH 1JMCA 4AHWA 3P2AA 3KLWA 3T1YL 1X6OA 5M5YH 2VQFL 1C09A 3A44A 1VQMA 2VQEL 2N78A 3PF4A 2ZIXA 4XGHA 2F3IA 5IT9c 2YTYA 1IL2A 2F52A 2KHIA 3M4OH 2CR8A 1KL9A 2XJVA 3ZG6A 5JVH1 4TVMA 1Y1VG 4JI3L 1VQHA 2JI1A 2ERJA 4E6YA 4PZ8A 2RDVA 4C3HH 3HOXH 4AQYQ 4C2MH 1KIXA 2R92G 3S14H 3PUYA 4XIGS 5DM61 4C3JH 2A68D 1E3PA 2V3BB 4OX9L 3KFUA 1DVBA 2UXCL 4KLKA 1FHHA 1EIYB 1VQAA 4LFAQ 4OWXB 5LMUL 4JYAL 2R93H 4JI6L 1WFQA 4X66Q 4UY8C 4TQUS 1VS0A 1N34L 4IJHA 2ATWA 2MFIA 1CSPA 4FDBA 2N8NA 4DR4L 1NY4A 4JI0Q 1VQ7A 1CKNB 4A3DG 4HJ8A 1I6HH 1RDGA 3CPWA 5BR8Q 1NXEA 1VQPA 3KYUA 1E8JA 4P74A 2H5XA 2C35B 1C7YA 1UE7A 4L5RC 1VQFA 1ZRPA 3HOVG 4LUZA 3H3VI 1BRFA 2BH2A 1Z92B 3BU2A 2VW9A 3I7FA 3K80C 3RNUA 3I4OA 4DV2Q 1SMWA 3PGZA 4DR1L 1H7VA 3TREA 3KOJA 2KENA 3M9BA 1K8AC 1XMOQ 4OWWB 3W1GA 4RXNA 3CCVA 5AI2A 1OXUA 4HIDA 5JJKA 3L0OA 4GLVB 2NN6G 5AJ3L 2ZTDA 3UE1A 5FJ8G 3I55A 3KJPA 3K35A 4X66L 1NJIC 2PVEA 2JA6H 2LXKA 2ERSA 5EINC 1NXGA 4GN3B 2E2HH 3I4NG 5LMUQ 3J81i 1VQDA 1FJGQ 1VQLA 1H95A 1VCIA 3AYHB 4UPAA 1JJ2A 5GAGc 1G51A 2BA0A 3J80i 1PYBA 5IYCH 2JI2A 5HY6A 4AQYL 4NXNQ 2XJSA 1SMUA 3VDYA 4TPUA 3SGIA 2PPTA 1MIUA 1VQIA 2MO0A 1WOCA 3EN2A 4JI2L 4IFDG 3TS2A 2B5ID 4A76A 4QY7A 1PH3A 3U58A 4DR7L 3E9HA 2IY5B 3HOWG 2JQOA 3PUXA 5ELNA 3A5UA 1KC8C 4DR7Q 1R9TH 1W2BA 1A63A 4HIOA 4JI6Q 2XJUA 1E7ZA 2KHJA 5M3FG 2HHHL 4A3DH 4GOPB 3KF6A 4GS7D 4GKKL 4A3JH 2MO1A 1T9PA 2ZTEA 1Y1WG 3KYXA 4LWCA 2LXJA 3S2DH 4JBJA 5M3FH 2UXCQ 3RR5A 5M3MH 4L5SA 1Q1EA 1TWAH 4UY81 3RN2A 1PH8A 4WJ4A 2BA1A 4ZN3B 3I2ZA 1BBWA 1OXTA 1T9QA 2ZJRA 3QVDA 2JA5G 3PIP1 1YZ6A 1L1OB 3CCSA 4OO1I 2IX0A 1VZGA 3E0EA 3G48A 3GTOH 2PI2A 4AH6A 1N36Q 4BXXG 1JT8A 2JI3A 1X3FA 3DM3A 4IPCA 1G291 3CCJA 3PV0A 5H1SE 2AMCB 3OTOQ 1U5KA 1VQOA 2E5LL 1K3RA 4LW1A 4LFCL 4NXNL 1T9OA 4DV2L 4DR1Q 4A93H 3GTJH 2XJRA 1QVCA 3OYYA 4ALPA 4LF5L 5J3BA 5LMNL 5MFPA 3STBC 3CQZH 4UP8A 4B3SQ 1E24A 1RIPA 4DV5Q 3CC7A 4YWLA 4K0KQ 4JI5Q 3G71A 5IYDH 1LTLA 3HFZB 4GLAC 3CAMA 1B2OA 4V196 1CUKA 4JI1L 4DK3C 4JI0L 1NBWA 1V43A 4DUZQ 2K50A 1N33Q 2PVXA 3PUVA 1AH9A 2K4KA 4LF7Q 3IU3I 1UE1A 4A3CH 2A19A 2NVYH 4LF7L 2RF4A 3RZOH 3WWNB 5FLMG 1GM5A 1VCXA 4HIKA 3CW2C 3E9IA 1YJ9A 5IYCG 4AI3A 4IOAA 1A62A 3EBEA 4OX9Q 3JC63 2NYDA 5C4JH 4LHNA 4B3TL 3UE0A 1LM0A 2M4VA 4POGA 2K5NA 3KDFA 4JG2A 4BXXH 4AR4A 1CSQA 2Z3RB 1WCMH 2K75A 1B13A 2R7FA 4GN4B 4YCWA 4X64Q 4A3BG 4YY3L 2OTJA 4A3IG 1HR0L 1R0JA 1E22A 2WB1E 2GVBA 4DNIA 1IBML 1CKMA 1W3SA 4JI4L 4LFBL 2UU9Q 1VQNA 1WI5A 1KD1C 3UDFA 1V1QA 4AYBG 1CKNA 4A3IH 4A3FH 2JA8H 3TRZA 5JJLA 1KQSA 1O7IA 2VQEQ 5GAEC 4DR6L 2R93G 4ME3A 3I4MH 5LMNW 3J7Z1 3F2CA 1NE3A 3PO2G 1KHIA 4JAGA 2F4VQ 1EOVA 1DGSA 1N36L 1HNXL 2NN6I 3ULLA 4HJ9A 4LF5Q 2R92H 1EQRA 1LKOA 1OXSC 4YCVA 4X64L 3BZKA 1UE6A 2JA7H 1YUXA 2BE5D 3KDFB 3CCMA 1XPRA 4AHYA 2GMGA 1GO3E 2BH8A 1IROA 3T1HQ 2CWAA 4YWKA 4GKKQ 1CADA 3NENA 4BY7H 3GTGH 2FXQA 4HIMA 5JEAJ 1R0GA 4A3LH 4GKJL 5ELOA 4BBRG 4LNQA 4G6BA 1BKBA 3ICEA 2LSSA 2GN5A 4DUZL 2KBNA 3PKIA 1ODHA 1PH5A 1PH7A 1K0RA 2E8GA 4JI1Q 4RG1A 3PKJA 1KRTA 1QZGA 5GADC 3DLLA 2H12A 2HQLA 1XMQQ 2UU9L 5FJ8H 2JA6G 4JI5L 2UXDL 3H0GH 4JI2Q 1YHAA 1SN8A 1VQGA 3UDIA 2R6GA 3PIOA 4DR3Q 3JC66 4A75A 3NFPI 3RZ6A 1YV1A 1I3QH 2A69D 5IE8A 3PSIA 1YITA 4JV5L 3PZAA 2LCQA 3F8TA 3FHWA 2C6BA 2ZTCA 3ER0A 1R0HA 1T9HA 5JVG1 1L1OA 3S1NH 3JAMi 1E1OA 2VNUD 1OWBA 3RZTA 1SRUA 5K36G 4POFA 4A3MG 1OXVA 1S2ZA 1Y1VH 3F1ZA 3LGJA 2JA7G 2MS3A 4GNXB 3Q8DA 2K5HA 2Q2UA 1EUJA 2D0PA 4R4QA 1N33L 3PO3H 1S72A 1SFOH 1VQEA 3HKZE 3P8BA 1EYGA 1YK5A 1V9PA 2WP8J 3B08B 1YUZA 3PO3G 3M85A 1FHMA 1RL2A 5C0XG 1M90C 4JBKA 4BY1H 1N32L 1I5FA 1XJVA 3K8AA 1C9OA 2Z6KA 2UUCQ 1SMMA 4JOIC 2J9UB 1U0LA 3CMEA 5C44G 2D0OA 1B2JA 3CPFA 3GTKH 3I4MG 1Q81C 3J80c 2AKWB 3KYYA 1YEZA 2IHFA 2L15A 1VQ6A 2A6ED 2ZJPA 2K5VA 4UP7A 4PMWA 1AE2A 4LF8L 2NVQH 4IOCA 4HJ5A 2VS1A 2DSXA 2YTVA 2HIVA 3NELA 4JI4Q 4LFBQ 5C0XJ 1X9NA 2KKDA 3HOZG 2Q2IA 2PMZE 3PIO1 4JYAQ 5JJIA 3PIPA 4LUVA 5FLXc 2A1AA 4DV4Q 2GVAA 5C3EG 1IBKL 4B3RL 4L5TA 4B3TQ 1DX8A 5M5XH 1HR0W 4A3KG 4BBRH 1PH1A 4P73A 4H02A 2JEBI 4UP9A 1YIJA 1WJVA 3HOUG 5GAHc 3K7UC 3I56A 1UE5A 4GOPC 1X54A 1VQ4A 3KF6B 4P71A 2AWOA 3HOXG 4AR5A 2WAQE 2B29A 4DUYQ 4DK6C 1QUQB 3KJOA 1IZ6A 4R1JA 3JAMc 4AI0A 1B71A 3EIVA 4DV5L 1YJWA 1HH2P 2UUAL 3CC2A 2JK8A 1YK4A 2C6AA 4LUOA 4EX5A 4IO9A 1EFWA 1MJEA 3AEVA 4A93G 5RXNA 5GAHC 4MNOA 3B0AB 2O5JD 3OW2A 5IP9G 4AHZA 3ULPA 5K2ME 4DV6Q 5GROA 1BVSA 2XTIA 4AYBE 1A0IA 1CKOA 4BA1I 4DV1Q 4A3GG 3FKIG 2N3SA 1IBLL 2I5LX 1SR3A 3GDEA 3A5ZB 1PYSB 3HOYG 3L2PA 3AQQA 2V0EA 2YTXA 4XTCS 4LF4Q 1JE5A 2RHSB 1Z9FA 2L0ZA 2WAQG 3CCUA 1K8GA 4AR6A 4ZN1B 5IY0A 1VQ5A 3A0JA 3KYHC 1A8VA 1XNRQ 3HOWH 2NVTH 3PUZA 1BQ9A 3HOUH 2AYJA 3F2BA 4PG3A 2HHHQ 1FGUA 1HNWL 5GQOA 4A3EH 2DGYA 4DV0Q 4OO1G 1UWVA 4X6AH 4JBMA 4DV7Q 5AN9H 1E1TA 1N9WA 1BBUA 2I5HA 1YHBA 1IRNA 3MXNB 4DV7L 1RYQA 1R0IA 4OONA 1N34Q 1QUQA 2CCZA 5MGNA 5IP7G 2JEAI 4DV0L 3GTPH 1Z47A 3WWVA 3S1QH 3F2DA 1N32Q 2EXDA 2V0FA 3I4NH 4Y7NH 1XPOA 4LFAL 2K14A 4A4IA 3CXCA 4B3ML 3M7NA 2UXBL 4A3FG 1XNQL 4R4IA 4BY7G 3D0FA 4MZ9A 4YCUA 1LYLA 4DUYL 1R0FA 4WFN1 1S3OA 1SMXA 2IHEA 3FP9A 3S1RH 3RLNA 4DAYB 1WYDA 4QQBX 1X3EA 4R4TA 1QVGA 4LF4L 2QL0A 2CKCA 1I50H 4IPDA 2YV5A 1VQCA 3S24A 5MLC3 3ZJYC 4JI3Q 4QL5A 2UUBL 2VY3A 5EIOC 1RB9A 1D7QA 2DUDA 1IBLQ 2D62A 5IYDG 2OWOA 2XGTA 3BZCA 4DV1L 1EQQA 1P8LA 5IP7H 3H0GG 2VQFQ 1PH2A 5H1Sc 1XMOL 2ES2A 3T1YQ 2ZM6L 1Q1BA 3JC62 4JOIA 1WJJA 4QJFA 2KCTA 3HKSA 5GAGC 1YI2A 1IBKQ 3S15H 1G6PA 1KAWA 2MQHA 2IT1A 1L2FA 4DAMA 1XNRL 3KYVA 1B70B 5DM71 5GADc 3A74A 1Q82C 1PH6A 4JI7L 4IFDJ 2CFMA 2UXBQ 1JYBA 3KYWA 1BFYA 4GS3A 1X56A 4X65Q 2UXDQ 1YBYA 5BR8L 4LF8Q 3CCRA 2KN9A 3CCQA 4KI0A 4TVAB 1Q7YC 2VUMH 1NNQA 1HZAA 3NBHB 2CKZB 4DR4Q 4J15A 4AHXA 2K2DA 1X65A 1FL0A 3BJUA 1HNZQ 3HKZG 4EQ5A 1HNWQ 1QCVA 3UDXA 1LKPA 2XJPA 4A3CG 2PNHA 1VQ9A 3GTQH 2CKAA 3M4PA 3T1HL 4Y52H 1AE3A 1J6QA 2B3GA 2XJQA 2RCNA 3RLOA 2EIFA 1YHQA 4LF9L 4A3GH 4NB3A 2M4YA 4OWTB 4B3RQ 2WFWA 1S30A 4DV4L 1HZBA 2XJTA 1VQJA 1YVCA 3AFPA 4PZ6A 5C4XH 4HJ7A 4YHHQ 2CWPA 4DR5L 1JB7A 1HNXQ 1X55A 4DKAC 1S40A 2F4VL 5GAEc 4APVA 1EWIA 2MNAA 1QVFA 3NEMA 5C3EH 1YJNA 3VPBE 1RDVA 1Y14B 1VQ8A 4LF6L 4DR6Q 4MTNA 1BQ8A 2NVXH 2PQAB 4LF6Q 2PYAA 1I94Q 3RZDH 4JAEA 1X3GA 2JJQA 3AFQA 1MKHA 4KHZA 1B8AA 1GKHA 1EIFA 5IYBH 5MFZA 2UUCL 4JV5Q 3J7Y1 1OXXK 4YY3Q 4GN5A 3W1BA 4AI2A 5FLMH 1PV4A 2VZAA 1B7YB 1SLJA 4NXMQ 3D31A 4A3KH 2M6OA 3G4SA 1ASYA 4BA2I 3CMAA 1HZ9A 1UEBA 3S2HH 1PHJA 5M3MG 1TWCH 3U50C 4DR2Q 4KHPQ 5MF6A 3K0XA 4DV3Q 1TWHH 2B63G 2AWNA 3TS0A 4L5QA 2AHOB 2Z6KC 1HJPA 4JI8Q 1Q46A 2JA9A 1GD7A 4KHPL 6RXNA 1TWGH 1LUZA 3H15A 2QEXA 3TQYA 1VZIA 1PH9A 1IYJB 3HOVH 2CQOA 2RHQB 5IYBG 3MEFA 1OTCA 2Q2TA 4BBSH 3MPSA 4XXBB 4JCVE 1C0AA 4WJ3M 2HIXA 1K9MC 2E2JH 2Y0SG 5IWAL 2VL6A 1XPUA 4R4CA 4JI7Q 4K9FA 4A3EG 4GLXA 5C44H 1TXYA 3CC4A 3U4VA 4B3SL 1KXLA 3RN5A 1P16A 4NPSA 3G6EA 4DPGA 2VUMG 4LFCQ 1HZCA 2NZHA 1MJCA 2WB1G 4IPGA 2ZM6Q 3K81C 4X62Q 1VQKA 2R7ZH 5C4XG 2E5LQ 2ASBA 2PQAA 3QQCE 4OXPA 1ASZA 1IU6A 1J5EL 1L1OC 1QYBA 3ERSX 3STBD 1IU5A 2ALYB 3HOZH 5HGQA 4HJAA 1JJCB 3CCLA 1IBMQ 3ULJA 4QIWE 1OWCA 5JEAG 4YHHL 3B6YA 4DR5Q 1HR0Q 1NTGA 2Y0SE 4DV3L 1GVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRO A;  2QA4 A;  2OCE A;  1QZH A;  4RMF A;  1LKM A;  4R4O A;  4LF9 Q;  1PH4 A;  1Q8K A;  3CD6 A;  1RWD A;  4YWM A;  4QGU A;  3J81 j;  3J7Z C;  1Q86 C;  4P72 A;  2EQS A;  5DLQ E;  4B3M Q;  1XNQ Q;  2Q2H A;  4IPH A;  2HT1 A;  3GTL H;  1L0W A;  4A3L G;  1NMF A;  3GD7 A;  4IFD I;  4O2D A;  3RLF A;  5AI3 A;  2N49 A;  4GNX A;  2HR5 A;  8RXN A;  2E2I H;  2JA5 H;  1HNZ L;  2A8V A;  1PA6 A;  4GNX C;  5C0X I;  3KF8 B;  2R7D A;  1FVI A;  1XTD A;  3GTM H;  2OQ0 A;  3S17 H;  4AIM A;  4IJL A;  1J5E Q;  3S1M H;  3GO5 A;  1PVO A;  4P75 A;  3CP0 A;  4A3J G;  1Y1W H;  3HOY H;  4X62 L;  3PF5 A;  2QGQ A;  4X65 L;  3FKI H;  3M4Q A;  2IX1 A;  1JJG A;  1M1K C;  3PO2 H;  1KRS A;  1N8R C;  1VQB A;  3CCE A;  7RXN A;  4JC0 A;  5LMN Q;  4O0A A;  5IP9 H;  4DR3 L;  3U4Z A;  4JBW A;  1NMG A;  5IWA Q;  3M3Y H;  3L7Z C;  2JA8 G;  4C3I H;  1XMQ L;  1K73 C;  2R7Z G;  4AR3 A;  2Z0S A;  1RYT A;  3PWF A;  3RYG A;  1D8L A;  3OTO L;  2OQK A;  4A3M H;  3H3V H;  2NZO A;  3UDG A;  1FJG L;  2V1C C;  3S16 H;  2I5M X;  3IRB A;  4A3B H;  3CF5 A;  1WCM G;  4JI8 L;  3W5O A;  2UUB Q;  4BY1 G;  1IXR A;  1Q12 A;  2KCM A;  3J7A 5;  5E7N A;  4GKJ Q;  1S24 A;  5AJ3 Q;  4BBS G;  3PCO B;  4PZ7 A;  3J81 c;  5EAY A;  4DV6 L;  4DR2 L;  2OTL A;  1BE7 A;  2JE6 I;  3PUW A;  4GOP A;  2K52 A;  3SS2 A;  2YU9 H;  1I94 L;  1PFS A;  4NXM L;  1K83 H;  2ZJQ A;  2PI2 E;  2B63 H;  2YYZ A;  1TWF H;  4K0K L;  2I0Q A;  1SE8 A;  2UUA Q;  3TEH B;  1CAA A;  1YNX A;  3K7A H;  2ID0 A;  5M5W H;  1JMC A;  3KLW A;  3T1Y L;  1X6O A;  5M5Y H;  2VQF L;  1C09 A;  3A44 A;  1VQM A;  2VQE L;  2N78 A;  3PF4 A;  2F3I A;  5IT9 c;  2YTY A;  1IL2 A;  2F52 A;  2KHI A;  3M4O H;  1KL9 A;  1Y1V G;  4JI3 L;  1VQH A;  4PZ8 A;  2RDV A;  4C3H H;  3HOX H;  4C2M H;  1KIX A;  2R92 G;  3S14 H;  3PUY A;  4XIG S;  4C3J H;  1E3P A;  2V3B B;  4OX9 L;  3KFU A;  1DVB A;  2UXC L;  4KLK A;  1FHH A;  1EIY B;  1VQA A;  4LFA Q;  4OWX B;  5LMU L;  4JYA L;  2R93 H;  4JI6 L;  1WFQ A;  4X66 Q;  4UY8 C;  4TQU S;  1VS0 A;  1N34 L;  4IJH A;  2ATW A;  2MFI A;  1CSP A;  4FDB A;  2N8N A;  4DR4 L;  1NY4 A;  4JI0 Q;  1VQ7 A;  1CKN B;  4A3D G;  4HJ8 A;  1I6H H;  1RDG A;  3CPW A;  5BR8 Q;  1VQP A;  3KYU A;  1E8J A;  4P74 A;  2H5X A;  2C35 B;  1C7Y A;  1UE7 A;  4L5R C;  1VQF A;  1ZRP A;  3HOV G;  4LUZ A;  3H3V I;  1BRF A;  2BH2 A;  3BU2 A;  2VW9 A;  3I7F A;  3K80 C;  3RNU A;  3I4O A;  4DV2 Q;  1SMW A;  3PGZ A;  4DR1 L;  1H7V A;  3TRE A;  3KOJ A;  2KEN A;  3M9B A;  1K8A C;  1XMO Q;  4OWW B;  3W1G A;  4RXN A;  3CCV A;  5AI2 A;  1OXU A;  4HID A;  5JJK A;  3L0O A;  4GLV B;  2NN6 G;  5AJ3 L;  2ZTD A;  3UE1 A;  5FJ8 G;  3I55 A;  3KJP A;  1NJI C;  4X66 L;  2JA6 H;  2PVE A;  2LXK A;  4GN3 B;  2E2H H;  3I4N G;  5LMU Q;  3J81 i;  1VQD A;  1FJG Q;  1VQL A;  1H95 A;  1VCI A;  3AYH B;  4UPA A;  1JJ2 A;  2BA0 A;  1G51 A;  3J80 i;  1PYB A;  5IYC H;  5HY6 A;  4AQY L;  4NXN Q;  1SMU A;  3VDY A;  4TPU A;  3SGI A;  1MIU A;  1VQI A;  2MO0 A;  1WOC A;  3EN2 A;  4JI2 L;  4IFD G;  3TS2 A;  4A76 A;  4QY7 A;  1PH3 A;  3U58 A;  4DR7 L;  3E9H A;  2IY5 B;  3HOW G;  2JQO A;  3PUX A;  5ELN A;  3A5U A;  1KC8 C;  4DR7 Q;  1R9T H;  1W2B A;  1A63 A;  4HIO A;  4JI6 Q;  1E7Z A;  2KHJ A;  5M3F G;  2HHH L;  4A3D H;  4GOP B;  3KF6 A;  4GKK L;  4A3J H;  2MO1 A;  1T9P A;  2ZTE A;  1Y1W G;  3KYX A;  4LWC A;  2LXJ A;  3S2D H;  4JBJ A;  5M3F H;  2UXC Q;  3RR5 A;  5M3M H;  4L5S A;  1Q1E A;  1TWA H;  3RN2 A;  1PH8 A;  4WJ4 A;  2BA1 A;  3I2Z A;  1BBW A;  1OXT A;  1T9Q A;  2ZJR A;  3QVD A;  2JA5 G;  1YZ6 A;  1L1O B;  3CCS A;  4OO1 I;  2IX0 A;  3E0E A;  3GTO H;  3G48 A;  4BXX G;  2PI2 A;  4AH6 A;  1N36 Q;  1JT8 A;  1X3F A;  3DM3 A;  4IPC A;  1G29 1;  3CCJ A;  3PV0 A;  5H1S E;  2AMC B;  3OTO Q;  1U5K A;  1VQO A;  2E5L L;  1K3R A;  4LW1 A;  4LFC L;  4NXN L;  1T9O A;  4DV2 L;  4DR1 Q;  4A93 H;  3GTJ H;  1QVC A;  3OYY A;  4ALP A;  4LF5 L;  5J3B A;  5LMN L;  3STB C;  3CQZ H;  4UP8 A;  4B3S Q;  1E24 A;  1RIP A;  4DV5 Q;  3CC7 A;  4YWL A;  4K0K Q;  4JI5 Q;  3G71 A;  5IYD H;  1LTL A;  3HFZ B;  4GLA C;  3CAM A;  1B2O A;  1CUK A;  4JI1 L;  4DK3 C;  4JI0 L;  1NBW A;  1V43 A;  4DUZ Q;  2K50 A;  1N33 Q;  2PVX A;  3PUV A;  1AH9 A;  2K4K A;  4LF7 Q;  1UE1 A;  4A3C H;  2A19 A;  2NVY H;  4LF7 L;  2RF4 A;  3RZO H;  5FLM G;  1GM5 A;  1VCX A;  4HIK A;  3CW2 C;  3E9I A;  1YJ9 A;  5IYC G;  4IOA A;  1A62 A;  3EBE A;  4OX9 Q;  3JC6 3;  5C4J H;  4B3T L;  3UE0 A;  1LM0 A;  2K5N A;  4POG A;  4JG2 A;  3KDF A;  4BXX H;  4AR4 A;  1CSQ A;  1WCM H;  2K75 A;  2R7F A;  1B13 A;  4GN4 B;  4YCW A;  4X64 Q;  4A3B G;  2OTJ A;  4YY3 L;  4A3I G;  1HR0 L;  1R0J A;  1E22 A;  2WB1 E;  2GVB A;  4DNI A;  1IBM L;  1CKM A;  1W3S A;  4JI4 L;  4LFB L;  2UU9 Q;  1VQN A;  1WI5 A;  1KD1 C;  3UDF A;  1V1Q A;  4AYB G;  1CKN A;  4A3I H;  4A3F H;  2JA8 H;  3TRZ A;  5JJL A;  1KQS A;  1O7I A;  2VQE Q;  5GAE C;  4DR6 L;  2R93 G;  4ME3 A;  3I4M H;  5LMN W;  3F2C A;  1NE3 A;  3PO2 G;  1KHI A;  2F4V Q;  1EOV A;  1DGS A;  1N36 L;  1HNX L;  2NN6 I;  3ULL A;  4HJ9 A;  4LF5 Q;  2R92 H;  1EQR A;  1LKO A;  1OXS C;  4YCV A;  4X64 L;  3BZK A;  1UE6 A;  2JA7 H;  1YUX A;  3KDF B;  3CCM A;  1XPR A;  2GMG A;  1GO3 E;  2BH8 A;  1IRO A;  3T1H Q;  2CWA A;  4YWK A;  4GKK Q;  1CAD A;  3NEN A;  4BY7 H;  3GTG H;  2FXQ A;  4HIM A;  5JEA J;  1R0G A;  4A3L H;  4GKJ L;  5ELO A;  4BBR G;  4LNQ A;  1BKB A;  3ICE A;  2LSS A;  2GN5 A;  4DUZ L;  2KBN A;  1PH5 A;  1PH7 A;  1K0R A;  2E8G A;  4JI1 Q;  4RG1 A;  1KRT A;  1QZG A;  5GAD C;  3DLL A;  2HQL A;  1XMQ Q;  2UU9 L;  5FJ8 H;  2JA6 G;  4JI5 L;  2UXD L;  3H0G H;  4JI2 Q;  1YHA A;  1SN8 A;  1VQG A;  3UDI A;  2R6G A;  3PIO A;  4DR3 Q;  3JC6 6;  4A75 A;  3RZ6 A;  1I3Q H;  1YV1 A;  5IE8 A;  1YIT A;  4JV5 L;  3PSI A;  3PZA A;  2LCQ A;  3F8T A;  3FHW A;  2ZTC A;  3ER0 A;  1R0H A;  1T9H A;  1L1O A;  3S1N H;  3JAM i;  1E1O A;  2VNU D;  3RZT A;  1SRU A;  5K36 G;  4POF A;  4A3M G;  1OXV A;  1S2Z A;  1Y1V H;  3F1Z A;  3LGJ A;  2JA7 G;  2MS3 A;  4GNX B;  3Q8D A;  2K5H A;  2Q2U A;  1EUJ A;  2D0P A;  4R4Q A;  1N33 L;  3PO3 H;  1S72 A;  1SFO H;  1VQE A;  3HKZ E;  1EYG A;  1YK5 A;  1V9P A;  2WP8 J;  1YUZ A;  3PO3 G;  3M85 A;  1FHM A;  1RL2 A;  5C0X G;  1M90 C;  4JBK A;  4BY1 H;  1N32 L;  1I5F A;  1XJV A;  3K8A A;  1C9O A;  2Z6K A;  2UUC Q;  1SMM A;  4JOI C;  1U0L A;  3CME A;  5C44 G;  2D0O A;  1B2J A;  3CPF A;  3GTK H;  3I4M G;  1Q81 C;  3J80 c;  2AKW B;  3KYY A;  1YEZ A;  2L15 A;  2IHF A;  1VQ6 A;  2ZJP A;  2NVQ H;  2K5V A;  4UP7 A;  4PMW A;  1AE2 A;  4LF8 L;  4IOC A;  4HJ5 A;  2VS1 A;  2DSX A;  2YTV A;  2HIV A;  3NEL A;  4JI4 Q;  4LFB Q;  5C0X J;  1X9N A;  2KKD A;  3HOZ G;  2Q2I A;  2PMZ E;  4JYA Q;  5JJI A;  3PIP A;  4LUV A;  5FLX c;  2A1A A;  4DV4 Q;  2GVA A;  5C3E G;  1IBK L;  4B3R L;  4L5T A;  4B3T Q;  1DX8 A;  5M5X H;  1HR0 W;  4A3K G;  4BBR H;  1PH1 A;  4P73 A;  4H02 A;  2JEB I;  4UP9 A;  1YIJ A;  3HOU G;  3K7U C;  3I56 A;  1UE5 A;  4GOP C;  1X54 A;  1VQ4 A;  3KF6 B;  4P71 A;  2AWO A;  3HOX G;  4AR5 A;  2WAQ E;  2B29 A;  4DUY Q;  4DK6 C;  1QUQ B;  3KJO A;  1IZ6 A;  4R1J A;  3JAM c;  3EIV A;  1B71 A;  4DV5 L;  1YJW A;  2UUA L;  1HH2 P;  3CC2 A;  2JK8 A;  1YK4 A;  4LUO A;  4EX5 A;  4IO9 A;  1EFW A;  1MJE A;  3AEV A;  5RXN A;  5GAH C;  4MNO A;  3OW2 A;  5IP9 G;  3ULP A;  4DV6 Q;  5GRO A;  1BVS A;  2XTI A;  4AYB E;  1A0I A;  1CKO A;  4BA1 I;  4DV1 Q;  4A3G G;  3FKI G;  2N3S A;  1IBL L;  2I5L X;  1SR3 A;  3GDE A;  3A5Z B;  1PYS B;  3HOY G;  3L2P A;  3AQQ A;  2YTX A;  4XTC S;  4LF4 Q;  1JE5 A;  2RHS B;  1Z9F A;  2WAQ G;  3CCU A;  1K8G A;  1VQ5 A;  4AR6 A;  5IY0 A;  3A0J A;  3KYH C;  1A8V A;  1XNR Q;  3HOW H;  2NVT H;  3PUZ A;  1BQ9 A;  3HOU H;  3F2B A;  4PG3 A;  2HHH Q;  1FGU A;  1HNW L;  5GQO A;  4A3E H;  2DGY A;  4DV0 Q;  4OO1 G;  1UWV A;  4X6A H;  4JBM A;  4DV7 Q;  1E1T A;  1N9W A;  1BBU A;  2I5H A;  1YHB A;  1IRN A;  3MXN B;  4DV7 L;  1R0I A;  4OON A;  1N34 Q;  1QUQ A;  2CCZ A;  5IP7 G;  4DV0 L;  3GTP H;  1Z47 A;  3WWV A;  3S1Q H;  3F2D A;  1N32 Q;  2EXD A;  3I4N H;  2UXB L;  4Y7N H;  1XPO A;  4LFA L;  2K14 A;  4A4I A;  3CXC A;  4B3M L;  3M7N A;  4A3F G;  1XNQ L;  4R4I A;  4BY7 G;  3D0F A;  4MZ9 A;  4YCU A;  1LYL A;  4DUY L;  1R0F A;  1S3O A;  1SMX A;  2IHE A;  3FP9 A;  4AQY Q;  3S1R H;  3RLN A;  4DAY B;  1WYD A;  4QQB X;  1X3E A;  4R4T A;  1QVG A;  4LF4 L;  2QL0 A;  1I50 H;  4IPD A;  4JI3 Q;  2YV5 A;  1VQC A;  3S24 A;  3ZJY C;  2JEA I;  4QL5 A;  2UUB L;  2VY3 A;  1RB9 A;  1D7Q A;  2DUD A;  1IBL Q;  2D62 A;  5IYD G;  2OWO A;  2XGT A;  3BZC A;  4DV1 L;  1EQQ A;  1P8L A;  5IP7 H;  3H0G G;  2VQF Q;  1PH2 A;  1XMO L;  2ES2 A;  3T1Y Q;  2ZM6 L;  1Q1B A;  3JC6 2;  4JOI A;  1WJJ A;  4QJF A;  2KCT A;  3HKS A;  5GAG C;  1YI2 A;  1IBK Q;  3S15 H;  1G6P A;  1KAW A;  2MQH A;  2IT1 A;  1L2F A;  4DAM A;  1XNR L;  3KYV A;  1B70 B;  3A74 A;  1Q82 C;  1PH6 A;  4JI7 L;  4IFD J;  2UXB Q;  2CFM A;  2UXD Q;  1JYB A;  3KYW A;  1BFY A;  4GS3 A;  1X56 A;  4X65 Q;  1YBY A;  5BR8 L;  4LF8 Q;  3CCR A;  2KN9 A;  3CCQ A;  4KI0 A;  4TVA B;  1Q7Y C;  2VUM H;  1NNQ A;  1HZA A;  3NBH B;  2CKZ B;  4DR4 Q;  4J15 A;  2K2D A;  1X65 A;  1FL0 A;  3BJU A;  1HNZ Q;  3HKZ G;  4EQ5 A;  1HNW Q;  1QCV A;  3UDX A;  1LKP A;  4A3C G;  2PNH A;  1VQ9 A;  3GTQ H;  3M4P A;  3T1H L;  4Y52 H;  1AE3 A;  1J6Q A;  2B3G A;  2RCN A;  3RLO A;  4A3G H;  2EIF A;  1YHQ A;  4LF9 L;  4B3R Q;  4NB3 A;  2M4Y A;  4OWT B;  2WFW A;  1S30 A;  4DV4 L;  1HZB A;  1VQJ A;  1YVC A;  3AFP A;  4PZ6 A;  4HJ7 A;  5C4X H;  1JB7 A;  4YHH Q;  2CWP A;  4DR5 L;  1HNX Q;  1X55 A;  4DKA C;  1S40 A;  2F4V L;  4APV A;  1EWI A;  2MNA A;  1QVF A;  3NEM A;  5C3E H;  1YJN A;  4LF6 L;  1RDV A;  1Y14 B;  1VQ8 A;  4DR6 Q;  4MTN A;  1BQ8 A;  2NVX H;  2PQA B;  4LF6 Q;  2PYA A;  1I94 Q;  3RZD H;  2JJQ A;  1X3G A;  3AFQ A;  1MKH A;  4KHZ A;  1B8A A;  1GKH A;  1EIF A;  5IYB H;  2UUC L;  4JV5 Q;  1OXX K;  4YY3 Q;  4GN5 A;  3W1B A;  5FLM H;  1PV4 A;  2VZA A;  1B7Y B;  1SLJ A;  4NXM Q;  3D31 A;  4A3K H;  1ASY A;  3G4S A;  4BA2 I;  3CMA A;  1HZ9 A;  1UEB A;  3S2H H;  1PHJ A;  5M3M G;  1TWC H;  3U50 C;  4DR2 Q;  4KHP Q;  3K0X A;  4DV3 Q;  1TWH H;  2B63 G;  2AWN A;  3TS0 A;  4L5Q A;  2AHO B;  2Z6K C;  1HJP A;  4JI8 Q;  1Q46 A;  2JA9 A;  1GD7 A;  4KHP L;  6RXN A;  1LUZ A;  1TWG H;  3H15 A;  2QEX A;  3TQY A;  1PH9 A;  3HOV H;  1IYJ B;  2CQO A;  2RHQ B;  5IYB G;  3MEF A;  1OTC A;  2Q2T A;  4BBS H;  3MPS A;  4JCV E;  1C0A A;  4WJ3 M;  2HIX A;  1K9M C;  2E2J H;  2Y0S G;  5IWA L;  2VL6 A;  1XPU A;  4R4C A;  4JI7 Q;  4K9F A;  4A3E G;  4GLX A;  5C44 H;  1TXY A;  3CC4 A;  3U4V A;  4B3S L;  1KXL A;  3RN5 A;  1P16 A;  4NPS A;  3G6E A;  4DPG A;  2VUM G;  4LFC Q;  1HZC A;  2NZH A;  1MJC A;  2WB1 G;  4IPG A;  2ZM6 Q;  3K81 C;  4X62 Q;  1VQK A;  2R7Z H;  5C4X G;  2E5L Q;  2ASB A;  2PQA A;  4OXP A;  1ASZ A;  1IU6 A;  1J5E L;  1L1O C;  1QYB A;  3ERS X;  3STB D;  1IU5 A;  2ALY B;  3HOZ H;  5HGQ A;  4HJA A;  1JJC B;  3CCL A;  1IBM Q;  3ULJ A;  4QIW E;  5JEA G;  4YHH L;  4DR5 Q;  3B6Y A;  1HR0 Q;  4A93 G;  1NTG A;  2Y0S E;  4DV3 L;  1GVP A; 
#chains in the Genus database with same CATH topology
 2QA4 A;  1QZH A;  4RMF A;  1LKM A;  4C3J L;  4AYB P;  1Q8K A;  4YWM A;  2EYL A;  3J81 j;  4QCL A;  1HA5 A;  4B3M Q;  5DLQ E;  4K5W A;  2JSO A;  1L0W A;  3GD7 A;  5AI3 A;  1JR0 D;  2N49 A;  3CRL C;  4GNX A;  3E5S A;  2JA5 L;  2E2I H;  3KBX A;  1FVI A;  3NBH A;  2OQ0 A;  1J5E Q;  1GUW A;  5KRU A;  1Y1W H;  4CBV A;  3HOY H;  2WAQ P;  4HCS A;  2IX1 A;  2L4N A;  2FFK B;  1I3Q B;  3LPE B;  2KVM A;  1K73 C;  2R7Z G;  1SE4 A;  2M6P A;  4ZRZ A;  3GTQ B;  3S16 H;  3GTO L;  4A3B H;  1ICW A;  3PMF A;  1WCM G;  5C5M A;  5I9O A;  3CF5 A;  1GHK A;  1TWH L;  2E2H L;  4BY1 G;  2UUB Q;  2KCM A;  5IIF A;  1S24 A;  2PMZ P;  1EZ8 A;  4BBS G;  1SEB D;  4DR2 L;  5EAY A;  4DV6 L;  3LWO B;  1EY6 A;  4GOP A;  2QDL A;  3PUW A;  5NUC A;  1WTV A;  1V1P B;  2YU9 H;  5E3F A;  4NXM L;  4EVO A;  2ZJQ A;  2B63 H;  3K5N A;  3MSU A;  3EFX D;  2UUA Q;  4Q0F A;  5ELF A;  1CAA A;  5M5W H;  2SNM A;  4KD4 A;  1JMC A;  2L55 A;  5TSS A;  3KLW A;  5C3W A;  2N78 A;  4A3C L;  4XGH A;  5IT9 c;  4A3B B;  4OIK A;  2KHI A;  2XJV A;  1XTC D;  3IFT A;  1Y1V G;  4E6Y A;  5IP9 L;  3HOX H;  4C2M H;  3S14 H;  3ND9 A;  3PUY A;  4C3J H;  1E3P A;  2UXC L;  4KLK A;  1NUC A;  4LFA Q;  4RHR A;  3PL5 A;  4UY8 C;  1TS5 A;  4TQU S;  1XWE A;  2R7Z B;  3E3X A;  2HQE A;  1CSP A;  2DNC A;  1KAB A;  4A3D G;  3CPW A;  1VQP A;  2M2L A;  4BBS L;  1C7Y A;  1VQF A;  3URY A;  2JA7 L;  3BS1 A;  3H3V I;  2BH2 A;  4LF5 Q;  2VW9 A;  3I4O A;  5CV5 A;  4DV2 Q;  3TDQ A;  5IGD A;  1HRJ A;  3S14 B;  2JP1 A;  3M9B A;  3CCV A;  4IQZ A;  3KK7 A;  4GLV B;  3I55 A;  3KJP A;  3TP7 A;  4X66 L;  2LXK A;  2ERS A;  5LMU Q;  5C3E B;  1VCI A;  3D3R A;  2BA0 A;  3GTG B;  1PYB A;  3SXH A;  3EA6 A;  4AQY L;  4RA8 A;  3SGI A;  2IJ0 A;  3HEJ A;  3EN2 A;  1B1Z A;  2B5I D;  1NNX A;  1S5E D;  4G57 A;  2IY5 B;  1UAP A;  2NB0 A;  5IT9 E;  1KC8 C;  4MHE A;  1ZKO A;  1JOR A;  4HIO A;  3SR1 A;  4JI6 Q;  1A6X A;  5EPJ A;  1EY5 A;  1K3B C;  4A3D L;  3HP3 A;  4FXK C;  5D65 A;  5FO7 B;  2MO1 A;  2LY7 A;  3KYX A;  2E75 C;  2LXJ A;  1D7Q A;  3RR5 A;  4L5S A;  2M00 A;  3HOX L;  4UY8 1;  3RN2 A;  1PH8 A;  1TWA L;  5LHY 1;  2BA1 A;  5CGK A;  1T9Q A;  3WDN A;  5JPM C;  3PQI A;  3HOV B;  4DA2 A;  1VZG A;  1STG A;  3E0E A;  3G48 A;  4N9T A;  5EBD A;  1JT8 A;  2JI3 A;  1X3F A;  1Z7T A;  4R8I A;  3GV6 A;  1PTO B;  4LW1 A;  1WTX A;  1AZP A;  1EWH A;  1QCB D;  1SNM A;  4DR1 Q;  3H91 A;  3GTJ H;  4ZUI A;  5LMN L;  3CQZ L;  4BY1 B;  4QIW P;  1E24 A;  3S1R B;  4DV5 Q;  1KDA A;  4HED A;  3CC7 A;  4U67 3;  3PIO 3;  4GLA C;  4V19 6;  1CUK A;  1E2W A;  4CKC A;  4BBR L;  1V43 A;  4DUZ Q;  2SOB A;  1AH9 A;  3IU3 I;  1UE1 A;  3RZO H;  3WWN B;  1MSH A;  1VCX A;  3JAM E;  1CQF A;  4IOA A;  1A62 A;  4OIJ A;  5C4J H;  4JG2 A;  4BXX H;  1HQR D;  4A3G B;  4C3J B;  4EQP A;  4AR4 A;  4YCW A;  5D3D A;  4GN4 B;  1HTL D;  4Z9C B;  4YY3 L;  1I4R A;  1E22 A;  3A56 A;  2H4O A;  4HTH A;  3CRK C;  4XQN A;  1S5D D;  4JI4 L;  4LFB L;  1WI5 A;  3HOZ B;  4A3F L;  3UDF A;  3T13 A;  2JA8 H;  5KYI A;  5GAE C;  3S1M B;  5LMN W;  5CC4 A;  1NE3 A;  3PO2 G;  2EE1 A;  4JAG A;  1PTO F;  4CDE C;  3J7A V;  2NN6 I;  2XIW A;  3MTS A;  2B2U C;  2JA7 H;  1YUX A;  2BE5 D;  2PO4 A;  5JOB A;  2BOS A;  1K8M A;  5IGC A;  3VYT A;  3T1H Q;  4F8M A;  4BY7 H;  4ZYS A;  1R0G A;  2AUJ D;  3K59 A;  3I90 A;  4BBR G;  4G6B A;  1BKB A;  2GN5 A;  1SYF A;  1NCV A;  4CKE A;  1ZYR D;  2B2Y A;  3C2P A;  3HG9 A;  4ZKB B;  4X3T A;  3PKJ A;  1LT4 D;  2HQL A;  2UXD L;  3NSW A;  3L3O C;  4JI5 L;  4JI2 Q;  1SN8 A;  2R6G A;  1TWF B;  4A75 A;  1U4P A;  3RZ6 A;  4QIW B;  1LV9 A;  4RCN A;  3PZA A;  3FHW A;  2JA7 B;  1E2Z A;  1T9H A;  2VNU D;  2A68 C;  4POF A;  1LAB A;  1WVL A;  1EY8 A;  5FLX L;  4A3M G;  1S2Z A;  3LGJ A;  2MS3 A;  2PZT A;  1QOH A;  1EUJ A;  3H9C A;  4HMJ A;  4QMG A;  4S3S A;  3PO3 H;  1S72 A;  1SFO H;  2R93 B;  4DXG A;  2WP8 J;  1BR9 A;  1PRT B;  5M3M B;  1EY0 A;  5C0X G;  2MHV A;  4BY1 L;  4JBK A;  3VA7 A;  2LFN A;  3K8A A;  4J1M A;  4JOI C;  3DWA A;  3GTK H;  2IHF A;  3QOL A;  4PMW A;  1AE2 A;  3FMC A;  3SK5 A;  3GTP L;  1ICF B;  4JI4 Q;  4LFB Q;  2K04 A;  5K5P A;  3WOE A;  3A54 A;  3LWP B;  1QNK A;  2CW0 C;  2LMC B;  4CGY B;  4KK7 A;  3FPP A;  4LJZ C;  4B3T Q;  4TKO B;  2LS0 1;  4DAY A;  4H02 A;  2C5C A;  3MXP A;  2Y0S P;  3I56 A;  5IP7 L;  3G6J B;  2AQ3 B;  4P71 A;  1RTO A;  4AR5 A;  4BY7 B;  4OEM B;  1TY2 A;  4WFN 3;  3I73 A;  2UUA L;  2B63 B;  1HH2 P;  1MI2 A;  1ET9 A;  3MC0 B;  5C0X H;  4L63 B;  4MNO A;  3VR2 A;  1ONL A;  2VUM L;  4DV1 Q;  1TII D;  2PW7 A;  2I5L X;  1PFY A;  1PYS B;  3L2P A;  2BE5 C;  2V0E A;  3NBI A;  2L0Z A;  3O13 A;  1IL8 A;  5IOC A;  1A8V A;  1QB5 D;  1XNR Q;  4DK1 A;  2NVT H;  3HOU H;  3Q22 A;  2E76 C;  1STA A;  3D4R A;  1TWG B;  1HNW L;  4A3E H;  4BBS B;  4OO1 G;  3T16 A;  4X6A H;  1EL0 A;  1PYW D;  2L12 A;  1YHB A;  1IRN A;  3MXN B;  4OON A;  1N34 Q;  3FDT A;  2CCZ A;  5IP7 G;  3GTP H;  1Z47 A;  2FMC A;  1V8Q A;  1N32 Q;  4Y7N L;  1F9S A;  2UXB L;  1PFB A;  4B3M L;  2RQX A;  3HOX B;  3CQZ B;  1H9S B;  4BY7 G;  1LYL A;  1R0F A;  1SMX A;  3FP9 A;  2L9H A;  1K28 A;  3S1R H;  2F1M A;  4QQB X;  4QUF A;  1X3E A;  4R4T A;  2DJF C;  2QL0 A;  5M5X L;  1I50 L;  1PTO H;  2QEJ C;  2YV5 A;  3S24 A;  1KNA A;  5EIO C;  4DN4 M;  3GTM L;  4IUQ A;  4CJ2 C;  1TS2 A;  1VF5 C;  2OWO A;  2XGT A;  4DV1 L;  3H0G G;  2VQF Q;  3H97 A;  1PH2 A;  3T1Y Q;  1WJJ A;  4QJF A;  5GAG C;  3HKS A;  1I4P A;  3J80 L;  2MQH A;  1X3P A;  1WCM B;  4DAM A;  1B70 B;  3A74 A;  2DY7 A;  5EQ0 A;  4JI7 L;  4IFD J;  2CFM A;  4XYO A;  1JYB A;  3KYW A;  4X65 Q;  1X56 A;  2EZV A;  5COY A;  3NHH A;  3ONA B;  4LF8 Q;  4LAA A;  4KI0 A;  1A2T A;  1HZA A;  4DR4 Q;  1U9R A;  1SNP A;  3NTH A;  1LKP A;  4CJ0 B;  1TWG L;  1EY9 A;  3M4P A;  2WB1 B;  2B3G A;  1PZI D;  2ENB A;  1MGS A;  2XJT A;  1JB7 A;  4YHH Q;  4DR5 L;  4J6H A;  2F4V L;  4APV A;  2MNA A;  4RGO S;  2HCC A;  1BQ8 A;  5C3X A;  3RZD H;  1X3G A;  3RZD L;  3AFQ A;  3F2U A;  2HUG A;  1GKH A;  5IYB H;  2UUC L;  4JV5 Q;  1OXX K;  1B50 A;  4TSS A;  2G9H D;  2KHS A;  1B7Y B;  4G7O C;  4A3K H;  3G4S A;  4A3K L;  1UEA B;  2B39 A;  3U50 C;  4DR2 Q;  4KHP Q;  1D5M C;  2RSO A;  3VR5 A;  2B63 G;  1DYQ A;  2SNS A;  6RXN A;  2IW3 A;  3TQY A;  1IYJ B;  2EVB A;  5E4W C;  5IYB G;  4BBS H;  2YU9 L;  4EQN A;  3MPS A;  4JCV E;  5BN5 A;  1F9P A;  4M1U B;  1TWF L;  2VL6 A;  1SDF A;  2F0T A;  4K9F A;  4R4C A;  3CC4 A;  1DCZ A;  3U4V A;  3G6E A;  4DPG A;  5EJW A;  4NXN Q;  4IPG A;  2ZM6 Q;  2PYK A;  4X62 Q;  2L11 A;  3P20 A;  1BOS A;  3NTI A;  1S5C D;  4HJA A;  1FGB D;  3CCL A;  1DON A;  3ULJ A;  1HTP A;  1LT5 D;  2PSM C;  5JVH 3;  5IGE A;  1BCP D;  1RWD A;  4A3G L;  3R93 A;  4QGU A;  4P72 A;  3S1R L;  4A3L G;  1VMP A;  5COR A;  1H9K A;  1NMF A;  4X3U A;  2JA5 H;  1I6H B;  5C4Z A;  1PA6 A;  5C0X I;  2R7D A;  1XTD A;  3OSO A;  4IJL A;  3BYY B;  3CP0 A;  4AI1 A;  1STE A;  3PF5 A;  2QGQ A;  4X65 L;  3M4Q A;  4FF2 A;  1A3U A;  1JJG A;  3S16 B;  1QQT A;  5IYB L;  1N8R C;  3CCE A;  7RXN A;  4JC0 A;  1GJX A;  1BQQ T;  3U4Z A;  5FLM L;  1NMG A;  4V0B A;  3H0G B;  3OTO L;  3H3V H;  3PWF A;  4FXG C;  2NZO A;  3UDG A;  1FJG L;  2V1C C;  4A3D B;  1R9T B;  3KLR A;  3L9A X;  3W5O A;  1Q12 A;  2ICI A;  4GKJ Q;  5E7N A;  1I4G A;  1EU4 A;  1STB A;  3OIP A;  3PCO B;  2JE6 I;  3EJI A;  2MUY A;  3HOV L;  4JAF A;  3LNL A;  1II3 A;  2NZ1 D;  1K83 H;  3BVG A;  4KY7 A;  4K0K L;  1B3Q A;  2EYJ A;  1EYC A;  1GOZ A;  1S5F D;  2PZW A;  1EIG A;  4L8J A;  4P2C B;  1C09 A;  3A44 A;  1PMR A;  5DEH A;  1E0B A;  2YTY A;  2F0M A;  2F52 A;  3M4O H;  1KL9 A;  3DEP A;  5JVH 1;  4RGM A;  4JI3 L;  3MZ5 A;  4KKU A;  2JI1 A;  4PZ8 A;  3Q23 A;  3S2H B;  2RDV A;  4C3H H;  1ENA A;  2A68 D;  2KED A;  1FHH A;  4OWX B;  2K5W A;  1SFO B;  2R93 H;  4CJ1 B;  4LMQ D;  1MD2 D;  2A5H A;  1O78 A;  1I4X A;  1N34 L;  4PV1 C;  2ATW A;  4FDB A;  3SDZ A;  4NW2 A;  4JI0 Q;  1VQ7 A;  1CKN B;  4NP5 A;  4HJ8 A;  1I6H L;  1RDG A;  2K33 A;  4WJW A;  5LL6 S;  5BR8 Q;  4P74 A;  1MSG A;  2H5X A;  3GQB A;  4N8F A;  4L5R C;  1DD2 A;  1ZRP A;  3HOV G;  4LUZ A;  1BRF A;  3BU2 A;  3TP8 A;  3K80 C;  1SMW A;  4C1N I;  3KOJ A;  4OWW B;  4J8Q A;  1XMO Q;  1JWM D;  5AJ3 L;  2ZTD A;  1RJT A;  3UE1 A;  2JA6 H;  3K35 A;  1LTA D;  5EIN C;  4GN3 B;  5M9O A;  3SK4 A;  2I07 B;  1B9N A;  1VQD A;  1X32 A;  1FJG Q;  1H95 A;  4XQJ A;  5C4X B;  1JJ2 A;  1TY0 A;  4K2L A;  3H99 A;  2F0K A;  4KN7 C;  1RTN A;  1MIU A;  1A3V A;  3C3L A;  1SXT A;  3LX0 A;  3HJW B;  3QR8 A;  1PH3 A;  1BUV T;  1QE6 A;  2HDM A;  3E9H A;  1YNJ C;  3PUX A;  2L1B A;  5ELN A;  1W2B A;  2EY5 A;  1TWH B;  2FHT A;  1A63 A;  2RDH A;  2KHJ A;  3U9O A;  4GS7 D;  4GKK L;  3BZD B;  4A3J H;  1T9P A;  4JK1 C;  1TS4 A;  4JBJ A;  4A3J B;  4ZN3 B;  2NYZ D;  3J81 L;  3HS0 C;  2ZJR A;  4JW0 A;  3QVD A;  3CCS A;  4OO1 I;  3GTO H;  4C56 C;  2PI2 A;  2R93 L;  1N36 Q;  2NTS A;  3R2T A;  4IPC A;  2EDG A;  3CCJ A;  4FYD A;  3PV0 A;  2F0G A;  2G9D A;  4IUR A;  3ZYY X;  5ELD A;  4A93 H;  4I7A A;  2X6L A;  3FRP B;  1ILQ A;  3STB C;  2PZU A;  3CQZ H;  1FR3 A;  1HUN A;  4A93 B;  1ML0 D;  4E6I A;  4JI5 Q;  5IYD H;  1RKN A;  2VB2 X;  4RHS A;  1LTL A;  3DWP A;  1DOL A;  2CVR A;  1Y8P B;  2KCC A;  5A2Q L;  3GTP B;  4JI0 L;  1NBW A;  1SMY D;  3PUV A;  2Q8R E;  3GTO B;  4LF7 L;  3J7Y W;  3K6O A;  3AU7 A;  1GM5 A;  1YJ9 A;  4HIK A;  3E9I A;  3R2I A;  4OX9 Q;  2EOT A;  2H1E A;  1HHV A;  3UE0 A;  4POG A;  2A6E C;  5IOD A;  5D14 A;  4X64 Q;  2K75 A;  1WCM L;  1JQY D;  2KUM A;  4R8N A;  1KNE A;  1HUM A;  4RH6 A;  1HR0 L;  2F0S A;  1R0J A;  2WB1 E;  1XXG A;  1CKM A;  5JJL A;  4M8A A;  2XVS A;  4AYB G;  1CKN A;  1T5E A;  4C2M 1;  1EFI D;  1O7I A;  2VQE Q;  2R93 G;  2JA5 B;  1O7L A;  4FP5 D;  2F4V Q;  1EOV A;  4DXF A;  1DGS A;  3X3M A;  1JIC A;  4HJ9 A;  2R92 L;  5FKA C;  4YCV A;  1Q90 A;  5IYD L;  1HFN A;  5I9P A;  3S2H L;  1SMY C;  1KDB A;  3OMG A;  2EXZ A;  2CWA A;  4YWK A;  3N6R A;  2EY2 A;  4GKK Q;  1JCK B;  2B2Y C;  1EOT A;  2NVX B;  5ELO A;  2JA6 B;  3CU7 A;  4LNQ A;  2QCP X;  5BN4 A;  3GTM B;  1BCP C;  2LSS A;  3DHQ A;  1IKL A;  4FXD A;  1PH5 A;  1PH7 A;  4UAI A;  1K0R A;  4JI1 Q;  2HVY C;  5GAD C;  3DLL A;  3NQI A;  2H12 A;  4I7Z C;  1XMQ Q;  2UU9 L;  1LTG D;  3WOF A;  2JA6 G;  3W3A A;  3JAM L;  1VQG A;  1MHW C;  1I3Q L;  2ZXR A;  2WKC A;  3NFP I;  2B2U A;  1YV1 A;  1YIT A;  2A69 D;  1PTO D;  2LCQ A;  3GTJ B;  2C6B A;  4C3H B;  3DWQ A;  3ER0 A;  3NXW A;  4CKB A;  1R0H A;  1BCP B;  3U9S A;  1L1O A;  3S1N H;  1E1O A;  3RZT A;  5A2Q E;  4F7X A;  5K36 G;  1OXV A;  1SE3 A;  1R9T L;  2JA7 G;  4FNF A;  5EKK A;  5JEA H;  1SFO L;  2ICE C;  1EYG A;  1V9P A;  1CA6 A;  1AFP A;  2TMP A;  3M85 A;  4KTA A;  2XNA C;  4BY1 H;  3CKI B;  5C4J B;  1XJV A;  1N32 L;  1U4L A;  2J9U B;  5C44 G;  2D0O A;  3GTK L;  3CPF A;  1VQ6 A;  2Z9H A;  3BVZ A;  2R7Z H;  2ZJP A;  2NVQ H;  2DSX A;  3NEL A;  1Q8I A;  4X3K A;  5C0X J;  3GTJ L;  2PMZ E;  3PIO 1;  5EGT A;  3VYR A;  1E2V A;  2HDL A;  4DV4 Q;  3W2D A;  1U4R A;  3FVQ A;  1SYG A;  1IBK L;  5CMD A;  4B3R L;  3NPP A;  5IT9 L;  1G2S A;  1JC7 A;  2PMZ B;  5I6Y A;  2G5D A;  5M5X H;  4FF3 A;  4A3E L;  2JEB I;  1CZG A;  3I70 A;  1YIJ A;  5GAH c;  3J80 E;  1SAP A;  2B2T A;  1UE5 A;  4K6L A;  1X54 A;  1W6J A;  5CV8 A;  4ID6 A;  3HOX G;  2WAQ E;  4RKB A;  1STN A;  4DUY Q;  1QUQ B;  3KJO A;  2E74 C;  2I46 A;  3S9W A;  4AI0 A;  3CC2 A;  4LUO A;  4EX5 A;  1EFW A;  2KOL A;  5G3L D;  3SE0 A;  5GAH C;  2XWB B;  4AHZ A;  5I2Y A;  3ULP A;  1BVS A;  4ME5 A;  1IBL L;  2N3S A;  3GDE A;  2Z8L A;  4N9P A;  3MFG A;  3VA5 A;  3Q0A A;  3K58 A;  4CDC C;  4LF4 Q;  3BDC A;  4XT1 B;  4ZN1 B;  2E2J L;  4C2M B;  1PFW A;  3MXU A;  4Q5V A;  4DV0 Q;  1P7P A;  1H9S A;  4DV7 Q;  5AN9 H;  5DAU A;  1N9W A;  1BBU A;  2I5H A;  2F0Q A;  1RCV D;  4DV7 L;  1W6K A;  5CR3 A;  1QUQ A;  2F0U A;  4DV0 L;  2Z6B A;  4RWS C;  2JYO A;  3WWV A;  1K0S A;  2EXD A;  4IUT A;  4LFA L;  2K14 A;  4A3F G;  1XNQ L;  4R4I A;  1O7Z A;  3K5M A;  1CI3 M;  1FYC A;  1TWC L;  4DAY B;  1WYD A;  4IPD A;  2CKC A;  3ZJY C;  2RSN A;  5MLC 3;  2KA7 A;  2VY3 A;  2C9O A;  1RB9 A;  1F2M A;  3S1M L;  3BZC A;  4IZ8 A;  4K8J A;  1XMO L;  2ES2 A;  1Q1B A;  1IBK Q;  1G6P A;  2K05 A;  1CZW A;  1O7Y A;  2NVT L;  4OL7 A;  2UXB Q;  5GAD c;  3KF8 A;  5CV4 A;  1YBY A;  3OWF A;  3CCR A;  1Z6H A;  3TZD A;  4KJN A;  4TVA B;  1Q7Y C;  2CKZ B;  2XN9 C;  4AHX A;  1D1I A;  1X65 A;  1FL0 A;  3BJU A;  3AB9 A;  1HNZ Q;  2NVQ B;  3DM1 A;  4A3C G;  1EU3 A;  1NSN S;  3GTQ H;  2CKA A;  4G4K A;  3M3Y B;  3T1H L;  1J6Q A;  4IN3 A;  2EIF A;  3R8B A;  1YHQ A;  2PPB C;  4B3R Q;  4OWT B;  1SNQ A;  1PLF A;  1HZB A;  1VQJ A;  1YVC A;  5C4X L;  4HJ7 A;  1IYU A;  2CWP A;  1LTS D;  3A7A B;  1QVF A;  4X3S A;  2NBF A;  1YJN A;  5JPN C;  1RDV A;  1Y14 B;  1TKW B;  1VQ8 A;  2CW0 D;  4LF6 L;  4IFD H;  2NVX H;  3LWV B;  1XX8 A;  4JAE A;  4HR7 B;  3Q24 A;  1MKH A;  4KHZ A;  1FNW A;  5MFZ A;  5FLM H;  3I4N L;  2D5D A;  1B3A A;  1Y8O B;  5CV6 A;  3CMA A;  1HZ9 A;  1PHJ A;  3PO3 B;  4DV3 Q;  2MP1 A;  2EJG C;  2IL8 A;  4L5Q A;  2AHO B;  2F3W A;  2EYH A;  1PZK D;  2Y0S B;  5DNF A;  4JI8 Q;  2JA9 A;  4A3E B;  1LUZ A;  2QEX A;  4OHJ A;  3H15 A;  2CQO A;  1OTC A;  2FIN B;  2Q2T A;  1C0A A;  1K83 L;  2N88 A;  2RA4 A;  5FK9 C;  4DK0 A;  1K9M C;  4JI7 Q;  2F3V A;  3A7L A;  2PQE A;  4B3S L;  5C44 H;  4ULL A;  1KXL A;  1HZC A;  1S5B D;  3R3O A;  3K81 C;  5C4X G;  4CHT B;  2E5L Q;  2PQA A;  4OXP A;  1Y69 U;  3NUC A;  2JA6 L;  1L1O C;  1SNC A;  3ERS X;  1MBY A;  2ALY B;  3HOZ L;  1JJC B;  4LK1 C;  4IUV A;  1IBM Q;  4BWG B;  5JEA G;  3B6Y A;  1HR0 Q;  4A93 G;  2KQ3 A;  4V19 0;  2Y0S E;  3DMU A;  4DV3 L;  1GVP A;  1SRO A;  3S14 L;  3QG1 A;  4U67 1;  3I3C A;  4DNR B;  4R4O A;  5KYL A;  1PH4 A;  2Z3Q B;  3CD6 A;  5CV7 A;  3NP8 A;  3J7Z C;  1Q86 C;  2EQS A;  2HT1 A;  4O2D A;  5DM6 3;  5EKI A;  2HR5 A;  1QIL A;  4FVM A;  1HNZ L;  4U68 A;  1LTI D;  3KF8 B;  3MXN A;  3GTM H;  3S17 H;  2VB3 X;  4G7H C;  1PVO A;  4P75 A;  4A3J G;  4X62 L;  1O80 A;  1PZX A;  3TP6 A;  1VQB A;  5C44 L;  1QWY A;  4O0A A;  4JBW A;  5IWA Q;  2RCF A;  4KD3 A;  2Z4I A;  2AUS B;  3DXJ C;  4RGN A;  1VZH A;  4XYQ A;  4AR3 A;  2Z0S A;  4A3M H;  2OQK A;  1EIH A;  3PO2 B;  2I5M X;  3IRB A;  1DOM A;  3BDO A;  1SND A;  4A3B L;  2ZXP A;  5C4H A;  3J81 c;  2QW7 A;  1IW7 D;  4KV6 A;  3LWU A;  1BE7 A;  1PDQ A;  3ERQ A;  4A93 L;  2K52 A;  1I94 L;  1PFS A;  3KLS A;  1BBX C;  2D2C C;  2PI2 E;  3TSS A;  2WAC A;  2NVT B;  2I0Q A;  3HJY B;  1SE8 A;  2RVL A;  4JAD A;  2B2W A;  1YNX A;  2ID0 A;  1B53 A;  1NR2 A;  1SJE D;  5M5Y H;  5M5Y L;  2EYO A;  3S17 L;  2Q8I B;  5KIX A;  1ROD A;  3PF4 A;  5M5Y B;  2F3I A;  2JN4 A;  1TWC B;  1CM9 A;  3PO2 L;  4A3J L;  1VQH A;  1D5Z C;  2TSS A;  1J9O A;  5DM6 1;  1DVB A;  3DUZ A;  4JYA L;  1DZ1 A;  2CHB D;  2E2I L;  1VS0 A;  2MGS A;  2MFI A;  4DR4 L;  4DGZ A;  1I6H H;  3KYU A;  1EWC A;  1B44 D;  2C35 B;  3KUP A;  4DU9 A;  4EGV A;  5C44 B;  1AZQ A;  1ESR A;  4JPB W;  3RNU A;  1I94 Q;  4DR1 L;  3K7A L;  3PGZ A;  3NWT A;  1H7V A;  2KEN A;  3EVQ A;  5FOB B;  3W1G A;  4DFA A;  5AI2 A;  2DNE A;  4HID A;  2NN6 G;  1NJI C;  1EZ6 A;  2SEB D;  1NXG A;  3H6M A;  3AMU A;  2K28 A;  3J81 i;  4KKS A;  4GZY C;  1VQL A;  3AYH B;  2A6H C;  1KTK A;  5IYC H;  3VDY A;  1FD7 D;  3HOW B;  2PPT A;  3SVM A;  2B63 L;  4JI2 L;  4IFD G;  3TS2 A;  1JWU D;  5I2X A;  3U58 A;  2JXM B;  3C1F A;  4DR7 L;  3HOW G;  2JQO A;  3S17 B;  1B9M A;  4DR7 Q;  1R9T H;  2WII B;  1TR5 A;  1F2Y A;  1E7Z A;  2HHH L;  1HPC A;  2IPK D;  3TBI B;  3FDJ A;  3S2D H;  2ZTE A;  4LWC A;  1B2T A;  1JE4 A;  5C4J L;  5M3M H;  1CT1 D;  4AYB B;  4WJ4 A;  3RMH A;  3V05 A;  1BBW A;  4Y7N B;  1K83 B;  4H44 C;  2JA5 G;  1YZ6 A;  1L1O B;  3S16 L;  2IX0 A;  4BXX G;  3K5O A;  5H1S E;  3OTO Q;  2E5L L;  1VQO A;  5LL6 X;  2MPM A;  3CHB D;  4LFC L;  1T9O A;  4DV2 L;  1JOO A;  3OYY A;  4ALP A;  4LF5 L;  4ZUJ A;  2WIN B;  5J3B A;  4B3S Q;  1CHP D;  2Z1C A;  1RIP A;  3TP5 A;  5CBA E;  4YWL A;  2K6A A;  4K0K Q;  3G71 A;  3I4L A;  4XQQ A;  3K5L A;  5FLX E;  2L0C A;  4JI1 L;  2K50 A;  2PVX A;  3HAX C;  4XXE A;  3NWS A;  3RZO L;  1G2T A;  2A19 A;  3SK6 A;  2QKI C;  3OHX C;  4ZK9 B;  5FLM G;  3CW2 C;  2RDG A;  4AI3 A;  1YNN D;  3JC6 3;  2NYD A;  4LHN A;  3A55 A;  4B3T L;  3ITP A;  5E1F A;  1JOK A;  2K5N A;  1X3Q A;  4H0L C;  2R7F A;  2Z3R B;  1B13 A;  4A3I G;  4DNI A;  1RD9 D;  2DY8 A;  2GVB A;  2KCN A;  2UU9 Q;  1VQN A;  1B4O A;  1KD1 C;  1V1Q A;  2NVQ L;  2K03 A;  1Y8N B;  3J7Z 1;  3F2C A;  1Y1V L;  1HNX L;  3ULL A;  1A15 A;  5KND A;  1EQR A;  2AQ1 B;  1LKO A;  4F88 A;  4X64 L;  1UE6 A;  1LTR D;  3CCM A;  3I91 A;  1XPR A;  2GMG A;  1GO3 E;  2BH8 A;  3MHB A;  4FF1 A;  4BY7 L;  1CAD A;  5F2D A;  3GTG H;  2FXQ A;  3MAQ A;  4A3L H;  3ICE A;  2EY4 E;  4NMZ A;  3PKI A;  3LNN A;  4RG1 A;  1KRT A;  1LO5 D;  3H0G L;  3GV3 A;  4FF4 A;  4K2K A;  4QUC A;  3PIO A;  4HSP A;  3JC6 6;  4JV5 L;  2YU9 B;  1IKM A;  4MTK A;  5KGU A;  3M4O B;  1PRT C;  3S1N L;  4A3I L;  5JVG 1;  2AUK A;  4IUP A;  2OF1 A;  1OWB A;  1S4Z A;  3H9B A;  4GNX B;  3Q8D A;  2K5H A;  2O2L D;  1N33 L;  2Q8T A;  3HKZ E;  3P8B A;  1SJH D;  2EYM A;  5J39 A;  1IHZ A;  1RL2 A;  1M90 C;  3TZU A;  2KJX A;  2Z6K A;  2UUC Q;  1WTQ A;  1U0L A;  5JAV A;  3CME A;  5K36 H;  3I4M G;  1Q81 C;  2JA8 L;  2AKW B;  3J80 c;  2A6E D;  4C3I G;  1JB3 A;  1TQO A;  4UP7 A;  4LF8 L;  4IOC A;  4HJ5 A;  2VS1 A;  2YTV A;  5G3L F;  2ZXO A;  5M5X B;  2KKD A;  2Q2I A;  2V4D A;  4JYA Q;  5JJI A;  1SYC A;  4LUV A;  1BXT A;  2GVA A;  4KJO A;  3VYU A;  1JWS D;  1WTO A;  4JVZ A;  4DNT B;  1HR0 W;  4A3K G;  4KMU C;  1PH1 A;  3HOU G;  1OO9 B;  2B2V A;  3K7U C;  1PXU A;  1ENC A;  4ZAI A;  4GOP C;  2E2H B;  4KHV A;  1VQ4 A;  3KF6 B;  4A3F B;  2AWO A;  2B29 A;  3VR4 A;  4DK6 C;  3HOU B;  1SYB A;  2XRS D;  2X69 A;  1B71 A;  4DV5 L;  1F4L A;  1YJW A;  2JK8 A;  3NTK A;  4IO9 A;  3AEV A;  1PZJ D;  5RXN A;  5ELE A;  3HOY B;  3S2D B;  3B0A B;  3TME A;  2QDB A;  1PTO C;  2A69 C;  4DV6 Q;  4BA1 I;  2XTI A;  1A0I A;  3I8Z A;  4IUN A;  3A5Z B;  2NUC A;  3H3V M;  3HOY G;  3AQQ A;  3FEW X;  1VF7 A;  1L0X B;  2XRQ D;  2YTX A;  1GUN A;  3CCU A;  4TRD A;  4AR6 A;  4C3I B;  3A0J A;  3KYH C;  2PW5 A;  5KNC A;  3PUZ A;  2F0N A;  1YNJ D;  3F2B A;  2BDN A;  3G7L A;  2A73 B;  2HHH Q;  1FGU A;  3K57 A;  4A3L L;  5GQO A;  1GUT A;  1Q3L A;  4ODG A;  1EQT A;  3VYS A;  1E1T A;  3J81 E;  1AN8 A;  1RYQ A;  1R0I A;  3RUZ A;  2K32 A;  1G8Z D;  1STH A;  5FJ8 L;  3S1Q H;  2V0F A;  3LWQ B;  4Y7N H;  4H13 C;  1XPO A;  3I4N H;  3D0F A;  4MZ9 A;  4YCU A;  4AQY Q;  1T5X D;  3A8K E;  1I50 H;  4JI3 Q;  1VQC A;  2B8F A;  1SSO A;  5IYD G;  1EQQ A;  2JA8 B;  4KKT A;  3HOY L;  5IP7 H;  4WOR A;  3QOJ A;  4KY6 A;  3JC6 2;  4JOI A;  1VDZ A;  3LWR B;  1KAW A;  2NN6 H;  2O5I C;  3KYV A;  5T1I A;  1Q82 C;  1PH6 A;  3MVV A;  3MXG A;  4GS3 A;  1BFY A;  2CH4 A;  2RFK B;  3P1H A;  4RFB A;  4XT3 B;  2F03 A;  4A3M L;  5KNB A;  2KN9 A;  4B9W A;  3CCQ A;  5EPK A;  2VUM H;  3JR7 A;  3NBH B;  1LT3 D;  2AQC A;  2GA4 B;  3MQK B;  2O4X A;  4O42 A;  4R9W A;  3IFD A;  1QCV A;  3UDX A;  2XJP A;  2PNH A;  2APO B;  3I4M B;  1FNU A;  1AE3 A;  4ILW A;  4Y52 L;  4Y52 H;  3RLO A;  4LF9 L;  3PIP 3;  5J1Z A;  2F0E A;  2WFW A;  4PQX A;  1S30 A;  5KEE A;  4PZ6 A;  1EYA A;  4DAP A;  1H9J A;  4UHV A;  4K8I A;  5GAE c;  1EWI A;  2R61 A;  1STY A;  2J0T D;  1GXD C;  4DR6 Q;  1F77 A;  2EPB A;  4MTN A;  1G91 A;  4LF6 Q;  2PYA A;  5J22 A;  4ZLT F;  2CH4 W;  4ZKC B;  1EIF A;  3S1N B;  4PMB A;  1QNU A;  4GN5 A;  5T1G A;  1PV4 A;  4NXM Q;  4BA2 I;  3VR3 A;  5M3M G;  3HZX A;  1TWH H;  2WB1 P;  3TS0 A;  2Z6K C;  1HJP A;  4KY5 A;  1GD7 A;  4KHP L;  1YNN C;  1TWG H;  3I72 A;  1VZI A;  3HOV H;  4IUU A;  4K14 A;  3MEF A;  4XXB B;  2HIX A;  2E2J H;  2Y0S G;  5IWA L;  3NQT A;  3BYT B;  1XPU A;  4OO1 H;  4A3E G;  2K5Q A;  2OEO A;  4O1N A;  4HSV A;  1P16 A;  2B2T C;  5HGT A;  3RN5 A;  4NPS A;  4IAL A;  2VUM G;  2NZH A;  1MJC A;  2PNR C;  1A3T A;  3QQC E;  1ASZ A;  1M8A A;  1IU6 A;  2QF7 A;  1J5E L;  2DN8 A;  1QYB A;  1IU5 A;  5HGQ A;  3RZO B;  2N55 A;  3D6C A;  1OWC A;  4QIW E;  4YHH L;  4DR5 Q;  1NTG A;  4XDX A;  1BF4 A;  2OCE A;  3KBG A;  5AFW A;  1C8C A;  1BO0 A;  5E4X A;  4LF9 Q;  2ZT9 C;  4RKL A;  1UNS A;  4B08 A;  1C4Q A;  1XNQ Q;  3GTL H;  2IWH A;  3VR6 A;  2E2J B;  2Q2H A;  4IPH A;  4IFD I;  3RLF A;  8RXN A;  2A8V A;  4DF7 A;  1CQV A;  4GNX C;  4LHL A;  3QIA A;  1TT2 A;  1HQM C;  4AIM A;  3S1M H;  2A74 C;  1WTR A;  3GO5 A;  3WWL A;  1KLG D;  3FKI H;  3M4O L;  5D3I B;  1M1K C;  3PO2 H;  1KRS A;  2IX3 A;  5LMN Q;  5IP9 H;  4DR3 L;  3OWE B;  3I4M L;  3M3Y H;  3L7Z C;  3SHL A;  2JA8 G;  4C3I H;  1XMQ L;  4C3I L;  1RYT A;  3RYG A;  1D8L A;  1RHP A;  4B8C D;  1V1O A;  2HD3 A;  4JI8 L;  1IXR A;  3J7A 5;  5AJ3 Q;  4OEL B;  5C5L A;  4PZ7 A;  2WV6 D;  2OTL A;  2A6H D;  4RCO A;  3SS2 A;  2YYZ A;  1TWF H;  3GTL L;  3MWY W;  5M5W L;  3TEH B;  3K7A H;  4AHW A;  3P2A A;  3T1Y L;  2F0F A;  1Y1V B;  1X6O A;  3TN2 A;  2VQF L;  5C3E L;  5I4D A;  1PFM A;  1VQM A;  2VQE L;  2NVX L;  1PFN A;  2ZIX A;  1IL2 A;  2CR8 A;  3ZG6 A;  4TVM A;  2ERJ A;  1PFU A;  1G6Z A;  1KIX A;  2R92 G;  4XIG S;  1PRT F;  2V3B B;  4OX9 L;  3KFU A;  1PRT D;  1GHJ A;  1EIY B;  1VQA A;  5LMU L;  1GUO A;  2F0O A;  3MFY A;  5CBE E;  3H09 A;  4JI6 L;  1WFQ A;  5EKL A;  4X66 Q;  4IJH A;  1I50 B;  2N8N A;  4NDX A;  1QJO A;  1NY4 A;  2KEE A;  1R4P B;  1CHQ D;  1NXE A;  1Y1W L;  1E8J A;  2X6G A;  5EPL A;  1UE7 A;  3FKI L;  3D8G A;  4ZCK A;  4OGQ C;  3S2D L;  4K5X A;  1Z92 B;  1UUP A;  1RF2 D;  3I7F A;  3S2H H;  3M3Y L;  1XNR L;  3TRE A;  3I4M H;  1K8A C;  4RXN A;  1RDP D;  1OXU A;  5JJK A;  3L0O A;  2L5T A;  5FJ8 G;  2K1B A;  1LT6 D;  2PVE A;  3M4Y A;  5HUR A;  2DJG C;  2E2H H;  3I4N G;  2VUM B;  1D6E C;  2E2I B;  5ISR A;  1IW7 C;  2VXW A;  4UPA A;  5GAG c;  1XYI A;  1G51 A;  3J80 i;  3HKZ P;  2JI2 A;  5HY6 A;  5JJZ A;  2XJS A;  4KN4 C;  1SMU A;  4TPU A;  1VQI A;  2MO0 A;  4QB4 A;  1WOC A;  2NTT A;  4A76 A;  4QY7 A;  2R92 B;  4B9X A;  1J8I A;  1U4M A;  1KLU D;  4L6T B;  3A5U A;  1NR4 A;  3OIQ A;  1BDO A;  2XJU A;  5M3F G;  4A3D H;  4GOP B;  3KF6 A;  1Y1W G;  1ZXT A;  2UXC Q;  5M3F H;  1KDC A;  1Q1E A;  1TWA H;  3I2Z A;  1OXT A;  4N8X 1;  3OOC A;  5FO9 B;  5M3F B;  3PIP 1;  3IAY A;  4AH6 A;  5L37 A;  3RZD B;  2B2V C;  3DM3 A;  2RDF A;  3QJY A;  1EEI D;  1G29 1;  1ESF A;  3C1E A;  4I65 A;  2AMC B;  5FO8 B;  1U5K A;  1K3R A;  4NXN L;  4RGT A;  2XJR A;  1QVC A;  4A3K B;  5MFP A;  1ZEQ X;  4UP8 A;  4EQO A;  5IGF A;  2R3Z A;  3HFZ B;  3IKJ A;  1V1P A;  3V96 A;  3RD4 A;  3CAM A;  1B2O A;  4DK3 C;  3A8I E;  2KEC A;  2Z4H A;  1N33 Q;  2WKD A;  1D1K A;  1GUG A;  1D5X C;  2K4K A;  4LF7 Q;  2NVY L;  4A3C H;  2NVY H;  2M9V A;  2RF4 A;  4FO2 A;  4CDD C;  3ERO A;  5IYC G;  5BN3 A;  3EBE A;  5M3F L;  4C3H L;  5M3M L;  1C48 A;  2M4V A;  1LM0 A;  3KDF A;  1FNV A;  1WCM H;  1CSQ A;  3FKI B;  4A3B G;  1DXM A;  2OTJ A;  4MIU A;  3UI2 A;  1Y1W B;  1A2U A;  1IBM L;  1W3S A;  3V2T A;  4HAE A;  5C6A A;  4A3I H;  4A3F H;  3TRZ A;  1KQS A;  4DR6 L;  4ME3 A;  4HCE A;  3P7J A;  1L0Y B;  4A3I B;  1KHI A;  2B8G A;  1NAP A;  1N36 L;  3E6Z X;  2R92 H;  1OXS C;  3PO3 L;  1R4Q B;  3BZK A;  3KDF B;  1I4Q A;  4AHY A;  2OXP A;  2HCI A;  2K01 A;  1IRO A;  2F0P A;  3NEN A;  2EJM A;  4HIM A;  3OPO A;  3ND8 A;  5JEA J;  4GKJ L;  2F0H A;  4X6A L;  2CQA A;  4DUZ L;  2KBN A;  1ODH A;  1ILP A;  2E8G A;  3LWE A;  1QZG A;  5M5W B;  2EYP A;  3S1Q L;  5FJ8 H;  5IYC L;  2QIL A;  2AQ2 B;  1YHA A;  3H0G H;  3MEH A;  3UDI A;  1ZYR C;  4DR3 Q;  1I3Q H;  3SEB A;  5IE8 A;  3PSI A;  3F8T A;  3IL8 A;  4K6D A;  2FMM A;  2ZTC A;  2F0W A;  4C3J G;  3JAM i;  1SRU A;  5CV9 A;  1BNZ A;  1Y1V H;  3F1Z A;  4QF4 A;  2Q2U A;  1LTB D;  2D0P A;  4R4Q A;  1VQE A;  1YK5 A;  1WTP A;  3B08 B;  2J7Z A;  1YUZ A;  3PO3 G;  4PMC A;  1HCZ A;  1FHM A;  1CFM A;  1ET6 A;  1EY7 A;  1I5F A;  1C9O A;  1SMM A;  3KLS X;  1B2J A;  2J4X A;  1AW7 A;  1DM0 B;  4C1N K;  2F4I A;  3KYY A;  1YEZ A;  2L15 A;  4ABN A;  2R7Z L;  3M7G A;  2K5V A;  2F0V A;  4WRD A;  3OMC A;  1H9R A;  2HIV A;  4PNY A;  1X9N A;  3BG3 A;  3PIP A;  5FLX c;  2A1A A;  5C3E G;  3GTL B;  4L5T A;  3HOW L;  1DX8 A;  3FPU B;  4BBR H;  1F2Z A;  3GTG L;  3K0Y A;  4P73 A;  3D6W A;  4UP9 A;  1F9R A;  1WJV A;  1TU2 B;  2BCO A;  1IYV A;  3T51 B;  2MJ8 A;  3A8J E;  3S15 L;  1TS3 A;  4BXX L;  1IZ6 A;  4R1J A;  3EIV A;  2P5Z X;  1I4H A;  3JAM c;  5JVG 3;  2EJF C;  1YK4 A;  2C6A A;  1SE2 A;  4DAV A;  1MJE A;  2F0D A;  2O5J D;  4RAU C;  3OW2 A;  3T53 B;  4F87 A;  5IP9 G;  3QO2 A;  5K2M E;  5GRO A;  4AYB E;  4A3G G;  1CKO A;  2D9U A;  1D2B A;  3FKI G;  1SR3 A;  5A35 A;  4H7B A;  1KAA A;  3T4A C;  1EYD A;  3GTQ L;  2FJ2 A;  4XTC S;  4HN7 A;  3HOZ G;  1JE5 A;  2RHS B;  1Z9F A;  2WAQ G;  3NE5 B;  1LLR D;  1K8G A;  5IY0 A;  1VQ5 A;  3MA2 B;  1EQV A;  3HOW H;  1PFV A;  1BQ9 A;  1SYD A;  2AYJ A;  3BDL A;  4PG3 A;  1DOK A;  1I6V C;  2DGY A;  3HKZ B;  1UWV A;  4JBM A;  1K8O A;  2RKS A;  4NKL A;  5MGN A;  3K7A B;  1LAC A;  2OT2 A;  3F2D A;  3QB3 A;  1F2L A;  4A4I A;  3CXC A;  3M7N A;  2EYF A;  2K7V A;  5ELB A;  3T56 B;  3X3N A;  4DUY L;  4G7Z C;  4WFN 1;  1S3O A;  2IHE A;  4BS9 A;  1H9M A;  3RLN A;  1QVG A;  4LF4 L;  3E0J A;  2JEA I;  2EY1 A;  4QL5 A;  2UUB L;  3H3V C;  1CTM A;  2DUD A;  1IBL Q;  2D62 A;  1CA5 A;  1P8L A;  5DM7 3;  3DEO A;  3J7A F;  5H1S c;  3GTK B;  1ENF A;  2ZM6 L;  2RBM A;  2KCT A;  1YI2 A;  3S15 H;  3SK8 A;  1WD0 A;  2IT1 A;  1L2F A;  3BVM A;  5DM7 1;  4ZQ3 A;  3S15 B;  2UXD Q;  3D4W A;  2E2D C;  4MN3 A;  5BR8 L;  1HA6 A;  3D4D A;  4K5V A;  1NNQ A;  4UDU C;  4J15 A;  2K2D A;  1SYE A;  1VMC A;  3HKZ G;  1GUS A;  3NK9 A;  4EQ5 A;  1HNW Q;  2B2W C;  4BBR B;  1VQ9 A;  1M4V A;  5I6W A;  3QWN A;  2RCN A;  2XJQ A;  4A3G H;  1SNO A;  2NWG A;  4NB3 A;  2M4Y A;  3HGB A;  4DV4 L;  3AFP A;  5C4X H;  3H94 A;  1QG7 A;  1HNX Q;  1X55 A;  4DKA C;  1S40 A;  3NEM A;  5C3E H;  3VPB E;  5EBC A;  1HXY D;  4C3H G;  2PQA B;  1EEF D;  2JJQ A;  5ELC A;  1B8A A;  4A3M B;  3J7Y 1;  4YY3 Q;  1LTT D;  3W1B A;  4AI2 A;  1AEX A;  2VZA A;  1TWA B;  3HRZ C;  5IGB A;  2K5D A;  1SLJ A;  3D31 A;  1ASY A;  2M6O A;  3Q6S A;  1BCP F;  4HMI A;  3C46 A;  1UEB A;  1TWC H;  1SBB B;  5MF6 A;  3K0X A;  1CK1 A;  2XWJ B;  2AWN A;  5IGG A;  3EQL C;  1WD1 A;  2SDF A;  2EY6 A;  1Q46 A;  2F0J A;  2PCF B;  1PH9 A;  2BDO A;  2RHQ B;  4WJ3 M;  2F0L A;  3P75 A;  5CYU A;  1F9Q A;  1WTW A;  1TVX A;  3S1Q B;  4GLX A;  1TXY A;  3HOU L;  3I4N B;  2WAQ B;  4LFC Q;  1HFG A;  2WB1 G;  3GP7 A;  4YIJ A;  1VQK A;  3OW7 A;  4CDF C;  2ASB A;  2LKV A;  2XSC A;  1WTH A;  2O5J C;  1AP0 A;  1EY4 A;  2F0I A;  3STB D;  3HOZ H;  2NVY B;  1JOQ A;  1DJR D;  3N52 A; 
#chains in the Genus database with same CATH homology
 1SRO A;  2QA4 A;  2OCE A;  1QZH A;  2PSM C;  4U67 1;  1LKM A;  4R4O A;  4RMF A;  4LF9 Q;  1PH4 A;  2Z3Q B;  1Q8K A;  3CD6 A;  1RWD A;  4YWM A;  4QGU A;  3J81 j;  3J7Z C;  1Q86 C;  4P72 A;  2EQS A;  5DLQ E;  4B3M Q;  1XNQ Q;  2Q2H A;  4IPH A;  2HT1 A;  3GTL H;  1L0W A;  4A3L G;  1NMF A;  3GD7 A;  4IFD I;  4O2D A;  3RLF A;  5AI3 A;  2N49 A;  4GNX A;  2HR5 A;  8RXN A;  2E2I H;  2JA5 H;  1HNZ L;  2A8V A;  1PA6 A;  4GNX C;  5C0X I;  3KF8 B;  4LHL A;  2R7D A;  1FVI A;  1XTD A;  3GTM H;  2OQ0 A;  3S17 H;  4AIM A;  4IJL A;  1J5E Q;  3S1M H;  3GO5 A;  1PVO A;  4P75 A;  3CP0 A;  4A3J G;  1Y1W H;  4AI1 A;  4X62 L;  3HOY H;  3PF5 A;  3WWL A;  2QGQ A;  4X65 L;  3FKI H;  3M4Q A;  2IX1 A;  1JJG A;  1M1K C;  3PO2 H;  1KRS A;  1N8R C;  1VQB A;  3CCE A;  7RXN A;  4JC0 A;  5LMN Q;  4O0A A;  5IP9 H;  4DR3 L;  3U4Z A;  4JBW A;  3LPE B;  1NMG A;  5IWA Q;  3M3Y H;  3L7Z C;  2JA8 G;  4C3I H;  1XMQ L;  1K73 C;  2R7Z G;  2M6P A;  1VZH A;  4AR3 A;  2Z0S A;  1RYT A;  3PWF A;  3RYG A;  1D8L A;  3OTO L;  2OQK A;  4A3M H;  3H3V H;  2NZO A;  3UDG A;  1FJG L;  2V1C C;  3S16 H;  4B8C D;  2I5M X;  3IRB A;  4A3B H;  3CF5 A;  1WCM G;  4JI8 L;  3W5O A;  2UUB Q;  4BY1 G;  1IXR A;  1Q12 A;  2KCM A;  3J7A 5;  5E7N A;  4GKJ Q;  1S24 A;  5AJ3 Q;  4BBS G;  3PCO B;  4PZ7 A;  3J81 c;  5EAY A;  4DV6 L;  4DR2 L;  1IW7 D;  2A6H D;  2OTL A;  1BE7 A;  2JE6 I;  3PUW A;  4GOP A;  2K52 A;  4JAF A;  3SS2 A;  2YU9 H;  1I94 L;  3LNL A;  1PFS A;  4NXM L;  1K83 H;  2ZJQ A;  2PI2 E;  2B63 H;  2YYZ A;  1TWF H;  3MSU A;  4K0K L;  2I0Q A;  1SE8 A;  2UUA Q;  4JAD A;  3TEH B;  1CAA A;  1YNX A;  3K7A H;  2ID0 A;  5M5W H;  1JMC A;  4AHW A;  3P2A A;  3KLW A;  3T1Y L;  1X6O A;  5M5Y H;  2VQF L;  1C09 A;  3A44 A;  1VQM A;  2VQE L;  2N78 A;  3PF4 A;  2ZIX A;  4XGH A;  2F3I A;  5IT9 c;  2YTY A;  1IL2 A;  2F52 A;  2KHI A;  3M4O H;  2CR8 A;  1KL9 A;  2XJV A;  3ZG6 A;  5JVH 1;  4TVM A;  1Y1V G;  4JI3 L;  1VQH A;  2JI1 A;  2ERJ A;  4E6Y A;  4PZ8 A;  2RDV A;  4C3H H;  3HOX H;  4AQY Q;  4C2M H;  1KIX A;  2R92 G;  3S14 H;  3PUY A;  4XIG S;  5DM6 1;  4C3J H;  2A68 D;  1E3P A;  2V3B B;  4OX9 L;  3KFU A;  1DVB A;  2UXC L;  4KLK A;  1FHH A;  1EIY B;  1VQA A;  4LFA Q;  4OWX B;  5LMU L;  4JYA L;  2R93 H;  4JI6 L;  1WFQ A;  4X66 Q;  4UY8 C;  4TQU S;  1VS0 A;  1N34 L;  4IJH A;  2ATW A;  2MFI A;  1CSP A;  4FDB A;  2N8N A;  4DR4 L;  1NY4 A;  4JI0 Q;  1VQ7 A;  1CKN B;  4A3D G;  4HJ8 A;  1I6H H;  1RDG A;  3CPW A;  5BR8 Q;  1NXE A;  1VQP A;  3KYU A;  1E8J A;  4P74 A;  2H5X A;  2C35 B;  1C7Y A;  1UE7 A;  4L5R C;  1VQF A;  1ZRP A;  3HOV G;  4LUZ A;  3H3V I;  1BRF A;  2BH2 A;  1Z92 B;  3BU2 A;  2VW9 A;  3I7F A;  3K80 C;  3RNU A;  3I4O A;  4DV2 Q;  1SMW A;  3PGZ A;  4DR1 L;  1H7V A;  3TRE A;  3KOJ A;  2KEN A;  3M9B A;  1K8A C;  1XMO Q;  4OWW B;  3W1G A;  4RXN A;  3CCV A;  5AI2 A;  1OXU A;  4HID A;  5JJK A;  3L0O A;  4GLV B;  2NN6 G;  5AJ3 L;  2ZTD A;  3UE1 A;  5FJ8 G;  3I55 A;  3KJP A;  3K35 A;  4X66 L;  1NJI C;  2PVE A;  2JA6 H;  2LXK A;  2ERS A;  5EIN C;  1NXG A;  4GN3 B;  2E2H H;  3I4N G;  5LMU Q;  3J81 i;  1VQD A;  1FJG Q;  1VQL A;  1H95 A;  1VCI A;  3AYH B;  4UPA A;  1JJ2 A;  5GAG c;  1G51 A;  2BA0 A;  3J80 i;  1PYB A;  5IYC H;  2JI2 A;  5HY6 A;  4AQY L;  4NXN Q;  2XJS A;  1SMU A;  3VDY A;  4TPU A;  3SGI A;  2PPT A;  1MIU A;  1VQI A;  2MO0 A;  1WOC A;  3EN2 A;  4JI2 L;  4IFD G;  3TS2 A;  2B5I D;  4A76 A;  4QY7 A;  1PH3 A;  3U58 A;  4DR7 L;  3E9H A;  2IY5 B;  3HOW G;  2JQO A;  3PUX A;  5ELN A;  3A5U A;  1KC8 C;  4DR7 Q;  1R9T H;  1W2B A;  1A63 A;  4HIO A;  4JI6 Q;  2XJU A;  1E7Z A;  2KHJ A;  5M3F G;  2HHH L;  4A3D H;  4GOP B;  3KF6 A;  4GS7 D;  4GKK L;  4A3J H;  2MO1 A;  1T9P A;  2ZTE A;  1Y1W G;  3KYX A;  4LWC A;  2LXJ A;  3S2D H;  4JBJ A;  5M3F H;  2UXC Q;  3RR5 A;  5M3M H;  4L5S A;  1Q1E A;  1TWA H;  4UY8 1;  3RN2 A;  1PH8 A;  4WJ4 A;  2BA1 A;  4ZN3 B;  3I2Z A;  1BBW A;  1OXT A;  1T9Q A;  2ZJR A;  3QVD A;  2JA5 G;  3PIP 1;  1YZ6 A;  1L1O B;  3CCS A;  4OO1 I;  2IX0 A;  1VZG A;  3E0E A;  3G48 A;  3GTO H;  2PI2 A;  4AH6 A;  1N36 Q;  4BXX G;  1JT8 A;  2JI3 A;  1X3F A;  3DM3 A;  4IPC A;  1G29 1;  3CCJ A;  3PV0 A;  5H1S E;  2AMC B;  3OTO Q;  1U5K A;  1VQO A;  2E5L L;  1K3R A;  4LW1 A;  4LFC L;  4NXN L;  1T9O A;  4DV2 L;  4DR1 Q;  4A93 H;  3GTJ H;  2XJR A;  1QVC A;  3OYY A;  4ALP A;  4LF5 L;  5J3B A;  5LMN L;  5MFP A;  3STB C;  3CQZ H;  4UP8 A;  4B3S Q;  1E24 A;  1RIP A;  4DV5 Q;  3CC7 A;  4YWL A;  4K0K Q;  4JI5 Q;  3G71 A;  5IYD H;  1LTL A;  3HFZ B;  4GLA C;  3CAM A;  1B2O A;  4V19 6;  1CUK A;  4JI1 L;  4DK3 C;  4JI0 L;  1NBW A;  1V43 A;  4DUZ Q;  2K50 A;  1N33 Q;  2PVX A;  3PUV A;  1AH9 A;  2K4K A;  4LF7 Q;  3IU3 I;  1UE1 A;  4A3C H;  2A19 A;  2NVY H;  4LF7 L;  2RF4 A;  3RZO H;  3WWN B;  5FLM G;  1GM5 A;  1VCX A;  4HIK A;  3CW2 C;  3E9I A;  1YJ9 A;  5IYC G;  4AI3 A;  4IOA A;  1A62 A;  3EBE A;  4OX9 Q;  3JC6 3;  2NYD A;  5C4J H;  4LHN A;  4B3T L;  3UE0 A;  1LM0 A;  2M4V A;  4POG A;  2K5N A;  3KDF A;  4JG2 A;  4BXX H;  4AR4 A;  1CSQ A;  2Z3R B;  1WCM H;  2K75 A;  1B13 A;  2R7F A;  4GN4 B;  4YCW A;  4X64 Q;  4A3B G;  4YY3 L;  2OTJ A;  4A3I G;  1HR0 L;  1R0J A;  1E22 A;  2WB1 E;  2GVB A;  4DNI A;  1IBM L;  1CKM A;  1W3S A;  4JI4 L;  4LFB L;  2UU9 Q;  1VQN A;  1WI5 A;  1KD1 C;  3UDF A;  1V1Q A;  4AYB G;  1CKN A;  4A3I H;  4A3F H;  2JA8 H;  3TRZ A;  5JJL A;  1KQS A;  1O7I A;  2VQE Q;  5GAE C;  4DR6 L;  2R93 G;  4ME3 A;  3I4M H;  5LMN W;  3J7Z 1;  3F2C A;  1NE3 A;  3PO2 G;  1KHI A;  4JAG A;  2F4V Q;  1EOV A;  1DGS A;  1N36 L;  1HNX L;  2NN6 I;  3ULL A;  4HJ9 A;  4LF5 Q;  2R92 H;  1EQR A;  1LKO A;  1OXS C;  4YCV A;  4X64 L;  3BZK A;  1UE6 A;  2JA7 H;  1YUX A;  2BE5 D;  3KDF B;  3CCM A;  1XPR A;  4AHY A;  2GMG A;  1GO3 E;  2BH8 A;  1IRO A;  3T1H Q;  2CWA A;  4YWK A;  4GKK Q;  1CAD A;  3NEN A;  4BY7 H;  3GTG H;  2FXQ A;  4HIM A;  5JEA J;  1R0G A;  4A3L H;  4GKJ L;  5ELO A;  4BBR G;  4LNQ A;  4G6B A;  1BKB A;  3ICE A;  2LSS A;  2GN5 A;  4DUZ L;  2KBN A;  3PKI A;  1ODH A;  1PH5 A;  1PH7 A;  1K0R A;  2E8G A;  4JI1 Q;  4RG1 A;  3PKJ A;  1KRT A;  1QZG A;  5GAD C;  3DLL A;  2H12 A;  2HQL A;  1XMQ Q;  2UU9 L;  5FJ8 H;  2JA6 G;  4JI5 L;  2UXD L;  3H0G H;  4JI2 Q;  1YHA A;  1SN8 A;  1VQG A;  3UDI A;  2R6G A;  3PIO A;  4DR3 Q;  3JC6 6;  4A75 A;  3NFP I;  3RZ6 A;  1YV1 A;  1I3Q H;  2A69 D;  5IE8 A;  3PSI A;  1YIT A;  4JV5 L;  3PZA A;  2LCQ A;  3F8T A;  3FHW A;  2C6B A;  2ZTC A;  3ER0 A;  1R0H A;  1T9H A;  5JVG 1;  1L1O A;  3S1N H;  3JAM i;  1E1O A;  2VNU D;  1OWB A;  3RZT A;  1SRU A;  5K36 G;  4POF A;  4A3M G;  1OXV A;  1S2Z A;  1Y1V H;  3F1Z A;  3LGJ A;  2JA7 G;  2MS3 A;  4GNX B;  3Q8D A;  2K5H A;  2Q2U A;  1EUJ A;  2D0P A;  4R4Q A;  1N33 L;  3PO3 H;  1S72 A;  1SFO H;  1VQE A;  3HKZ E;  3P8B A;  1EYG A;  1YK5 A;  1V9P A;  2WP8 J;  3B08 B;  1YUZ A;  3PO3 G;  3M85 A;  1FHM A;  1RL2 A;  5C0X G;  1M90 C;  4JBK A;  4BY1 H;  1N32 L;  1I5F A;  1XJV A;  3K8A A;  1C9O A;  2Z6K A;  2UUC Q;  1SMM A;  4JOI C;  2J9U B;  1U0L A;  3CME A;  5C44 G;  2D0O A;  1B2J A;  3CPF A;  3GTK H;  3I4M G;  1Q81 C;  3J80 c;  2AKW B;  3KYY A;  1YEZ A;  2IHF A;  2L15 A;  1VQ6 A;  2A6E D;  2ZJP A;  2K5V A;  4UP7 A;  4PMW A;  1AE2 A;  4LF8 L;  2NVQ H;  4IOC A;  4HJ5 A;  2VS1 A;  2DSX A;  2YTV A;  2HIV A;  3NEL A;  4JI4 Q;  4LFB Q;  5C0X J;  1X9N A;  2KKD A;  3HOZ G;  2Q2I A;  2PMZ E;  3PIO 1;  4JYA Q;  5JJI A;  3PIP A;  4LUV A;  5FLX c;  2A1A A;  4DV4 Q;  2GVA A;  5C3E G;  1IBK L;  4B3R L;  4L5T A;  4B3T Q;  1DX8 A;  5M5X H;  1HR0 W;  4A3K G;  4BBR H;  1PH1 A;  4P73 A;  4H02 A;  2JEB I;  4UP9 A;  1YIJ A;  1WJV A;  3HOU G;  5GAH c;  3K7U C;  3I56 A;  1UE5 A;  4GOP C;  1X54 A;  1VQ4 A;  3KF6 B;  4P71 A;  2AWO A;  3HOX G;  4AR5 A;  2WAQ E;  2B29 A;  4DUY Q;  4DK6 C;  1QUQ B;  3KJO A;  1IZ6 A;  4R1J A;  3JAM c;  4AI0 A;  1B71 A;  3EIV A;  4DV5 L;  1YJW A;  1HH2 P;  2UUA L;  3CC2 A;  2JK8 A;  1YK4 A;  2C6A A;  4LUO A;  4EX5 A;  4IO9 A;  1EFW A;  1MJE A;  3AEV A;  4A93 G;  5RXN A;  5GAH C;  4MNO A;  3B0A B;  2O5J D;  3OW2 A;  5IP9 G;  4AHZ A;  3ULP A;  5K2M E;  4DV6 Q;  5GRO A;  1BVS A;  2XTI A;  4AYB E;  1A0I A;  1CKO A;  4BA1 I;  4DV1 Q;  4A3G G;  3FKI G;  2N3S A;  1IBL L;  2I5L X;  1SR3 A;  3GDE A;  3A5Z B;  1PYS B;  3HOY G;  3L2P A;  3AQQ A;  2V0E A;  2YTX A;  4XTC S;  4LF4 Q;  1JE5 A;  2RHS B;  1Z9F A;  2L0Z A;  2WAQ G;  3CCU A;  1K8G A;  4AR6 A;  4ZN1 B;  5IY0 A;  1VQ5 A;  3A0J A;  3KYH C;  1A8V A;  1XNR Q;  3HOW H;  2NVT H;  3PUZ A;  1BQ9 A;  3HOU H;  2AYJ A;  3F2B A;  4PG3 A;  2HHH Q;  1FGU A;  1HNW L;  5GQO A;  4A3E H;  2DGY A;  4DV0 Q;  4OO1 G;  1UWV A;  4X6A H;  4JBM A;  4DV7 Q;  5AN9 H;  1E1T A;  1N9W A;  1BBU A;  2I5H A;  1YHB A;  1IRN A;  3MXN B;  4DV7 L;  1RYQ A;  1R0I A;  4OON A;  1N34 Q;  1QUQ A;  2CCZ A;  5MGN A;  5IP7 G;  2JEA I;  4DV0 L;  3GTP H;  1Z47 A;  3WWV A;  3S1Q H;  3F2D A;  1N32 Q;  2EXD A;  2V0F A;  3I4N H;  4Y7N H;  1XPO A;  4LFA L;  2K14 A;  4A4I A;  3CXC A;  4B3M L;  3M7N A;  2UXB L;  4A3F G;  1XNQ L;  4R4I A;  4BY7 G;  3D0F A;  4MZ9 A;  4YCU A;  1LYL A;  4DUY L;  1R0F A;  4WFN 1;  1S3O A;  1SMX A;  2IHE A;  3FP9 A;  3S1R H;  3RLN A;  4DAY B;  1WYD A;  4QQB X;  1X3E A;  4R4T A;  1QVG A;  4LF4 L;  2QL0 A;  2CKC A;  1I50 H;  4IPD A;  2YV5 A;  1VQC A;  3S24 A;  5MLC 3;  3ZJY C;  4JI3 Q;  4QL5 A;  2UUB L;  2VY3 A;  5EIO C;  1RB9 A;  1D7Q A;  2DUD A;  1IBL Q;  2D62 A;  5IYD G;  2OWO A;  2XGT A;  3BZC A;  4DV1 L;  1EQQ A;  1P8L A;  5IP7 H;  3H0G G;  2VQF Q;  1PH2 A;  5H1S c;  1XMO L;  2ES2 A;  3T1Y Q;  2ZM6 L;  1Q1B A;  3JC6 2;  4JOI A;  1WJJ A;  4QJF A;  2KCT A;  3HKS A;  5GAG C;  1YI2 A;  1IBK Q;  3S15 H;  1G6P A;  1KAW A;  2MQH A;  2IT1 A;  1L2F A;  4DAM A;  1XNR L;  3KYV A;  1B70 B;  5DM7 1;  5GAD c;  3A74 A;  1Q82 C;  1PH6 A;  4JI7 L;  4IFD J;  2CFM A;  2UXB Q;  1JYB A;  3KYW A;  1BFY A;  4GS3 A;  1X56 A;  4X65 Q;  2UXD Q;  1YBY A;  5BR8 L;  4LF8 Q;  3CCR A;  2KN9 A;  3CCQ A;  4KI0 A;  4TVA B;  1Q7Y C;  2VUM H;  1NNQ A;  1HZA A;  3NBH B;  2CKZ B;  4DR4 Q;  4J15 A;  4AHX A;  2K2D A;  1X65 A;  1FL0 A;  3BJU A;  1HNZ Q;  3HKZ G;  4EQ5 A;  1HNW Q;  1QCV A;  3UDX A;  1LKP A;  2XJP A;  4A3C G;  2PNH A;  1VQ9 A;  3GTQ H;  2CKA A;  3M4P A;  3T1H L;  4Y52 H;  1AE3 A;  1J6Q A;  2B3G A;  2XJQ A;  2RCN A;  3RLO A;  2EIF A;  1YHQ A;  4LF9 L;  4A3G H;  4NB3 A;  2M4Y A;  4OWT B;  4B3R Q;  2WFW A;  1S30 A;  4DV4 L;  1HZB A;  2XJT A;  1VQJ A;  1YVC A;  3AFP A;  4PZ6 A;  5C4X H;  4HJ7 A;  4YHH Q;  2CWP A;  4DR5 L;  1JB7 A;  1HNX Q;  1X55 A;  4DKA C;  1S40 A;  2F4V L;  5GAE c;  4APV A;  1EWI A;  2MNA A;  1QVF A;  3NEM A;  5C3E H;  1YJN A;  3VPB E;  1RDV A;  1Y14 B;  1VQ8 A;  4LF6 L;  4DR6 Q;  4MTN A;  1BQ8 A;  2NVX H;  2PQA B;  4LF6 Q;  2PYA A;  1I94 Q;  3RZD H;  4JAE A;  1X3G A;  2JJQ A;  3AFQ A;  1MKH A;  4KHZ A;  1B8A A;  1GKH A;  1EIF A;  5IYB H;  5MFZ A;  2UUC L;  4JV5 Q;  3J7Y 1;  1OXX K;  4YY3 Q;  4GN5 A;  3W1B A;  4AI2 A;  5FLM H;  1PV4 A;  2VZA A;  1B7Y B;  1SLJ A;  4NXM Q;  3D31 A;  4A3K H;  2M6O A;  3G4S A;  1ASY A;  4BA2 I;  3CMA A;  1HZ9 A;  1UEB A;  3S2H H;  1PHJ A;  5M3M G;  1TWC H;  3U50 C;  4DR2 Q;  4KHP Q;  5MF6 A;  3K0X A;  4DV3 Q;  1TWH H;  2B63 G;  2AWN A;  3TS0 A;  4L5Q A;  2AHO B;  2Z6K C;  1HJP A;  4JI8 Q;  1Q46 A;  2JA9 A;  1GD7 A;  4KHP L;  6RXN A;  1TWG H;  1LUZ A;  3H15 A;  2QEX A;  3TQY A;  1VZI A;  1PH9 A;  1IYJ B;  3HOV H;  2CQO A;  2RHQ B;  5IYB G;  3MEF A;  1OTC A;  2Q2T A;  4BBS H;  3MPS A;  4XXB B;  4JCV E;  1C0A A;  4WJ3 M;  2HIX A;  1K9M C;  2E2J H;  2Y0S G;  5IWA L;  2VL6 A;  1XPU A;  4R4C A;  4JI7 Q;  4K9F A;  4A3E G;  4GLX A;  5C44 H;  1TXY A;  3CC4 A;  3U4V A;  4B3S L;  1KXL A;  3RN5 A;  1P16 A;  4NPS A;  3G6E A;  4DPG A;  2VUM G;  4LFC Q;  1HZC A;  2NZH A;  1MJC A;  2WB1 G;  4IPG A;  2ZM6 Q;  3K81 C;  4X62 Q;  1VQK A;  2R7Z H;  5C4X G;  2E5L Q;  2ASB A;  2PQA A;  3QQC E;  4OXP A;  1ASZ A;  1IU6 A;  1J5E L;  1L1O C;  1QYB A;  3ERS X;  3STB D;  1IU5 A;  2ALY B;  3HOZ H;  5HGQ A;  4HJA A;  1JJC B;  3CCL A;  1IBM Q;  3ULJ A;  4QIW E;  1OWC A;  5JEA G;  4YHH L;  3B6Y A;  4DR5 Q;  1HR0 Q;  1NTG A;  2Y0S E;  4DV3 L;  1GVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...