4POGA

Mcm-ssdna co-crystal structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, dna binding protein/dna
molecule keywords Cell division control protein 21
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 57
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pogA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pogA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pogA01
2GMGA 4Y7NH 3VDYA 2UUBQ 2IHEA 1QVCA 5FLMG 1A63A 3HOYG 3I4MG 3S1QH 1WJJA 2K50A 2ZM6Q 3HOVH 2I5MX 1L2FA 5HGQA 4HJ7A 2IHFA 1EYGA 1X65A 1MKHA 2YTYA 4IPGA 1CKNB 1YJWA 1DGSA 3RLOA 2UUAL 1UWVA 3CXCA 2Q2TA 4LF9Q 1C0AA 5BR8Q 3CCMA 5IYCG 3M3YH 4OWWB 2WB1E 1EOVA 2XTIA 4LWCA 1HR0Q 3T1HQ 2JA8H 2NVQH 2VQEQ 3PUXA 1RL2A 4DUZL 2JK8A 2JA7G 4DUYL 5IYDG 2WP8J 3OYYA 4BY7G 4BBRH 3GTLH 1UEBA 1GKHA 3KF6A 1LKMA 1RB9A 4RXNA 3PUVA 4NXNL 1K8GA 1LM0A 4C3JH 1JJCB 1KD1C 4YWKA 2E2JH 2A8VA 1W3SA 1E1OA 1VQPA 4YCWA 5GAEC 1HNXQ 4GKKQ 2YV5A 3UE1A 2VQEL 2KKDA 1I3QH 3I2ZA 5AJ3Q 4AR5A 4JI1Q 2K2DA 3CC2A 2ALYB 2C35B 4A3GG 4DV2L 3GTMH 2Z0SA 1YUXA 4DV3L 7RXNA 4A3LH 3OW2A 1AH9A 3H3VH 1QVGA 2EQSA 3ER0A 3KF6B 2N49A 2QEXA 1KIXA 2PQAA 4AYBE 4GKKL 2K52A 3PO2G 3M4OH 4JC0A 2VUMG 1VQIA 3HKZE 1PH7A 4LF7L 4X6AH 2YTVA 2R92G 4A3IH 1YI2A 2N3SA 4DPGA 1TWGH 2ASBA 3F2BA 4R4CA 1I50H 3CQZH 4LUVA 2M4YA 5IE8A 3GTPH 3HFZB 1Q8KA 1HJPA 4YWLA 1YEZA 4L5TA 2UXBQ 2WFWA 1V9PA 4DV5Q 1CAAA 1HZCA 4A76A 1NNQA 1T9QA 4GLAC 1JJGA 2PMZE 1Z47A 1DX8A 3DM3A 2JQOA 2N78A 4GNXA 1XMQQ 5FLXc 4A3MH 1IBLL 2I0QA 3UDXA 1U0LA 1VQFA 5C4JH 1IBML 5E7NA 1R9TH 2Q2UA 5IP9G 4LF8L 4P72A 4AR3A 3EIVA 4GLVB 4LF4Q 3CCQA 3HOYH 3I4MH 3H0GH 1GM5A 4X66L 1BFYA 2NVXH 4DV7Q 2WAQE 4JI7Q 4LF5Q 2NZOA 3S2HH 1OXUA 3NEMA 1IBKQ 2JA8G 5IWAL 4TPUA 2BA1A 4KLKA 3NELA 2D0OA 2UUCQ 2BH8A 4ME3A 1GD7A 3S15H 3PCOB 1OXSC 2QL0A 4BBRG 2BA0A 1Y1WG 3I4NH 1AE3A 1HNZL 1JE5A 4MZ9A 4R4OA 1VQ5A 4K0KQ 2N8NA 4C3HH 1CKOA 4PZ8A 3T1YQ 2ATWA 3PF4A 3PSIA 4B3RQ 3JC63 4R4QA 1IU5A 4NPSA 5IYDH 1K8AC 1H95A 1ASZA 1Z9FA 3K80C 5GADC 1HH2P 1EQQA 1PH8A 4QIWE 4DR4L 1EFWA 2HIXA 3CCRA 4L5SA 3ERSX 4LFAL 3HOUG 3HOWG 3PO3G 4JYAQ 2VL6A 2KHJA 4FDBA 1ASYA 4DNIA 2LCQA 1HZBA 3TS0A 4IPHA 4A3LG 1QUQB 1UE7A 2IT1A 3G6EA 3T1YL 1HNWQ 1SE8A 3GTOH 1XNRQ 2NN6G 3PV0A 2B63H 1FHMA 2OCEA 4A3KG 4X64Q 4LFCL 1BRFA 1HZ9A 5GAGC 1PH1A 1VQLA 3A5UA 4B3SL 2CCZA 4IO9A 4X62Q 4DKAC 4UP8A 4A3IG 6RXNA 4B3MQ 4YY3Q 4MNOA 1S2ZA 1WCMH 1OXVA 2RCNA 2IX0A 3IRBA 3W5OA 3CPWA 4PZ6A 1KL9A 3MXNB 4X65Q 4DV0Q 3BJUA 1LTLA 2VUMH 3QVDA 4RMFA 3RLNA 2HQLA 4X64L 1VQ9A 1N33L 1VQ6A 1WOCA 2ZJPA 4A3MG 2RDVA 4B3ML 1YJ9A 2DSXA 2Q2HA 1YUZA 3PUZA 1YV1A 1EIYB 4IOCA 5HY6A 1L0WA 4LNQA 4LUOA 3I7FA 4GKJL 3AYHB 2E5LL 3H0GG 2V3BB 4BY1G 1TWFH 3GDEA 5DLQE 1Q82C 3CCUA 4A3EG 1D8LA 3FP9A 2D0PA 1CSPA 5IP9H 1JMCA 4PG3A 4YHHL 3STBC 3M4QA 4A4IA 2ZTCA 4K9FA 1YK5A 5JEAG 3S1MH 2NVYH 1WYDA 2I5LX 4LF6Q 4JI4L 3K7AH 3I4NG 2AWOA 2GVBA 1SMXA 5LMNL 2IY5B 4JBMA 2UUBL 4HIOA 1VQ4A 4JI0Q 4GN5A 3PIOA 1IL2A 1JT8A 3F2CA 4OX9Q 4QL5A 1A8VA 2ZM6L 2UU9Q 3I4OA 2E2HH 4ALPA 1YNXA 2QGQA 4LFBQ 3KDFB 2RF4A 4IFDI 1NTGA 1Y1WH 1HZAA 3PF5A 1PH6A 3S17H 4BXXG 4OO1G 3UE0A 4LF9L 5BR8L 3G71A 3W1GA 1BE7A 3SGIA 3CCSA 1HR0L 1MJCA 1X6OA 1CADA 1K9MC 3K7UC 3CW2C 3KYUA 1B2OA 3F8TA 3KJOA 3T1HL 3KFUA 3M7NA 1YHAA 1SMWA 2MO0A 3PGZA 4GN4B 4DR2Q 2AHOB 4LUZA 5JJLA 2R7ZH 3HOUH 2B63G 1SMMA 1ZRPA 1A62A 1VQEA 1XTDA 5EAYA 5C0XI 3HOWH 5IYBH 1PA6A 4LFBL 3GTJH 4LW1A 1XNQL 1E22A 4JI0L 4DV6Q 1VQNA 1WCMG 4O0AA 1YBYA 3UDFA 4C3IH 5LMUQ 1X9NA 1KXLA 1FJGQ 3TREA 4AH6A 3UDGA 4IOAA 1HNXL 3ZJYC 4A3KH 4HJ5A 4MTNA 5JEAJ 3H3VI 5RXNA 3HKZG 4DR2L 5C3EH 1JYBA 2HIVA 2MFIA 4QY7A 3AFPA 5C44G 4JI2Q 4JI1L 1KRTA 5AJ3L 3CC7A 5AI2A 4TVAB 2GVAA 3GTQH 3L0OA 1Y1VH 3G4SA 2PNHA 3RN5A 3RNUA 3J81c 2JA9A 4KHZA 3OTOQ 2DGYA 4KHPQ 1Q81C 1XPOA 4YCVA 3K0XA 3PUWA 5M5XH 1YHQA 1J5EQ 1R0FA 3JAMc 1VCXA 3RZ6A 1XPUA 4PZ7A 1M90C 1R0HA 4JI3Q 4B3TQ 3K8AA 3NBHB 3S16H 1I5FA 2FXQA 1L1OC 2R93G 3M85A 1MIUA 3EBEA 1R0IA 4DV4Q 2BH2A 1N32Q 3CD6A 3SS2A 1L1OA 4IJLA 2ZTEA 2B29A 1G291 4XTCS 3STBD 2I5HA 1PH2A 3W1BA 2UXBL 3A5ZB 5JJKA 1WFQA 1YITA 8RXNA 3CCJA 2R7FA 4OWTB 1T9PA 4DV5L 5ELOA 1PH4A 1E8JA 2WAQG 4XIGS 1J5EL 4A3EH 4BY1H 2HR5A 1SLJA 1UE6A 2VZAA 3A74A 2HHHQ 4O2DA 1Q12A 1C09A 1QVFA 1S24A 3RYGA 1CKMA 1TXYA 1UE1A 2OQKA 4JI3L 4A75A 1RDVA 3E0EA 4B3TL 2MNAA 1XMQL 3PWFA 1S72A 4DV1Q 1QUQA 1N34Q 1N36Q 4LF4L 5LMNW 1K73C 2ES2A 3BZCA 1L1OB 1KC8C 1BQ8A 4J15A 1KQSA 1Q46A 4L5QA 1XPRA 2A1AA 1E7ZA 4IPCA 4DV7L 4GOPB 1XMOQ 4JI7L 4LF5L 2JA6G 3AFQA 1CSQA 1BVSA 3EN2A 4GN3B 4P71A 1IBKL 3PIPA 2OWOA 4NXMQ 2NVTH 1BKBA 4NB3A 4DK3C 1RIPA 2EIFA 1LYLA 2UUCL 1J6QA 2R7ZG 4BXXH 1S3OA 1Q1BA 3GO5A 3MEFA 5C4XH 3PO3H 3J80c 5IYBG 1VQDA 3CCVA 3S14H 4A93H 2CQOA 3HOZG 2UXDQ 1YVCA 3KLWA 1HR0W 4POFA 4UPAA 2F4VQ 1PYSB 1A0IA 1B71A 4K0KL 1NJIC 2MQHA 5FJ8G 4B3RL 4JI6Q 2ID0A 4JI4Q 1NMFA 4JCVE 1YJNA 1YZ6A 2D62A 1SN8A 3BZKA 1U5KA 1VQMA 5C4XG 4UY8C 2KENA 1I6HH 1B8AA 5C3EG 3J7ZC 1VQ8A 1X3GA 1T9OA 1R0JA 1N9WA 1FHHA 4BBSG 4JV5Q 4IJHA 4JYAL 4GS3A 1Y1VG 1QZHA 2F4VL 1KAWA 1VQGA 2Q2IA 2YTXA 1S40A 3TRZA 1HNWL 1PH5A 1OXTA 1V43A 2VS1A 3KYHC 4DAYB 4L5RC 1FL0A 1X56A 5C44H 3S24A 1XNRL 1PH9A 3ULPA 4PMWA 3I56A 1VQBA 4X62L 1I94Q 2K75A 2PVEA 1LUZA 4YY3L 5ELNA 5IT9c 1PHJA 2R7DA 4A3FH 1IU6A 3CPFA 3CP0A 4A3JG 2LXKA 3NENA 2RHSB 4X65L 4DV0L 1JJ2A 1K83H 3WWVA 1X3FA 2CWAA 3KDFA 4JI8Q 2R93H 4APVA 2YYZA 3M9BA 2R6GA 5H1SE 1NMGA 1C9OA 1NE3A 2OTJA 3Q8DA 1X54A 2KHIA 2WB1G 4YCUA 4GLXA 3LGJA 2UUAQ 1RYTA 1IZ6A 2RHQB 3FHWA 1NBWA 2F3IA 3KF8B 4DR5Q 2Y0SE 1VQCA 4R1JA 3RR5A 2K4KA 3FKIH 2QA4A 4A3CG 3U4VA 4DUZQ 2YU9H 4DUYQ 1JB7A 2L15A 3K81C 3L2PA 2OTLA 1CUKA 3D31A 4LF6L 4A93G 1E3PA 1Y14B 4A3DG 1GO3E 1VQOA 2V1CC 3AQQA 3PUYA 2JA5G 1B70B 1GVPA 1LKOA 4NXNQ 4AIMA 4OX9L 4EQ5A 2UU9L 1E1TA 1PYBA 1BQ9A 1IYJB 3PZAA 1P8LA 2KCTA 3RLFA 2F52A 3J81i 4DR5L 3A44A 1IROA 1O7IA 1Q1EA 3RN2A 2K5NA 3JAMi 3HOZH 1V1QA 1VQAA 2KBNA 5IP7H 4R4TA 1MJEA 4JBJA 4TQUS 5FJ8H 5IY0A 3DLLA 4DV2Q 4HIDA 5GROA 4HJ9A 4AYBG 3D0FA 4DV3Q 1B2JA 5AI3A 4C2MH 4DR6Q 3BU2A 4AR4A 1IXRA 3CCEA 1XJVA 2K5HA 3GTKH 1C7YA 4BBSH 4IPDA 1SROA 2NN6I 2E8GA 3RZDH 1YHBA 4OXPA 4HIKA 4HJ8A 5J3BA 2XGTA 2VQFQ 4DV6L 5LMNQ 3HOXG 1E24A 1EWIA 2KN9A 3CCLA 4LF7Q 1B13A 2CKZB 5LMUL 4A3FG 4DR6L 4HJAA 1FJGL 3S2DH 4P74A 4UP7A 3CMAA 1OTCA 5M3FG 2E2IH 4AR6A 3U4ZA 3H15A 1W2BA 2K14A 4UP9A 4JI2L 4GOPC 2CFMA 2JEAI 4JG2A 5GAHC 4DR1Q 4A3JH 4KHPL 2VQFL 3OTOL 3KJPA 4GOPA 1IBLQ 2Z6KC 1IBMQ 3MPSA 4LF8Q 2MS3A 1QZGA 3HKSA 2Z6KA 4A3BH 2GN5A 3J80i 1X55A 1EIFA 2PYAA 2DUDA 2PI2E 5M3MG 4HIMA 4DR3Q 1YK4A 4JI5Q 1D7QA 2PVXA 4X66Q 3CF5A 1QCVA 1B7YB 1FGUA 2AWNA 3KYYA 1EUJA 4GNXC 4DV4L 1N32L 3KYWA 1BBWA 1KRSA 1NY4A 4DK6C 1QYBA 2JJQA 3FKIG 5IWAQ 2PQAB 3CMEA 4DR1L 4R4IA 2JE6I 3HOVG 1VQ7A 1H7VA 2A19A 4YWMA 1YIJA 3S1NH 1DVBA 2LXJA 3F1ZA 3B6YA 1OXXK 3M4PA 2HHHL 1HNZQ 1M1KC 5FLMH 2EXDA 4JI5L 4DR3L 4KI0A 1TWAH 2UXCQ 4OONA 3ULLA 2PI2A 4QGUA 2JA6H 3J7A5 1UE5A 4A3CH 4DV1L 2B3GA 4IFDG 3ICEA 4P73A 4RG1A 1N34L 1N36L 1R0GA 1BBUA 4A3DH 1VQJA 1SRUA 4AQYQ 1VQKA 5M5WH 5IP7G 2JA5H 4DR4Q 3U50C 4OO1I 1VS0A 4LFAQ 2ZJRA 4GNXB 1EQRA 1PFSA 2ZTDA 3L7ZC 4H02A 3TEHB 3TQYA 5IYCH 1XMOL 3KOJA 4NXML 1IRNA 2NZHA 3JC66 4JOIC 2OQ0A 1VQHA 3GD7A 2UXCL 1KHIA 3A0JA 4JOIA 5C0XG 2JEBI 4OWXB 3E9IA 2JA7H 2UXDL 1G6PA 4QJFA 1SFOH 4LFCQ 1P16A 4B3SQ 4BY7H 2MO1A 2KCMA 1AE2A 2CWPA 4AQYL 2HT1A 2ZJQA 1FVIA 1TWHH 4JI6L 1LKPA 1T9HA 3G48A 3J81j 3RZTA 1SMUA 2IX1A 3E9HA 3F2DA 2VNUD 1SR3A 1Q7YC 1PV4A 3CAMA 2AMCB 4Y52H 4P75A 4QQBX 5JJIA 1K3RA 4JV5L 1RDGA 2VW9A 3HOXH 1PH3A 2AKWB 1XNQQ 2LSSA 4A3GH 1N33Q 1G51A 1VCIA 3S1RH 1WI5A 5M3FH 4DR7Q 1RWDA 1S30A 4JBKA 1Q86C 4IFDJ 4A3BG 4GKJQ 2K5VA 2E5LQ 4WJ4A 3CC4A 3PO2H 2VY3A 4EX5A 1K0RA 3UDIA 1I94L 3GTGH 4WJ3M 1N8RC 1CKNA 4POGA 3JC62 2R92H 5K36G 5M5YH 3U58A 1PVOA 4BA2I 3I55A 3AEVA 1TWCH 4YHHQ 3RZOH 3TS2A 3KYXA 4JBWA 5M3MH 4BA1I 5GQOA 4DAMA 3KYVA 2H5XA 5C0XJ 3ULJA 4DR7L 4JI8L 2Y0SG 1X3EA
chains in the Genus database with same CATH superfamily
4Y7NH 3B08B 3NXWA 4QIWB 3HOYG 3I4MG 3S1QH 3URYA 2K50A 1WTPA 3HOVH 2MPMA 2A6HD 4IPGA 5EKLA 2NUCA 5I9PA 5LL6S 1C0AA 3OPOA 5C44L 4J1MA 3D4DA 3DWAA 1O7YA 4BBSB 1G91A 1DCZA 3PUXA 1RL2A 1JOKA 5JOBA 4BY7G 1Z7TA 5J39A 1OWBA 1PTOH 2AQ1B 2K03A 1XNQQ 1K8GA 2A8VA 1W3SA 3S16B 1VMCA 5GAEC 1BOSA 4GKKQ 2YV5A 4MN3A 2VQEL 2KKDA 1I3QH 3D4WA 5AJ3Q 1TT2A 3CC2A 1EIHA 4DV2L 1BCPF 4DV3L 1AH9A 3SK8A 1KLGD 2XJSA 2JI2A 3PO2G 3FKIL 4JC0A 5KRUA 1PH7A 2WB1B 2YTVA 4A3IH 2CW0D 2R92G 2ASBA 1TWGH 3KBXA 3JAME 4LUVA 5IE8A 4L5TA 1VDZA 2PO4A 4AHXA 1V9PA 4A76A 2NVTB 1NNQA 1T9QA 1QILA 2Z4HA 2APOB 1JJGA 3FVQA 2K32A 2MGSA 2F3VA 1FYCA 2JQOA 3PO3B 1IBLL 4RGMA 4A93B 2F0TA 1U0LA 3I91A 4M1UB 2F0LA 3QO2A 4LF4Q 2QEJC 3IL8A 2M6OA 3Q23A 4X66L 1GM5A 1CA6A 1BFYA 4LF5Q 3GTKL 1U4MA 3S2HH 1KABA 1IBKQ 5ELDA 2L55A 4KY6A 4H7BA 4ME3A 2Z6BA 3B0AB 5IT9L 3S15H 2QL0A 3S2DL 2BA0A 4BBRG 1B3QA 1Y1WG 1AE3A 2L4NA 1VQ5A 1EEID 4K0KQ 1D1IA 1UEAB 2N8NA 5C44B 1V1PB 3OIQA 3PF4A 3PSIA 5IOCA 4N8FA 5IYDH 5KNCA 4AI1A 2HIXA 5G3LD 3ERSX 1ICWA 2ICIA 4LFAL 2ERJA 4FDBA 3IU3I 3K57A 5I2YA 5M3FB 4A3LG 3VYTA 4RCOA 1UE7A 3BVZA 2IT1A 5IGGA 3G6EA 5EQ0A 3D4RA 1SE8A 1HNWQ 3N6RA 3PV0A 1KDBA 2IX3A 4A3KG 1QB5D 1BRFA 1HZ9A 2E75C 4K2KA 2XJTA 5M5YB 4DKAC 4KJOA 1TWCB 2IX0A 3MA2B 2DY8A 1T5XD 1KL9A 1ENCA 2VUMH 3FKIB 4J6HA 3QVDA 1N33L 3A54A 3L3OC 2ZJPA 4A3MG 4B3ML 4RGTA 1YJ9A 1YUZA 1I6HL 1YV1A 5EPJA 1L0WA 4LNQA 1MHWC 3I7FA 4LUOA 4GKJL 3AYHB 2E5LL 1ET6A 3GDEA 1F2MA 5LL6X 1RJTA 4DFAA 3FP9A 3P75A 1KDCA 2D0PA 1CSPA 4BY7L 3STBC 3GV3A 5JEAG 4WJWA 1HHVA 1LT5D 3K7AH 1Z92B 2GVBA 1WTOA 4C2MB 1STEA 2H1EA 3GTKB 3F2CA 4OX9Q 4QL5A 4Y52L 2UU9Q 4AI3A 4TSSA 1HCZA 2A69D 2F0KA 5CYUA 3MAQA 4I7AA 3KDFB 1S4ZA 3PF5A 4F7XA 2HCIA 4AI2A 3S2DB 2NYDA 3G71A 2A6EC 3CCSA 5MGNA 4TRDA 1X6OA 3TSSA 3PO2L 1SMWA 4DR2Q 4LUZA 2R92L 3HOUH 2B63G 1SMMA 1ZRPA 1A62A 1VQEA 5EAYA 4LFBL 1PZID 4GS7D 2F0WA 2K05A 1L0YB 4LW1A 3LX0A 4F87A 1XNQL 3FPPA 5LMUQ 2KECA 2FINB 4RHSA 1EY9A 3T53B 3MZ5A 5JEAJ 2ZXOA 2WIIB 5AJ3L 4OIJA 2RDGA 4JI2Q 1KRTA 3CC7A 3WOEA 2K5DA 2G5DA 3W2DA 4PMCA 2Y0SB 1GUSA 3A56A 1EZ8A 3PUWA 4RCNA 3U9SA 4QUFA 5A2QE 1XPUA 3HOYB 1EY0A 3S16H 5C4HA 4HMIA 1JCKB 1L1OC 2R93G 4DV4Q 1WTVA 3H09A 3CD6A 2B29A 1PH2A 1I6HB 4C3JL 2R7FA 1PH4A 1T9PA 4BY1H 5ELOA 4KKUA 1J5EL 4XIGS 2HR5A 1SLJA 1QVFA 2HHHQ 1Q12A 1C09A 4OHJA 2RSNA 1S24A 1CKMA 1UE1A 4JI3L 4V0BA 2EYOA 3QG1A 2DNCA 3KLSX 4BY7B 3PKIA 1N36Q 4LF4L 1KLUD 3I70A 2ES2A 4A3LL 4B08A 1MD2D 2EYMA 3TZUA 1L1OB 4J15A 2WINB 3KLSA 2FJ2A 4LF5L 2JA6G 2V4DA 1BVSA 1IBKL 2NVTH 2ERSA 4DK3C 5IGFA 2EIFA 1LYLA 2J9UB 1J6QA 2QW7A 1NXGA 4BXXH 1Q1BA 1EY8A 1HTLD 3PO3H 5IYBG 3CQZL 4A93H 2CQOA 2Z4IA 5CR3A 3KLWA 2F4VQ 4K0KL 5TSSA 1CHQD 5FJ8G 2ID0A 3NTIA 4FF4A 2D62A 3PO2B 2EVBA 3LWVB 1GHKA 2R92B 1VQ8A 2L11A 3N52A 1R0JA 3KBGA 4IJHA 1Y1VG 4G7ZC 1QZHA 2YTXA 1VMPA 1S40A 1HNWL 1FNUA 4DAYB 4L5RC 1FL0A 5C44H 4KKTA 5CV6A 1VQBA 5M5WL 1LTRD 5ELNA 2L5TA 5IT9c 1WTRA 1NCVA 2NBFA 3CPFA 2LXKA 2QF7A 3NENA 3MTSA 1DD2A 5C6AA 5I4DA 2CWAA 4JI8Q 2O5JD 4HTHA 3R3OA 3ND9A 2B2VC 3H3VC 2VXWA 2FHTA 1HUMA 2WKDA 1PZXA 3FRPB 4L63B 4BBRB 3Q8DA 4GLXA 3P8BA 2UUAQ 4C3JB 2IW3A 1D5MC 2RHQB 2F3IA 2F3WA 3GTOL 2B63L 1HRJA 2SEBD 3FKIH 2QA4A 1Z6HA 3U4VA 2OTLA 2L15A 3D31A 3HZXA 1E3PA 4A3DG 1GO3E 2V1CC 3VPBE 1LKOA 4OX9L 4G6BA 2UU9L 3NPPA 2KCTA 3JAML 2L9HA 3RN2A 1SEBD 2JI3A 2K5NA 1Q90A 2EYPA 2X69A 1VQAA 3CQZB 2KBNA 3E3XA 2EY4E 4TQUS 4AYBG 2M9VA 5AI3A 2B8FA 4C2MH 3V96A 1TWFL 2F0MA 1A3VA 3GTKH 1PTOD 1C7YA 4A3MB 2F0GA 3DUZA 2NTSA 3HEJA 4OXPA 5J3BA 2NVYL 2XGTA 3HOXG 4FO2A 3HAXC 1EOTA 5LMUL 4DR6L 3S2DH 4C1NI 4MHEA 2B2WC 3U4ZA 2E2HL 1HXYD 4JI2L 4RA8A 2CFMA 2VQFL 4GOPA 2AYJA 3J80L 2MS3A 2O5JC 2JA6L 2Z6KA 4XQNA 1X55A 2CVRA 2AQCA 2PW7A 2AWNA 4DV4L 5IYBL 5IWAQ 3GTJL 3NTHA 2M6PA 5A35A 2L0CA 2XNAC 4C3IL 1A3TA 2EY2A 2LXJA 2HHHL 2K04A 4HR7B 1M1KC 3GTOB 5JPMC 3QWNA 2F1MA 2UXCQ 1XWEA 2B63B 4OONA 1S5BD 4IFDG 1QOHA 3VR3A 1N36L 1ICFB 1R0GA 1BCPC 3OMCA 1Y1VL 5DEHA 3FDTA 2KCNA 1I6HH 1PFSA 2ZTDA 3TQYA 1LLRD 3PKJA 1QNKA 4AHZA 5IGCA 3A0JA 3PIO1 5C0XG 2EXZA 3EROA 4B3SQ 4BY7H 2F0EA 4AQYL 3VR6A 2F0PA 2B2UA 5IODA 5DM73 4A3EL 1SYGA 3G48A 1BCPB 3J81j 1TWFB 2A74C 2VNUD 2F0UA 2EOTA 3CAMA 1Q7YC 4Y52H 4QQBX 4TKOB 2NVYB 2OEOA 1DXMA 3SDZA 1G51A 3KF8A 1SJHD 4LAAA 1JWUD 4ZLTF 4IFDJ 1I4PA 1F77A 4ODGA 2JN4A 4K5WA 2E2HB 4CGYB 3PO2H 2VY3A 4WJ4A 3EQLC 2GA4B 3JC62 2R92H 2CH4W 3U58A 1PVOA 4R8NA 3EVQA 3I55A 4UAIA 3H9CA 4BA1I 2JA6B 2R3ZA 5GQOA 5C0XJ 1Y8PB 3ULJA 1QG7A 4JI8L 5LMNQ 2PMZE 2GMGA 3VDYA 1QVCA 2Q8RE 5FLMG 2ZM6Q 4WFN3 2I5MX 1L2FA 4HJ7A 3P20A 3GTJB 1EYGA 4GZYC 1ZYRD 1MKHA 2YTYA 1ILQA 1CKNB 1CK1A 2F0JA 2UUAL 2Q2TA 4C3IB 5BR8Q 3CCMA 5IYCG 4LWCA 3Q6SA 3PIO3 4DK0A 3T1HQ 3H94A 3K58A 2VQEQ 1STHA 1NXEA 1PMRA 1SDFA 2DJGC 2JK8A 1Y1VB 4RGOS 2LS01 3OYYA 1JWMD 5A2QL 4BBRH 1SBBB 5CV8A 5C3XA 4XQQA 1UEBA 3KF6A 1RB9A 4JI0Q 5M5XB 1K83L 4C3JH 1JJCB 5ISRA 4YWKA 4YCWA 1LTGD 2K5QA 5ELEA 3PIP1 4I65A 1CI3M 2K2DA 2QILA 2B2YC 2J7ZA 2Z0SA 3H6MA 4A3LH 1D2BA 3H3VH 1QVGA 2Z3QB 1LV9A 1KIXA 2PQAA 3LWQB 2BOSA 3HP3A 4DU9A 3HKZE 4X6AH 2XJPA 1J9OA 4WORA 5K2ME 3CQZH 1MBYA 4UY81 4DK1A 2Z9HA 2JSOA 4B8CD 2WFWA 1OWCA 1STGA 4U671 4QB4A 3G7LA 3Q0AA 5FLXc 4A3MH 4Q5VA 1VQFA 1CQFA 5E7NA 3S17L 5IP9G 1O7ZA 4P72A 4AR3A 4GLVB 1SE4A 4L8JA 2WAQE 2NZOA 4BBSL 5FOBB 3R2TA 2JA8G 5IWAL 4KLKA 4DAVA 2LY7A 1TS3A 2D0OA 5JEAH 2BH8A 4AYBB 4CKBA 1SSOA 1I4RA 1E2WA 1LTTD 1OO9B 3S16L 2E2IL 4B3RQ 1FGBD 1A6XA 3I8ZA 4R4QA 4KD3A 2C6AA 3K80C 2EJFC 1EQQA 4A3JL 3HOWG 3V2TA 2VL6A 1ASYA 4DNIA 2LCQA 1K83B 2PNRC 1EIGA 1UUPA 4X3TA 4RH6A 5JVG3 3GTOH 2WACA 2NN6G 4KMUC 3QIAA 3VYSA 2B63H 4B3SL 4NDXA 1PFNA 4B3MQ 4KN7C 2EE1A 2HCCA 4MNOA 2RCNA 4YY3Q 3CPWA 3T51B 5FLML 1BR9A 2P5ZX 1LTLA 3MVVA 2OT2A 4RMFA 3RLNA 4X64L 2HQLA 2L12A 1VQ9A 1WOCA 2RVLA 3NSWA 1E0BA 3HRZC 5I6WA 3M4YA 3A8IE 3QOJA 1EIYB 5C5LA 1PLFA 2PPBC 1TWFH 2KEEA 1EY5A 2XJQA 2E76C 4QIWP 3S17B 2NVYH 4DNRB 1WYDA 1CA5A 1AEXA 5LMNL 3HS0C 2CKAA 3SK5A 1V8QA 4J8QA 4YIJA 1PFVA 1TR5A 4GN5A 1IL2A 1JT8A 1A8VA 2ZM6L 4QF4A 2CKCA 2E2HH 3HGBA 3A8JE 4LFBQ 2EYFA 3E0JA 4IFDI 1NTGA 3K6OA 2IL8A 1TY2A 5M3FL 5BR8L 1PFUA 3W1GA 5HGTA 1IKMA 1K9MC 1CADA 4FXKC 5CV9A 2JA6H 3KYUA 1B2OA 4TVMA 3T1HL 2E2IB 2ZIXA 1ILPA 4ZUJA 3GTGL 4PQXA 5M5YL 3ONAB 2H4OA 5C0XI 4A3JB 1H9SB 5IYBH 1TWCL 3RZOL 4RAUC 3GTJH 3HJWB 5M3ML 1W6JA 4JI0L 1WCMG 3UDFA 4C3IH 1KXLA 3H97A 3UDGA 1STAA 1FNWA 5LHY1 4HJ5A 2Z1CA 3MWYW 3EA6A 3HKZG 1A2UA 1JYBA 2XJRA 2K33A 4HCSA 4TVAB 1Y1VH 4OL7A 1JQYD 2PNHA 2C5CA 3RNUA 3J81c 2KA7A 2DGYA 1RTNA 4CDCC 4YCVA 3M3YL 1J5EQ 5M5XH 2WB1P 1R0FA 1GHJA 3AU7A 4KN4C 2JA8L 4JI3Q 3NBHB 1I5FA 4CKCA 3M85A 2F03A 3EBEA 2B2TA 5K5PA 4XTCS 3STBD 2I5HA 2R61A 3W1BA 1YITA 3CCJA 4QCLA 1E8JA 2WAQG 4A3EH 1BDOA 1STBA 2VZAA 1UAPA 3RYGA 4A75A 4XXBB 1RDVA 2HDLA 2SOBA 3E0EA 1S72A 1QUQA 4XXEA 2EY5A 4IURA 3GTML 1UNSA 5LMNW 1JICA 3BDCA 2XWJB 5IGEA 1KC8C 1BQ8A 1Q46A 4KY7A 1XPRA 4IUVA 4IPCA 2A6ED 4GOPB 2OWOA 1CSQA 1QJOA 4P71A 1VZGA 1BKBA 4NB3A 1RIPA 5DM61 5MFPA 3MXNA 4ID6A 1I50L 3HOZG 3R93A 1YVCA 5T1GA 1O78A 4X3UA 3EJIA 4KV6A 1A0IA 1NJIC 4JAGA 4B3RL 1NMFA 4JCVE 1QQTA 1EY6A 1YZ6A 2RFKB 1SN8A 3BZKA 3C2PA 3GTGB 4UY8C 2KENA 1I4XA 3K5LA 1TVXA 4K8JA 1T9OA 5C4JL 4JV5Q 1R9TL 3RZOB 4GS3A 5M3MB 1SYBA 1KAWA 2AUJD 2F4IA 3HOYL 3OOCA 3I4ML 2F0DA 2NVXL 4ZAIA 5EPLA 1X56A 3S24A 2CR8A 3HJYB 3I56A 1I94Q 1LUZA 4YY3L 1PHJA 1HFGA 1IU6A 2K5WA 3M3YB 1JJ2A 5EPKA 1K83H 3WWVA 5CC4A 1GUTA 1H9KA 2JA8B 2NVQB 2R6GA 5EKIA 1NE3A 2OTJA 1IYUA 1X54A 5CV5A 3VA5A 3IFDA 2ZXRA 1AW7A 1RYTA 4JAEA 4O1NA 1IZ6A 3OIPA 1NBWA 3KF8B 5EKKA 4R1JA 5KEEA 2TSSA 1TQOA 4NMZA 4ZUIA 2CQAA 5GAEc 1NNXA 3FPUB 3HOWB 3MQKB 4A3CG 2PW5A 3GTMB 1WCML 5C4ZA 3K81C 4DUYQ 3L9AX 2AQ2B 3RUZA 1C8CA 2JA5G 1AP0A 2XWBB 3SE0A 4XQJA 1F9RA 1P8LA 5JJZA 2M2LA 3A44A 1O7IA 5I9OA 2EZVA 1SE2A 1B50A 1GUGA 2O4XA 1V1QA 4LJZC 3I4LA 1I50B 5D3DA 1MJEA 3S17H 4HJ9A 4DR6Q 5IY0A 5GROA 4IQZA 3D0FA 1B2JA 4G57A 3BDLA 3K59A 1IXRA 3BYTB 5C0XH 4BBSH 4HEDA 3C1EA 2NN6I 1F4LA 2E8GA 1SNOA 1YHBA 5C4JB 4XYQA 3S1ML 4HJ8A 1R9TB 3FDJA 2VQFQ 4LF7Q 2PMZB 3CCLA 1EWIA 5ELCA 1EYDA 4HJAA 3I4MB 4UP7A 4S3SA 2NVXB 5CBAE 1KAAA 2E2IH 5KIXA 1W2BA 3H15A 2Y0SP 1TY0A 4BBRL 1Y1WL 3J81E 5GAHC 2EY6A 4A3JH 4B9WA 3H3VM 1LTAD 2K01A 1RHPA 5EGTA 4HIMA 4AHWA 3GQBA 1FGUA 3KYYA 5BN3A 4DK6C 1NY4A 1DJRD 1I4QA 1QYBA 3CMEA 2PQAB 3HOVG 4ZN1B 2JE6I 2F0SA 4HSPA 2AUSB 2A19A 2SNSA 5IIFA 4HAEA 2MHVA 1JORA 1OXXK 1HNZQ 4A3KL 5FLMH 2A68C 2EXDA 4JI5L 4DR3L 4MTKA 4X6AL 1STNA 2B3GA 3ICEA 2HVYC 1BBUA 1WCMB 4AQYQ 5IP7G 3U50C 1VS0A 3TEHB 5IYCH 4N8X1 1IRNA 2NZHA 3HKZB 1VQHA 3GD7A 2D2CC 4A3ML 3CRKC 4JOIA 2JEBI 4LFCQ 3VR2A 2KCMA 3CU7A 1JWSD 2HUGA 3RZTA 1A2TA 4JADA 3P1HA 2KQ3A 3F2DA 1QE6A 1SR3A 2I07B 1PV4A 1B1ZA 4JV5L 2AKWB 3S1MB 4X3KA 4FF1A 1SYCA 1WI5A 1YNNC 1SNQA 2WAQB 3SK6A 5M3FH 3NUCA 1RWDA 3OW7A 1Q86C 3U9OA 4A3BG 1HTPA 2K5VA 2C6BA 1K0RA 4EX5A 1I94L 3GTGH 1B9NA 4WJ3M 2KHSA 3UI2A 1Y1WB 1SMYC 3T4AC 5M5YH 3PMFA 1TWCH 3QR8A 3RZOH 1SXTA 3KYXA 1TS5A 4JBWA 3TS2A 5M3MH 4EQPA 2SDFA 4DR7L 1EYAA 1XX8A 2IHEA 5I2XA 1QNUA 1A63A 1WJJA 4XT1B 5HGQA 4CDFC 1HQMC 1NR4A 1X65A 1BCPD 1DGSA 5I6YA 4FP5D 1UWVA 1EFID 3M3YH 2WB1E 4A3KB 1EOVA 2XTIA 3E6ZX 3NWSA 1II3A 2JA8H 1W6KA 2NVQH 4ZKCB 3DWPA 3IFTA 5E4WC 5F2DA 2JA7G 4DUYL 5IYDG 4BWGB 4PNYA 4RXNA 2F0OA 4DGZA 2R93L 1E1OA 2LKVA 1HNXQ 1G2TA 1EQTA 4H13C 3UE1A 1R4PB 3I2ZA 2SNMA 4AR5A 4JI1Q 4A3GG 3GTMH 3LNLA 7RXNA 4KK7A 3P2AA 5GAHc 1GJXA 4CJ2C 5MFZA 3ER0A 1Q8IA 1SNCA 2NN6H 2K1BA 2KJXA 2VUMG 1VQIA 4LF7L 4OIKA 4IN3A 3F2BA 1I50H 5M9OA 2M4YA 3HFZB 1Q8KA 1HJPA 4YWLA 3J7Z1 4DNTB 3RMHA 3QJYA 3AB9A 4DV5Q 1CAAA 1HZCA 4GLAC 3SXHA 5KNBA 1MGSA 1P7PA 4V190 1YNJC 4GNXA 1A3UA 1F9SA 2RBMA 2I0QA 5IP7L 4QUCA 3UDXA 5C4JH 1R9TH 5FJ8L 2Q2UA 1TKWB 1XYIA 3A55A 3EIVA 4DA2A 1V1PA 3CCQA 3HOYH 1DOLA 3BVGA 1ZXTA 3I4MH 2NVXH 4DV7Q 1S5DD 3NEMA 1K8OA 4TPUA 1F9QA 3NELA 3RZDL 1IKLA 1SFOB 1GD7A 3PCOB 5M5XL 1OXSC 2N55A 1HNZL 4MZ9A 4R4OA 4MIUA 4PZ8A 2ATWA 3JC63 3J7AF 1D5XC 4NPSA 3MHBA 1H95A 1ASZA 5GADC 1PH8A 1HH2P 1EFWA 3HOUG 3C1FA 3S1RB 4ULLA 1HZBA 4A3BL 3TP5A 1S5ED 1K8MA 1QUQB 2LMCB 2R93B 2RCFA 5HURA 3T1YL 2NYZD 2J0TD 3J7A5 3TP8A 4X64Q 4LFCL 3MFYA 3MEHA 5GAGC 4CDDC 2Q8IB 1V1OA 2CCZA 4IO9A 4JVZA 3W5OA 1S2ZA 1WCMH 1OXVA 3IRBA 1WD0A 3A7AB 4PZ6A 3MXNB 1TWAL 3BJUA 2B5ID 5IT9E 4RWSC 3HOVB 1VQ6A 2YU9B 4A3DL 2XN9C 3VYUA 1HFNA 2BE5C 2Q2HA 3PUZA 5EJWA 1WTXA 1NR2A 5HY6A 2G9DA 3H0GG 4BY1G 1Q82C 1TS4A 1X32A 3MXPA 3VYRA 4ME5A 3CCUA 2JA7L 4U68A 1GUWA 2K6AA 2ZTCA 4A4IA 3S1MH 1FNVA 4WRDA 1VF7A 4OELB 1PFMA 5DAUA 1RTOA 3I4NG 2X6LA 2BDNA 4HIOA 4C3HG 3A7LA 3I4OA 2CHBD 3HOXL 2F0HA 3RZDB 2QGQA 4A3GL 2RF4A 1Y1WH 3TP6A 4BXXG 4OO1G 3UE0A 4I7ZC 1MJCA 4LK1C 3K7UC 3KJOA 3F8TA 4CJ0B 1JC7A 3M7NA 1YHAA 2AHOB 5JJLA 1XTDA 1T5EA 2D5DA 2QDLA 1D1KA 1TWGB 3LNNA 1E22A 1VQNA 4F8MA 5JVH1 1X9NA 4A3BB 1FJGQ 1D5ZC 4XYOA 1HNXL 3ZJYC 4A3KH 1B4OA 1GOZA 5RXNA 3SEBA 4ZN3B 4QY7A 1K0SA 5C44G 4JI1L 1STYA 5AI2A 3ITPA 2GVAA 1NUCA 3L0OA 4HN7A 3G4SA 3S1NB 4KHZA 3OTOQ 1Q81C 1XPOA 3K0XA 1YHQA 3JAMc 1TWAB 2HDMA 4PZ7A 1R0HA 1DOMA 1LABA 1ENAA 3TP7A 3MXUA 4C1NK 1MIUA 4A3DB 1R0IA 1N32Q 1L1OA 3K5OA 3GTLL 5JJKA 3A5ZB 2E2JL 1KNEA 1PYWD 3NBIA 4DV5L 2EYHA 1IHZA 1TIID 4E6YA 1TXYA 1PRTB 4B3TL 2JA7B 4AI0A 3LWRB 5ELFA 2IJ0A 3H91A 4HCEA 3P7JA 2PPTA 1LTID 3BZCA 1KQSA 3KUPA 2A1AA 4FNFA 4DV7L 2FFKB 1XMOQ 2L1BA 3EN2A 2FMMA 3PIP3 4AYBP 4K2LA 1GUOA 3M4OL 3HOXB 2KVMA 2R7ZG 4A3GB 1O80A 3M7GA 3MEFA 3J80c 2UXDQ 3GTPL 4POFA 4DAYA 5CBEE 1Y69U 1S5CD 1YJNA 2RQXA 1U5KA 3MSUA 1ML0D 5C3EG 3J7ZC 3HG9A 3E5SA 1F2YA 1N9WA 2KOLA 1VQGA 3IAYA 2Q2IA 4U673 2F0IA 3H0GL 1G8ZD 3TRZA 5MF6A 1V43A 4ZCKA 4JPBW 2PYKA 3ULPA 3QB3A 4PMWA 2K75A 2PVEA 2A73B 2R7DA 5IYCL 3I4NL 2JXMB 2WKCA 4CDEC 3PL5A 3OWEB 4C3HL 4HMJA 2R93H 1HA6A 1SNDA 1WD1A 3BZDB 1C9OA 3NFPI 3OHXC 1Y8NB 2KHIA 1R4QB 4YCUA 3GTLB 5KGUA 2E2JB 3R8BA 3FHWA 2DN8A 1VQCA 1Q3LA 1EU4A 3HOUB 2KUMA 3BVMA 1DM0B 4NKLA 4CKEA 4DUZQ 2YU9H 3CKIB 4DXGA 5C4XG 1CUKA 1KNAA 1G2SA 1Y14B 4G4KA 1VQOA 3NE5B 3MFGA 1KDAA 2N88A 3AQQA 3PUYA 1GVPA 3X3NA 4NXNQ 1E1TA 1PYBA 2PSMC 1IYJB 3PZAA 1SE3A 3J81i 4DR5L 3M4OB 1IROA 1Q1EA 1HPCA 1MSGA 1DONA 3K35A 1M4VA 5IP7H 3GTPB 2XJVA 4JBJA 5FJ8H 4HIDA 4R8IA 4H0LC 3H99A 1E2ZA 3PQIA 4FF2A 2D9UA 3DEPA 3BU2A 4AR4A 1XJVA 3CCEA 2K5HA 2EY1A 4IPDA 5IP9L 4N9PA 2B39A 3RZDH 4R9WA 1E24A 2CKZB 4A3FG 3DMUA 2NTTA 5T1IA 2AQ3B 1FJGL 3H0GB 4BY1B 3V05A 4ABNA 2NVQL 1CFMA 1OTCA 2B2WA 2K14A 4UP9A 4GOPC 1CHPD 2EPBA 1NAPA 1F2ZA 1RCVD 3G6JB 1WTHA 3OTOL 4CHTB 3I4NB 2Z6KC 1B9MA 1IBMQ 2RDHA 4LF8Q 1CT1D 3HKSA 4FYDA 1TU2B 4A3BH 2GN5A 4C3HB 2DUDA 1EIFA 1WTQA 1WJVA 5FLXE 4JI5Q 4DR3Q 2F0FA 2PVXA 3CF5A 4UDUC 2R7ZL 1B7YB 3JR7A 3HOWL 1PTOF 1EUJA 2JI1A 4K14A 2Z8LA 3NQTA 1BBWA 1KRSA 4GNXC 4IALA 1N32L 3QQCE 1LT6D 4DR1L 5AN9H 4R4IA 3I73A 1VQ7A 2IWHA 4YWMA 1YIJA 4HSVA 3S1NH 1DVBA 4ZYSA 3F1ZA 3B6YA 3M4PA 1M8AA 4ZK9B 2RA4A 5IGBA 1TWAH 5C3EL 3ULLA 4QGUA 5JPNC 2A6HC 4P73A 5CGKA 3GTQL 3R2IA 1ESRA 1LTSD 5EIOC 4A3DH 2M4VA 1S5FD 1SRUA 2F0NA 1DYQA 1VQKA 4DR4Q 4OO1I 2ZJRA 4GNXB 1EQRA 1XMOL 3KOJA 2KCCA 5C5MA 2OQ0A 5EINC 1KTKA 4C3JG 5C3WA 3J80E 4RFBA 4K8IA 4OWXB 3E9IA 2JA7H 2UXDL 4QJFA 2B2UC 2MO1A 1AE2A 2HT1A 2ZJQA 1LKPA 3VR5A 2IX1A 3E9HA 2AMCB 1K3RA 2CH4A 5MLC3 4EQOA 3HOXH 1PH3A 2LSSA 4A3GH 3T56B 3D3RA 1BUVT 1VCIA 4N9TA 2HQEA 4DN4M 4DR7Q 1S30A 4KY5A 4LMQD 4RHRA 3CC4A 4CJ1B 3ZG6A 3UDIA 1CKNA 4POGA 2CW0C 5C4XL 5K36G 3S14L 1A15A 4YHHQ 1PRTF 4DAMA 3KYVA 4JI4Q 2UUBQ 5DM63 1U4RA 1VZIA 4LHNA 2A68D 2R7ZB 5FO7B 3BG3A 2F0VA 1IL8A 2IHFA 1IW7D 1YJWA 3RLOA 3CXCA 1LACA 4LF9Q 4EQNA 1ZEQX 4FVMA 4OWWB 1HR0Q 1BXTA 4IFDH 5D65A 5C3EB 2RDFA 4IUQA 1U4PA 3RD4A 4DUZL 3GTQB 3QOLA 4A3FL 2J4XA 2WP8J 1HA5A 3NWTA 3GTLH 1GKHA 3PUVA 1LKMA 4NXNL 4JK1C 1LM0A 2E2JH 1KD1C 2O5IC 3KLRA 1VQPA 1HUNA 1SYDA 3K5MA 1CTMA 2JYOA 3LWUA 5BN4A 1ENFA 1XXGA 2ALYB 2C35B 1YUXA 3OW2A 1YNND 2B2YA 2EQSA 1SYFA 3KF6B 2N49A 2QEXA 2PMZP 4AYBE 3J7Y1 4GKKL 1G6ZA 2K52A 3M4OH 2DJFC 1YI2A 2N3SA 2TMPA 3I90A 4DPGA 1SMYD 4R4CA 4EGVA 3GTPH 1YEZA 2UXBQ 2XRQD 2AUKA 3DM1A 1BNZA 1ODHA 3EFXD 5E4XA 1Z47A 1DX8A 3HOZL 1EZ6A 1JR0D 3DM3A 2N78A 4FXDA 5C4XB 3T13A 1XMQQ 1ONLA 2XIWA 3S14B 3GV6A 1IBML 5D3IB 4LF8L 3IKJA 1RDPD 4X3SA 3H0GH 4FXGC 4JI7Q 4KKSA 1OXUA 1IW7C 4DXFA 2BA1A 2V0EA 1JOOA 1PZKD 5NUCA 2UUCQ 4F88A 3ND8A 2MUYA 3I4NH 1JE5A 4QMGA 4C3HH 1CKOA 3T1YQ 5EBCA 3SR1A 2A69C 1IU5A 1GUNA 1K8AC 3O13A 1Z9FA 4QIWE 4A3FB 3HKZP 4DR4L 4L5SA 3CCRA 2DY7A 3K5NA 4OO1H 4PV1C 5CV7A 4JYAQ 2KHJA 1MI2A 3TS0A 3OMGA 4IPHA 3OWFA 4K6DA 2HD3A 4IZ8A 1EY7A 4C3IG 2VB2X 2EYLA 1XNRQ 1X3PA 2B8GA 1SJED 1FHMA 2OCEA 3NK9A 4K5XA 3T16A 1PH1A 1VQLA 3A5UA 4H44C 4X62Q 4UP8A 4A3IG 6RXNA 2QDBA 3D8GA 3I3CA 4G7HC 3KK7A 4X65Q 4DV0Q 1IYVA 1XTCD 5JAVA 1SYEA 1SAPA 4A3CL 2WAQP 1PFYA 1YNJD 2RDVA 5H1Sc 2DSXA 2JA5L 3LWPB 4IOCA 2A5HA 3W3AA 2V3BB 5KYIA 1PDQA 5DLQE 2PQEA 2Q8TA 2QKIC 1LT3D 4A3EG 1D8LA 2L0ZA 3HOZB 1ET9A 1BF4A 1SFOL 2OXPA 5IP9H 1JMCA 4ZKBB 4PG3A 4YHHL 3M4QA 4K9FA 1YK5A 4K5VA 2I5LX 1TWHL 5COYA 4JI4L 4LF6Q 2AWOA 4XT3B 1SMXA 2IY5B 4JBMA 1AFPA 2UUBL 1VQ4A 1VZHA 3LWEA 1EWCA 1DOKA 3PIOA 2ZT9C 3BS1A 3DWQA 1H9SA 4ALPA 1YNXA 4FF3A 3F2UA 3LPEB 1HZAA 1PH6A 1PXUA 3S1RL 3GP7A 4ILWA 4OEMB 4LF9L 1BE7A 2PCFB 3SGIA 1EL0A 1HR0L 3FMCA 3CW2C 3KFUA 1J8IA 3PGZA 2MO0A 4GN4B 2R7ZH 3Q24A 3HOWH 2XRSD 4DAPA 1PA6A 3AMUA 3J7AV 1BO0A 3D6WA 5CORA 5FLXL 4DV6Q 1DZ1A 1EY4A 4O0AA 1YBYA 1CQVA 3MXGA 4IOAA 4Y7NL 3TREA 3NBHA 4AH6A 3WWNB 4Z9CB 4MTNA 3S1QL 3H3VI 3HOVL 4DR2L 5C3EH 2VB3X 4EVOA 2HIVA 2MFIA 2YU9L 2WV6D 3AFPA 5FO9B 2BCOA 3Q22A 3GTQH 3RN5A 4KHPQ 2JA9A 1H9RA 2BE5D 5IGDA 1VCXA 3RZ6A 3NTKA 1M90C 5DM71 3K8AA 4XDXA 4B3TQ 4V196 2B2TC 4DF7A 2FXQA 2O2LD 2BH2A 1U9RA 5M5WB 3SS2A 2JA5B 1HQRD 2ZTEA 4IJLA 1G291 2UXBL 1WFQA 8RXNA 2X6GA 4OWTB 4B9XA 4M8AA 3A74A 4LHLA 1UE6A 1E2VA 1AZPA 4O2DA 1VF5C 5KNDA 2OQKA 1CM9A 1F2LA 1I3QL 1I4GA 1B44D 2MNAA 2IPKD 1XMQL 3PWFA 2E74C 3WOFA 4DV1Q 2EJGC 5KYLA 1N34Q 2DNEA 1K73C 3FEWX 1TWHB 1PFBA 4KD4A 4L5QA 3S9WA 1E7ZA 3C46A 4JI7L 3VR4A 3H9BA 2RSOA 3AFQA 4GN3B 4NXMQ 3PIPA 1B2TA 2UUCL 1I6VC 1B3AA 1CZGA 4A3IL 1S3OA 3GO5A 1TWGL 3K0YA 5C4XH 3CCVA 1VQDA 2EJMA 3S14H 4WFN1 1HR0W 4UPAA 1PYSB 1B71A 1AZQA 2MQHA 1AN8A 4JI6Q 3TMEA 1VQMA 3WDNA 1RODA 3NQIA 1B8AA 1X3GA 2E2DC 4BBSG 1FHHA 3S1NL 4JYAL 3ERQA 3TDQA 2F4VL 2PZWA 3NP8A 3SHLA 1PRTD 5FK9C 4Y7NB 3TBIB 1PH5A 1OXTA 3KYHC 1H9JA 2VS1A 3S2HL 3J7YW 1XNRL 1PTOC 4ZRZA 3S1QB 1PH9A 4NW2A 1EYCA 4X62L 1NSNS 4RGNA 5G3LF 2NB0A 3S15L 3DXJC 4A3FH 3CP0A 4A3JG 5EBDA 2RHSB 4X65L 4KJNA 4DV0L 1X3FA 1RD9D 4RKLA 5FO8B 2QCPX 3KDFA 4O42A 1RYQA 2C9OA 5IYDL 4APVA 2YYZA 3M9BA 5H1SE 1NMGA 5FKAC 1JOQA 4BS9A 1K3BC 1ZKOA 3SVMA 1EU3A 1PTOB 2XSCA 2WB1G 2KEDA 3LGJA 4RKBA 1WVLA 1CZWA 4G7OC 1LTBD 3X3MA 1RF2D 4DR5Q 2Y0SE 2MJ8A 1I3QB 3RR5A 4AHYA 2K4KA 3PO3G 1JB7A 4LF6L 3L2PA 2ENBA 4A93G 4XGHA 1QWYA 1EWHA 2I46A 4JW0A 4CBVA 3J81L 1B70B 3I72A 3OSOA 1RKNA 5E1FA 3WWLA 4AIMA 1Y8OB 5DNFA 2VUML 4EQ5A 3C3LA 3CRLC 1BQ9A 4IUPA 3BYYB 3RLFA 2F52A 1O7LA 4JAFA 2BDOA 5E3FA 5ELBA 3JAMi 4A3IB 3HOZH 2NWGA 4R4TA 4K6LA 3DLLA 4DV2Q 3MC0B 4DV3Q 4IUNA 3D6CA 1SNPA 4L6TB 1FR3A 1SROA 3ZYYX 5D14A 2ICEC 2NZ1D 4HIKA 1I4HA 1U4LA 1PRTC 4DV6L 2KN9A 3K7AL 1B13A 5BN5A 1K28A 4P74A 3CMAA 5M3FG 4A3EB 3S2HB 1WTWA 4AR6A 2H12A 1D6EC 4ZQ3A 5JVG1 2JEAI 4JG2A 1EEFD 4DR1Q 4KHPL 3S15B 1IBLQ 3KJPA 1SNMA 4NP5A 3MPSA 2Z3RB 1QZGA 1C4QA 2FMCA 3BDOA 3J80i 2PI2E 5M3MG 2PYAA 1D7QA 3TZDA 1YK4A 4X66Q 1QCVA 3HOUL 3TN2A 2K28A 5L37A 5J1ZA 3KYWA 5K36H 1MSHA 2G9HD 2JJQA 3FKIG 1ESFA 1H7VA 5GADc 3NHHA 4C2M1 2JP1A 5CV4A 2OF1A 2PZUA 4KI0A 2PI2A 4IUTA 1UE5A 2RKSA 4A3CH 1L0XB 4DV1L 1ZYRC 2XVSA 1X3QA 4IUUA 4RG1A 5JVH3 1N34L 1VQJA 5GAGc 3DEOA 5M5WH 2JA5H 1C48A 4LFAQ 2MP1A 5AFWA 3L7ZC 4H02A 1FD7D 4UHVA 5CMDA 2ZXPA 4KHVA 4NXML 3JC66 4JOIC 1LT4D 2VUMB 2K7VA 2UXCL 1KHIA 1JB3A 2EDGA 2XJUA 1G6PA 1F9PA 1SFOH 1P16A 5J22A 1GXDC 2CWPA 4PMBA 2M00A 4BY1L 1PFWA 1FVIA 1TWHH 4JI6L 1T9HA 1QCBD 2V0FA 1TS2A 1PZJD 1SMUA 4P2CB 4Q0FA 3LWOB 2PZTA 3A8KE 3SK4A 1EQVA 1B53A 4C56C 4P75A 5JJIA 1RDGA 2VW9A 1BBXC 1N33Q 3K7AB 1H9MA 3S1RH 4JBKA 1JE4A 1BQQT 2NVTL 4GKJQ 2E5LQ 3CHBD 4BXXL 3VA7A 2B2VA 1N8RC 3PO3L 4E6IA 4OGQC 4A93L 2LFNA 3DHQA 1LO5D 4KTAA 3AEVA 4BA2I 2F0QA 2H5XA 2Y0SG 1X3EA 2EYJA
chains in the Genus database with same CATH topology
4Y7NH 3B08B 3HOYG 3I4MG 3S1QH 2K50A 3HOVH 2A6HD 4IPGA 1C0AA 3PUXA 1RL2A 4BY7G 1OWBA 1XNQQ 1K8GA 2A8VA 1W3SA 5GAEC 4GKKQ 2YV5A 2VQEL 2KKDA 1I3QH 5AJ3Q 3CC2A 4DV2L 4DV3L 1AH9A 2XJSA 2JI2A 3PO2G 4JC0A 1PH7A 2YTVA 2R92G 4A3IH 2ASBA 1TWGH 4LUVA 5IE8A 4L5TA 4AHXA 1V9PA 4A76A 1NNQA 1T9QA 1JJGA 2JQOA 1IBLL 1U0LA 4LF4Q 2M6OA 1GM5A 4X66L 1BFYA 4LF5Q 3S2HH 1IBKQ 4ME3A 3B0AB 3S15H 2QL0A 4BBRG 2BA0A 1Y1WG 1AE3A 1VQ5A 4K0KQ 2N8NA 3PF4A 3PSIA 5IYDH 4AI1A 2HIXA 4LFAL 3ERSX 2ERJA 4FDBA 3IU3I 4A3LG 1UE7A 2IT1A 3G6EA 1HNWQ 1SE8A 3PV0A 4A3KG 1BRFA 1HZ9A 2XJTA 4DKAC 2IX0A 1KL9A 2VUMH 3QVDA 1N33L 2ZJPA 4A3MG 4B3ML 1YJ9A 1YUZA 1YV1A 1L0WA 4LNQA 4LUOA 3I7FA 4GKJL 3AYHB 2E5LL 3GDEA 3FP9A 2D0PA 1CSPA 3STBC 5JEAG 3K7AH 1Z92B 2GVBA 3F2CA 4OX9Q 4QL5A 2UU9Q 4AI3A 2A69D 3KDFB 3PF5A 4AI2A 2NYDA 3G71A 3CCSA 5MGNA 1X6OA 1SMWA 4DR2Q 4LUZA 3HOUH 2B63G 1SMMA 1ZRPA 1A62A 1VQEA 5EAYA 4LFBL 4GS7D 4LW1A 1XNQL 5LMUQ 5JEAJ 5AJ3L 4JI2Q 1KRTA 3CC7A 3PUWA 1XPUA 3S16H 1L1OC 2R93G 4DV4Q 3CD6A 2B29A 1PH2A 2R7FA 1PH4A 1T9PA 4BY1H 5ELOA 1J5EL 4XIGS 2HR5A 1SLJA 1QVFA 2HHHQ 1Q12A 1C09A 1S24A 1CKMA 1UE1A 4JI3L 3PKIA 1N36Q 4LF4L 2ES2A 1L1OB 4J15A 4LF5L 2JA6G 1BVSA 1IBKL 2NVTH 2ERSA 4DK3C 4BXXH 2EIFA 2J9UB 1LYLA 1J6QA 1NXGA 1Q1BA 3PO3H 5IYBG 4A93H 2CQOA 3KLWA 2F4VQ 4K0KL 5FJ8G 2ID0A 2D62A 1VQ8A 1R0JA 4IJHA 1Y1VG 1QZHA 2YTXA 1S40A 1HNWL 4DAYB 4L5RC 1FL0A 5C44H 1VQBA 5ELNA 5IT9c 3CPFA 2LXKA 3NENA 2CWAA 4JI8Q 2O5JD 3Q8DA 4GLXA 3P8BA 2UUAQ 2RHQB 2F3IA 3FKIH 2QA4A 3U4VA 2OTLA 2L15A 3D31A 1E3PA 4A3DG 1GO3E 2V1CC 3VPBE 1LKOA 4OX9L 4G6BA 2UU9L 2KCTA 3RN2A 2JI3A 2K5NA 1VQAA 2KBNA 4TQUS 4AYBG 5AI3A 4C2MH 3GTKH 1C7YA 4OXPA 5J3BA 2XGTA 3HOXG 5LMUL 4DR6L 3S2DH 3U4ZA 4JI2L 2CFMA 2VQFL 4GOPA 2AYJA 2MS3A 2Z6KA 1X55A 2AWNA 4DV4L 5IWAQ 2M6PA 2LXJA 2HHHL 1M1KC 2UXCQ 4OONA 4IFDG 1N36L 1R0GA 1I6HH 1PFSA 2ZTDA 3TQYA 3PKJA 4AHZA 3A0JA 3PIO1 5C0XG 4B3SQ 4BY7H 4AQYL 3G48A 3J81j 2VNUD 1Q7YC 3CAMA 4Y52H 4QQBX 1G51A 4IFDJ 4WJ4A 3PO2H 2VY3A 3JC62 2R92H 3U58A 1PVOA 3I55A 4BA1I 5GQOA 5C0XJ 3ULJA 4JI8L 5LMNQ 2PMZE 2GMGA 3VDYA 1QVCA 5FLMG 2ZM6Q 2I5MX 1L2FA 4HJ7A 1EYGA 1MKHA 2YTYA 1CKNB 2UUAL 2Q2TA 5BR8Q 3CCMA 5IYCG 4LWCA 3T1HQ 2VQEQ 1NXEA 2JK8A 3OYYA 4BBRH 1UEBA 3KF6A 1RB9A 4JI0Q 4C3JH 1JJCB 4YWKA 4YCWA 3PIP1 2K2DA 2Z0SA 4A3LH 3H3VH 1QVGA 2Z3QB 1KIXA 2PQAA 3HKZE 4X6AH 2XJPA 5K2ME 3CQZH 4UY81 4B8CD 2WFWA 1OWCA 4U671 5FLXc 4A3MH 1VQFA 5E7NA 5IP9G 4P72A 4AR3A 4GLVB 2WAQE 2NZOA 2JA8G 5IWAL 4KLKA 2D0OA 2BH8A 4B3RQ 4R4QA 2C6AA 3K80C 1EQQA 3HOWG 2VL6A 1ASYA 4DNIA 2LCQA 3GTOH 2NN6G 2B63H 4B3SL 4B3MQ 4YY3Q 4MNOA 2RCNA 3CPWA 1LTLA 4RMFA 3RLNA 4X64L 2HQLA 1VQ9A 1WOCA 1EIYB 1TWFH 2XJQA 2NVYH 1WYDA 5LMNL 2CKAA 4GN5A 1IL2A 1JT8A 1A8VA 2ZM6L 2CKCA 2E2HH 4LFBQ 4IFDI 1NTGA 5BR8L 3W1GA 1K9MC 1CADA 2JA6H 3KYUA 1B2OA 4TVMA 3T1HL 2ZIXA 5C0XI 5IYBH 3GTJH 4JI0L 1WCMG 3UDFA 4C3IH 1KXLA 3UDGA 4HJ5A 3HKZG 1JYBA 2XJRA 4TVAB 1Y1VH 2PNHA 3RNUA 3J81c 2DGYA 4YCVA 1J5EQ 5M5XH 1R0FA 4JI3Q 3NBHB 1I5FA 3M85A 3EBEA 4XTCS 3STBD 2I5HA 3W1BA 1YITA 3CCJA 1E8JA 2WAQG 4A3EH 2VZAA 3RYGA 4A75A 4XXBB 1RDVA 3E0EA 1S72A 1QUQA 5LMNW 1KC8C 1BQ8A 1Q46A 1XPRA 4IPCA 2A6ED 4GOPB 2OWOA 1CSQA 4P71A 1VZGA 1BKBA 4NB3A 1RIPA 5DM61 5MFPA 3HOZG 1YVCA 1A0IA 1NJIC 4JAGA 4B3RL 1NMFA 4JCVE 1YZ6A 1SN8A 3BZKA 4UY8C 2KENA 1T9OA 4JV5Q 4GS3A 1KAWA 1X56A 3S24A 2CR8A 3I56A 1I94Q 1LUZA 4YY3L 1PHJA 1IU6A 1JJ2A 1K83H 3WWVA 2R6GA 1NE3A 2OTJA 1X54A 1RYTA 4JAEA 1IZ6A 1NBWA 3KF8B 4R1JA 5GAEc 4A3CG 4DUYQ 3K81C 2JA5G 1P8LA 1O7IA 3A44A 1V1QA 1MJEA 3S17H 4HJ9A 4DR6Q 5IY0A 5GROA 3D0FA 1B2JA 1IXRA 4BBSH 2NN6I 2E8GA 1YHBA 4HJ8A 2VQFQ 4LF7Q 3CCLA 1EWIA 4HJAA 4UP7A 2E2IH 1W2BA 3H15A 5GAHC 4A3JH 4HIMA 4AHWA 1FGUA 3KYYA 4DK6C 1NY4A 1QYBA 3CMEA 2PQAB 3HOVG 4ZN1B 2JE6I 2A19A 1OXXK 1HNZQ 5FLMH 2EXDA 4JI5L 4DR3L 2B3GA 3ICEA 1BBUA 4AQYQ 5IP7G 3U50C 1VS0A 3TEHB 5IYCH 1IRNA 2NZHA 1VQHA 3GD7A 4JOIA 2JEBI 4LFCQ 2KCMA 3RZTA 4JADA 3F2DA 1SR3A 1PV4A 4JV5L 2AKWB 1WI5A 5M3FH 1RWDA 1Q86C 4A3BG 2K5VA 2C6BA 1K0RA 4EX5A 1I94L 3GTGH 4WJ3M 5M5YH 1TWCH 3RZOH 3TS2A 3KYXA 4JBWA 5M3MH 4DR7L 2IHEA 1A63A 1WJJA 5HGQA 1X65A 1DGSA 1UWVA 3M3YH 2WB1E 1EOVA 2XTIA 2JA8H 2NVQH 2JA7G 4DUYL 5IYDG 4RXNA 1E1OA 1HNXQ 3UE1A 3I2ZA 4AR5A 4JI1Q 4A3GG 3GTMH 3LNLA 7RXNA 3P2AA 5GAHc 5MFZA 3ER0A 2VUMG 1VQIA 4LF7L 3F2BA 1I50H 2M4YA 3HFZB 1Q8KA 1HJPA 4YWLA 3J7Z1 4DV5Q 1CAAA 1HZCA 4GLAC 4GNXA 2I0QA 3UDXA 5C4JH 1R9TH 2Q2UA 3EIVA 3CCQA 3HOYH 3I4MH 2NVXH 4DV7Q 3NEMA 4TPUA 3NELA 1GD7A 3PCOB 1OXSC 1HNZL 4MZ9A 4R4OA 4PZ8A 2ATWA 3JC63 4NPSA 1H95A 1ASZA 5GADC 1PH8A 1HH2P 1EFWA 3HOUG 1HZBA 1QUQB 3T1YL 3J7A5 4X64Q 4LFCL 5GAGC 2CCZA 4IO9A 3W5OA 1S2ZA 1WCMH 1OXVA 3IRBA 4PZ6A 3MXNB 3BJUA 2B5ID 1VQ6A 2Q2HA 3PUZA 5HY6A 3H0GG 4BY1G 1Q82C 3CCUA 4A4IA 2ZTCA 3S1MH 3I4NG 4HIOA 3I4OA 2QGQA 2RF4A 1Y1WH 4BXXG 4OO1G 3UE0A 1MJCA 3K7UC 3KJOA 3F8TA 3M7NA 1YHAA 2AHOB 5JJLA 1XTDA 1E22A 1VQNA 5JVH1 1X9NA 1FJGQ 1HNXL 3ZJYC 4A3KH 5RXNA 4ZN3B 4QY7A 5C44G 4JI1L 5AI2A 2GVAA 3L0OA 3G4SA 4KHZA 3OTOQ 1Q81C 1XPOA 3K0XA 1YHQA 3JAMc 4PZ7A 1R0HA 1MIUA 1R0IA 1N32Q 1L1OA 5JJKA 3A5ZB 4DV5L 4E6YA 1TXYA 4B3TL 4AI0A 2PPTA 3BZCA 1KQSA 2A1AA 4DV7L 1XMOQ 3EN2A 2R7ZG 3MEFA 3J80c 2UXDQ 4POFA 1YJNA 1U5KA 3MSUA 5C3EG 3J7ZC 1N9WA 1VQGA 2Q2IA 3TRZA 5MF6A 1V43A 3ULPA 4PMWA 2K75A 2PVEA 2R7DA 2R93H 1C9OA 3NFPI 2KHIA 4YCUA 3FHWA 1VQCA 4DUZQ 2YU9H 5C4XG 1CUKA 1Y14B 1VQOA 3AQQA 3PUYA 1GVPA 4NXNQ 1E1TA 1PYBA 2PSMC 1IYJB 3PZAA 4DR5L 3J81i 1IROA 1Q1EA 3K35A 5IP7H 2XJVA 4JBJA 5FJ8H 4HIDA 3BU2A 4AR4A 1XJVA 3CCEA 2K5HA 4IPDA 3RZDH 1E24A 2CKZB 4A3FG 1FJGL 1OTCA 2K14A 4UP9A 4GOPC 3OTOL 2Z6KC 1IBMQ 4LF8Q 3HKSA 4A3BH 2GN5A 2DUDA 1EIFA 1WJVA 4JI5Q 4DR3Q 2PVXA 3CF5A 1B7YB 1EUJA 2JI1A 4GNXC 1N32L 1BBWA 1KRSA 3QQCE 4DR1L 5AN9H 4R4IA 1VQ7A 4YWMA 1YIJA 3S1NH 1DVBA 3F1ZA 3B6YA 3M4PA 1TWAH 3ULLA 4QGUA 4P73A 5EIOC 4A3DH 2M4VA 1SRUA 1VQKA 4DR4Q 4OO1I 2ZJRA 4GNXB 1EQRA 1XMOL 3KOJA 2OQ0A 5EINC 4OWXB 3E9IA 2JA7H 2UXDL 4QJFA 2MO1A 1AE2A 2HT1A 2ZJQA 1LKPA 2IX1A 3E9HA 2AMCB 1K3RA 5MLC3 3HOXH 1PH3A 2LSSA 4A3GH 1VCIA 4DR7Q 1S30A 3CC4A 3ZG6A 3UDIA 1CKNA 4POGA 5K36G 4YHHQ 4DAMA 3KYVA 4JI4Q 2UUBQ 1VZIA 4LHNA 2A68D 2IHFA 1IW7D 1YJWA 3RLOA 3CXCA 4LF9Q 4OWWB 1HR0Q 4DUZL 2WP8J 3GTLH 1GKHA 3PUVA 1LKMA 4NXNL 1LM0A 2E2JH 1KD1C 1VQPA 2ALYB 2C35B 1YUXA 3OW2A 2EQSA 3KF6B 2QEXA 2N49A 4AYBE 3J7Y1 4GKKL 2K52A 3M4OH 1YI2A 2N3SA 4DPGA 4R4CA 3GTPH 1YEZA 2UXBQ 1ODHA 1Z47A 1DX8A 3DM3A 2N78A 1XMQQ 1IBML 4LF8L 3H0GH 4JI7Q 1OXUA 2BA1A 2V0EA 2UUCQ 3I4NH 1JE5A 4C3HH 1CKOA 3T1YQ 1IU5A 1K8AC 1Z9FA 4QIWE 4DR4L 4L5SA 3CCRA 4JYAQ 2KHJA 3TS0A 4IPHA 1XNRQ 1FHMA 2OCEA 1PH1A 1VQLA 3A5UA 4X62Q 4UP8A 4A3IG 6RXNA 4X65Q 4DV0Q 2RDVA 5H1Sc 2DSXA 4IOCA 2V3BB 5DLQE 4A3EG 1D8LA 2L0ZA 5IP9H 1JMCA 4PG3A 4YHHL 3M4QA 4K9FA 1YK5A 2I5LX 4LF6Q 4JI4L 2AWOA 2IY5B 1SMXA 4JBMA 2UUBL 1VQ4A 1VZHA 3PIOA 4ALPA 1YNXA 3LPEB 1HZAA 1PH6A 4LF9L 1BE7A 3SGIA 1HR0L 3CW2C 3KFUA 3PGZA 2MO0A 4GN4B 2R7ZH 3HOWH 1PA6A 4DV6Q 4O0AA 1YBYA 4IOAA 3TREA 4AH6A 3WWNB 4MTNA 3H3VI 4DR2L 5C3EH 2HIVA 2MFIA 3AFPA 3GTQH 3RN5A 4KHPQ 2JA9A 2BE5D 1VCXA 3RZ6A 1M90C 5DM71 3K8AA 4B3TQ 4V196 2FXQA 2BH2A 3SS2A 4IJLA 2ZTEA 1G291 2UXBL 1WFQA 8RXNA 4OWTB 3A74A 4LHLA 1UE6A 4O2DA 2OQKA 2MNAA 1XMQL 3PWFA 4DV1Q 1N34Q 1K73C 4L5QA 1E7ZA 4JI7L 3AFQA 4GN3B 4NXMQ 3PIPA 2UUCL 1S3OA 3GO5A 5C4XH 3CCVA 1VQDA 3S14H 4WFN1 1HR0W 4UPAA 1PYSB 1B71A 2MQHA 4JI6Q 1VQMA 1B8AA 1X3GA 4BBSG 1FHHA 4JYAL 2F4VL 1PH5A 1OXTA 3KYHC 2VS1A 1XNRL 1PH9A 4X62L 4A3FH 3CP0A 4A3JG 2RHSB 4X65L 4DV0L 1X3FA 3KDFA 1RYQA 4APVA 2YYZA 3M9BA 5H1SE 1NMGA 2WB1G 3LGJA 4DR5Q 2Y0SE 3RR5A 4AHYA 2K4KA 3PO3G 1JB7A 4LF6L 3L2PA 4A93G 4XGHA 1B70B 4AIMA 3WWLA 4EQ5A 1BQ9A 3RLFA 2F52A 4JAFA 3JAMi 3HOZH 4R4TA 3DLLA 4DV2Q 4DV3Q 1SROA 4HIKA 4DV6L 2KN9A 1B13A 4P74A 3CMAA 5M3FG 4AR6A 2H12A 5JVG1 2JEAI 4JG2A 4DR1Q 4KHPL 1IBLQ 3KJPA 3MPSA 2Z3RB 1QZGA 3J80i 2PI2E 5M3MG 2PYAA 1D7QA 1YK4A 4X66Q 1QCVA 3KYWA 2JJQA 3FKIG 1H7VA 5GADc 4KI0A 2PI2A 1UE5A 4A3CH 4DV1L 1N34L 4RG1A 1VQJA 5GAGc 5M5WH 2JA5H 4LFAQ 3L7ZC 4H02A 4NXML 3JC66 4JOIC 2UXCL 1KHIA 2XJUA 1G6PA 1SFOH 1P16A 2CWPA 1FVIA 1TWHH 4JI6L 1T9HA 2V0FA 1SMUA 4P75A 5JJIA 1RDGA 2VW9A 1N33Q 3S1RH 4JBKA 4GKJQ 2E5LQ 1N8RC 4BA2I 3AEVA 2H5XA 2Y0SG 1X3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMG A;  4Y7N H;  3VDY A;  2UUB Q;  2IHE A;  1QVC A;  5FLM G;  1A63 A;  3HOY G;  3I4M G;  3S1Q H;  1WJJ A;  2K50 A;  2ZM6 Q;  3HOV H;  2I5M X;  1L2F A;  5HGQ A;  4HJ7 A;  2IHF A;  1EYG A;  1X65 A;  1MKH A;  2YTY A;  4IPG A;  1CKN B;  1YJW A;  1DGS A;  3RLO A;  2UUA L;  1UWV A;  3CXC A;  2Q2T A;  4LF9 Q;  1C0A A;  5BR8 Q;  3CCM A;  5IYC G;  3M3Y H;  4OWW B;  2WB1 E;  1EOV A;  2XTI A;  4LWC A;  1HR0 Q;  3T1H Q;  2JA8 H;  2NVQ H;  2VQE Q;  3PUX A;  1RL2 A;  4DUZ L;  2JK8 A;  2JA7 G;  4DUY L;  5IYD G;  2WP8 J;  3OYY A;  4BY7 G;  4BBR H;  3GTL H;  1UEB A;  1GKH A;  3KF6 A;  1LKM A;  1RB9 A;  4RXN A;  3PUV A;  4NXN L;  1K8G A;  1LM0 A;  4C3J H;  1JJC B;  1KD1 C;  4YWK A;  2E2J H;  2A8V A;  1W3S A;  1E1O A;  1VQP A;  4YCW A;  5GAE C;  1HNX Q;  4GKK Q;  2YV5 A;  3UE1 A;  2VQE L;  2KKD A;  1I3Q H;  3I2Z A;  5AJ3 Q;  4AR5 A;  4JI1 Q;  2K2D A;  3CC2 A;  2ALY B;  2C35 B;  4A3G G;  4DV2 L;  3GTM H;  2Z0S A;  1YUX A;  4DV3 L;  7RXN A;  4A3L H;  3OW2 A;  1AH9 A;  3H3V H;  1QVG A;  2EQS A;  3ER0 A;  3KF6 B;  2N49 A;  2QEX A;  1KIX A;  2PQA A;  4AYB E;  4GKK L;  2K52 A;  3PO2 G;  3M4O H;  4JC0 A;  2VUM G;  1VQI A;  3HKZ E;  1PH7 A;  4LF7 L;  4X6A H;  2YTV A;  2R92 G;  4A3I H;  1YI2 A;  2N3S A;  4DPG A;  1TWG H;  2ASB A;  3F2B A;  4R4C A;  1I50 H;  3CQZ H;  4LUV A;  2M4Y A;  5IE8 A;  3GTP H;  3HFZ B;  1Q8K A;  1HJP A;  4YWL A;  1YEZ A;  4L5T A;  2UXB Q;  2WFW A;  1V9P A;  4DV5 Q;  1CAA A;  1HZC A;  4A76 A;  1NNQ A;  1T9Q A;  4GLA C;  1JJG A;  2PMZ E;  1Z47 A;  1DX8 A;  3DM3 A;  2JQO A;  2N78 A;  4GNX A;  1XMQ Q;  5FLX c;  4A3M H;  1IBL L;  2I0Q A;  3UDX A;  1U0L A;  1VQF A;  5C4J H;  1IBM L;  5E7N A;  1R9T H;  2Q2U A;  5IP9 G;  4LF8 L;  4P72 A;  4AR3 A;  3EIV A;  4GLV B;  4LF4 Q;  3CCQ A;  3HOY H;  3I4M H;  3H0G H;  1GM5 A;  4X66 L;  1BFY A;  2NVX H;  4DV7 Q;  2WAQ E;  4JI7 Q;  4LF5 Q;  2NZO A;  3S2H H;  1OXU A;  3NEM A;  1IBK Q;  2JA8 G;  5IWA L;  4TPU A;  2BA1 A;  4KLK A;  3NEL A;  2D0O A;  2UUC Q;  2BH8 A;  4ME3 A;  1GD7 A;  3S15 H;  3PCO B;  1OXS C;  2QL0 A;  4BBR G;  2BA0 A;  1Y1W G;  3I4N H;  1AE3 A;  1HNZ L;  1JE5 A;  4MZ9 A;  4R4O A;  1VQ5 A;  4K0K Q;  2N8N A;  4C3H H;  1CKO A;  4PZ8 A;  3T1Y Q;  2ATW A;  3PF4 A;  3PSI A;  4B3R Q;  3JC6 3;  4R4Q A;  1IU5 A;  4NPS A;  5IYD H;  1K8A C;  1H95 A;  1ASZ A;  1Z9F A;  3K80 C;  5GAD C;  1HH2 P;  1EQQ A;  1PH8 A;  4QIW E;  4DR4 L;  1EFW A;  2HIX A;  3CCR A;  4L5S A;  3ERS X;  4LFA L;  3HOU G;  3HOW G;  3PO3 G;  4JYA Q;  2VL6 A;  2KHJ A;  4FDB A;  1ASY A;  4DNI A;  2LCQ A;  1HZB A;  3TS0 A;  4IPH A;  4A3L G;  1QUQ B;  1UE7 A;  2IT1 A;  3G6E A;  3T1Y L;  1HNW Q;  1SE8 A;  3GTO H;  1XNR Q;  2NN6 G;  3PV0 A;  2B63 H;  1FHM A;  2OCE A;  4A3K G;  4X64 Q;  4LFC L;  1BRF A;  1HZ9 A;  5GAG C;  1PH1 A;  1VQL A;  3A5U A;  4B3S L;  2CCZ A;  4IO9 A;  4X62 Q;  4DKA C;  4UP8 A;  4A3I G;  6RXN A;  4B3M Q;  4YY3 Q;  4MNO A;  1S2Z A;  1WCM H;  1OXV A;  2RCN A;  2IX0 A;  3IRB A;  3W5O A;  3CPW A;  4PZ6 A;  1KL9 A;  3MXN B;  4X65 Q;  4DV0 Q;  3BJU A;  1LTL A;  2VUM H;  3QVD A;  4RMF A;  3RLN A;  2HQL A;  4X64 L;  1VQ9 A;  1N33 L;  1VQ6 A;  1WOC A;  2ZJP A;  4A3M G;  2RDV A;  4B3M L;  1YJ9 A;  2DSX A;  2Q2H A;  1YUZ A;  3PUZ A;  1YV1 A;  1EIY B;  4IOC A;  5HY6 A;  1L0W A;  4LNQ A;  4LUO A;  3I7F A;  4GKJ L;  3AYH B;  2E5L L;  3H0G G;  2V3B B;  4BY1 G;  1TWF H;  3GDE A;  5DLQ E;  1Q82 C;  3CCU A;  4A3E G;  1D8L A;  3FP9 A;  2D0P A;  1CSP A;  5IP9 H;  1JMC A;  4PG3 A;  4YHH L;  3STB C;  3M4Q A;  4A4I A;  2ZTC A;  4K9F A;  1YK5 A;  5JEA G;  3S1M H;  2NVY H;  1WYD A;  2I5L X;  4LF6 Q;  4JI4 L;  3K7A H;  3I4N G;  2AWO A;  2GVB A;  1SMX A;  5LMN L;  2IY5 B;  4JBM A;  2UUB L;  4HIO A;  1VQ4 A;  4JI0 Q;  4GN5 A;  3PIO A;  1IL2 A;  1JT8 A;  3F2C A;  4OX9 Q;  4QL5 A;  1A8V A;  2ZM6 L;  2UU9 Q;  3I4O A;  2E2H H;  4ALP A;  1YNX A;  2QGQ A;  4LFB Q;  3KDF B;  2RF4 A;  4IFD I;  1NTG A;  1Y1W H;  1HZA A;  3PF5 A;  1PH6 A;  3S17 H;  4BXX G;  4OO1 G;  3UE0 A;  4LF9 L;  5BR8 L;  3G71 A;  3W1G A;  1BE7 A;  3SGI A;  3CCS A;  1HR0 L;  1MJC A;  1X6O A;  1CAD A;  1K9M C;  3K7U C;  3CW2 C;  3KYU A;  1B2O A;  3F8T A;  3KJO A;  3T1H L;  3KFU A;  3M7N A;  1YHA A;  1SMW A;  2MO0 A;  3PGZ A;  4GN4 B;  4DR2 Q;  2AHO B;  4LUZ A;  5JJL A;  2R7Z H;  3HOU H;  2B63 G;  1SMM A;  1ZRP A;  1A62 A;  1VQE A;  1XTD A;  5EAY A;  5C0X I;  3HOW H;  5IYB H;  1PA6 A;  4LFB L;  3GTJ H;  4LW1 A;  1XNQ L;  1E22 A;  4JI0 L;  4DV6 Q;  1VQN A;  1WCM G;  4O0A A;  1YBY A;  3UDF A;  4C3I H;  5LMU Q;  1X9N A;  1KXL A;  1FJG Q;  3TRE A;  4AH6 A;  3UDG A;  4IOA A;  1HNX L;  3ZJY C;  4A3K H;  4HJ5 A;  4MTN A;  5JEA J;  3H3V I;  5RXN A;  3HKZ G;  4DR2 L;  5C3E H;  1JYB A;  2HIV A;  2MFI A;  4QY7 A;  3AFP A;  5C44 G;  4JI2 Q;  4JI1 L;  1KRT A;  5AJ3 L;  3CC7 A;  5AI2 A;  4TVA B;  2GVA A;  3GTQ H;  3L0O A;  1Y1V H;  3G4S A;  2PNH A;  3RN5 A;  3RNU A;  3J81 c;  2JA9 A;  4KHZ A;  3OTO Q;  2DGY A;  4KHP Q;  1Q81 C;  1XPO A;  4YCV A;  3K0X A;  3PUW A;  5M5X H;  1YHQ A;  1J5E Q;  1R0F A;  3JAM c;  1VCX A;  3RZ6 A;  1XPU A;  4PZ7 A;  1M90 C;  1R0H A;  4JI3 Q;  4B3T Q;  3K8A A;  3NBH B;  3S16 H;  1I5F A;  2FXQ A;  1L1O C;  2R93 G;  3M85 A;  1MIU A;  3EBE A;  1R0I A;  4DV4 Q;  2BH2 A;  1N32 Q;  3CD6 A;  3SS2 A;  1L1O A;  4IJL A;  2ZTE A;  2B29 A;  1G29 1;  4XTC S;  3STB D;  2I5H A;  1PH2 A;  3W1B A;  2UXB L;  3A5Z B;  5JJK A;  1WFQ A;  1YIT A;  8RXN A;  3CCJ A;  2R7F A;  4OWT B;  1T9P A;  4DV5 L;  5ELO A;  1PH4 A;  1E8J A;  2WAQ G;  4XIG S;  1J5E L;  4A3E H;  4BY1 H;  2HR5 A;  1SLJ A;  1UE6 A;  2VZA A;  3A74 A;  2HHH Q;  4O2D A;  1Q12 A;  1C09 A;  1QVF A;  1S24 A;  3RYG A;  1CKM A;  1TXY A;  1UE1 A;  2OQK A;  4JI3 L;  4A75 A;  1RDV A;  3E0E A;  4B3T L;  2MNA A;  1XMQ L;  3PWF A;  1S72 A;  4DV1 Q;  1QUQ A;  1N34 Q;  1N36 Q;  4LF4 L;  5LMN W;  1K73 C;  2ES2 A;  3BZC A;  1L1O B;  1KC8 C;  1BQ8 A;  4J15 A;  1KQS A;  1Q46 A;  4L5Q A;  1XPR A;  2A1A A;  1E7Z A;  4IPC A;  4DV7 L;  4GOP B;  1XMO Q;  4JI7 L;  4LF5 L;  2JA6 G;  3AFQ A;  1CSQ A;  1BVS A;  3EN2 A;  4GN3 B;  4P71 A;  1IBK L;  3PIP A;  2OWO A;  4NXM Q;  2NVT H;  1BKB A;  4NB3 A;  4DK3 C;  1RIP A;  2EIF A;  1LYL A;  2UUC L;  1J6Q A;  2R7Z G;  4BXX H;  1S3O A;  1Q1B A;  3GO5 A;  3MEF A;  5C4X H;  3PO3 H;  3J80 c;  5IYB G;  1VQD A;  3CCV A;  3S14 H;  4A93 H;  2CQO A;  3HOZ G;  2UXD Q;  1YVC A;  3KLW A;  1HR0 W;  4POF A;  4UPA A;  2F4V Q;  1PYS B;  1A0I A;  1B71 A;  4K0K L;  1NJI C;  2MQH A;  5FJ8 G;  4B3R L;  4JI6 Q;  2ID0 A;  4JI4 Q;  1NMF A;  4JCV E;  1YJN A;  1YZ6 A;  2D62 A;  1SN8 A;  3BZK A;  1U5K A;  1VQM A;  5C4X G;  4UY8 C;  2KEN A;  1I6H H;  1B8A A;  5C3E G;  3J7Z C;  1VQ8 A;  1X3G A;  1T9O A;  1R0J A;  1N9W A;  1FHH A;  4BBS G;  4JV5 Q;  4IJH A;  4JYA L;  4GS3 A;  1Y1V G;  1QZH A;  2F4V L;  1KAW A;  1VQG A;  2Q2I A;  2YTX A;  1S40 A;  3TRZ A;  1HNW L;  1PH5 A;  1OXT A;  1V43 A;  2VS1 A;  3KYH C;  4DAY B;  4L5R C;  1FL0 A;  1X56 A;  5C44 H;  3S24 A;  1XNR L;  1PH9 A;  3ULP A;  4PMW A;  3I56 A;  1VQB A;  4X62 L;  1I94 Q;  2K75 A;  2PVE A;  1LUZ A;  4YY3 L;  5ELN A;  5IT9 c;  1PHJ A;  2R7D A;  4A3F H;  1IU6 A;  3CPF A;  3CP0 A;  4A3J G;  2LXK A;  3NEN A;  2RHS B;  4X65 L;  4DV0 L;  1JJ2 A;  1K83 H;  3WWV A;  1X3F A;  2CWA A;  3KDF A;  4JI8 Q;  2R93 H;  4APV A;  2YYZ A;  3M9B A;  2R6G A;  5H1S E;  1NMG A;  1C9O A;  1NE3 A;  2OTJ A;  3Q8D A;  1X54 A;  2KHI A;  2WB1 G;  4YCU A;  4GLX A;  3LGJ A;  2UUA Q;  1RYT A;  1IZ6 A;  2RHQ B;  3FHW A;  1NBW A;  2F3I A;  3KF8 B;  4DR5 Q;  2Y0S E;  1VQC A;  4R1J A;  3RR5 A;  2K4K A;  3FKI H;  2QA4 A;  4A3C G;  3U4V A;  4DUZ Q;  2YU9 H;  4DUY Q;  1JB7 A;  2L15 A;  3K81 C;  3L2P A;  2OTL A;  1CUK A;  3D31 A;  4LF6 L;  4A93 G;  1E3P A;  1Y14 B;  4A3D G;  1GO3 E;  1VQO A;  2V1C C;  3AQQ A;  3PUY A;  2JA5 G;  1B70 B;  1GVP A;  1LKO A;  4NXN Q;  4AIM A;  4OX9 L;  4EQ5 A;  2UU9 L;  1E1T A;  1PYB A;  1BQ9 A;  1IYJ B;  3PZA A;  1P8L A;  2KCT A;  3RLF A;  2F52 A;  3J81 i;  4DR5 L;  3A44 A;  1IRO A;  1O7I A;  1Q1E A;  3RN2 A;  2K5N A;  3JAM i;  3HOZ H;  1V1Q A;  1VQA A;  2KBN A;  5IP7 H;  4R4T A;  1MJE A;  4JBJ A;  4TQU S;  5FJ8 H;  5IY0 A;  3DLL A;  4DV2 Q;  4HID A;  5GRO A;  4HJ9 A;  4AYB G;  3D0F A;  4DV3 Q;  1B2J A;  5AI3 A;  4C2M H;  4DR6 Q;  3BU2 A;  4AR4 A;  1IXR A;  3CCE A;  1XJV A;  2K5H A;  3GTK H;  1C7Y A;  4BBS H;  4IPD A;  1SRO A;  2NN6 I;  2E8G A;  3RZD H;  1YHB A;  4OXP A;  4HIK A;  4HJ8 A;  5J3B A;  2XGT A;  2VQF Q;  4DV6 L;  5LMN Q;  3HOX G;  1E24 A;  1EWI A;  2KN9 A;  3CCL A;  4LF7 Q;  1B13 A;  2CKZ B;  5LMU L;  4A3F G;  4DR6 L;  4HJA A;  1FJG L;  3S2D H;  4P74 A;  4UP7 A;  3CMA A;  1OTC A;  5M3F G;  2E2I H;  4AR6 A;  3U4Z A;  3H15 A;  1W2B A;  2K14 A;  4UP9 A;  4JI2 L;  4GOP C;  2CFM A;  2JEA I;  4JG2 A;  5GAH C;  4DR1 Q;  4A3J H;  4KHP L;  2VQF L;  3OTO L;  3KJP A;  4GOP A;  1IBL Q;  2Z6K C;  1IBM Q;  3MPS A;  4LF8 Q;  2MS3 A;  1QZG A;  3HKS A;  2Z6K A;  4A3B H;  2GN5 A;  3J80 i;  1X55 A;  1EIF A;  2PYA A;  2DUD A;  2PI2 E;  5M3M G;  4HIM A;  4DR3 Q;  1YK4 A;  4JI5 Q;  1D7Q A;  2PVX A;  4X66 Q;  3CF5 A;  1QCV A;  1B7Y B;  1FGU A;  2AWN A;  3KYY A;  1EUJ A;  4GNX C;  4DV4 L;  1N32 L;  3KYW A;  1BBW A;  1KRS A;  1NY4 A;  4DK6 C;  1QYB A;  2JJQ A;  3FKI G;  5IWA Q;  2PQA B;  3CME A;  4DR1 L;  4R4I A;  2JE6 I;  3HOV G;  1VQ7 A;  1H7V A;  2A19 A;  4YWM A;  1YIJ A;  3S1N H;  1DVB A;  2LXJ A;  3F1Z A;  3B6Y A;  1OXX K;  3M4P A;  2HHH L;  1HNZ Q;  1M1K C;  5FLM H;  2EXD A;  4JI5 L;  4DR3 L;  4KI0 A;  1TWA H;  2UXC Q;  4OON A;  3ULL A;  2PI2 A;  4QGU A;  2JA6 H;  3J7A 5;  1UE5 A;  4A3C H;  4DV1 L;  2B3G A;  4IFD G;  3ICE A;  4P73 A;  4RG1 A;  1N34 L;  1N36 L;  1R0G A;  1BBU A;  4A3D H;  1VQJ A;  1SRU A;  4AQY Q;  1VQK A;  5M5W H;  5IP7 G;  2JA5 H;  4DR4 Q;  3U50 C;  4OO1 I;  1VS0 A;  4LFA Q;  2ZJR A;  4GNX B;  1EQR A;  1PFS A;  2ZTD A;  3L7Z C;  4H02 A;  3TEH B;  3TQY A;  5IYC H;  1XMO L;  3KOJ A;  4NXM L;  1IRN A;  2NZH A;  3JC6 6;  4JOI C;  2OQ0 A;  1VQH A;  3GD7 A;  2UXC L;  1KHI A;  3A0J A;  4JOI A;  5C0X G;  2JEB I;  4OWX B;  3E9I A;  2JA7 H;  2UXD L;  1G6P A;  4QJF A;  1SFO H;  4LFC Q;  1P16 A;  4B3S Q;  4BY7 H;  2MO1 A;  2KCM A;  1AE2 A;  2CWP A;  4AQY L;  2HT1 A;  2ZJQ A;  1FVI A;  1TWH H;  4JI6 L;  1LKP A;  1T9H A;  3G48 A;  3J81 j;  3RZT A;  1SMU A;  2IX1 A;  3E9H A;  3F2D A;  2VNU D;  1SR3 A;  1Q7Y C;  1PV4 A;  3CAM A;  2AMC B;  4Y52 H;  4P75 A;  4QQB X;  5JJI A;  1K3R A;  4JV5 L;  1RDG A;  2VW9 A;  3HOX H;  1PH3 A;  2AKW B;  1XNQ Q;  2LSS A;  4A3G H;  1N33 Q;  1G51 A;  1VCI A;  3S1R H;  1WI5 A;  5M3F H;  4DR7 Q;  1RWD A;  1S30 A;  4JBK A;  1Q86 C;  4IFD J;  4A3B G;  4GKJ Q;  2K5V A;  2E5L Q;  4WJ4 A;  3CC4 A;  3PO2 H;  2VY3 A;  4EX5 A;  1K0R A;  3UDI A;  1I94 L;  3GTG H;  4WJ3 M;  1N8R C;  1CKN A;  4POG A;  3JC6 2;  2R92 H;  5K36 G;  5M5Y H;  3U58 A;  1PVO A;  4BA2 I;  3I55 A;  3AEV A;  1TWC H;  4YHH Q;  3RZO H;  3TS2 A;  3KYX A;  4JBW A;  5M3M H;  4BA1 I;  5GQO A;  4DAM A;  3KYV A;  2H5X A;  5C0X J;  3ULJ A;  4DR7 L;  4JI8 L;  2Y0S G;  1X3E A; 
#chains in the Genus database with same CATH topology
 4Y7N H;  3B08 B;  3NXW A;  4QIW B;  3HOY G;  3I4M G;  3S1Q H;  3URY A;  2K50 A;  1WTP A;  3HOV H;  2MPM A;  2A6H D;  4IPG A;  5EKL A;  2NUC A;  5I9P A;  5LL6 S;  1C0A A;  3OPO A;  5C44 L;  4J1M A;  3D4D A;  3DWA A;  1O7Y A;  4BBS B;  1G91 A;  1DCZ A;  3PUX A;  1RL2 A;  1JOK A;  5JOB A;  4BY7 G;  1Z7T A;  5J39 A;  1OWB A;  1PTO H;  2AQ1 B;  2K03 A;  1XNQ Q;  1K8G A;  2A8V A;  1W3S A;  3S16 B;  1VMC A;  5GAE C;  1BOS A;  4GKK Q;  2YV5 A;  4MN3 A;  2VQE L;  2KKD A;  1I3Q H;  3D4W A;  5AJ3 Q;  1TT2 A;  3CC2 A;  1EIH A;  4DV2 L;  1BCP F;  4DV3 L;  1AH9 A;  3SK8 A;  1KLG D;  2XJS A;  2JI2 A;  3PO2 G;  3FKI L;  4JC0 A;  5KRU A;  1PH7 A;  2WB1 B;  2YTV A;  4A3I H;  2CW0 D;  2R92 G;  2ASB A;  1TWG H;  3KBX A;  3JAM E;  4LUV A;  5IE8 A;  4L5T A;  1VDZ A;  2PO4 A;  4AHX A;  1V9P A;  4A76 A;  2NVT B;  1NNQ A;  1T9Q A;  1QIL A;  2Z4H A;  2APO B;  1JJG A;  3FVQ A;  2K32 A;  2MGS A;  2F3V A;  1FYC A;  2JQO A;  3PO3 B;  1IBL L;  4RGM A;  4A93 B;  2F0T A;  1U0L A;  3I91 A;  4M1U B;  2F0L A;  3QO2 A;  4LF4 Q;  2QEJ C;  3IL8 A;  2M6O A;  3Q23 A;  4X66 L;  1GM5 A;  1CA6 A;  1BFY A;  4LF5 Q;  3GTK L;  1U4M A;  3S2H H;  1KAB A;  1IBK Q;  5ELD A;  2L55 A;  4KY6 A;  4H7B A;  4ME3 A;  2Z6B A;  3B0A B;  5IT9 L;  3S15 H;  2QL0 A;  3S2D L;  2BA0 A;  4BBR G;  1B3Q A;  1Y1W G;  1AE3 A;  2L4N A;  1VQ5 A;  1EEI D;  4K0K Q;  1D1I A;  1UEA B;  2N8N A;  5C44 B;  1V1P B;  3OIQ A;  3PF4 A;  3PSI A;  5IOC A;  4N8F A;  5IYD H;  5KNC A;  4AI1 A;  2HIX A;  5G3L D;  3ERS X;  1ICW A;  2ICI A;  4LFA L;  2ERJ A;  4FDB A;  3IU3 I;  3K57 A;  5I2Y A;  5M3F B;  4A3L G;  3VYT A;  4RCO A;  1UE7 A;  3BVZ A;  2IT1 A;  5IGG A;  3G6E A;  5EQ0 A;  3D4R A;  1SE8 A;  1HNW Q;  3N6R A;  3PV0 A;  1KDB A;  2IX3 A;  4A3K G;  1QB5 D;  1BRF A;  1HZ9 A;  2E75 C;  4K2K A;  2XJT A;  5M5Y B;  4DKA C;  4KJO A;  1TWC B;  2IX0 A;  3MA2 B;  2DY8 A;  1T5X D;  1KL9 A;  1ENC A;  2VUM H;  3FKI B;  4J6H A;  3QVD A;  1N33 L;  3A54 A;  3L3O C;  2ZJP A;  4A3M G;  4B3M L;  4RGT A;  1YJ9 A;  1YUZ A;  1I6H L;  1YV1 A;  5EPJ A;  1L0W A;  4LNQ A;  1MHW C;  3I7F A;  4LUO A;  4GKJ L;  3AYH B;  2E5L L;  1ET6 A;  3GDE A;  1F2M A;  5LL6 X;  1RJT A;  4DFA A;  3FP9 A;  3P75 A;  1KDC A;  2D0P A;  1CSP A;  4BY7 L;  3STB C;  3GV3 A;  5JEA G;  4WJW A;  1HHV A;  1LT5 D;  3K7A H;  1Z92 B;  2GVB A;  1WTO A;  4C2M B;  1STE A;  2H1E A;  3GTK B;  3F2C A;  4OX9 Q;  4QL5 A;  4Y52 L;  2UU9 Q;  4AI3 A;  4TSS A;  1HCZ A;  2A69 D;  2F0K A;  5CYU A;  3MAQ A;  4I7A A;  3KDF B;  1S4Z A;  3PF5 A;  4F7X A;  2HCI A;  4AI2 A;  3S2D B;  2NYD A;  3G71 A;  2A6E C;  3CCS A;  5MGN A;  4TRD A;  1X6O A;  3TSS A;  3PO2 L;  1SMW A;  4DR2 Q;  4LUZ A;  2R92 L;  3HOU H;  2B63 G;  1SMM A;  1ZRP A;  1A62 A;  1VQE A;  5EAY A;  4LFB L;  1PZI D;  4GS7 D;  2F0W A;  2K05 A;  1L0Y B;  4LW1 A;  3LX0 A;  4F87 A;  1XNQ L;  3FPP A;  5LMU Q;  2KEC A;  2FIN B;  4RHS A;  1EY9 A;  3T53 B;  3MZ5 A;  5JEA J;  2ZXO A;  2WII B;  5AJ3 L;  4OIJ A;  2RDG A;  4JI2 Q;  1KRT A;  3CC7 A;  3WOE A;  2K5D A;  2G5D A;  3W2D A;  4PMC A;  2Y0S B;  1GUS A;  3A56 A;  1EZ8 A;  3PUW A;  4RCN A;  3U9S A;  4QUF A;  5A2Q E;  1XPU A;  3HOY B;  1EY0 A;  3S16 H;  5C4H A;  4HMI A;  1JCK B;  1L1O C;  2R93 G;  4DV4 Q;  1WTV A;  3H09 A;  3CD6 A;  2B29 A;  1PH2 A;  1I6H B;  4C3J L;  2R7F A;  1PH4 A;  1T9P A;  4BY1 H;  5ELO A;  4KKU A;  1J5E L;  4XIG S;  2HR5 A;  1SLJ A;  1QVF A;  2HHH Q;  1Q12 A;  1C09 A;  4OHJ A;  2RSN A;  1S24 A;  1CKM A;  1UE1 A;  4JI3 L;  4V0B A;  2EYO A;  3QG1 A;  2DNC A;  3KLS X;  4BY7 B;  3PKI A;  1N36 Q;  4LF4 L;  1KLU D;  3I70 A;  2ES2 A;  4A3L L;  4B08 A;  1MD2 D;  2EYM A;  3TZU A;  1L1O B;  4J15 A;  2WIN B;  3KLS A;  2FJ2 A;  4LF5 L;  2JA6 G;  2V4D A;  1BVS A;  1IBK L;  2NVT H;  2ERS A;  4DK3 C;  5IGF A;  2EIF A;  1LYL A;  2J9U B;  1J6Q A;  2QW7 A;  1NXG A;  4BXX H;  1Q1B A;  1EY8 A;  1HTL D;  3PO3 H;  5IYB G;  3CQZ L;  4A93 H;  2CQO A;  2Z4I A;  5CR3 A;  3KLW A;  2F4V Q;  4K0K L;  5TSS A;  1CHQ D;  5FJ8 G;  2ID0 A;  3NTI A;  4FF4 A;  2D62 A;  3PO2 B;  2EVB A;  3LWV B;  1GHK A;  2R92 B;  1VQ8 A;  2L11 A;  3N52 A;  1R0J A;  3KBG A;  4IJH A;  1Y1V G;  4G7Z C;  1QZH A;  2YTX A;  1VMP A;  1S40 A;  1HNW L;  1FNU A;  4DAY B;  4L5R C;  1FL0 A;  5C44 H;  4KKT A;  5CV6 A;  1VQB A;  5M5W L;  1LTR D;  5ELN A;  2L5T A;  5IT9 c;  1WTR A;  1NCV A;  2NBF A;  3CPF A;  2LXK A;  2QF7 A;  3NEN A;  3MTS A;  1DD2 A;  5C6A A;  5I4D A;  2CWA A;  4JI8 Q;  2O5J D;  4HTH A;  3R3O A;  3ND9 A;  2B2V C;  3H3V C;  2VXW A;  2FHT A;  1HUM A;  2WKD A;  1PZX A;  3FRP B;  4L63 B;  4BBR B;  3Q8D A;  4GLX A;  3P8B A;  2UUA Q;  4C3J B;  2IW3 A;  1D5M C;  2RHQ B;  2F3I A;  2F3W A;  3GTO L;  2B63 L;  1HRJ A;  2SEB D;  3FKI H;  2QA4 A;  1Z6H A;  3U4V A;  2OTL A;  2L15 A;  3D31 A;  3HZX A;  1E3P A;  4A3D G;  1GO3 E;  2V1C C;  3VPB E;  1LKO A;  4OX9 L;  4G6B A;  2UU9 L;  3NPP A;  2KCT A;  3JAM L;  2L9H A;  3RN2 A;  1SEB D;  2JI3 A;  2K5N A;  1Q90 A;  2EYP A;  2X69 A;  1VQA A;  3CQZ B;  2KBN A;  3E3X A;  2EY4 E;  4TQU S;  4AYB G;  2M9V A;  5AI3 A;  2B8F A;  4C2M H;  3V96 A;  1TWF L;  2F0M A;  1A3V A;  3GTK H;  1PTO D;  1C7Y A;  4A3M B;  2F0G A;  3DUZ A;  2NTS A;  3HEJ A;  4OXP A;  5J3B A;  2NVY L;  2XGT A;  3HOX G;  4FO2 A;  3HAX C;  1EOT A;  5LMU L;  4DR6 L;  3S2D H;  4C1N I;  4MHE A;  2B2W C;  3U4Z A;  2E2H L;  1HXY D;  4JI2 L;  4RA8 A;  2CFM A;  2VQF L;  4GOP A;  2AYJ A;  3J80 L;  2MS3 A;  2O5J C;  2JA6 L;  2Z6K A;  4XQN A;  1X55 A;  2CVR A;  2AQC A;  2PW7 A;  2AWN A;  4DV4 L;  5IYB L;  5IWA Q;  3GTJ L;  3NTH A;  2M6P A;  5A35 A;  2L0C A;  2XNA C;  4C3I L;  1A3T A;  2EY2 A;  2LXJ A;  2HHH L;  2K04 A;  4HR7 B;  1M1K C;  3GTO B;  5JPM C;  3QWN A;  2F1M A;  2UXC Q;  1XWE A;  2B63 B;  4OON A;  1S5B D;  4IFD G;  1QOH A;  3VR3 A;  1N36 L;  1ICF B;  1R0G A;  1BCP C;  3OMC A;  1Y1V L;  5DEH A;  3FDT A;  2KCN A;  1I6H H;  1PFS A;  2ZTD A;  3TQY A;  1LLR D;  3PKJ A;  1QNK A;  4AHZ A;  5IGC A;  3A0J A;  3PIO 1;  5C0X G;  2EXZ A;  3ERO A;  4B3S Q;  4BY7 H;  2F0E A;  4AQY L;  3VR6 A;  2F0P A;  2B2U A;  5IOD A;  5DM7 3;  4A3E L;  1SYG A;  3G48 A;  1BCP B;  3J81 j;  1TWF B;  2A74 C;  2VNU D;  2F0U A;  2EOT A;  3CAM A;  1Q7Y C;  4Y52 H;  4QQB X;  4TKO B;  2NVY B;  2OEO A;  1DXM A;  3SDZ A;  1G51 A;  3KF8 A;  1SJH D;  4LAA A;  1JWU D;  4ZLT F;  4IFD J;  1I4P A;  1F77 A;  4ODG A;  2JN4 A;  4K5W A;  2E2H B;  4CGY B;  3PO2 H;  2VY3 A;  4WJ4 A;  3EQL C;  2GA4 B;  3JC6 2;  2R92 H;  2CH4 W;  3U58 A;  1PVO A;  4R8N A;  3EVQ A;  3I55 A;  4UAI A;  3H9C A;  4BA1 I;  2JA6 B;  2R3Z A;  5GQO A;  5C0X J;  1Y8P B;  3ULJ A;  1QG7 A;  4JI8 L;  5LMN Q;  2PMZ E;  2GMG A;  3VDY A;  1QVC A;  2Q8R E;  5FLM G;  2ZM6 Q;  4WFN 3;  2I5M X;  1L2F A;  4HJ7 A;  3P20 A;  3GTJ B;  1EYG A;  4GZY C;  1ZYR D;  1MKH A;  2YTY A;  1ILQ A;  1CKN B;  1CK1 A;  2F0J A;  2UUA L;  2Q2T A;  4C3I B;  5BR8 Q;  3CCM A;  5IYC G;  4LWC A;  3Q6S A;  3PIO 3;  4DK0 A;  3T1H Q;  3H94 A;  3K58 A;  2VQE Q;  1STH A;  1NXE A;  1PMR A;  1SDF A;  2DJG C;  2JK8 A;  1Y1V B;  4RGO S;  2LS0 1;  3OYY A;  1JWM D;  5A2Q L;  4BBR H;  1SBB B;  5CV8 A;  5C3X A;  4XQQ A;  1UEB A;  3KF6 A;  1RB9 A;  4JI0 Q;  5M5X B;  1K83 L;  4C3J H;  1JJC B;  5ISR A;  4YWK A;  4YCW A;  1LTG D;  2K5Q A;  5ELE A;  3PIP 1;  4I65 A;  1CI3 M;  2K2D A;  2QIL A;  2B2Y C;  2J7Z A;  2Z0S A;  3H6M A;  4A3L H;  1D2B A;  3H3V H;  1QVG A;  2Z3Q B;  1LV9 A;  1KIX A;  2PQA A;  3LWQ B;  2BOS A;  3HP3 A;  4DU9 A;  3HKZ E;  4X6A H;  2XJP A;  1J9O A;  4WOR A;  5K2M E;  3CQZ H;  1MBY A;  4UY8 1;  4DK1 A;  2Z9H A;  2JSO A;  4B8C D;  2WFW A;  1OWC A;  1STG A;  4U67 1;  4QB4 A;  3G7L A;  3Q0A A;  5FLX c;  4A3M H;  4Q5V A;  1VQF A;  1CQF A;  5E7N A;  3S17 L;  5IP9 G;  1O7Z A;  4P72 A;  4AR3 A;  4GLV B;  1SE4 A;  4L8J A;  2WAQ E;  2NZO A;  4BBS L;  5FOB B;  3R2T A;  2JA8 G;  5IWA L;  4KLK A;  4DAV A;  2LY7 A;  1TS3 A;  2D0O A;  5JEA H;  2BH8 A;  4AYB B;  4CKB A;  1SSO A;  1I4R A;  1E2W A;  1LTT D;  1OO9 B;  3S16 L;  2E2I L;  4B3R Q;  1FGB D;  1A6X A;  3I8Z A;  4R4Q A;  4KD3 A;  2C6A A;  3K80 C;  2EJF C;  1EQQ A;  4A3J L;  3HOW G;  3V2T A;  2VL6 A;  1ASY A;  4DNI A;  2LCQ A;  1K83 B;  2PNR C;  1EIG A;  1UUP A;  4X3T A;  4RH6 A;  5JVG 3;  3GTO H;  2WAC A;  2NN6 G;  4KMU C;  3QIA A;  3VYS A;  2B63 H;  4B3S L;  4NDX A;  1PFN A;  4B3M Q;  4KN7 C;  2EE1 A;  2HCC A;  4MNO A;  2RCN A;  4YY3 Q;  3CPW A;  3T51 B;  5FLM L;  1BR9 A;  2P5Z X;  1LTL A;  3MVV A;  2OT2 A;  4RMF A;  3RLN A;  4X64 L;  2HQL A;  2L12 A;  1VQ9 A;  1WOC A;  2RVL A;  3NSW A;  1E0B A;  3HRZ C;  5I6W A;  3M4Y A;  3A8I E;  3QOJ A;  1EIY B;  5C5L A;  1PLF A;  2PPB C;  1TWF H;  2KEE A;  1EY5 A;  2XJQ A;  2E76 C;  4QIW P;  3S17 B;  2NVY H;  4DNR B;  1WYD A;  1CA5 A;  1AEX A;  5LMN L;  3HS0 C;  2CKA A;  3SK5 A;  1V8Q A;  4J8Q A;  4YIJ A;  1PFV A;  1TR5 A;  4GN5 A;  1IL2 A;  1JT8 A;  1A8V A;  2ZM6 L;  4QF4 A;  2CKC A;  2E2H H;  3HGB A;  3A8J E;  4LFB Q;  2EYF A;  3E0J A;  4IFD I;  1NTG A;  3K6O A;  2IL8 A;  1TY2 A;  5M3F L;  5BR8 L;  1PFU A;  3W1G A;  5HGT A;  1IKM A;  1K9M C;  1CAD A;  4FXK C;  5CV9 A;  2JA6 H;  3KYU A;  1B2O A;  4TVM A;  3T1H L;  2E2I B;  2ZIX A;  1ILP A;  4ZUJ A;  3GTG L;  4PQX A;  5M5Y L;  3ONA B;  2H4O A;  5C0X I;  4A3J B;  1H9S B;  5IYB H;  1TWC L;  3RZO L;  4RAU C;  3GTJ H;  3HJW B;  5M3M L;  1W6J A;  4JI0 L;  1WCM G;  3UDF A;  4C3I H;  1KXL A;  3H97 A;  3UDG A;  1STA A;  1FNW A;  5LHY 1;  4HJ5 A;  2Z1C A;  3MWY W;  3EA6 A;  3HKZ G;  1A2U A;  1JYB A;  2XJR A;  2K33 A;  4HCS A;  4TVA B;  1Y1V H;  4OL7 A;  1JQY D;  2PNH A;  2C5C A;  3RNU A;  3J81 c;  2KA7 A;  2DGY A;  1RTN A;  4CDC C;  4YCV A;  3M3Y L;  1J5E Q;  5M5X H;  2WB1 P;  1R0F A;  1GHJ A;  3AU7 A;  4KN4 C;  2JA8 L;  4JI3 Q;  3NBH B;  1I5F A;  4CKC A;  3M85 A;  2F03 A;  3EBE A;  2B2T A;  5K5P A;  4XTC S;  3STB D;  2I5H A;  2R61 A;  3W1B A;  1YIT A;  3CCJ A;  4QCL A;  1E8J A;  2WAQ G;  4A3E H;  1BDO A;  1STB A;  2VZA A;  1UAP A;  3RYG A;  4A75 A;  4XXB B;  1RDV A;  2HDL A;  2SOB A;  3E0E A;  1S72 A;  1QUQ A;  4XXE A;  2EY5 A;  4IUR A;  3GTM L;  1UNS A;  5LMN W;  1JIC A;  3BDC A;  2XWJ B;  5IGE A;  1KC8 C;  1BQ8 A;  1Q46 A;  4KY7 A;  1XPR A;  4IUV A;  4IPC A;  2A6E D;  4GOP B;  2OWO A;  1CSQ A;  1QJO A;  4P71 A;  1VZG A;  1BKB A;  4NB3 A;  1RIP A;  5DM6 1;  5MFP A;  3MXN A;  4ID6 A;  1I50 L;  3HOZ G;  3R93 A;  1YVC A;  5T1G A;  1O78 A;  4X3U A;  3EJI A;  4KV6 A;  1A0I A;  1NJI C;  4JAG A;  4B3R L;  1NMF A;  4JCV E;  1QQT A;  1EY6 A;  1YZ6 A;  2RFK B;  1SN8 A;  3BZK A;  3C2P A;  3GTG B;  4UY8 C;  2KEN A;  1I4X A;  3K5L A;  1TVX A;  4K8J A;  1T9O A;  5C4J L;  4JV5 Q;  1R9T L;  3RZO B;  4GS3 A;  5M3M B;  1SYB A;  1KAW A;  2AUJ D;  2F4I A;  3HOY L;  3OOC A;  3I4M L;  2F0D A;  2NVX L;  4ZAI A;  5EPL A;  1X56 A;  3S24 A;  2CR8 A;  3HJY B;  3I56 A;  1I94 Q;  1LUZ A;  4YY3 L;  1PHJ A;  1HFG A;  1IU6 A;  2K5W A;  3M3Y B;  1JJ2 A;  5EPK A;  1K83 H;  3WWV A;  5CC4 A;  1GUT A;  1H9K A;  2JA8 B;  2NVQ B;  2R6G A;  5EKI A;  1NE3 A;  2OTJ A;  1IYU A;  1X54 A;  5CV5 A;  3VA5 A;  3IFD A;  2ZXR A;  1AW7 A;  1RYT A;  4JAE A;  4O1N A;  1IZ6 A;  3OIP A;  1NBW A;  3KF8 B;  5EKK A;  4R1J A;  5KEE A;  2TSS A;  1TQO A;  4NMZ A;  4ZUI A;  2CQA A;  5GAE c;  1NNX A;  3FPU B;  3HOW B;  3MQK B;  4A3C G;  2PW5 A;  3GTM B;  1WCM L;  5C4Z A;  3K81 C;  4DUY Q;  3L9A X;  2AQ2 B;  3RUZ A;  1C8C A;  2JA5 G;  1AP0 A;  2XWB B;  3SE0 A;  4XQJ A;  1F9R A;  1P8L A;  5JJZ A;  2M2L A;  3A44 A;  1O7I A;  5I9O A;  2EZV A;  1SE2 A;  1B50 A;  1GUG A;  2O4X A;  1V1Q A;  4LJZ C;  3I4L A;  1I50 B;  5D3D A;  1MJE A;  3S17 H;  4HJ9 A;  4DR6 Q;  5IY0 A;  5GRO A;  4IQZ A;  3D0F A;  1B2J A;  4G57 A;  3BDL A;  3K59 A;  1IXR A;  3BYT B;  5C0X H;  4BBS H;  4HED A;  3C1E A;  2NN6 I;  1F4L A;  2E8G A;  1SNO A;  1YHB A;  5C4J B;  4XYQ A;  3S1M L;  4HJ8 A;  1R9T B;  3FDJ A;  2VQF Q;  4LF7 Q;  2PMZ B;  3CCL A;  1EWI A;  5ELC A;  1EYD A;  4HJA A;  3I4M B;  4UP7 A;  4S3S A;  2NVX B;  5CBA E;  1KAA A;  2E2I H;  5KIX A;  1W2B A;  3H15 A;  2Y0S P;  1TY0 A;  4BBR L;  1Y1W L;  3J81 E;  5GAH C;  2EY6 A;  4A3J H;  4B9W A;  3H3V M;  1LTA D;  2K01 A;  1RHP A;  5EGT A;  4HIM A;  4AHW A;  3GQB A;  1FGU A;  3KYY A;  5BN3 A;  4DK6 C;  1NY4 A;  1DJR D;  1I4Q A;  1QYB A;  3CME A;  2PQA B;  3HOV G;  4ZN1 B;  2JE6 I;  2F0S A;  4HSP A;  2AUS B;  2A19 A;  2SNS A;  5IIF A;  4HAE A;  2MHV A;  1JOR A;  1OXX K;  1HNZ Q;  4A3K L;  5FLM H;  2A68 C;  2EXD A;  4JI5 L;  4DR3 L;  4MTK A;  4X6A L;  1STN A;  2B3G A;  3ICE A;  2HVY C;  1BBU A;  1WCM B;  4AQY Q;  5IP7 G;  3U50 C;  1VS0 A;  3TEH B;  5IYC H;  4N8X 1;  1IRN A;  2NZH A;  3HKZ B;  1VQH A;  3GD7 A;  2D2C C;  4A3M L;  3CRK C;  4JOI A;  2JEB I;  4LFC Q;  3VR2 A;  2KCM A;  3CU7 A;  1JWS D;  2HUG A;  3RZT A;  1A2T A;  4JAD A;  3P1H A;  2KQ3 A;  3F2D A;  1QE6 A;  1SR3 A;  2I07 B;  1PV4 A;  1B1Z A;  4JV5 L;  2AKW B;  3S1M B;  4X3K A;  4FF1 A;  1SYC A;  1WI5 A;  1YNN C;  1SNQ A;  2WAQ B;  3SK6 A;  5M3F H;  3NUC A;  1RWD A;  3OW7 A;  1Q86 C;  3U9O A;  4A3B G;  1HTP A;  2K5V A;  2C6B A;  1K0R A;  4EX5 A;  1I94 L;  3GTG H;  1B9N A;  4WJ3 M;  2KHS A;  3UI2 A;  1Y1W B;  1SMY C;  3T4A C;  5M5Y H;  3PMF A;  1TWC H;  3QR8 A;  3RZO H;  1SXT A;  3KYX A;  1TS5 A;  4JBW A;  3TS2 A;  5M3M H;  4EQP A;  2SDF A;  4DR7 L;  1EYA A;  1XX8 A;  2IHE A;  5I2X A;  1QNU A;  1A63 A;  1WJJ A;  4XT1 B;  5HGQ A;  4CDF C;  1HQM C;  1NR4 A;  1X65 A;  1BCP D;  1DGS A;  5I6Y A;  4FP5 D;  1UWV A;  1EFI D;  3M3Y H;  2WB1 E;  4A3K B;  1EOV A;  2XTI A;  3E6Z X;  3NWS A;  1II3 A;  2JA8 H;  1W6K A;  2NVQ H;  4ZKC B;  3DWP A;  3IFT A;  5E4W C;  5F2D A;  2JA7 G;  4DUY L;  5IYD G;  4BWG B;  4PNY A;  4RXN A;  2F0O A;  4DGZ A;  2R93 L;  1E1O A;  2LKV A;  1HNX Q;  1G2T A;  1EQT A;  4H13 C;  3UE1 A;  1R4P B;  3I2Z A;  2SNM A;  4AR5 A;  4JI1 Q;  4A3G G;  3GTM H;  3LNL A;  7RXN A;  4KK7 A;  3P2A A;  5GAH c;  1GJX A;  4CJ2 C;  5MFZ A;  3ER0 A;  1Q8I A;  1SNC A;  2NN6 H;  2K1B A;  2KJX A;  2VUM G;  1VQI A;  4LF7 L;  4OIK A;  4IN3 A;  3F2B A;  1I50 H;  5M9O A;  2M4Y A;  3HFZ B;  1Q8K A;  1HJP A;  4YWL A;  3J7Z 1;  4DNT B;  3RMH A;  3QJY A;  3AB9 A;  4DV5 Q;  1CAA A;  1HZC A;  4GLA C;  3SXH A;  5KNB A;  1MGS A;  1P7P A;  4V19 0;  1YNJ C;  4GNX A;  1A3U A;  1F9S A;  2RBM A;  2I0Q A;  5IP7 L;  4QUC A;  3UDX A;  5C4J H;  1R9T H;  5FJ8 L;  2Q2U A;  1TKW B;  1XYI A;  3A55 A;  3EIV A;  4DA2 A;  1V1P A;  3CCQ A;  3HOY H;  1DOL A;  3BVG A;  1ZXT A;  3I4M H;  2NVX H;  4DV7 Q;  1S5D D;  3NEM A;  1K8O A;  4TPU A;  1F9Q A;  3NEL A;  3RZD L;  1IKL A;  1SFO B;  1GD7 A;  3PCO B;  5M5X L;  1OXS C;  2N55 A;  1HNZ L;  4MZ9 A;  4R4O A;  4MIU A;  4PZ8 A;  2ATW A;  3JC6 3;  3J7A F;  1D5X C;  4NPS A;  3MHB A;  1H95 A;  1ASZ A;  5GAD C;  1PH8 A;  1HH2 P;  1EFW A;  3HOU G;  3C1F A;  3S1R B;  4ULL A;  1HZB A;  4A3B L;  3TP5 A;  1S5E D;  1K8M A;  1QUQ B;  2LMC B;  2R93 B;  2RCF A;  5HUR A;  3T1Y L;  2NYZ D;  2J0T D;  3J7A 5;  3TP8 A;  4X64 Q;  4LFC L;  3MFY A;  3MEH A;  5GAG C;  4CDD C;  2Q8I B;  1V1O A;  2CCZ A;  4IO9 A;  4JVZ A;  3W5O A;  1S2Z A;  1WCM H;  1OXV A;  3IRB A;  1WD0 A;  3A7A B;  4PZ6 A;  3MXN B;  1TWA L;  3BJU A;  2B5I D;  5IT9 E;  4RWS C;  3HOV B;  1VQ6 A;  2YU9 B;  4A3D L;  2XN9 C;  3VYU A;  1HFN A;  2BE5 C;  2Q2H A;  3PUZ A;  5EJW A;  1WTX A;  1NR2 A;  5HY6 A;  2G9D A;  3H0G G;  4BY1 G;  1Q82 C;  1TS4 A;  1X32 A;  3MXP A;  3VYR A;  4ME5 A;  3CCU A;  2JA7 L;  4U68 A;  1GUW A;  2K6A A;  2ZTC A;  4A4I A;  3S1M H;  1FNV A;  4WRD A;  1VF7 A;  4OEL B;  1PFM A;  5DAU A;  1RTO A;  3I4N G;  2X6L A;  2BDN A;  4HIO A;  4C3H G;  3A7L A;  3I4O A;  2CHB D;  3HOX L;  2F0H A;  3RZD B;  2QGQ A;  4A3G L;  2RF4 A;  1Y1W H;  3TP6 A;  4BXX G;  4OO1 G;  3UE0 A;  4I7Z C;  1MJC A;  4LK1 C;  3K7U C;  3KJO A;  3F8T A;  4CJ0 B;  1JC7 A;  3M7N A;  1YHA A;  2AHO B;  5JJL A;  1XTD A;  1T5E A;  2D5D A;  2QDL A;  1D1K A;  1TWG B;  3LNN A;  1E22 A;  1VQN A;  4F8M A;  5JVH 1;  1X9N A;  4A3B B;  1FJG Q;  1D5Z C;  4XYO A;  1HNX L;  3ZJY C;  4A3K H;  1B4O A;  1GOZ A;  5RXN A;  3SEB A;  4ZN3 B;  4QY7 A;  1K0S A;  5C44 G;  4JI1 L;  1STY A;  5AI2 A;  3ITP A;  2GVA A;  1NUC A;  3L0O A;  4HN7 A;  3G4S A;  3S1N B;  4KHZ A;  3OTO Q;  1Q81 C;  1XPO A;  3K0X A;  1YHQ A;  3JAM c;  1TWA B;  2HDM A;  4PZ7 A;  1R0H A;  1DOM A;  1LAB A;  1ENA A;  3TP7 A;  3MXU A;  4C1N K;  1MIU A;  4A3D B;  1R0I A;  1N32 Q;  1L1O A;  3K5O A;  3GTL L;  5JJK A;  3A5Z B;  2E2J L;  1KNE A;  1PYW D;  3NBI A;  4DV5 L;  2EYH A;  1IHZ A;  1TII D;  4E6Y A;  1TXY A;  1PRT B;  4B3T L;  2JA7 B;  4AI0 A;  3LWR B;  5ELF A;  2IJ0 A;  3H91 A;  4HCE A;  3P7J A;  2PPT A;  1LTI D;  3BZC A;  1KQS A;  3KUP A;  2A1A A;  4FNF A;  4DV7 L;  2FFK B;  1XMO Q;  2L1B A;  3EN2 A;  2FMM A;  3PIP 3;  4AYB P;  4K2L A;  1GUO A;  3M4O L;  3HOX B;  2KVM A;  2R7Z G;  4A3G B;  1O80 A;  3M7G A;  3MEF A;  3J80 c;  2UXD Q;  3GTP L;  4POF A;  4DAY A;  5CBE E;  1Y69 U;  1S5C D;  1YJN A;  2RQX A;  1U5K A;  3MSU A;  1ML0 D;  5C3E G;  3J7Z C;  3HG9 A;  3E5S A;  1F2Y A;  1N9W A;  2KOL A;  1VQG A;  3IAY A;  2Q2I A;  4U67 3;  2F0I A;  3H0G L;  1G8Z D;  3TRZ A;  5MF6 A;  1V43 A;  4ZCK A;  4JPB W;  2PYK A;  3ULP A;  3QB3 A;  4PMW A;  2K75 A;  2PVE A;  2A73 B;  2R7D A;  5IYC L;  3I4N L;  2JXM B;  2WKC A;  4CDE C;  3PL5 A;  3OWE B;  4C3H L;  4HMJ A;  2R93 H;  1HA6 A;  1SND A;  1WD1 A;  3BZD B;  1C9O A;  3NFP I;  3OHX C;  1Y8N B;  2KHI A;  1R4Q B;  4YCU A;  3GTL B;  5KGU A;  2E2J B;  3R8B A;  3FHW A;  2DN8 A;  1VQC A;  1Q3L A;  1EU4 A;  3HOU B;  2KUM A;  3BVM A;  1DM0 B;  4NKL A;  4CKE A;  4DUZ Q;  2YU9 H;  3CKI B;  4DXG A;  5C4X G;  1CUK A;  1KNA A;  1G2S A;  1Y14 B;  4G4K A;  1VQO A;  3NE5 B;  3MFG A;  1KDA A;  2N88 A;  3AQQ A;  3PUY A;  1GVP A;  3X3N A;  4NXN Q;  1E1T A;  1PYB A;  2PSM C;  1IYJ B;  3PZA A;  1SE3 A;  3J81 i;  4DR5 L;  3M4O B;  1IRO A;  1Q1E A;  1HPC A;  1MSG A;  1DON A;  3K35 A;  1M4V A;  5IP7 H;  3GTP B;  2XJV A;  4JBJ A;  5FJ8 H;  4HID A;  4R8I A;  4H0L C;  3H99 A;  1E2Z A;  3PQI A;  4FF2 A;  2D9U A;  3DEP A;  3BU2 A;  4AR4 A;  1XJV A;  3CCE A;  2K5H A;  2EY1 A;  4IPD A;  5IP9 L;  4N9P A;  2B39 A;  3RZD H;  4R9W A;  1E24 A;  2CKZ B;  4A3F G;  3DMU A;  2NTT A;  5T1I A;  2AQ3 B;  1FJG L;  3H0G B;  4BY1 B;  3V05 A;  4ABN A;  2NVQ L;  1CFM A;  1OTC A;  2B2W A;  2K14 A;  4UP9 A;  4GOP C;  1CHP D;  2EPB A;  1NAP A;  1F2Z A;  1RCV D;  3G6J B;  1WTH A;  3OTO L;  4CHT B;  3I4N B;  2Z6K C;  1B9M A;  1IBM Q;  2RDH A;  4LF8 Q;  1CT1 D;  3HKS A;  4FYD A;  1TU2 B;  4A3B H;  2GN5 A;  4C3H B;  2DUD A;  1EIF A;  1WTQ A;  1WJV A;  5FLX E;  4JI5 Q;  4DR3 Q;  2F0F A;  2PVX A;  3CF5 A;  4UDU C;  2R7Z L;  1B7Y B;  3JR7 A;  3HOW L;  1PTO F;  1EUJ A;  2JI1 A;  4K14 A;  2Z8L A;  3NQT A;  1BBW A;  1KRS A;  4GNX C;  4IAL A;  1N32 L;  3QQC E;  1LT6 D;  4DR1 L;  5AN9 H;  4R4I A;  3I73 A;  1VQ7 A;  2IWH A;  4YWM A;  1YIJ A;  4HSV A;  3S1N H;  1DVB A;  4ZYS A;  3F1Z A;  3B6Y A;  3M4P A;  1M8A A;  4ZK9 B;  2RA4 A;  5IGB A;  1TWA H;  5C3E L;  3ULL A;  4QGU A;  5JPN C;  2A6H C;  4P73 A;  5CGK A;  3GTQ L;  3R2I A;  1ESR A;  1LTS D;  5EIO C;  4A3D H;  2M4V A;  1S5F D;  1SRU A;  2F0N A;  1DYQ A;  1VQK A;  4DR4 Q;  4OO1 I;  2ZJR A;  4GNX B;  1EQR A;  1XMO L;  3KOJ A;  2KCC A;  5C5M A;  2OQ0 A;  5EIN C;  1KTK A;  4C3J G;  5C3W A;  3J80 E;  4RFB A;  4K8I A;  4OWX B;  3E9I A;  2JA7 H;  2UXD L;  4QJF A;  2B2U C;  2MO1 A;  1AE2 A;  2HT1 A;  2ZJQ A;  1LKP A;  3VR5 A;  2IX1 A;  3E9H A;  2AMC B;  1K3R A;  2CH4 A;  5MLC 3;  4EQO A;  3HOX H;  1PH3 A;  2LSS A;  4A3G H;  3T56 B;  3D3R A;  1BUV T;  1VCI A;  4N9T A;  2HQE A;  4DN4 M;  4DR7 Q;  1S30 A;  4KY5 A;  4LMQ D;  4RHR A;  3CC4 A;  4CJ1 B;  3ZG6 A;  3UDI A;  1CKN A;  4POG A;  2CW0 C;  5C4X L;  5K36 G;  3S14 L;  1A15 A;  4YHH Q;  1PRT F;  4DAM A;  3KYV A;  4JI4 Q;  2UUB Q;  5DM6 3;  1U4R A;  1VZI A;  4LHN A;  2A68 D;  2R7Z B;  5FO7 B;  3BG3 A;  2F0V A;  1IL8 A;  2IHF A;  1IW7 D;  1YJW A;  3RLO A;  3CXC A;  1LAC A;  4LF9 Q;  4EQN A;  1ZEQ X;  4FVM A;  4OWW B;  1HR0 Q;  1BXT A;  4IFD H;  5D65 A;  5C3E B;  2RDF A;  4IUQ A;  1U4P A;  3RD4 A;  4DUZ L;  3GTQ B;  3QOL A;  4A3F L;  2J4X A;  2WP8 J;  1HA5 A;  3NWT A;  3GTL H;  1GKH A;  3PUV A;  1LKM A;  4NXN L;  4JK1 C;  1LM0 A;  2E2J H;  1KD1 C;  2O5I C;  3KLR A;  1VQP A;  1HUN A;  1SYD A;  3K5M A;  1CTM A;  2JYO A;  3LWU A;  5BN4 A;  1ENF A;  1XXG A;  2ALY B;  2C35 B;  1YUX A;  3OW2 A;  1YNN D;  2B2Y A;  2EQS A;  1SYF A;  3KF6 B;  2N49 A;  2QEX A;  2PMZ P;  4AYB E;  3J7Y 1;  4GKK L;  1G6Z A;  2K52 A;  3M4O H;  2DJF C;  1YI2 A;  2N3S A;  2TMP A;  3I90 A;  4DPG A;  1SMY D;  4R4C A;  4EGV A;  3GTP H;  1YEZ A;  2UXB Q;  2XRQ D;  2AUK A;  3DM1 A;  1BNZ A;  1ODH A;  3EFX D;  5E4X A;  1Z47 A;  1DX8 A;  3HOZ L;  1EZ6 A;  1JR0 D;  3DM3 A;  2N78 A;  4FXD A;  5C4X B;  3T13 A;  1XMQ Q;  1ONL A;  2XIW A;  3S14 B;  3GV6 A;  1IBM L;  5D3I B;  4LF8 L;  3IKJ A;  1RDP D;  4X3S A;  3H0G H;  4FXG C;  4JI7 Q;  4KKS A;  1OXU A;  1IW7 C;  4DXF A;  2BA1 A;  2V0E A;  1JOO A;  1PZK D;  5NUC A;  2UUC Q;  4F88 A;  3ND8 A;  2MUY A;  3I4N H;  1JE5 A;  4QMG A;  4C3H H;  1CKO A;  3T1Y Q;  5EBC A;  3SR1 A;  2A69 C;  1IU5 A;  1GUN A;  1K8A C;  3O13 A;  1Z9F A;  4QIW E;  4A3F B;  3HKZ P;  4DR4 L;  4L5S A;  3CCR A;  2DY7 A;  3K5N A;  4OO1 H;  4PV1 C;  5CV7 A;  4JYA Q;  2KHJ A;  1MI2 A;  3TS0 A;  3OMG A;  4IPH A;  3OWF A;  4K6D A;  2HD3 A;  4IZ8 A;  1EY7 A;  4C3I G;  2VB2 X;  2EYL A;  1XNR Q;  1X3P A;  2B8G A;  1SJE D;  1FHM A;  2OCE A;  3NK9 A;  4K5X A;  3T16 A;  1PH1 A;  1VQL A;  3A5U A;  4H44 C;  4X62 Q;  4UP8 A;  4A3I G;  6RXN A;  2QDB A;  3D8G A;  3I3C A;  4G7H C;  3KK7 A;  4X65 Q;  4DV0 Q;  1IYV A;  1XTC D;  5JAV A;  1SYE A;  1SAP A;  4A3C L;  2WAQ P;  1PFY A;  1YNJ D;  2RDV A;  5H1S c;  2DSX A;  2JA5 L;  3LWP B;  4IOC A;  2A5H A;  3W3A A;  2V3B B;  5KYI A;  1PDQ A;  5DLQ E;  2PQE A;  2Q8T A;  2QKI C;  1LT3 D;  4A3E G;  1D8L A;  2L0Z A;  3HOZ B;  1ET9 A;  1BF4 A;  1SFO L;  2OXP A;  5IP9 H;  1JMC A;  4ZKB B;  4PG3 A;  4YHH L;  3M4Q A;  4K9F A;  1YK5 A;  4K5V A;  2I5L X;  1TWH L;  5COY A;  4JI4 L;  4LF6 Q;  2AWO A;  4XT3 B;  1SMX A;  2IY5 B;  4JBM A;  1AFP A;  2UUB L;  1VQ4 A;  1VZH A;  3LWE A;  1EWC A;  1DOK A;  3PIO A;  2ZT9 C;  3BS1 A;  3DWQ A;  1H9S A;  4ALP A;  1YNX A;  4FF3 A;  3F2U A;  3LPE B;  1HZA A;  1PH6 A;  1PXU A;  3S1R L;  3GP7 A;  4ILW A;  4OEM B;  4LF9 L;  1BE7 A;  2PCF B;  3SGI A;  1EL0 A;  1HR0 L;  3FMC A;  3CW2 C;  3KFU A;  1J8I A;  3PGZ A;  2MO0 A;  4GN4 B;  2R7Z H;  3Q24 A;  3HOW H;  2XRS D;  4DAP A;  1PA6 A;  3AMU A;  3J7A V;  1BO0 A;  3D6W A;  5COR A;  5FLX L;  4DV6 Q;  1DZ1 A;  1EY4 A;  4O0A A;  1YBY A;  1CQV A;  3MXG A;  4IOA A;  4Y7N L;  3TRE A;  3NBH A;  4AH6 A;  3WWN B;  4Z9C B;  4MTN A;  3S1Q L;  3H3V I;  3HOV L;  4DR2 L;  5C3E H;  2VB3 X;  4EVO A;  2HIV A;  2MFI A;  2YU9 L;  2WV6 D;  3AFP A;  5FO9 B;  2BCO A;  3Q22 A;  3GTQ H;  3RN5 A;  4KHP Q;  2JA9 A;  1H9R A;  2BE5 D;  5IGD A;  1VCX A;  3RZ6 A;  3NTK A;  1M90 C;  5DM7 1;  3K8A A;  4XDX A;  4B3T Q;  4V19 6;  2B2T C;  4DF7 A;  2FXQ A;  2O2L D;  2BH2 A;  1U9R A;  5M5W B;  3SS2 A;  2JA5 B;  1HQR D;  2ZTE A;  4IJL A;  1G29 1;  2UXB L;  1WFQ A;  8RXN A;  2X6G A;  4OWT B;  4B9X A;  4M8A A;  3A74 A;  4LHL A;  1UE6 A;  1E2V A;  1AZP A;  4O2D A;  1VF5 C;  5KND A;  2OQK A;  1CM9 A;  1F2L A;  1I3Q L;  1I4G A;  1B44 D;  2MNA A;  2IPK D;  1XMQ L;  3PWF A;  2E74 C;  3WOF A;  4DV1 Q;  2EJG C;  5KYL A;  1N34 Q;  2DNE A;  1K73 C;  3FEW X;  1TWH B;  1PFB A;  4KD4 A;  4L5Q A;  3S9W A;  1E7Z A;  3C46 A;  4JI7 L;  3VR4 A;  3H9B A;  2RSO A;  3AFQ A;  4GN3 B;  4NXM Q;  3PIP A;  1B2T A;  2UUC L;  1I6V C;  1B3A A;  1CZG A;  4A3I L;  1S3O A;  3GO5 A;  1TWG L;  3K0Y A;  5C4X H;  3CCV A;  1VQD A;  2EJM A;  3S14 H;  4WFN 1;  1HR0 W;  4UPA A;  1PYS B;  1B71 A;  1AZQ A;  2MQH A;  1AN8 A;  4JI6 Q;  3TME A;  1VQM A;  3WDN A;  1ROD A;  3NQI A;  1B8A A;  1X3G A;  2E2D C;  4BBS G;  1FHH A;  3S1N L;  4JYA L;  3ERQ A;  3TDQ A;  2F4V L;  2PZW A;  3NP8 A;  3SHL A;  1PRT D;  5FK9 C;  4Y7N B;  3TBI B;  1PH5 A;  1OXT A;  3KYH C;  1H9J A;  2VS1 A;  3S2H L;  3J7Y W;  1XNR L;  1PTO C;  4ZRZ A;  3S1Q B;  1PH9 A;  4NW2 A;  1EYC A;  4X62 L;  1NSN S;  4RGN A;  5G3L F;  2NB0 A;  3S15 L;  3DXJ C;  4A3F H;  3CP0 A;  4A3J G;  5EBD A;  2RHS B;  4X65 L;  4KJN A;  4DV0 L;  1X3F A;  1RD9 D;  4RKL A;  5FO8 B;  2QCP X;  3KDF A;  4O42 A;  1RYQ A;  2C9O A;  5IYD L;  4APV A;  2YYZ A;  3M9B A;  5H1S E;  1NMG A;  5FKA C;  1JOQ A;  4BS9 A;  1K3B C;  1ZKO A;  3SVM A;  1EU3 A;  1PTO B;  2XSC A;  2WB1 G;  2KED A;  3LGJ A;  4RKB A;  1WVL A;  1CZW A;  4G7O C;  1LTB D;  3X3M A;  1RF2 D;  4DR5 Q;  2Y0S E;  2MJ8 A;  1I3Q B;  3RR5 A;  4AHY A;  2K4K A;  3PO3 G;  1JB7 A;  4LF6 L;  3L2P A;  2ENB A;  4A93 G;  4XGH A;  1QWY A;  1EWH A;  2I46 A;  4JW0 A;  4CBV A;  3J81 L;  1B70 B;  3I72 A;  3OSO A;  1RKN A;  5E1F A;  3WWL A;  4AIM A;  1Y8O B;  5DNF A;  2VUM L;  4EQ5 A;  3C3L A;  3CRL C;  1BQ9 A;  4IUP A;  3BYY B;  3RLF A;  2F52 A;  1O7L A;  4JAF A;  2BDO A;  5E3F A;  5ELB A;  3JAM i;  4A3I B;  3HOZ H;  2NWG A;  4R4T A;  4K6L A;  3DLL A;  4DV2 Q;  3MC0 B;  4DV3 Q;  4IUN A;  3D6C A;  1SNP A;  4L6T B;  1FR3 A;  1SRO A;  3ZYY X;  5D14 A;  2ICE C;  2NZ1 D;  4HIK A;  1I4H A;  1U4L A;  1PRT C;  4DV6 L;  2KN9 A;  3K7A L;  1B13 A;  5BN5 A;  1K28 A;  4P74 A;  3CMA A;  5M3F G;  4A3E B;  3S2H B;  1WTW A;  4AR6 A;  2H12 A;  1D6E C;  4ZQ3 A;  5JVG 1;  2JEA I;  4JG2 A;  1EEF D;  4DR1 Q;  4KHP L;  3S15 B;  1IBL Q;  3KJP A;  1SNM A;  4NP5 A;  3MPS A;  2Z3R B;  1QZG A;  1C4Q A;  2FMC A;  3BDO A;  3J80 i;  2PI2 E;  5M3M G;  2PYA A;  1D7Q A;  3TZD A;  1YK4 A;  4X66 Q;  1QCV A;  3HOU L;  3TN2 A;  2K28 A;  5L37 A;  5J1Z A;  3KYW A;  5K36 H;  1MSH A;  2G9H D;  2JJQ A;  3FKI G;  1ESF A;  1H7V A;  5GAD c;  3NHH A;  4C2M 1;  2JP1 A;  5CV4 A;  2OF1 A;  2PZU A;  4KI0 A;  2PI2 A;  4IUT A;  1UE5 A;  2RKS A;  4A3C H;  1L0X B;  4DV1 L;  1ZYR C;  2XVS A;  1X3Q A;  4IUU A;  4RG1 A;  5JVH 3;  1N34 L;  1VQJ A;  5GAG c;  3DEO A;  5M5W H;  2JA5 H;  1C48 A;  4LFA Q;  2MP1 A;  5AFW A;  3L7Z C;  4H02 A;  1FD7 D;  4UHV A;  5CMD A;  2ZXP A;  4KHV A;  4NXM L;  3JC6 6;  4JOI C;  1LT4 D;  2VUM B;  2K7V A;  2UXC L;  1KHI A;  1JB3 A;  2EDG A;  2XJU A;  1G6P A;  1F9P A;  1SFO H;  1P16 A;  5J22 A;  1GXD C;  2CWP A;  4PMB A;  2M00 A;  4BY1 L;  1PFW A;  1FVI A;  1TWH H;  4JI6 L;  1T9H A;  1QCB D;  2V0F A;  1TS2 A;  1PZJ D;  1SMU A;  4P2C B;  4Q0F A;  3LWO B;  2PZT A;  3A8K E;  3SK4 A;  1EQV A;  1B53 A;  4C56 C;  4P75 A;  5JJI A;  1RDG A;  2VW9 A;  1BBX C;  1N33 Q;  3K7A B;  1H9M A;  3S1R H;  4JBK A;  1JE4 A;  1BQQ T;  2NVT L;  4GKJ Q;  2E5L Q;  3CHB D;  4BXX L;  3VA7 A;  2B2V A;  1N8R C;  3PO3 L;  4E6I A;  4OGQ C;  4A93 L;  2LFN A;  3DHQ A;  1LO5 D;  4KTA A;  3AEV A;  4BA2 I;  2F0Q A;  2H5X A;  2Y0S G;  1X3E A;  2EYJ A; 
#chains in the Genus database with same CATH homology
 4Y7N H;  3B08 B;  3HOY G;  3I4M G;  3S1Q H;  2K50 A;  3HOV H;  2A6H D;  4IPG A;  1C0A A;  3PUX A;  1RL2 A;  4BY7 G;  1OWB A;  1XNQ Q;  1K8G A;  2A8V A;  1W3S A;  5GAE C;  4GKK Q;  2YV5 A;  2VQE L;  2KKD A;  1I3Q H;  5AJ3 Q;  3CC2 A;  4DV2 L;  4DV3 L;  1AH9 A;  2XJS A;  2JI2 A;  3PO2 G;  4JC0 A;  1PH7 A;  2YTV A;  2R92 G;  4A3I H;  2ASB A;  1TWG H;  4LUV A;  5IE8 A;  4L5T A;  4AHX A;  1V9P A;  4A76 A;  1NNQ A;  1T9Q A;  1JJG A;  2JQO A;  1IBL L;  1U0L A;  4LF4 Q;  2M6O A;  1GM5 A;  4X66 L;  1BFY A;  4LF5 Q;  3S2H H;  1IBK Q;  4ME3 A;  3B0A B;  3S15 H;  2QL0 A;  4BBR G;  2BA0 A;  1Y1W G;  1AE3 A;  1VQ5 A;  4K0K Q;  2N8N A;  3PF4 A;  3PSI A;  5IYD H;  4AI1 A;  2HIX A;  4LFA L;  3ERS X;  2ERJ A;  4FDB A;  3IU3 I;  4A3L G;  1UE7 A;  2IT1 A;  3G6E A;  1HNW Q;  1SE8 A;  3PV0 A;  4A3K G;  1BRF A;  1HZ9 A;  2XJT A;  4DKA C;  2IX0 A;  1KL9 A;  2VUM H;  3QVD A;  1N33 L;  2ZJP A;  4A3M G;  4B3M L;  1YJ9 A;  1YUZ A;  1YV1 A;  1L0W A;  4LNQ A;  4LUO A;  3I7F A;  4GKJ L;  3AYH B;  2E5L L;  3GDE A;  3FP9 A;  2D0P A;  1CSP A;  3STB C;  5JEA G;  3K7A H;  1Z92 B;  2GVB A;  3F2C A;  4OX9 Q;  4QL5 A;  2UU9 Q;  4AI3 A;  2A69 D;  3KDF B;  3PF5 A;  4AI2 A;  2NYD A;  3G71 A;  3CCS A;  5MGN A;  1X6O A;  1SMW A;  4DR2 Q;  4LUZ A;  3HOU H;  2B63 G;  1SMM A;  1ZRP A;  1A62 A;  1VQE A;  5EAY A;  4LFB L;  4GS7 D;  4LW1 A;  1XNQ L;  5LMU Q;  5JEA J;  5AJ3 L;  4JI2 Q;  1KRT A;  3CC7 A;  3PUW A;  1XPU A;  3S16 H;  1L1O C;  2R93 G;  4DV4 Q;  3CD6 A;  2B29 A;  1PH2 A;  2R7F A;  1PH4 A;  1T9P A;  4BY1 H;  5ELO A;  1J5E L;  4XIG S;  2HR5 A;  1SLJ A;  1QVF A;  2HHH Q;  1Q12 A;  1C09 A;  1S24 A;  1CKM A;  1UE1 A;  4JI3 L;  3PKI A;  1N36 Q;  4LF4 L;  2ES2 A;  1L1O B;  4J15 A;  4LF5 L;  2JA6 G;  1BVS A;  1IBK L;  2NVT H;  2ERS A;  4DK3 C;  4BXX H;  2EIF A;  2J9U B;  1LYL A;  1J6Q A;  1NXG A;  1Q1B A;  3PO3 H;  5IYB G;  4A93 H;  2CQO A;  3KLW A;  2F4V Q;  4K0K L;  5FJ8 G;  2ID0 A;  2D62 A;  1VQ8 A;  1R0J A;  4IJH A;  1Y1V G;  1QZH A;  2YTX A;  1S40 A;  1HNW L;  4DAY B;  4L5R C;  1FL0 A;  5C44 H;  1VQB A;  5ELN A;  5IT9 c;  3CPF A;  2LXK A;  3NEN A;  2CWA A;  4JI8 Q;  2O5J D;  3Q8D A;  4GLX A;  3P8B A;  2UUA Q;  2RHQ B;  2F3I A;  3FKI H;  2QA4 A;  3U4V A;  2OTL A;  2L15 A;  3D31 A;  1E3P A;  4A3D G;  1GO3 E;  2V1C C;  3VPB E;  1LKO A;  4OX9 L;  4G6B A;  2UU9 L;  2KCT A;  3RN2 A;  2JI3 A;  2K5N A;  1VQA A;  2KBN A;  4TQU S;  4AYB G;  5AI3 A;  4C2M H;  3GTK H;  1C7Y A;  4OXP A;  5J3B A;  2XGT A;  3HOX G;  5LMU L;  4DR6 L;  3S2D H;  3U4Z A;  4JI2 L;  2CFM A;  2VQF L;  4GOP A;  2AYJ A;  2MS3 A;  2Z6K A;  1X55 A;  2AWN A;  4DV4 L;  5IWA Q;  2M6P A;  2LXJ A;  2HHH L;  1M1K C;  2UXC Q;  4OON A;  4IFD G;  1N36 L;  1R0G A;  1I6H H;  1PFS A;  2ZTD A;  3TQY A;  3PKJ A;  4AHZ A;  3A0J A;  3PIO 1;  5C0X G;  4B3S Q;  4BY7 H;  4AQY L;  3G48 A;  3J81 j;  2VNU D;  1Q7Y C;  3CAM A;  4Y52 H;  4QQB X;  1G51 A;  4IFD J;  4WJ4 A;  3PO2 H;  2VY3 A;  3JC6 2;  2R92 H;  3U58 A;  1PVO A;  3I55 A;  4BA1 I;  5GQO A;  5C0X J;  3ULJ A;  4JI8 L;  5LMN Q;  2PMZ E;  2GMG A;  3VDY A;  1QVC A;  5FLM G;  2ZM6 Q;  2I5M X;  1L2F A;  4HJ7 A;  1EYG A;  1MKH A;  2YTY A;  1CKN B;  2UUA L;  2Q2T A;  5BR8 Q;  3CCM A;  5IYC G;  4LWC A;  3T1H Q;  2VQE Q;  1NXE A;  2JK8 A;  3OYY A;  4BBR H;  1UEB A;  3KF6 A;  1RB9 A;  4JI0 Q;  4C3J H;  1JJC B;  4YWK A;  4YCW A;  3PIP 1;  2K2D A;  2Z0S A;  4A3L H;  3H3V H;  1QVG A;  2Z3Q B;  1KIX A;  2PQA A;  3HKZ E;  4X6A H;  2XJP A;  5K2M E;  3CQZ H;  4UY8 1;  4B8C D;  2WFW A;  1OWC A;  4U67 1;  5FLX c;  4A3M H;  1VQF A;  5E7N A;  5IP9 G;  4P72 A;  4AR3 A;  4GLV B;  2WAQ E;  2NZO A;  2JA8 G;  5IWA L;  4KLK A;  2D0O A;  2BH8 A;  4B3R Q;  4R4Q A;  2C6A A;  3K80 C;  1EQQ A;  3HOW G;  2VL6 A;  1ASY A;  4DNI A;  2LCQ A;  3GTO H;  2NN6 G;  2B63 H;  4B3S L;  4B3M Q;  4YY3 Q;  4MNO A;  2RCN A;  3CPW A;  1LTL A;  4RMF A;  3RLN A;  4X64 L;  2HQL A;  1VQ9 A;  1WOC A;  1EIY B;  1TWF H;  2XJQ A;  2NVY H;  1WYD A;  5LMN L;  2CKA A;  4GN5 A;  1IL2 A;  1JT8 A;  1A8V A;  2ZM6 L;  2CKC A;  2E2H H;  4LFB Q;  4IFD I;  1NTG A;  5BR8 L;  3W1G A;  1K9M C;  1CAD A;  2JA6 H;  3KYU A;  1B2O A;  4TVM A;  3T1H L;  2ZIX A;  5C0X I;  5IYB H;  3GTJ H;  4JI0 L;  1WCM G;  3UDF A;  4C3I H;  1KXL A;  3UDG A;  4HJ5 A;  3HKZ G;  1JYB A;  2XJR A;  4TVA B;  1Y1V H;  2PNH A;  3RNU A;  3J81 c;  2DGY A;  4YCV A;  1J5E Q;  5M5X H;  1R0F A;  4JI3 Q;  3NBH B;  1I5F A;  3M85 A;  3EBE A;  4XTC S;  3STB D;  2I5H A;  3W1B A;  1YIT A;  3CCJ A;  1E8J A;  2WAQ G;  4A3E H;  2VZA A;  3RYG A;  4A75 A;  4XXB B;  1RDV A;  3E0E A;  1S72 A;  1QUQ A;  5LMN W;  1KC8 C;  1BQ8 A;  1Q46 A;  1XPR A;  4IPC A;  2A6E D;  4GOP B;  2OWO A;  1CSQ A;  4P71 A;  1VZG A;  1BKB A;  4NB3 A;  1RIP A;  5DM6 1;  5MFP A;  3HOZ G;  1YVC A;  1A0I A;  1NJI C;  4JAG A;  4B3R L;  1NMF A;  4JCV E;  1YZ6 A;  1SN8 A;  3BZK A;  4UY8 C;  2KEN A;  1T9O A;  4JV5 Q;  4GS3 A;  1KAW A;  1X56 A;  3S24 A;  2CR8 A;  3I56 A;  1I94 Q;  1LUZ A;  4YY3 L;  1PHJ A;  1IU6 A;  1JJ2 A;  1K83 H;  3WWV A;  2R6G A;  1NE3 A;  2OTJ A;  1X54 A;  1RYT A;  4JAE A;  1IZ6 A;  1NBW A;  3KF8 B;  4R1J A;  5GAE c;  4A3C G;  4DUY Q;  3K81 C;  2JA5 G;  1P8L A;  1O7I A;  3A44 A;  1V1Q A;  1MJE A;  3S17 H;  4HJ9 A;  4DR6 Q;  5IY0 A;  5GRO A;  3D0F A;  1B2J A;  1IXR A;  4BBS H;  2NN6 I;  2E8G A;  1YHB A;  4HJ8 A;  2VQF Q;  4LF7 Q;  3CCL A;  1EWI A;  4HJA A;  4UP7 A;  2E2I H;  1W2B A;  3H15 A;  5GAH C;  4A3J H;  4HIM A;  4AHW A;  1FGU A;  3KYY A;  4DK6 C;  1NY4 A;  1QYB A;  3CME A;  2PQA B;  3HOV G;  4ZN1 B;  2JE6 I;  2A19 A;  1OXX K;  1HNZ Q;  5FLM H;  2EXD A;  4JI5 L;  4DR3 L;  2B3G A;  3ICE A;  1BBU A;  4AQY Q;  5IP7 G;  3U50 C;  1VS0 A;  3TEH B;  5IYC H;  1IRN A;  2NZH A;  1VQH A;  3GD7 A;  4JOI A;  2JEB I;  4LFC Q;  2KCM A;  3RZT A;  4JAD A;  3F2D A;  1SR3 A;  1PV4 A;  4JV5 L;  2AKW B;  1WI5 A;  5M3F H;  1RWD A;  1Q86 C;  4A3B G;  2K5V A;  2C6B A;  1K0R A;  4EX5 A;  1I94 L;  3GTG H;  4WJ3 M;  5M5Y H;  1TWC H;  3RZO H;  3TS2 A;  3KYX A;  4JBW A;  5M3M H;  4DR7 L;  2IHE A;  1A63 A;  1WJJ A;  5HGQ A;  1X65 A;  1DGS A;  1UWV A;  3M3Y H;  2WB1 E;  1EOV A;  2XTI A;  2JA8 H;  2NVQ H;  2JA7 G;  4DUY L;  5IYD G;  4RXN A;  1E1O A;  1HNX Q;  3UE1 A;  3I2Z A;  4AR5 A;  4JI1 Q;  4A3G G;  3GTM H;  3LNL A;  7RXN A;  3P2A A;  5GAH c;  5MFZ A;  3ER0 A;  2VUM G;  1VQI A;  4LF7 L;  3F2B A;  1I50 H;  2M4Y A;  3HFZ B;  1Q8K A;  1HJP A;  4YWL A;  3J7Z 1;  4DV5 Q;  1CAA A;  1HZC A;  4GLA C;  4GNX A;  2I0Q A;  3UDX A;  5C4J H;  1R9T H;  2Q2U A;  3EIV A;  3CCQ A;  3HOY H;  3I4M H;  2NVX H;  4DV7 Q;  3NEM A;  4TPU A;  3NEL A;  1GD7 A;  3PCO B;  1OXS C;  1HNZ L;  4MZ9 A;  4R4O A;  4PZ8 A;  2ATW A;  3JC6 3;  4NPS A;  1H95 A;  1ASZ A;  5GAD C;  1PH8 A;  1HH2 P;  1EFW A;  3HOU G;  1HZB A;  1QUQ B;  3T1Y L;  3J7A 5;  4X64 Q;  4LFC L;  5GAG C;  2CCZ A;  4IO9 A;  3W5O A;  1S2Z A;  1WCM H;  1OXV A;  3IRB A;  4PZ6 A;  3MXN B;  3BJU A;  2B5I D;  1VQ6 A;  2Q2H A;  3PUZ A;  5HY6 A;  3H0G G;  4BY1 G;  1Q82 C;  3CCU A;  4A4I A;  2ZTC A;  3S1M H;  3I4N G;  4HIO A;  3I4O A;  2QGQ A;  2RF4 A;  1Y1W H;  4BXX G;  4OO1 G;  3UE0 A;  1MJC A;  3K7U C;  3KJO A;  3F8T A;  3M7N A;  1YHA A;  2AHO B;  5JJL A;  1XTD A;  1E22 A;  1VQN A;  5JVH 1;  1X9N A;  1FJG Q;  1HNX L;  3ZJY C;  4A3K H;  5RXN A;  4ZN3 B;  4QY7 A;  5C44 G;  4JI1 L;  5AI2 A;  2GVA A;  3L0O A;  3G4S A;  4KHZ A;  3OTO Q;  1Q81 C;  1XPO A;  3K0X A;  1YHQ A;  3JAM c;  4PZ7 A;  1R0H A;  1MIU A;  1R0I A;  1N32 Q;  1L1O A;  5JJK A;  3A5Z B;  4DV5 L;  4E6Y A;  1TXY A;  4B3T L;  4AI0 A;  2PPT A;  3BZC A;  1KQS A;  2A1A A;  4DV7 L;  1XMO Q;  3EN2 A;  2R7Z G;  3MEF A;  3J80 c;  2UXD Q;  4POF A;  1YJN A;  1U5K A;  3MSU A;  5C3E G;  3J7Z C;  1N9W A;  1VQG A;  2Q2I A;  3TRZ A;  5MF6 A;  1V43 A;  3ULP A;  4PMW A;  2K75 A;  2PVE A;  2R7D A;  2R93 H;  1C9O A;  3NFP I;  2KHI A;  4YCU A;  3FHW A;  1VQC A;  4DUZ Q;  2YU9 H;  5C4X G;  1CUK A;  1Y14 B;  1VQO A;  3AQQ A;  3PUY A;  1GVP A;  4NXN Q;  1E1T A;  1PYB A;  2PSM C;  1IYJ B;  3PZA A;  4DR5 L;  3J81 i;  1IRO A;  1Q1E A;  3K35 A;  5IP7 H;  2XJV A;  4JBJ A;  5FJ8 H;  4HID A;  3BU2 A;  4AR4 A;  1XJV A;  3CCE A;  2K5H A;  4IPD A;  3RZD H;  1E24 A;  2CKZ B;  4A3F G;  1FJG L;  1OTC A;  2K14 A;  4UP9 A;  4GOP C;  3OTO L;  2Z6K C;  1IBM Q;  4LF8 Q;  3HKS A;  4A3B H;  2GN5 A;  2DUD A;  1EIF A;  1WJV A;  4JI5 Q;  4DR3 Q;  2PVX A;  3CF5 A;  1B7Y B;  1EUJ A;  2JI1 A;  4GNX C;  1N32 L;  1BBW A;  1KRS A;  3QQC E;  4DR1 L;  5AN9 H;  4R4I A;  1VQ7 A;  4YWM A;  1YIJ A;  3S1N H;  1DVB A;  3F1Z A;  3B6Y A;  3M4P A;  1TWA H;  3ULL A;  4QGU A;  4P73 A;  5EIO C;  4A3D H;  2M4V A;  1SRU A;  1VQK A;  4DR4 Q;  4OO1 I;  2ZJR A;  4GNX B;  1EQR A;  1XMO L;  3KOJ A;  2OQ0 A;  5EIN C;  4OWX B;  3E9I A;  2JA7 H;  2UXD L;  4QJF A;  2MO1 A;  1AE2 A;  2HT1 A;  2ZJQ A;  1LKP A;  2IX1 A;  3E9H A;  2AMC B;  1K3R A;  5MLC 3;  3HOX H;  1PH3 A;  2LSS A;  4A3G H;  1VCI A;  4DR7 Q;  1S30 A;  3CC4 A;  3ZG6 A;  3UDI A;  1CKN A;  4POG A;  5K36 G;  4YHH Q;  4DAM A;  3KYV A;  4JI4 Q;  2UUB Q;  1VZI A;  4LHN A;  2A68 D;  2IHF A;  1IW7 D;  1YJW A;  3RLO A;  3CXC A;  4LF9 Q;  4OWW B;  1HR0 Q;  4DUZ L;  2WP8 J;  3GTL H;  1GKH A;  3PUV A;  1LKM A;  4NXN L;  1LM0 A;  2E2J H;  1KD1 C;  1VQP A;  2ALY B;  2C35 B;  1YUX A;  3OW2 A;  2EQS A;  3KF6 B;  2QEX A;  2N49 A;  4AYB E;  3J7Y 1;  4GKK L;  2K52 A;  3M4O H;  1YI2 A;  2N3S A;  4DPG A;  4R4C A;  3GTP H;  1YEZ A;  2UXB Q;  1ODH A;  1Z47 A;  1DX8 A;  3DM3 A;  2N78 A;  1XMQ Q;  1IBM L;  4LF8 L;  3H0G H;  4JI7 Q;  1OXU A;  2BA1 A;  2V0E A;  2UUC Q;  3I4N H;  1JE5 A;  4C3H H;  1CKO A;  3T1Y Q;  1IU5 A;  1K8A C;  1Z9F A;  4QIW E;  4DR4 L;  4L5S A;  3CCR A;  4JYA Q;  2KHJ A;  3TS0 A;  4IPH A;  1XNR Q;  1FHM A;  2OCE A;  1PH1 A;  1VQL A;  3A5U A;  4X62 Q;  4UP8 A;  4A3I G;  6RXN A;  4X65 Q;  4DV0 Q;  2RDV A;  5H1S c;  2DSX A;  4IOC A;  2V3B B;  5DLQ E;  4A3E G;  1D8L A;  2L0Z A;  5IP9 H;  1JMC A;  4PG3 A;  4YHH L;  3M4Q A;  4K9F A;  1YK5 A;  2I5L X;  4LF6 Q;  4JI4 L;  2AWO A;  2IY5 B;  1SMX A;  4JBM A;  2UUB L;  1VQ4 A;  1VZH A;  3PIO A;  4ALP A;  1YNX A;  3LPE B;  1HZA A;  1PH6 A;  4LF9 L;  1BE7 A;  3SGI A;  1HR0 L;  3CW2 C;  3KFU A;  3PGZ A;  2MO0 A;  4GN4 B;  2R7Z H;  3HOW H;  1PA6 A;  4DV6 Q;  4O0A A;  1YBY A;  4IOA A;  3TRE A;  4AH6 A;  3WWN B;  4MTN A;  3H3V I;  4DR2 L;  5C3E H;  2HIV A;  2MFI A;  3AFP A;  3GTQ H;  3RN5 A;  4KHP Q;  2JA9 A;  2BE5 D;  1VCX A;  3RZ6 A;  1M90 C;  5DM7 1;  3K8A A;  4B3T Q;  4V19 6;  2FXQ A;  2BH2 A;  3SS2 A;  4IJL A;  2ZTE A;  1G29 1;  2UXB L;  1WFQ A;  8RXN A;  4OWT B;  3A74 A;  4LHL A;  1UE6 A;  4O2D A;  2OQK A;  2MNA A;  1XMQ L;  3PWF A;  4DV1 Q;  1N34 Q;  1K73 C;  4L5Q A;  1E7Z A;  4JI7 L;  3AFQ A;  4GN3 B;  4NXM Q;  3PIP A;  2UUC L;  1S3O A;  3GO5 A;  5C4X H;  3CCV A;  1VQD A;  3S14 H;  4WFN 1;  1HR0 W;  4UPA A;  1PYS B;  1B71 A;  2MQH A;  4JI6 Q;  1VQM A;  1B8A A;  1X3G A;  4BBS G;  1FHH A;  4JYA L;  2F4V L;  1PH5 A;  1OXT A;  3KYH C;  2VS1 A;  1XNR L;  1PH9 A;  4X62 L;  4A3F H;  3CP0 A;  4A3J G;  2RHS B;  4X65 L;  4DV0 L;  1X3F A;  3KDF A;  1RYQ A;  4APV A;  2YYZ A;  3M9B A;  5H1S E;  1NMG A;  2WB1 G;  3LGJ A;  4DR5 Q;  2Y0S E;  3RR5 A;  4AHY A;  2K4K A;  3PO3 G;  1JB7 A;  4LF6 L;  3L2P A;  4A93 G;  4XGH A;  1B70 B;  4AIM A;  3WWL A;  4EQ5 A;  1BQ9 A;  3RLF A;  2F52 A;  4JAF A;  3JAM i;  3HOZ H;  4R4T A;  3DLL A;  4DV2 Q;  4DV3 Q;  1SRO A;  4HIK A;  4DV6 L;  2KN9 A;  1B13 A;  4P74 A;  3CMA A;  5M3F G;  4AR6 A;  2H12 A;  5JVG 1;  2JEA I;  4JG2 A;  4DR1 Q;  4KHP L;  1IBL Q;  3KJP A;  3MPS A;  2Z3R B;  1QZG A;  3J80 i;  2PI2 E;  5M3M G;  2PYA A;  1D7Q A;  1YK4 A;  4X66 Q;  1QCV A;  3KYW A;  2JJQ A;  3FKI G;  1H7V A;  5GAD c;  4KI0 A;  2PI2 A;  1UE5 A;  4A3C H;  4DV1 L;  1N34 L;  4RG1 A;  1VQJ A;  5GAG c;  5M5W H;  2JA5 H;  4LFA Q;  3L7Z C;  4H02 A;  4NXM L;  3JC6 6;  4JOI C;  2UXC L;  1KHI A;  2XJU A;  1G6P A;  1SFO H;  1P16 A;  2CWP A;  1FVI A;  1TWH H;  4JI6 L;  1T9H A;  2V0F A;  1SMU A;  4P75 A;  5JJI A;  1RDG A;  2VW9 A;  1N33 Q;  3S1R H;  4JBK A;  4GKJ Q;  2E5L Q;  1N8R C;  4BA2 I;  3AEV A;  2H5X A;  2Y0S G;  1X3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...