4POGA

Mcm-ssdna co-crystal structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication, dna binding protein/dna
molecule keywords Cell division control protein 21
total genus 57
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pogA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pogA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pogA01
1X3FA 1BBUA 1YUXA 1HZAA 3S17H 1VQ9A 4APVA 1Q12A 5IY0A 4DV4L 3W1BA 1HNXQ 3EBEA 1PYSB 1T9QA 4A3BH 3GD7A 3CCRA 4JI4L 1D7QA 1VCIA 1IBLQ 1BBWA 1SE8A 1W3SA 1KXLA 1L0WA 3J7A5 3CMEA 2HIVA 1PH2A 2DSXA 1YJWA 5GROA 1QUQA 1UE1A 4AYBG 5BR8Q 4A3GH 4LNQA 4DAMA 4JYAQ 2K14A 4GNXB 4AH6A 2PVXA 4B3ML 4LF8L 3J80i 2K5VA 4X65Q 5FLMH 4YHHQ 1P8LA 2UUCL 1XPOA 4R4CA 1X6OA 3E9IA 4BBRH 2VQFQ 4DV3Q 4A3GG 2D0PA 1A0IA 1YZ6A 2NZHA 4NPSA 1KC8C 1VQ7A 3OW2A 1I94L 5C0XG 1C09A 2N3SA 5GAEC 5RXNA 2E2JH 2D0OA 5DLQE 4RMFA 4X66Q 1PYBA 4JI1Q 3RNUA 2VUMG 1OXUA 5FLXc 4HJ9A 4GNXA 1Y1WG 1XNQQ 5IYDH 3A5ZB 5JJIA 4LF9Q 1PHJA 1CSQA 1YHBA 4MNOA 1AE3A 1ZRPA 5C3EG 3I56A 2KENA 4QIWE 4JI6Q 5M5WH 2DGYA 1YJ9A 2JA6G 3HOYH 3CP0A 2N8NA 4DPGA 3ICEA 1FVIA 4LW1A 1N34Q 3NELA 4JI1L 2B3GA 2NN6G 1IU6A 1IRNA 1HZBA 5M5XH 1V1QA 4X64Q 4A3LG 4DR5L 1IBKQ 2IX1A 4R4IA 1CKMA 3RN2A 4B3TL 4PZ8A 4OONA 4O0AA 3K7AH 2MFIA 4LF6Q 2KHIA 3KYYA 1SMMA 2JK8A 4YCUA 2JA8H 1M1KC 2IHEA 3PO2H 2UXCL 2R7DA 3S2HH 4FDBA 2ZJQA 1BKBA 2HHHQ 3G71A 1VQMA 2JA5G 1B13A 5C3EH 1BFYA 2EXDA 3B6YA 3M4OH 3L2PA 4DUYQ 1J6QA 1K0RA 3K8AA 4A3KG 4B3SL 1Q46A 4LFAQ 4GOPB 1SFOH 3PUXA 2VQEL 3S1QH 3STBD 3KFUA 2VUMH 4A3DG 3H15A 1YK5A 4YWLA 1OXVA 3KDFB 4GS3A 3HOXG 3CCUA 4GNXC 4DV1L 4DR3Q 4RG1A 1Y1VH 1KHIA 2ASBA 4YCVA 8RXNA 1WCMH 2YTXA 1L1OA 3G6EA 4B3MQ 4LF8Q 3KYVA 1RL2A 4Y7NH 1R0IA 5JJLA 3QVDA 1IBKL 3J81i 4DAYB 3S16H 1K3RA 3W5OA 4K0KL 1C0AA 3M9BA 3PO3H 2MNAA 2N49A 1LTLA 2BH8A 2Q2IA 4DV0Q 2AKWB 4TVAB 1JJGA 2KCTA 2EIFA 1VQNA 2VY3A 4AYBE 1XMQL 4K0KQ 2I5LX 3L0OA 3M85A 1LKPA 4BY7H 1BQ8A 1YV1A 1CKNB 4R4OA 5M3FH 1HJPA 1NBWA 4LUZA 3K81C 1XNQL 4GKKQ 3VDYA 1Q7YC 1R9TH 4DUYL 4B3SQ 4GN3B 5J3BA 1S2ZA 4GLXA 4R4QA 2XGTA 3TRZA 4OO1G 3EIVA 2YTYA 4TQUS 4LFCQ 1WFQA 3H0GG 1HZ9A 4L5SA 1LYLA 1UE7A 4A3FH 4RXNA 1CKOA 4NXMQ 4KHZA 1TWAH 1GD7A 4NXNQ 2R92H 4YWMA 4JI5Q 1XTDA 4C3JH 1D8LA 3H3VH 1ASZA 1NTGA 4P72A 2HT1A 1PFSA 4A3EG 4B3TQ 3T1HL 1S3OA 4HIOA 3CMAA 1VQKA 4L5QA 4ME3A 3KF6B 2VL6A 4HIDA 4POGA 2I5MX 3TS0A 3RLFA 1JYBA 2MO0A 2B63H 4JYAL 2KBNA 4O2DA 3I4NH 5IP9G 5IE8A 2PYAA 4UP7A 2Q2UA 1YEZA 2Z0SA 3UDXA 3A74A 1KD1C 1P16A 3NEMA 1HR0Q 4A3IG 1RDGA 5C4JH 1FL0A 3TREA 5C4XG 3CCEA 3W1GA 1IBMQ 2Y0SE 2NN6I 1UE5A 1FGUA 4DKAC 1U5KA 2UUBQ 1GO3E 4GKJQ 5EAYA 1QVFA 4NXML 5M5YH 3CAMA 2Q2HA 2RHSB 3RZ6A 4L5TA 1XJVA 1K73C 4K9FA 2YU9H 3M3YH 2ALYB 1SROA 3CPWA 1BE7A 1NMGA 5HY6A 3F2BA 3RN5A 2HIXA 3U58A 1K8AC 2I0QA 4P74A 3K80C 1AH9A 2K50A 5BR8L 1HZCA 3MEFA 4X62Q 1DX8A 2ATWA 1CADA 5M3MH 1SMWA 1QVGA 4IFDG 2RDVA 1SR3A 1PH3A 1KRTA 1XMQQ 3CC2A 2R6GA 2Z6KC 4A3DH 2MO1A 1SLJA 1I5FA 3I2ZA 1FJGQ 4LFBL 4QQBX 3S1NH 1VQGA 3PUWA 4GKKL 1MKHA 4A3MG 1VCXA 2RCNA 5IYCH 2UXBQ 4AR4A 3T1YL 4KI0A 4GLVB 4H02A 1EIYB 1YI2A 1VQHA 2LXJA 4C2MH 1VQ8A 3CC4A 4JG2A 1UE6A 1SRUA 5IWAQ 2I5HA 4LF4L 1O7IA 1B2JA 2JA9A 3GTJH 4LF5L 4A93G 4X6AH 4Y52H 3JAMc 3GTGH 1N32L 4DR1Q 2AMCB 1A62A 2CQOA 2UXBL 2C35B 2Z6KA 3KF6A 3T1HQ 4DR4Q 1PH4A 1E22A 3GTPH 1VQOA 1C9OA 1QVCA 3HKSA 2ES2A 1BQ9A 2R7ZG 1VQIA 2YYZA 3HOVG 3K0XA 1VS0A 2JA7H 4JI4Q 3HOUH 4LF7L 4GLAC 1NMFA 3CW2C 3TQYA 4DV2Q 4LFBQ 2CWPA 5GADC 3I4MH 4LF6L 2R7FA 3GDEA 5JEAJ 5AI3A 4IFDI 1X3EA 3CCJA 2CWAA 5IP7G 5C44G 1T9OA 4DV7Q 1EFWA 3IRBA 4IPCA 3PIOA 1PH1A 1EWIA 1Z9FA 4POFA 4GKJL 1RYTA 4QL5A 4DUZQ 3TS2A 4YY3L 1NNQA 1LM0A 1SMXA 4GOPC 3PF5A 2M4YA 6RXNA 2VQFL 2Y0SG 2UU9Q 2F52A 1JT8A 5AJ3Q 5FLMG 3HFZB 5C0XI 2K75A 5C44H 2V3BB 2K52A 3KYWA 3ERSX 1ASYA 3D0FA 3NBHB 4GN5A 4DV1Q 1QYBA 1Q86C 2A1AA 4A76A 4JI2L 3S2DH 3HKZE 2IX0A 3F1ZA 1EQRA 3PZAA 1E3PA 2AWNA 4AR3A 5IYBG 3I7FA 1YVCA 2BA0A 5HGQA 5LMNQ 2R7ZH 1HNWQ 1B2OA 1CSPA 4DV5L 2E5LL 2OWOA 1E24A 4A3BG 1V9PA 3HKZG 4HJAA 1N34L 3GO5A 4TPUA 1X65A 4EQ5A 3GTLH 1VQLA 1HNZQ 4DNIA 5IWAL 2ID0A 1HNWL 4DR6L 1RWDA 5FJ8G 4A3JH 2F4VQ 3NENA 2R93G 4JI3L 4BY1H 2PQAA 2K5NA 5E7NA 4LFCL 3BZKA 3ULPA 4UY8C 2ZM6L 4IPDA 4QGUA 4NXNL 4GOPA 3AQQA 2ZJPA 4HIMA 3CCMA 1I6HH 1VQ5A 1R0GA 4C3IH 3PWFA 4C3HH 4JBKA 3RLOA 3UE1A 2ZJRA 1L1OC 5C0XJ 2BA1A 1EQQA 3CCLA 3J80c 4P71A 1I50H 5LMNL 2IHFA 3PCOB 4LUOA 4DV3L 4A3CH 1H7VA 2JJQA 1VQEA 2VS1A 1IL2A 1C7YA 2VW9A 4KHPQ 1FHHA 3AFQA 1VQBA 3F2DA 3G48A 4JI0Q 1SMUA 3KYHC 1QZGA 4ALPA 2B29A 2WP8J 3ZJYC 1I3QH 1X9NA 1OXSC 2PMZE 4AQYQ 3J7ZC 3A0JA 1XNRL 4B3RL 4QY7A 3FKIG 3SGIA 4DV0L 5JEAG 4PZ6A 1K83H 7RXNA 1S24A 1RIPA 1XMOL 3PIPA 1B8AA 1PH8A 2K5HA 1HNXL 4LF4Q 4AR5A 3KF8B 4AQYL 3I4NG 2CFMA 2RHQB 1YITA 1IBLL 4PMWA 3CC7A 1S72A 4LFAL 1NE3A 3HOWG 1N32Q 1S30A 3KYXA 4DR7L 1B71A 4DR4L 4DV6L 1CAAA 3U4VA 1VQFA 1PVOA 4BY1G 3ULJA 2PVEA 4A3EH 5FJ8H 3S1MH 3GTQH 1J5EL 4IPHA 4HJ8A 4JOIA 1PH7A 1E1TA 4LF7Q 2NVTH 2HHHL 3I55A 3PGZA 3CCQA 1XPUA 2R92G 2F4VL 2QL0A 3E0EA 3CXCA 1IU5A 4UPAA 3H0GH 3AYHB 2QEXA 4DV6Q 3GTKH 4IO9A 1MJEA 4DV7L 5AI2A 1JE5A 3SS2A 1DGSA 1Q1EA 3CQZH 2JQOA 4IJLA 1N8RC 4DK6C 4BBSG 1TXYA 2XTIA 1X3GA 1B7YB 3OTOQ 4MZ9A 1JJ2A 4XTCS 1Y14B 3A44A 3JC62 1N33Q 3S15H 4JI8L 4A75A 1EOVA 1N9WA 3J81j 3FP9A 4L5RC 1U0LA 2OCEA 1QCVA 1N36L 4WJ4A 1VQJA 4JI6L 3E9HA 3PSIA 2GMGA 3PO3G 3M4QA 1R0HA 4EX5A 1WOCA 4JI2Q 4JCVE 3S24A 2OTLA 2R93H 3U50C 2E2HH 4X64L 5ELOA 1EUJA 3FKIH 1IXRA 1UWVA 1GM5A 4DR2L 4JI0L 3PUZA 2E2IH 1QUQB 1WCMG 1L1OB 1G291 4LUVA 1N33L 4OXPA 3H3VI 1YUZA 1YNXA 4JC0A 3I4OA 4QJFA 1V43A 1YJNA 1K9MC 4LF9L 1VQCA 3UDIA 1MJCA 1IZ6A 2WAQG 3BZCA 3LGJA 3Q8DA 1KAWA 4P73A 1Q82C 1Q81C 3ER0A 5LMUQ 2QGQA 4JI7L 4X66L 1WJJA 3ULLA 4YY3Q 1HR0L 4A3CG 4JI5L 1PA6A 2OQKA 2JA7G 2WFWA 2UU9L 2UUAQ 2FXQA 3K7UC 3OTOL 3KOJA 1UEBA 2A19A 3PO2G 4NB3A 1GKHA 2JA8G 3JC63 1M90C 4IPGA 1RDVA 3KJOA 4AR6A 5IT9c 3KJPA 3RYGA 1CKNA 1T9HA 3DLLA 4HJ7A 1J5EQ 1BVSA 5H1SE 2HR5A 1HH2P 5ELNA 4BXXG 2KKDA 3HOZH 4A3JG 2D62A 2KN9A 4XIGS 4DR2Q 2PNHA 3RZOH 3KLWA 4GN4B 3HOZG 4JBMA 4BXXH 2CKZB 3AFPA 1R0JA 1IYJB 2V1CC 4DK3C 1QZHA 1VQPA 3S1RH 3FHWA 2JA6H 3HOYG 3S14H 1H95A 2GN5A 4A3MH 4JV5Q 3JAMi 4OX9Q 2JE6I 3PUVA 1JMCA 3PUYA 5IYDG 3CF5A 3A5UA 2PI2A 4DV2L 4HJ5A 1Y1WH 2GVAA 2A8VA 1YBYA 2NVXH 2BH2A 5IYBH 4JBWA 2GVBA 4UP8A 5M3MG 3MPSA 1JJCB 1Q8KA 2MS3A 1VQDA 4JI8Q 3UE0A 2UUAL 3AEVA 2L15A 4B3RQ 4JV5L 2H5XA 3WWVA 1OTCA 3JC66 2EQSA 4BBRG 1XMOQ 4X62L 4IOAA 4DUZL 4MTNA 3BJUA 2ZTEA 4IOCA 2MQHA 1KQSA 1NY4A 4WJ3M 5LMNW 1KL9A 4OWXB 1LUZA 2AWOA 1HR0W 4DR7Q 2HQLA 3STBC 4PG3A 1PH6A 3T1YQ 2UUBL 4A3IH 1TWCH 5IP7H 1VQAA 5LMUL 4JI7Q 3M7NA 3MXNB 4DR5Q 1YK4A 5IP9H 1YIJA 3RLNA 3I4MG 1CUKA 2F3IA 1TWHH 1IROA 2LSSA 3PV0A 4R1JA 3UDFA 2QA4A 4IFDJ 2E8GA 3HOUG 1Z47A 4BBSH 1VQ6A 1I94Q 3HOVH 2PQAB 2Q2TA 1FHMA 4BA1I 3RZDH 2UXDQ 3EN2A 1HNZL 4P75A 1A8VA 1S40A 4DR6Q 1W2BA 3CCSA 5AJ3L 4A4IA 4A3FG 2LXKA 4IJHA 4A93H 1VQ4A 2WB1E 4KLKA 2VQEQ 4OWTB 1X56A 1TWFH 1EIFA 1PV4A 2YV5A 5M3FG 3L7ZC 2ZTCA 5IYCG 2IY5B 5GAGC 1NJIC 1AE2A 1OXTA 4BY7G 2WB1G 1EYGA 3BU2A 4PZ7A 4AIMA 4DV5Q 2E5LQ 1FJGL 3HOWH 1LKOA 3GTMH 2PI2E 2YTVA 3F8TA 5GQOA 1IBML 1G6PA 4R4TA 2UXCQ 1WI5A 3U4ZA 2JEAI 1X55A 1WYDA 3KYUA 4YWKA 1X54A 2UXDL 2JEBI 2UUCQ 3M4PA 2CCZA 1OXXK 4YCWA 4LF5Q 1R0FA 2K4KA 4JI3Q 1Y1VG 2N78A 3PF4A 1G51A 1N36Q 3RR5A 3GTOH 3HOXH 3F2CA 4DR3L 2OTJA 5JJKA 3RZTA 4UP9A 1KRSA 4DV4Q 2VNUD 3J81c 4OO1I 1RB9A 1MIUA 4A3KH 1E1OA 2IT1A 2WAQE 4J15A 3CD6A 2LCQA 2ZTDA 5C4XH 2JA5H 1Q1BA 1BRFA 2NZOA 3OYYA 3UDGA 2KCMA 3KDFA 1YHQA 5K36G 4JBJA 4JOIC 2K2DA 1GVPA 2OQ0A 5GAHC 1PH9A 3CCVA 4BA2I 2KHJA 3CPFA 1A63A 2B63G 2RF4A 4KHPL 1DVBA 1T9PA 1LKMA 4OWWB 4OX9L 1E7ZA 2ZM6Q 3DM3A 1XPRA 4X65L 4YHHL 1E8JA 2DUDA 2NVQH 2NVYH 1B70B 1JB7A 2AHOB 1PH5A 1K8GA 3G4SA 1L2FA 1TWGH 2VZAA 3D31A 1SN8A 1XNRQ 4A3LH 4LWCA 4DR1L 3TEHB 1YHAA 1KIXA 4HIKA
chains in the Genus database with same CATH superfamily
4A3EB 1YUXA 3S17H 3J81E 3TSSA 2A5HA 5IY0A 3EBEA 3CRKC 3GD7A 3CCRA 3MXNA 4J8QA 1W3SA 1SE8A 2EY4E 1L0WA 2HIVA 5GROA 1UE1A 4QUCA 1K83B 5BR8Q 2K14A 2XIWA 4AH6A 3J80L 2PVXA 4LF8L 2N55A 2F0GA 4X65Q 4YHHQ 3LWPB 4R4CA 4BBRH 2RKSA 4DV3Q 1QG7A 1G91A 2D0PA 1A0IA 3P8BA 3B0AB 1YZ6A 4NPSA 1BBXC 5CYUA 3AMUA 5DEHA 1CQVA 5GAEC 3C2PA 1TKWB 4RMFA 4X66Q 2VUMG 5IYDH 3K5LA 1XNQQ 4F8MA 1YHBA 1FNUA 3I56A 1WTOA 4QIWE 4ZN3B 5M5WH 1IKMA 2JA6G 3HOYH 3E0JA 1F9RA 4LW1A 3NELA 2EYMA 1IRNA 2B2VA 3MSUA 1TS2A 4KV6A 1B2TA 2A68C 2JXMB 4OONA 3S2DL 1KAAA 1SYGA 2KHIA 2WACA 2HDMA 1SMMA 4QIWB 4C2MB 2JA8H 1PTOH 2IHEA 3HOVB 2NB0A 4U671 3S17L 5LL6X 2EYHA 2R7ZB 1RF2D 5M3FB 1E2ZA 5FO7B 4B3SL 1J6QA 4A3KG 3P1HA 3PUXA 2VUMH 1YK5A 3HOXG 2B39A 1KDCA 2IJ0A 4YCVA 4FXKC 1L1OA 4B3MQ 1SYDA 3HOVL 3KYVA 1R0IA 3QVDA 1IBKL 4HCSA 2XN9C 1ESRA 1K3RA 1Y1VL 4ILWA 2N49A 1LTLA 2L1BA 3D6WA 3TBIB 1AW7A 1QOHA 3S1NB 4PQXA 4K0KQ 1LKPA 1YV1A 1NBWA 4GKKQ 3VDYA 2XGTA 4OO1G 3EIVA 4LFCQ 1WFQA 3H0GG 1HZ9A 1LYLA 2EYJA 1EY9A 2AUSB 4KHZA 5I9PA 3H3VH 1ASZA 4MIUA 2K33A 1UUPA 2HT1A 1PFSA 3OWFA 4C3JB 2IPKD 1LTAD 3CMAA 3NFPI 3RZDB 3P75A 2I5MX 1JYBA 2MO0A 4OO1H 2WB1B 2Q8IB 4FXDA 3NEMA 1YNND 1RDGA 2K32A 1H9KA 3W1GA 5M9OA 2ERSA 1QVFA 1K73C 2RHSB 1HHVA 3RZ6A 3M3YH 4WJWA 1CHPD 5HY6A 4KY5A 1GXDC 2HIXA 3PIO3 1K8AC 2I0QA 1G2TA 1QVGA 1PH3A 4IZ8A 2Z6KC 4ZRZA 2EYPA 4ZK9B 1F2YA 3VR4A 2D9UA 1I6HB 1I4PA 1KLGD 2B63B 5IYCH 1EYDA 1RKNA 2PQEA 1VQHA 2EVBA 2J0TD 4JG2A 4G4KA 5J22A 1O7IA 2JA9A 2KOLA 3SR1A 1N32L 2AMCB 1A62A 1DXMA 2CQOA 2C35B 2Z6KA 3KF6A 3MEHA 4V190 4DR4Q 3J80E 2F0TA 3GTPH 3BDCA 3HKSA 2ES2A 4DK0A 3HOVG 1VS0A 1F9PA 2P5ZX 5EIOC 2X6GA 2VB3X 4PNYA 4IFDI 3BDLA 1EFWA 1TQOA 3PIOA 4IPCA 4XT1B 2L4NA 4PV1C 1ILPA 1PFNA 2O5IC 1ODHA 3V2TA 4QL5A 2XJPA 1SMXA 3ZYYX 4RFBA 2Y0SG 1SJED 2O5JD 2K75A 2K52A 3ERSX 5I9OA 4A3FL 1Q86C 4JVZA 1DZ1A 3PZAA 2R7ZH 3S14L 2F0IA 2Z4IA 2OWOA 1KDAA 3WDNA 1V9PA 1OWBA 4G6BA 3I70A 3I4NL 1ML0D 4TPUA 1X65A 1HNZQ 1ENAA 1JORA 1TWGB 2WAQP 1STGA 4IURA 5FJ8G 2F4VQ 2R93G 2PSMC 3Q22A 1B53A 3CQZL 3HGBA 2RCFA 1IW7D 4MN3A 3R93A 3HOYB 4DK1A 4NXNL 3AQQA 1I4XA 3CCMA 5JVH1 2R61A 1VQ5A 4DGZA 5EINC 3S2HB 3EFXD 1GUOA 5C4XB 3K6OA 1Y8OB 1I50H 2K5WA 2IHFA 1SNMA 2GA4B 1H7VA 2B2UC 2SDFA 4ID6A 1C7YA 3A7AB 1FHHA 3AFQA 4B9XA 4JI0Q 1SMUA 1QZGA 3P2AA 1RODA 1S5ED 1I3QH 1W6JA 4AQYQ 1EY4A 4B3RL 4QY7A 2JA7L 4K6LA 1AP0A 1S24A 1RIPA 1XMOL 1I50B 5M5WL 1B8AA 3J7AF 3T16A 4AQYL 4K8JA 2RHQB 4QF4A 1N32Q 1K83L 3CC7A 3HOUB 4H13C 1K28A 3KYXA 1TWFL 4DR4L 3U4VA 2I46A 1VQFA 5ELEA 2EJFC 5FJ8H 4ZUJA 2HHHL 2K04A 1DOLA 2DN8A 1H9SA 1XPUA 2C9OA 1C48A 3E0EA 3IL8A 3GTQB 2QEXA 5FOBB 1BOSA 4CDCC 3TZUA 1PZKD 3EROA 4O1NA 3VYRA 3SS2A 3CQZH 4IJLA 2VUML 1SEBD 5EJWA 4DK6C 1TWHB 2CKAA 4OIJA 2QDLA 1Y14B 3JC62 3S15H 4QMGA 4R8NA 4C2M1 4WJ4A 1N36L 1SNQA 1VQJA 2GMGA 1I50L 3OMGA 3M4QA 1R0HA 3S24A 3U50C 1GM5A 1EUJA 1K8OA 1L1OB 4I7AA 2RSOA 3H3VI 1YUZA 1K9MC 2PZUA 2AUKA 1VQCA 3UDIA 1MJCA 2DY7A 1KAWA 1VZIA 1Y69U 1Q81C 2QGQA 3MAQA 5ELBA 4YY3Q 4A3CG 2XJQA 4JI5L 1PA6A 2AQ3B 4MTKA 2FXQA 3K7UC 1TVXA 3OTOL 5JPNC 4FXGC 4NB3A 5GAHc 3HOZL 2JA8G 1X3QA 2KECA 1RDVA 4AR6A 2JA6B 3DLLA 4C3IL 5JPMC 4RWSC 3GTGL 1J5EQ 4DAVA 1HH2P 5ELNA 4A3JG 2D62A 5ISRA 4DR2Q 3RZOH 3KLWA 4GN4B 3KLSA 5JVH3 2Z8LA 1YNJC 2V1CC 4DK3C 1QZHA 1VQPA 3DWPA 3FHWA 2GN5A 4OX9Q 2NBFA 4FVMA 2SNSA 3H9CA 3NWSA 3PUYA 5IYDG 4DV2L 4HJ5A 1EIGA 1YBYA 2NVXH 1V1PA 2GVBA 1Q8KA 1JJCB 1VQDA 3H94A 2UUAL 4B3RQ 4IFDH 3I91A 3WWNB 3S15L 2H5XA 1OTCA 1GOZA 2EQSA 4BBRG 1XMOQ 3GTOB 5IGGA 4X62L 1RYQA 3BJUA 2ZTEA 4QIWP 4KKSA 4Q5VA 2JA8L 5GAEc 1NY4A 5I6YA 1KL9A 4OWXB 1HR0W 3R8BA 2HQLA 4A3KL 4PG3A 3PKJA 5IGFA 4JAEA 1SE4A 1VQAA 4BBSL 3E3XA 4JAGA 3S15B 3MXNB 4LHLA 3LWRB 4DF7A 4IFDJ 2LSSA 4CHTB 4B9WA 2JA7B 2QA4A 3HJWB 4RGMA 3HOUG 4K5XA 1R9TL 3HOVH 4HTHA 2PQAB 5DAUA 3EN2A 2NZ1D 2AYJA 5FLXE 3D8GA 1S40A 4DR6Q 5AJ3L 4A4IA 3A8IE 4A3FG 4A93H 2NVQB 2WB1E 4EGVA 1PV4A 3S2HL 2PMZP 3TP6A 3A8JE 2ZTCA 3E6ZX 5IYCG 3S1ML 2IY5B 2B63L 2WB1G 4IUUA 4AIMA 3HOWH 3A7LA 1D6EC 1JR0D 1G6PA 5I6WA 1KABA 4LHNA 4WRDA 3J7Z1 2L5TA 2EXZA 5CR3A 4YWKA 1X54A 5EKKA 2F3WA 2JEBI 2UUCQ 4YCWA 1Y1VG 2DJGC 2N78A 5C4XL 2R3ZA 5KYLA 2CR8A 3GTOH 1KRSA 2VNUD 4OO1I 4A3KH 1D5XC 1G6ZA 3MFGA 3M4OB 5IODA 3HOXL 1BRFA 4U673 2NZOA 3UDGA 4JOIC 3RD4A 3CCVA 3DM1A 4HR7B 2KHJA 1HTLD 3CPFA 1A63A 2B63G 1T9PA 3PIP3 1E7ZA 1SAPA 4XGHA 4OX9L 4KJOA 4X65L 4YHHL 5KEEA 5G3LD 4EQOA 1K8GA 1YHAA 1GJXA 1HA6A 1STEA 1BBUA 2NVYL 4DV4L 3IAYA 1HNXQ 1WTQA 1PYSB 2EZVA 4A3BH 2EPBA 2J4XA 1QNKA 1BBWA 1PFVA 3K57A 4BY7B 5C0XH 2L0ZA 2XWBB 1OO9B 3I4ML 1KTKA 2OEOA 4A3GH 4Y7NL 2F0HA 3NBHA 1B44D 3I73A 1HQRD 3B08B 3J80i 5FLMH 3SK8A 5MFZA 4DU9A 1P8LA 2PPBC 1XPOA 1F9QA 5JAVA 3E9IA 1I4HA 2VQFQ 3DEOA 2NZHA 2Y0SB 5C4JL 3KK7A 3GTOL 1PYBA 3RNUA 5JJIA 1NSNS 2M2LA 3MWYW 2F0NA 4FF3A 1ZRPA 5C3EG 2F4IA 3ONAB 1YJ9A 3CP0A 4DPGA 1FVIA 2LMCB 3SEBA 3S1RB 1N34Q 2NN6G 1V1QA 2B2YA 1XWEA 2J7ZA 1IBKQ 4R4IA 4KTAA 4PZ8A 1XYIA 4B3TL 3K7AH 3LPEB 2XJRA 4LF6Q 3S1MB 1VMCA 3NE5B 4A3FB 2KQ3A 3SVMA 1JICA 5C3XA 1EFID 1VQMA 1MSHA 3B6YA 3MA2B 3M4OH 1K0RA 3S1QH 2QEJC 2VQEL 2ICEC 3H15A 4LF9Q 3S1NH 1OXVA 3KDFB 4DV1L 1BQQT 2VB2X 4AYBB 1KHIA 5ELFA 2YTXA 1ZKOA 3QOLA 4LF8Q 2MUYA 4Y7NH 3M3YB 3W5OA 1EEFD 5FLML 1RCVD 2MGSA 4TVAB 1PFYA 2E2IL 2EIFA 4AYBE 2APOB 1XMQL 2I5LX 3OMCA 3M85A 1BQ8A 4R4OA 1XNQL 2F0PA 5M3FH 1HJPA 3IFTA 4LUZA 5KGUA 3NQIA 4GN3B 4K2LA 4R4QA 1EY7A 3RZOL 4EVOA 1J9OA 3Q23A 1UE7A 4L5SA 3G7LA 1LACA 4YWMA 4C3JH 2A6HC 1D8LA 3L9AX 3ITPA 4P72A 4AYBP 4A3EG 3T1HL 4L5QA 3Q0AA 1EL0A 1M8AA 3TS0A 4KD3A 4AHZA 2KBNA 4O2DA 5IP9G 2PYAA 2Q2UA 1LTGD 1YEZA 2JA6L 2AUJD 3UDXA 2JA5B 1HA5A 2LY7A 5D3DA 4KKTA 5D14A 5M5YL 1PTOC 1IBMQ 1CT1D 1FGBD 2NN6I 5IGDA 2CQAA 1UE5A 1DCZA 1FGUA 2RSNA 1U5KA 2Q8TA 2UUBQ 1GO3E 4GKJQ 4NXML 1T5XD 3CAMA 4UDUC 5C44L 2ALYB 3PO2L 3C3LA 1BE7A 3H09A 4ULLA 1PFMA 3RN5A 1DYQA 1DOMA 1BNZA 2XNAC 3KF8A 3M7GA 1AH9A 2XRQD 1DX8A 4TRDA 1CADA 1SMWA 2F0OA 2RDVA 2EJMA 4K0KL 1STNA 4A3DH 2MO1A 1I5FA 1VQGA 2AQCA 1S5BD 4GKKL 2RA4A 5BN3A 1WCML 4AR4A 3OOCA 3T1YL 4KI0A 4H02A 2C6AA 2LXJA 1BCPC 4C2MH 2JA8B 1CTMA 3DWAA 4A3LL 2I5HA 1B2JA 3NTKA 1QWYA 4F7XA 1VQOA 1KNEA 3DWQA 3HG9A 3QOJA 2A69D 2R7ZG 1VQIA 1R9TB 3TQYA 5ELCA 4LFBQ 5GADC 4I7ZC 4N8FA 1HCZA 3GDEA 5CMDA 3CCJA 1SJHD 5LHY1 3QQCE 1U4MA 1WVLA 2CWAA 5IP7G 3IRBA 1K8MA 1I4RA 4DUZQ 4GOPC 2M4YA 2UU9Q 2F52A 1WCMB 5AJ3Q 1ILQA 5C0XI 5C44H 3MC0B 1QYBA 4Z9CB 1VZGA 4CGYB 3F1ZA 2AWNA 4AR3A 2EY5A 3I7FA 1A3VA 1HNWQ 1B2OA 3S1RL 1E24A 5IGBA 4FF2A 3EQLC 4EQ5A 2CW0C 5I2XA 1SE2A 2BDNA 4DNIA 1VQLA 4QB4A 1HNWL 1RWDA 5J39A 4BY1H 2PQAA 2K5NA 4C3HL 1KDBA 1ENFA 1ICFB 4WORA 4B08A 1CA5A 3BZKA 1B1ZA 5HURA 4X3UA 4IPDA 3EJIA 2ZJPA 2CH4A 4JBKA 2K1BA 2ZJRA 3X3MA 3CCLA 4JW0A 5LMNL 2A74C 3PCOB 5JEAH 4DV3L 1VQEA 1GHKA 4XT3B 4BWGB 3S16L 3KYHC 3QWNA 4LAAA 2WP8J 1VDZA 1OXSC 2M00A 3SGIA 3VA5A 4ME5A 2WIIB 1V1PB 3I4MB 2K5HA 1WTXA 1HNXL 1B50A 3LWQB 1BF4A 1STYA 4LFAL 3I72A 3M3YL 4L8JA 1NE3A 1PRTB 3DHQA 5CBEE 4DR7L 4DV6L 1PVOA 4AI3A 2EDGA 1SYFA 3K7AL 3NQTA 1GUGA 4IPHA 4A3JB 2IL8A 2NVTH 3WOFA 3PGZA 3I55A 3C46A 1EU3A 2F4VL 4KJNA 2QL0A 1IU5A 1QE6A 3H0GH 3R2TA 4UPAA 4DV6Q 1RJTA 4ZAIA 4KMUC 5AI2A 2RDFA 4AI0A 1N8RC 4G7ZC 1SYBA 2XTIA 2Q8RE 3OTOQ 4XTCS 2RVLA 4KK7A 1TU2B 5IP7L 1N33Q 5FO9B 3FKIL 1N9WA 2PZWA 5IT9E 3PIP1 1QCVA 1GUWA 3E9HA 2JSOA 3PQIA 3PO3G 4ZLTF 1B9NA 4JCVE 1QCBD 2OTLA 2AQ2B 4X3TA 2QKIC 4JI0L 4DR2L 3PUZA 2E2IH 1N33L 2YU9B 4LUVA 1I6VC 4JC0A 1XX8A 3Q8DA 4P73A 1WJJA 3ULLA 1TY2A 1HR0L 2OQKA 1PXUA 3T53B 5C4HA 2UUAQ 5IT9L 2JA7G 1LO5D 4FYDA 4C3HG 2E74C 3NHHA 2Z1CA 1XXGA 1GKHA 2FFKB 1M90C 5T1IA 3S17B 3N6RA 2M6OA 4HMIA 2HR5A 2L9HA 1U4PA 3HOZH 3D6CA 3FPPA 2B2WA 4XIGS 4KN7C 3AFPA 1R0JA 1IYJB 1S5FD 3FEWX 2JA6H 3HOYG 3AU7A 4IUPA 3S14H 4A3MH 4JV5Q 3JAMi 2PO4A 3PUVA 1JMCA 1QJOA 5IGEA 1Y1WH 2IW3A 3SE0A 2Z3QB 5IYBH 2F0DA 2R93L 2F0FA 5M3MG 1AZPA 4A3EL 2QCPX 2MS3A 4DFAA 1CI3M 4JV5L 3WWVA 3JC66 3MTSA 2HVYC 3MFYA 1EEID 4KD4A 5EPJA 3K35A 4AHXA 4WJ3M 5LMNW 4A3DL 3MXPA 1PLFA 1UEAB 4DR7Q 3QO2A 3WWLA 2RDHA 1PH6A 3M4OL 1B3QA 4A3IH 2JA5L 1TWCH 2F1MA 1EWCA 3DXJC 1GUTA 3S1NL 3I4MG 3RLNA 1D5MC 1TWHH 4AHWA 3PV0A 4R1JA 3UDFA 2KJXA 2E8GA 3HKZB 2C5CA 4BBSH 2ENBA 1ZYRD 1VQ6A 5LL6S 3PO2B 1B4OA 3CU7A 3RZDH 1HNZL 5EBCA 4X3SA 4P75A 1J8IA 3V05A 3KLRA 4IUNA 3GTJB 4XXBB 1JOOA 3NBIA 4K8IA 4FF4A 4CKEA 2N88A 5E3FA 4OWTB 1TWFH 1EIFA 1VMPA 4QCLA 4OHJA 4TKOB 4IUVA 3A8KE 2WINB 3FDJA 1IKLA 1V1OA 5GAGC 4BY7G 1AE2A 1OXTA 1EYGA 1G2SA 4PZ7A 4A3DB 4DV5Q 3H6MA 2E76C 3GTMH 4DNTB 1HQMC 5GQOA 1JWMD 1WI5A 1CQFA 2JN4A 5ELDA 2I07B 4B8CD 1HUMA 4GZYC 2CCZA 1OXXK 2K4KA 3PF4A 5FKAC 3F2CA 5JJKA 2KVMA 4RHRA 4DV4Q 4FNFA 3OIPA 3GTKL 1MIUA 2NTSA 3GTMB 3CD6A 2ZTDA 1LV9A 5C4XH 1TWCL 4GS7D 2JA5H 5MLC3 2KCNA 1FNWA 2B5ID 5C3EB 2KCMA 5K36G 1YHQA 5EPKA 2K2DA 3U9OA 2OQ0A 5GAHC 5L37A 4YIJA 2RF4A 4KHPL 1DVBA 3KLSX 4XYQA 1LKMA 1CFMA 2NVQH 2DUDA 2CHBD 2MJ8A 1JB7A 5FO8B 4XQJA 2AHOB 3G4SA 1L2FA 1TWGH 2VZAA 3D31A 1HPCA 1SN8A 4IALA 4DAYA 4ZKCB 4DR1L 1XNRQ 5KNDA 1KIXA 4HIKA 1AZQA 1X3FA 4IN3A 1Q12A 3O13A 1SNCA 1T9QA 1FD7D 4JI4L 1D7QA 1VCIA 1IBLQ 5FK9C 2DNCA 1KXLA 3F2UA 1PH2A 3S2DB 1QUQA 5M3MB 4AYBG 1MGSA 2L11A 4LNQA 4DAMA 4GNXB 3VR3A 1SNDA 3TZDA 3NUCA 5EPLA 1H9SB 2UUCL 1X6OA 1S5DD 1KC8C 3OSOA 2E75C 2A6EC 2E2JH 1C09A 2L12A 2KHSA 2D0OA 4X6AL 2NTTA 3NWTA 4MHEA 1DOKA 3Q6SA 3PMFA 5FLXc 1Q3LA 1CSQA 1YNJD 3FVQA 2B8FA 1JE4A 1JOKA 2Z6BA 4JI6Q 2R92L 1TWFB 3ICEA 3S14B 1H9JA 1IU6A 1HZBA 5M5XH 4IQZA 2FJ2A 5EBDA 4A3LG 4DR5L 4ODGA 1HRJA 3LX0A 3TP7A 4O0AA 2XJVA 1TWGL 3KYYA 2JK8A 4YCUA 3CKIB 1F2ZA 1FYCA 5K36H 3QG1A 1BKBA 2F3VA 2EY6A 3G71A 2JA5G 1B13A 1PRTF 5COYA 1BFYA 1E0BA 2EXDA 1WD1A 1AFPA 3K8AA 1NXEA 1Q46A 4LFAQ 1QQTA 2O4XA 4A3DG 2Y0SP 5E4XA 4YWLA 1PDQA 3CCUA 1PZXA 4GNXC 2ZXRA 4RG1A 1IW7C 1NCVA 1Y8PB 5C44B 2EOTA 5IYCL 3G6EA 4BY1L 5JJLA 3HOUL 3J81i 3M9BA 3HOWL 2MNAA 1I3QL 4DV0Q 2AKWB 1DD2A 1SMYD 3N52A 1JJGA 3CRLC 1VQNA 1T5EA 2FMCA 2ZT9C 2CKCA 4E6IA 2Z9HA 3K81C 3R3OA 4DUYL 2K03A 1S2ZA 5CV4A 3E5SA 4NDXA 1SSOA 3GTJL 4RXNA 4BBRL 1RDPD 4RH6A 1GD7A 4NXMQ 4NXNQ 2R92H 5KNCA 3HP3A 3KBGA 2KEDA 5CV8A 2G9DA 4B3TQ 1S3OA 3GTLB 4HN7A 3OW7A 4HIDA 4POGA 1EOTA 3RLFA 1WTPA 1NUCA 1ET9A 2KEEA 5IE8A 4UP7A 5DM71 2Z0SA 1HR0Q 3A74A 1P16A 2ERJA 5C4JH 1SXTA 1FL0A 1ZYRC 4LMQD 3CCEA 1CZWA 2Y0SE 2E2JB 1SYEA 5AFWA 2PZTA 4DKAC 2X6LA 4WFN1 3PO3B 4O42A 5M5YH 2Q2HA 1XJVA 4N9PA 4RKLA 3U58A 2K50A 1WTHA 5BR8L 1HZCA 2F0UA 5M3MH 1SFOB 5C6AA 1XMQQ 4L63B 4CJ2C 2R6GA 4WFN3 4C3IG 4LFBL 4QQBX 1E2WA 2MPMA 1HTPA 2LFNA 2PMZB 3J81L 3H97A 4UAIA 1MKHA 4K2KA 1U9RA 1O78A 2UXBQ 1MHWC 1Z92B 1EIYB 1YI2A 3CC4A 2RBMA 3G6JB 4H44C 4FF1A 1D2BA 3GTKB 1AEXA 5IWAQ 4LF4L 4LF5L 3GTJH 2WKDA 3JAMc 4ZUIA 1XTCD 3GTGH 2JI3A 2UXBL 3T1HQ 1TS3A 2R92B 2D5DA 4RKBA 1C9OA 2NN6H 2HUGA 1QVCA 1I6HL 3I4LA 2YYZA 3K0XA 2K7VA 2JA7H 1CM9A 1GUSA 4GLAC 5CV9A 1NMFA 4RAUC 2CWPA 1SMYC 1DONA 5J1ZA 1TR5A 1R4QB 4DA2A 3C1EA 5JEAJ 5AI3A 2NVXL 2A6ED 1U4RA 1T9OA 4J6HA 1PH1A 4DXGA 1Z9FA 4GKJL 5M3FL 1RYTA 3TS2A 4YY3L 1LM0A 2K5QA 2VQFL 5IOCA 4V0BA 2WAQB 5FLMG 2NYZD 2XJTA 3KYWA 3AB9A 1Y1WL 2A6HD 4GN5A 1X32A 3V96A 2A1AA 2F03A 4JI2L 1IYVA 3X3NA 3HKZE 1A3TA 1EQRA 1MD2D 2B2UA 5HGQA 2NVQL 2BA0A 3BVMA 5LMNQ 2ZXPA 1EYCA 2DNEA 4DV5L 1IL8A 4A3BG 1PZID 4A3MB 4A3JL 3HKZG 1N34L 3GO5A 4AI2A 1GHJA 3GTLH 2ID0A 4HSVA 2OXPA 4P2CB 4G7OC 4CBVA 3URYA 4LFCL 1RHPA 1RTOA 4UY8C 2ZM6L 4QGUA 2QILA 1I6HH 2EYLA 4C3HH 4C3JL 3RLOA 3UE1A 1LT4D 2V0EA 2RFKB 1EQVA 3VR5A 3K5OA 3RZDL 5C0XJ 1EY6A 4P71A 3H99A 4AHYA 4LUOA 5EKIA 3PIO1 2JJQA 2VS1A 1IL2A 4AI1A 4KHPQ 2VW9A 3MQKB 1L0XB 4LJZC 3ZG6A 1ESFA 4ZYSA 3S16B 3GTPL 4ALPA 2B29A 5E1FA 2MHVA 1X9NA 5E4WC 2KUMA 1XNRL 3A0JA 3FKIG 4M1UB 5GAGc 4C56C 7RXNA 3P20A 1MI2A 3T13A 3K0YA 5CV5A 1HXYD 4AR5A 4LF4Q 3KF8B 2PCFB 3SK4A 3I4NG 1YITA 3D4DA 4JK1C 1IBLL 5DNFA 2HDLA 3HOWG 1S30A 3CQZB 3HRZC 3C1FA 1B71A 2IX3A 2KA7A 2BCOA 4BY1G 3ULJA 2NWGA 5C4ZA 3EVQA 3GTQH 4H7BA 4HJ8A 4JOIA 2A73B 2NUCA 1PH7A 1E1TA 1AN8A 1CK1A 3CCQA 4K6DA 4XXEA 1TS5A 3LWUA 5IIFA 3GTKH 4IO9A 2YU9L 1MJEA 2R7ZL 2JQOA 1WTRA 4BBSG 1EY0A 3TP5A 1X3GA 1B7YB 4ABNA 4MZ9A 4H0LC 1JWUD 1I4GA 4JI8L 4A75A 1EOVA 1JCKB 1U0LA 2OCEA 4JI6L 3PSIA 4EX5A 1WOCA 4JI2Q 5D3IB 2E2HH 5ELOA 3FKIH 1IXRA 4TVMA 1UWVA 1WCMG 1G291 1DM0B 5D65A 4Y7NB 1H9MA 4OXPA 1VF7A 3I4OA 4QJFA 1V43A 3SDZA 2WAQG 1IZ6A 3LGJA 4KKUA 5A2QE 3NXWA 1PZJD 1Q82C 1EZ6A 2ICIA 5C4JB 5LMUQ 4X66L 4JI7L 3PO3L 2JP1A 3S2HH 3KOJA 2A19A 4JAFA 3PO2G 4OL7A 3JC63 3RUZA 4IPGA 3KJOA 4CKCA 3RYGA 3HAXC 5H1SE 3KBXA 2HQEA 2KKDA 4F87A 3ND8A 2HCCA 2PNHA 3HOZG 1S5CD 2CKZB 5A2QL 1TWAL 4RGTA 5CBAE 3S1RH 1H95A 1NR4A 4X3KA 3JAML 1L0YB 5G3LF 3HS0C 3A5UA 2BH2A 2GVAA 4U68A 4JBWA 3MPSA 3AEVA 4M8AA 2L15A 1ENCA 5IYDL 1SBBB 4DUZL 4IOAA 4MTNA 1HFNA 4RHSA 2FMMA 4IOCA 1KQSA 2E2HL 3HJYB 1HFGA 1LUZA 5AN9H 1KNAA 3WOEA 3T1YQ 1PRTD 3U9SA 3M7NA 2RQXA 1YK4A 3IFDA 5IP9H 1YIJA 1HUNA 1BO0A 1CUKA 1VZHA 3P7JA 1IROA 3DUZA 3I4NB 4A3BL 1F77A 1Z47A 5EGTA 1I94Q 3T56B 5MFPA 4CDDC 2Q2TA 1FHMA 1EY5A 4BA1I 3FPUB 4BY1B 3RZOB 2F0KA 2O5JC 4PMCA 1WTWA 4IJHA 3VYSA 5KYIA 3K58A 4N8X1 2VQEQ 2M9VA 1E2VA 3TDQA 4Y52L 2YV5A 2J9UB 3FDTA 2G9HD 3L7ZC 5KNBA 1NJIC 2F0VA 2E5LQ 5KRUA 1STBA 4A3KB 1TWCB 2KCCA 2PI2E 2YTVA 3F8TA 3M4YA 4E6YA 4R4TA 5KIXA 1ET6A 2UXCQ 3HOXB 2JEAI 1X55A 1WYDA 2UXDL 1JOQA 1ICWA 2K5DA 4LF5Q 4JI3Q 4KHVA 3J7AV 1YNNC 1G51A 1N36Q 1LT3D 1PTOD 1C4QA 4RA8A 4DR3L 3SK6A 3RZTA 2OTJA 4DXFA 3GV6A 2OF1A 1E1OA 2IT1A 2LCQA 5EQ0A 3I3CA 4C3HB 5CORA 2PPTA 4C3IB 4ZN1B 4HMJA 3D4RA 5CV6A 1GVPA 1NNXA 1JQYD 5FJ8L 3LWEA 1I4QA 2K05A 3NSWA 5C5MA 1F4LA 3H0GB 3DM3A 3MHBA 3NP8A 4RCOA 2L0CA 1PH5A 2R93H 4JADA 1A15A 4A3LH 5DM73 2E2DC 3TEHB 3PIPA 1Q7YC 3DEPA 3FMCA 4C3JG 4ZKBB 1HZAA 2XWJB 1VQ9A 4APVA 1QB5D 3W1BA 1BCPD 3IU3I 1F9SA 3NTHA 5CGKA 3J7A5 3CMEA 2DSXA 2FHTA 1YJWA 2H1EA 1Z6HA 4A3IL 4JYAQ 4K5WA 3J7YW 2A69C 4B3ML 2CW0D 2K5VA 2DJFC 5H1Sc 1I3QB 1TWHL 5M5YB 4A3GG 5IYBL 5GADc 1VQ7A 5DM63 2F0MA 3OW2A 1X3PA 1H9RA 1UNSA 1I94L 5C0XG 4BY7L 2N3SA 5RXNA 3OPOA 5DLQE 1NXGA 4BXXL 4Q0FA 4JI1Q 3VR6A 1SYCA 1OXUA 4HJ9A 4GNXA 1Y1WG 3A5ZB 2TMPA 4NP5A 1PHJA 3H3VC 3LWVB 1AE3A 4MNOA 2Z3RB 2KENA 1TIID 2DGYA 1VF5C 2V0FA 2N8NA 4JI1L 1PFBA 2B3GA 4X64Q 1A2UA 3K7AB 3VYTA 4A93B 3W2DA 4PMBA 2IX1A 1CKMA 4IUTA 3RN2A 2NVTB 4QUFA 4XQQA 5I2YA 3T4AC 4K14A 2MFIA 4CKBA 2EJGC 3LWOB 1M1KC 3PO2H 2UXCL 5TSSA 4RGNA 2B8GA 2R7DA 4FDBA 2ZJQA 3T51B 2HHHQ 2JYOA 5C3EH 4CJ0B 5CC4A 2V4DA 3KUPA 3L2PA 4DUYQ 1JB3A 3ND9A 2TSSA 4GOPB 1SFOH 3BDOA 3STBD 3KFUA 4GS3A 4DR3Q 1PRTC 4EQPA 1Y1VH 2ASBA 8RXNA 1WCMH 1RL2A 3S16H 4DAYB 2NYDA 3D3RA 1W6KA 1C0AA 2ZIXA 3PO3H 1LTBD 2K6AA 2BH8A 2Q2IA 2B2YC 2FINB 1Y8NB 2K28A 1ZXTA 2KCTA 2VY3A 2L55A 3BVGA 4RCNA 5C5LA 1D1IA 3L0OA 4OIKA 4BY7H 3SK5A 2PW5A 1CKNB 3R2IA 2LS01 1JWSD 1R9TH 5JVG1 4B3SQ 5J3BA 4GLXA 3TP8A 3RMHA 3TRZA 4NKLA 2YTYA 2ZXOA 4TQUS 5BN5A 4A3FH 1EIHA 1CKOA 1PYWD 2A68D 1TWAH 5MF6A 4JI5Q 1XTDA 3BS1A 1STAA 1O7ZA 1NTGA 4HIOA 1VQKA 1TWAB 4ME3A 3KF6B 2VL6A 2XJUA 1B9MA 2F0QA 2B63H 4JYAL 2M6PA 3EA6A 3I4NH 1KD1C 1LTID 1TY0A 3H91A 3A54A 4A3IG 5C3EL 3TREA 5C4XG 2E2JL 4R9WA 1UAPA 1BUVT 3GV3A 2QF7A 2BOSA 3CHBD 5EAYA 5CV7A 3BYTB 4K5VA 4L5TA 2YU9H 4K9FA 2HCIA 2EY2A 1SROA 3CPWA 2BDOA 1NMGA 3F2BA 4P74A 3K80C 4HSPA 4A3GB 2G5DA 4NW2A 4XDXA 3MEFA 4X62Q 4IFDG 2ATWA 4ZQ3A 1SR3A 1KRTA 3CC2A 1CHQD 1SLJA 3I2ZA 2CH4W 1FJGQ 5JJZA 1Q8IA 3PUWA 4FP5D 4A3BB 4A3MG 3BG3A 1VCXA 4IUQA 2EYFA 2RCNA 4DN4M 4GLVB 1VQ8A 1UE6A 1SRUA 2BE5D 1KLUD 3BVZA 3FRPB 4X6AH 2XJSA 1OWCA 4A93G 4Y52H 1TT2A 4DR1Q 2DY8A 2H4OA 2QW7A 1DJRD 1WD0A 1E22A 1PH4A 3A55A 4LK1C 1BQ9A 4NMZA 1SE3A 4JI4Q 3HOUH 4LF7L 5M5XL 1GUNA 3H3VM 3CW2C 4DV2Q 5JVG3 4OEMB 3I4MH 3K59A 4LF6L 2R7FA 3SHLA 4A3GL 1X3EA 4S3SA 3NK9A 1WTVA 5C44G 4DV7Q 1PTOF 1PMRA 1EWIA 2EYOA 4XQNA 3LNLA 1ZEQX 4UHVA 4POFA 4HEDA 1FR3A 2CVRA 3BZDB 1NNQA 4BS9A 3PF5A 2E2IB 3JR7A 6RXNA 3FKIB 4DNRB 1JT8A 1SNOA 3HFZB 1EYAA 4XYOA 2V3BB 1ASYA 3D0FA 3NBHB 4DV1Q 4A76A 2F0EA 3S2DH 1BXTA 4RGOS 2IX0A 3OHXC 3HOWB 1E3PA 2NVXB 5IYBG 1YVCA 1Z7TA 2B2VC 1CSPA 2E5LL 5IGCA 1PTOB 4HJAA 1SNPA 5EKLA 5IWAL 4OELB 1U4LA 4R8IA 1CA6A 3VA7A 4DR6L 4A3JH 3MXGA 4TSSA 3NENA 4JI3L 5E7NA 2XRSD 3ULPA 1PFUA 4GOPA 4BBSB 4HIMA 1R0GA 2HD3A 4C3IH 3PWFA 3OWEB 1L1OC 2BA1A 3HZXA 1EQQA 3J80c 3QR8A 4A3CH 4A3IB 4C1NK 5M3ML 3GTML 2PYKA 1VQBA 3F2DA 3G48A 4BBRB 3ZJYC 2PMZE 3J7ZC 1TS4A 4KN4C 2SNMA 4DV0L 2WB1P 1BR9A 4PZ6A 1K83H 2BE5C 1II3A 5JEAG 3NTIA 3D4WA 3S9WA 1PH8A 1LT6D 3L3OC 2EE1A 2JI2A 2CFMA 3JAME 1MBYA 4PMWA 5A35A 1S72A 3TMEA 5C3WA 3H9BA 2F0SA 1CAAA 4CJ1B 3GTPB 2PVEA 4A3EH 3S1MH 1EY8A 1J5EL 1G8ZD 5BN4A 1IHZA 2O2LD 4FO2A 4LF7Q 5JOBA 2M4VA 2X69A 3DMUA 2R92G 3CXCA 5M5XB 3AYHB 2SOBA 3GTQL 3QJYA 1F2MA 1RTNA 4DV7L 1JE5A 1DGSA 1Q1EA 4CDFC 1TXYA 3I8ZA 2RDGA 3Q24A 1JJ2A 2MP1A 1EZ8A 1STHA 3A44A 3PL5A 3OIQA 3J81j 3FP9A 4L5RC 3GQBA 4A93L 2B2WC 1FNVA 2PW7A 4A3CL 5K5PA 4UY81 2OT2A 3VPBE 1V8QA 4X64L 1RD9D 1QUQB 3QIAA 3W3AA 1ONLA 3HEJA 1YNXA 4LF9L 1YJNA 3K5MA 1EQTA 1Y1VB 5FLXL 3BZCA 2H12A 3I90A 3GTLL 4N9TA 3ER0A 1QILA 2WFWA 3GP7A 1Y1WB 2UU9L 1UEBA 4F88A 3ERQA 2XSCA 4ZCKA 1A2TA 2F0WA 3J7Y1 4CDEC 3BYYB 1EWHA 5IT9c 3KJPA 1CKNA 1T9HA 4HJ7A 1Q90A 1BVSA 2PNRC 1O7LA 3GTGB 2D2CC 4BXXG 2AQ1B 2KN9A 1C8CA 4BXXH 4JBMA 2B2TC 1LTRD 2Z4HA 2WV6D 4EQNA 5M5WB 2JE6I 1LTSD 1P7PA 1NR2A 3CF5A 2C6BA 2PI2A 2A8VA 2F0LA 1BCPB 4UP8A 4JI8Q 3UE0A 1CZGA 1F2LA 2B2TA 1IYUA 1MSGA 2WKCA 5T1GA 1SDFA 3H0GL 1D5ZC 2MQHA 2E2HB 2AWOA 1B3AA 1JC7A 3STBC 2QDBA 2UUBL 2VUMB 4J1MA 5NUCA 5IP7H 3S1QB 4G57A 1A6XA 5LMUL 4JI7Q 1SFOL 4HCEA 1K0SA 3PKIA 5K2ME 4DR5Q 3VR2A 1BCPF 1WJVA 4KY6A 2F3IA 1K3BC 1QNUA 3MVVA 2VXWA 1S4ZA 5IP9L 2UXDQ 1EU4A 1A8VA 5I4DA 2R93B 1O7YA 1W2BA 3CCSA 3S1QL 1M4VA 2NVYB 3SXHA 2LXKA 1VQ4A 4KLKA 2IWHA 4C1NI 4L6TB 1X56A 4HAEA 1NAPA 3A56A 5M3FG 3TN2A 5MGNA 3MZ5A 3BU2A 3MXUA 1FJGL 3QB3A 1LKOA 1R4PB 4OGQC 1A3UA 5F2DA 1BDOA 1IBML 3VYUA 3U4ZA 3NPPA 3KYUA 1PFWA 2F0JA 3M4PA 2EY1A 4A3ML 1R0FA 5DM61 1LLRD 4JPBW 3RR5A 3HOXH 3IKJA 1O80A 4UP9A 3UI2A 3J81c 4DAPA 1RB9A 1LABA 2WAQE 4I65A 5HGTA 4J15A 1LT5D 4G7HC 1Q1BA 3OYYA 1D1KA 3KDFA 3HOYL 4JBJA 1PH9A 4KY7A 4BA2I 3K5NA 4V196 4OWWB 2XVSA 2NVTL 2JI1A 2ZM6Q 3LNNA 1XPRA 1E8JA 2NVYH 1B70B 2LKVA 3HKZP 3HOZB 1LTTD 4LWCA 2SEBD 2K01A
chains in the Genus database with same CATH topology
1X3FA 1BBUA 1YUXA 1HZAA 3S17H 1VQ9A 4APVA 1Q12A 5IY0A 4DV4L 3W1BA 1HNXQ 3EBEA 3IU3I 1PYSB 1T9QA 4A3BH 3GD7A 3CCRA 4JI4L 1D7QA 1VCIA 1IBLQ 1BBWA 1SE8A 1W3SA 1KXLA 1L0WA 3J7A5 3CMEA 2HIVA 1PH2A 2DSXA 1YJWA 2L0ZA 5GROA 1QUQA 1UE1A 4AYBG 5BR8Q 4A3GH 4LNQA 4DAMA 4JYAQ 2K14A 4GNXB 4AH6A 2PVXA 4B3ML 4LF8L 3J80i 2K5VA 3B08B 5H1Sc 4X65Q 5FLMH 4YHHQ 5MFZA 1P8LA 2UUCL 1XPOA 4R4CA 1X6OA 3E9IA 4BBRH 2VQFQ 4DV3Q 4A3GG 2D0PA 5GADc 1A0IA 3P8BA 3B0AB 1YZ6A 2NZHA 4NPSA 3OW2A 1KC8C 1VQ7A 1I94L 5C0XG 1C09A 2N3SA 5GAEC 5RXNA 2E2JH 2D0OA 1NXGA 5DLQE 4RMFA 4X66Q 1PYBA 4JI1Q 3RNUA 2VUMG 1OXUA 5FLXc 4HJ9A 4GNXA 1Y1WG 1XNQQ 5IYDH 3A5ZB 5JJIA 4LF9Q 1PHJA 1CSQA 1YHBA 4MNOA 1AE3A 2Z3RB 1ZRPA 5C3EG 3I56A 2KENA 4QIWE 4ZN3B 5M5WH 4JI6Q 2DGYA 1YJ9A 2JA6G 3HOYH 3CP0A 2V0FA 2N8NA 4DPGA 3ICEA 1FVIA 4LW1A 1N34Q 3NELA 4JI1L 2B3GA 2NN6G 1IU6A 1IRNA 1HZBA 5M5XH 1V1QA 4X64Q 4A3LG 3MSUA 4DR5L 1IBKQ 4R4IA 2IX1A 1CKMA 3RN2A 4B3TL 4PZ8A 4OONA 4O0AA 2XJVA 3K7AH 3LPEB 2XJRA 2MFIA 4LF6Q 2KHIA 3KYYA 1SMMA 2JK8A 4YCUA 2JA8H 1M1KC 2IHEA 3PO2H 2UXCL 2R7DA 4U671 4FDBA 3S2HH 2ZJQA 1BKBA 2HHHQ 3G71A 1VQMA 2JA5G 1B13A 5C3EH 1BFYA 2EXDA 3B6YA 3M4OH 3L2PA 4DUYQ 1J6QA 1NXEA 1K0RA 3K8AA 4A3KG 4B3SL 1Q46A 4LFAQ 4GOPB 1SFOH 3PUXA 2VQEL 3S1QH 3STBD 3KFUA 2VUMH 4A3DG 3H15A 1YK5A 4YWLA 1OXVA 3KDFB 4GS3A 3HOXG 3CCUA 4GNXC 4DV1L 4DR3Q 4RG1A 1Y1VH 1KHIA 2ASBA 4YCVA 8RXNA 1WCMH 2YTXA 1L1OA 3G6EA 4B3MQ 4LF8Q 1RL2A 3KYVA 4Y7NH 1R0IA 5JJLA 3QVDA 1IBKL 3J81i 4DAYB 2NYDA 3S16H 1K3RA 3W5OA 4K0KL 1C0AA 2ZIXA 3M9BA 3PO3H 2MNAA 2N49A 1LTLA 2BH8A 2Q2IA 4DV0Q 2AKWB 4TVAB 1JJGA 2KCTA 2EIFA 1VQNA 2VY3A 4AYBE 1XMQL 4K0KQ 2I5LX 3L0OA 3M85A 1LKPA 4BY7H 2CKCA 1BQ8A 1YV1A 1CKNB 4R4OA 5M3FH 1HJPA 1NBWA 4LUZA 3K81C 1XNQL 4GKKQ 3VDYA 1Q7YC 1R9TH 5JVG1 4DUYL 4B3SQ 4GN3B 5J3BA 1S2ZA 4GLXA 4R4QA 2XGTA 3TRZA 4OO1G 3EIVA 2YTYA 4TQUS 4LFCQ 1WFQA 3H0GG 1HZ9A 4L5SA 1LYLA 1UE7A 4A3FH 4RXNA 1CKOA 4NXMQ 2A68D 1TWAH 1GD7A 4KHZA 4NXNQ 5MF6A 4YWMA 4JI5Q 1XTDA 4C3JH 1D8LA 3H3VH 1ASZA 1NTGA 4P72A 2HT1A 1PFSA 4A3EG 4B3TQ 3T1HL 1S3OA 4HIOA 3CMAA 1VQKA 3NFPI 4L5QA 4ME3A 3KF6B 2VL6A 2XJUA 4HIDA 4POGA 2I5MX 3TS0A 3RLFA 1JYBA 2MO0A 3I4NG 4AHZA 2B63H 4JYAL 2M6PA 2KBNA 4O2DA 3I4NH 5IP9G 5IE8A 2PYAA 4UP7A 2Q2UA 5DM71 1YEZA 2Z0SA 3UDXA 3A74A 1KD1C 1P16A 3NEMA 2ERJA 1HR0Q 4A3IG 1RDGA 5C4JH 1FL0A 3TREA 5C4XG 3CCEA 3W1GA 1IBMQ 2Y0SE 2NN6I 1UE5A 1FGUA 4DKAC 1U5KA 2ERSA 2UUBQ 4WFN1 1GO3E 4GKJQ 5EAYA 1QVFA 4NXML 5M5YH 3CAMA 2Q2HA 2RHSB 3RZ6A 4L5TA 1XJVA 1K73C 4K9FA 2YU9H 3M3YH 2ALYB 1SROA 3CPWA 1BE7A 1NMGA 5HY6A 3F2BA 3RN5A 2HIXA 3U58A 1K8AC 2I0QA 4P74A 3K80C 1AH9A 2K50A 5BR8L 1HZCA 3MEFA 4X62Q 1DX8A 2ATWA 1CADA 5M3MH 1SMWA 1QVGA 4IFDG 2RDVA 1SR3A 1PH3A 1KRTA 1XMQQ 3CC2A 2R6GA 2Z6KC 4A3DH 2MO1A 1SLJA 1I5FA 3I2ZA 1FJGQ 4LFBL 4QQBX 3S1NH 1VQGA 3PUWA 4GKKL 1MKHA 4A3MG 1VCXA 2RCNA 5IYCH 2UXBQ 4AR4A 3T1YL 4KI0A 1Z92B 4GLVB 4H02A 1EIYB 1YI2A 2C6AA 1VQHA 2LXJA 4C2MH 1VQ8A 3CC4A 4JG2A 1UE6A 1SRUA 5IWAQ 2BE5D 2I5HA 1O7IA 1B2JA 2JA9A 2XJSA 1OWCA 3GTJH 4LF5L 4LF4L 3JAMc 4A93G 4Y52H 3GTGH 1N32L 4DR1Q 2AMCB 1A62A 2CQOA 2JI3A 2UXBL 2C35B 2Z6KA 3KF6A 3T1HQ 4DR4Q 1PH4A 1E22A 3GTPH 1VQOA 1C9OA 1QVCA 3HKSA 2ES2A 1BQ9A 2A69D 2R7ZG 1VQIA 2YYZA 3HOVG 3K0XA 1VS0A 2JA7H 4JI4Q 3HOUH 4LF7L 5EIOC 4GLAC 1NMFA 3CW2C 3TQYA 4DV2Q 4LFBQ 2CWPA 5GADC 3I4MH 4LF6L 2R7FA 3GDEA 5JEAJ 5AI3A 4IFDI 2A6ED 1X3EA 3CCJA 3QQCE 2CWAA 5IP7G 5C44G 1T9OA 4DV7Q 1EFWA 3IRBA 4IPCA 3PIOA 1PH1A 1EWIA 4X6AH 3LNLA 1ODHA 1Z9FA 4POFA 4GKJL 1RYTA 4QL5A 4DUZQ 3TS2A 4YY3L 1NNQA 2XJPA 1SMXA 1LM0A 4GOPC 3PF5A 2M4YA 6RXNA 2VQFL 2Y0SG 2UU9Q 2F52A 1JT8A 5AJ3Q 2O5JD 5FLMG 3HFZB 5C0XI 2K75A 5C44H 2V3BB 2XJTA 3KYWA 2K52A 3ERSX 3D0FA 1ASYA 3NBHB 2A6HD 4GN5A 1QYBA 4DV1Q 1Q86C 2A1AA 4A76A 4JI2L 3S2DH 1VZGA 3HKZE 2IX0A 3F1ZA 1EQRA 1E3PA 3PZAA 2AWNA 4AR3A 5IYBG 3I7FA 1YVCA 2BA0A 5HGQA 5LMNQ 2R7ZH 1HNWQ 1B2OA 1CSPA 4DV5L 2E5LL 2OWOA 1E24A 4A3BG 1V9PA 3HKZG 4HJAA 1OWBA 4G6BA 1N34L 3GO5A 4TPUA 4AI2A 1X65A 4EQ5A 3GTLH 1VQLA 1HNZQ 4DNIA 5IWAL 2ID0A 1HNWL 4DR6L 1RWDA 5FJ8G 4A3JH 2F4VQ 3NENA 2R93G 4JI3L 4BY1H 2PSMC 2PQAA 2K5NA 5E7NA 4LFCL 3BZKA 5K36G 1IW7D 3ULPA 4UY8C 2ZM6L 4IPDA 4QGUA 4NXNL 4GOPA 3AQQA 2ZJPA 4HIMA 3CCMA 5JVH1 1VQ5A 1I6HH 1R0GA 4C3IH 5EINC 3PWFA 4C3HH 4JBKA 3RLOA 3UE1A 2V0EA 2ZJRA 1L1OC 5C0XJ 2BA1A 1EQQA 3CCLA 3J80c 4P71A 1I50H 4AHYA 2IHFA 3PCOB 4LUOA 5LMNL 4DV3L 4A3CH 1H7VA 3PIO1 2JJQA 1VQEA 2VS1A 1IL2A 4AI1A 1C7YA 2VW9A 4KHPQ 1FHHA 3AFQA 1VQBA 3F2DA 3G48A 4JI0Q 1SMUA 3ZG6A 3KYHC 1QZGA 4ALPA 3P2AA 2B29A 2WP8J 3ZJYC 1I3QH 1X9NA 1OXSC 2PMZE 4AQYQ 3J7ZC 3A0JA 1XNRL 4B3RL 4QY7A 3FKIG 3SGIA 4DV0L 5GAGc 5JEAG 4PZ6A 1K83H 7RXNA 1S24A 1RIPA 1XMOL 3PIPA 1B8AA 1PH8A 2K5HA 1HNXL 4LF4Q 4AR5A 3KF8B 4AQYL 2JI2A 2CFMA 2RHQB 1YITA 1IBLL 4PMWA 3CC7A 1S72A 4LFAL 1NE3A 3HOWG 1N32Q 1S30A 3KYXA 4DR7L 1B71A 4DR4L 4DV6L 1CAAA 3U4VA 1VQFA 2R92H 1PVOA 4BY1G 4AI3A 3ULJA 2PVEA 4A3EH 5FJ8H 3S1MH 3GTQH 1J5EL 4IPHA 4HJ8A 4JOIA 1PH7A 1E1TA 4LF7Q 2NVTH 2M4VA 2HHHL 3I55A 3PGZA 3CCQA 1XPUA 2R92G 2F4VL 2QL0A 3E0EA 3CXCA 1IU5A 4UPAA 3H0GH 3AYHB 2QEXA 4DV6Q 3GTKH 4IO9A 1MJEA 4DV7L 5AI2A 1JE5A 3SS2A 4AI0A 1DGSA 1Q1EA 2JQOA 3CQZH 4IJLA 4DK6C 1N8RC 4BBSG 1TXYA 2XTIA 2CKAA 1X3GA 1B7YB 3OTOQ 4MZ9A 1JJ2A 4XTCS 1Y14B 3A44A 3JC62 1N33Q 3S15H 4JI8L 4A75A 1EOVA 1N9WA 3J81j 3FP9A 4L5RC 3PIP1 1U0LA 1QCVA 2OCEA 1N36L 1VQJA 4WJ4A 4JI6L 3E9HA 3PSIA 2GMGA 3PO3G 3M4QA 1R0HA 4EX5A 1WOCA 4JI2Q 4JCVE 3S24A 2OTLA 2R93H 4UY81 3U50C 2E2HH 3VPBE 5ELOA 1EUJA 3FKIH 1IXRA 4TVMA 1UWVA 4X64L 4DR2L 3PUZA 1GM5A 1QUQB 1WCMG 1L1OB 1G291 4LUVA 2E2IH 4OXPA 1N33L 3H3VI 1YUZA 1YNXA 4JC0A 3I4OA 4QJFA 1V43A 1YJNA 1K9MC 4LF9L 1VQCA 3UDIA 1MJCA 1IZ6A 2WAQG 3BZCA 3LGJA 2H12A 1KAWA 1VZIA 3Q8DA 4P73A 1Q82C 1Q81C 3ER0A 5LMUQ 2QGQA 4JI7L 4X66L 1WJJA 3ULLA 4YY3Q 1HR0L 4A3CG 2XJQA 4JI5L 1PA6A 2OQKA 2JA7G 2WFWA 2UU9L 2UUAQ 2FXQA 3K7UC 3OTOL 3KOJA 1UEBA 2A19A 4JAFA 3PO2G 4NB3A 5GAHc 1GKHA 2JA8G 3JC63 1M90C 4IPGA 3J7Y1 1RDVA 3KJOA 4AR6A 5IT9c 3KJPA 3RYGA 1CKNA 1T9HA 2M6OA 3DLLA 4HJ7A 1J5EQ 1BVSA 5H1SE 2HR5A 1HH2P 5ELNA 4BXXG 2KKDA 3HOZH 4A3JG 2D62A 2KN9A 4XIGS 4DR2Q 2PNHA 3RZOH 3KLWA 4GN4B 3HOZG 4JBMA 4BXXH 2CKZB 3AFPA 1R0JA 1IYJB 2V1CC 4DK3C 1QZHA 1VQPA 3S1RH 3FHWA 2JA6H 3HOYG 3S14H 1H95A 2GN5A 4A3MH 4JV5Q 3JAMi 4OX9Q 2JE6I 3PUVA 1JMCA 3PUYA 5IYDG 2C6BA 3A5UA 2PI2A 3CF5A 4DV2L 4HJ5A 2GVAA 1Y1WH 1YBYA 2NVXH 2A8VA 2Z3QB 5IYBH 2BH2A 4JBWA 2GVBA 4UP8A 5M3MG 3MPSA 1JJCB 1Q8KA 2MS3A 1VQDA 4JI8Q 3UE0A 2UUAL 3AEVA 2L15A 4B3RQ 3WWNB 4JV5L 2H5XA 3WWVA 1OTCA 3JC66 2EQSA 4BBRG 1XMOQ 4X62L 4IOAA 4DUZL 1RYQA 4MTNA 3BJUA 3K35A 2ZTEA 4IOCA 2MQHA 1KQSA 5GAEc 4AHXA 1NY4A 4WJ3M 5LMNW 1KL9A 4OWXB 1LUZA 2AWOA 1HR0W 4DR7Q 5AN9H 2HQLA 3WWLA 3STBC 4PG3A 3PKJA 1PH6A 3T1YQ 2UUBL 4JAEA 4A3IH 1TWCH 5IP7H 1VQAA 5LMUL 4JAGA 4JI7Q 3M7NA 3PKIA 3MXNB 4LHLA 5K2ME 1YK4A 4DR5Q 5IP9H 1YIJA 3RLNA 3I4MG 1WJVA 1CUKA 1VZHA 2F3IA 1TWHH 1IROA 4AHWA 2LSSA 3PV0A 4R1JA 3UDFA 2QA4A 4IFDJ 2E8GA 3HOUG 1Z47A 4BBSH 1VQ6A 1I94Q 3HOVH 2PQAB 2Q2TA 5MFPA 1FHMA 4BA1I 3RZDH 2UXDQ 3EN2A 1HNZL 2AYJA 4P75A 1A8VA 1S40A 4DR6Q 1W2BA 3CCSA 5AJ3L 4XXBB 4A4IA 4A3FG 2LXKA 4IJHA 4A93H 1VQ4A 2WB1E 4KLKA 2VQEQ 4OWTB 1X56A 1TWFH 1EIFA 1PV4A 2YV5A 2J9UB 5M3FG 3L7ZC 5MGNA 2ZTCA 5IYCG 2IY5B 5GAGC 1NJIC 1AE2A 1OXTA 4BY7G 2WB1G 1EYGA 3BU2A 4PZ7A 4AIMA 4DV5Q 2E5LQ 1FJGL 3HOWH 1LKOA 3GTMH 2PI2E 2YTVA 3F8TA 5GQOA 1IBML 4E6YA 1G6PA 4R4TA 2UXCQ 1WI5A 4LHNA 3U4ZA 3J7Z1 2JEAI 1X55A 1WYDA 3KYUA 4JI0L 4YWKA 1X54A 2UXDL 4B8CD 2JEBI 2UUCQ 3M4PA 2CCZA 1OXXK 4YCWA 4LF5Q 1R0FA 2K4KA 4JI3Q 1Y1VG 2N78A 5DM61 3PF4A 2CR8A 1G51A 1N36Q 3RR5A 3GTOH 3HOXH 3F2CA 4DR3L 2OTJA 5JJKA 3RZTA 4UP9A 1KRSA 4DV4Q 2VNUD 3J81c 4OO1I 1RB9A 1MIUA 4A3KH 1E1OA 2IT1A 2WAQE 4J15A 3CD6A 2LCQA 2ZTDA 5C4XH 2JA5H 1Q1BA 4GS7D 1BRFA 5MLC3 2PPTA 2NZOA 2B5ID 4ZN1B 2KCMA 3KDFA 3OYYA 3UDGA 4JBJA 1YHQA 4JOIC 2K2DA 1GVPA 2OQ0A 5GAHC 1PH9A 3CCVA 4BA2I 2KHJA 3CPFA 1A63A 2B63G 2RF4A 4KHPL 1DVBA 4V196 1T9PA 1LKMA 4OWWB 2JI1A 1E7ZA 4OX9L 4XGHA 3DM3A 2ZM6Q 4X65L 4YHHL 1E8JA 2DUDA 1XPRA 2NVQH 2NVYH 1B70B 1JB7A 2AHOB 1PH5A 4JADA 3G4SA 1L2FA 1TWGH 2VZAA 3D31A 1SN8A 1K8GA 1XNRQ 4A3LH 4LWCA 4DR1L 3TEHB 1YHAA 1KIXA 4HIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3F A;  1BBU A;  1YUX A;  1HZA A;  3S17 H;  1VQ9 A;  4APV A;  1Q12 A;  5IY0 A;  4DV4 L;  3W1B A;  1HNX Q;  3EBE A;  1PYS B;  1T9Q A;  4A3B H;  3GD7 A;  3CCR A;  4JI4 L;  1D7Q A;  1VCI A;  1IBL Q;  1BBW A;  1SE8 A;  1W3S A;  1KXL A;  1L0W A;  3J7A 5;  3CME A;  2HIV A;  1PH2 A;  2DSX A;  1YJW A;  5GRO A;  1QUQ A;  1UE1 A;  4AYB G;  5BR8 Q;  4A3G H;  4LNQ A;  4DAM A;  4JYA Q;  2K14 A;  4GNX B;  4AH6 A;  2PVX A;  4B3M L;  4LF8 L;  3J80 i;  2K5V A;  4X65 Q;  5FLM H;  4YHH Q;  1P8L A;  2UUC L;  1XPO A;  4R4C A;  1X6O A;  3E9I A;  4BBR H;  2VQF Q;  4DV3 Q;  4A3G G;  2D0P A;  1A0I A;  1YZ6 A;  2NZH A;  4NPS A;  1KC8 C;  1VQ7 A;  3OW2 A;  1I94 L;  5C0X G;  1C09 A;  2N3S A;  5GAE C;  5RXN A;  2E2J H;  2D0O A;  5DLQ E;  4RMF A;  4X66 Q;  1PYB A;  4JI1 Q;  3RNU A;  2VUM G;  1OXU A;  5FLX c;  4HJ9 A;  4GNX A;  1Y1W G;  1XNQ Q;  5IYD H;  3A5Z B;  5JJI A;  4LF9 Q;  1PHJ A;  1CSQ A;  1YHB A;  4MNO A;  1AE3 A;  1ZRP A;  5C3E G;  3I56 A;  2KEN A;  4QIW E;  4JI6 Q;  5M5W H;  2DGY A;  1YJ9 A;  2JA6 G;  3HOY H;  3CP0 A;  2N8N A;  4DPG A;  3ICE A;  1FVI A;  4LW1 A;  1N34 Q;  3NEL A;  4JI1 L;  2B3G A;  2NN6 G;  1IU6 A;  1IRN A;  1HZB A;  5M5X H;  1V1Q A;  4X64 Q;  4A3L G;  4DR5 L;  1IBK Q;  2IX1 A;  4R4I A;  1CKM A;  3RN2 A;  4B3T L;  4PZ8 A;  4OON A;  4O0A A;  3K7A H;  2MFI A;  4LF6 Q;  2KHI A;  3KYY A;  1SMM A;  2JK8 A;  4YCU A;  2JA8 H;  1M1K C;  2IHE A;  3PO2 H;  2UXC L;  2R7D A;  3S2H H;  4FDB A;  2ZJQ A;  1BKB A;  2HHH Q;  3G71 A;  1VQM A;  2JA5 G;  1B13 A;  5C3E H;  1BFY A;  2EXD A;  3B6Y A;  3M4O H;  3L2P A;  4DUY Q;  1J6Q A;  1K0R A;  3K8A A;  4A3K G;  4B3S L;  1Q46 A;  4LFA Q;  4GOP B;  1SFO H;  3PUX A;  2VQE L;  3S1Q H;  3STB D;  3KFU A;  2VUM H;  4A3D G;  3H15 A;  1YK5 A;  4YWL A;  1OXV A;  3KDF B;  4GS3 A;  3HOX G;  3CCU A;  4GNX C;  4DV1 L;  4DR3 Q;  4RG1 A;  1Y1V H;  1KHI A;  2ASB A;  4YCV A;  8RXN A;  1WCM H;  2YTX A;  1L1O A;  3G6E A;  4B3M Q;  4LF8 Q;  3KYV A;  1RL2 A;  4Y7N H;  1R0I A;  5JJL A;  3QVD A;  1IBK L;  3J81 i;  4DAY B;  3S16 H;  1K3R A;  3W5O A;  4K0K L;  1C0A A;  3M9B A;  3PO3 H;  2MNA A;  2N49 A;  1LTL A;  2BH8 A;  2Q2I A;  4DV0 Q;  2AKW B;  4TVA B;  1JJG A;  2KCT A;  2EIF A;  1VQN A;  2VY3 A;  4AYB E;  1XMQ L;  4K0K Q;  2I5L X;  3L0O A;  3M85 A;  1LKP A;  4BY7 H;  1BQ8 A;  1YV1 A;  1CKN B;  4R4O A;  5M3F H;  1HJP A;  1NBW A;  4LUZ A;  3K81 C;  1XNQ L;  4GKK Q;  3VDY A;  1Q7Y C;  1R9T H;  4DUY L;  4B3S Q;  4GN3 B;  5J3B A;  1S2Z A;  4GLX A;  4R4Q A;  2XGT A;  3TRZ A;  4OO1 G;  3EIV A;  2YTY A;  4TQU S;  4LFC Q;  1WFQ A;  3H0G G;  1HZ9 A;  4L5S A;  1LYL A;  1UE7 A;  4A3F H;  4RXN A;  1CKO A;  4NXM Q;  4KHZ A;  1TWA H;  1GD7 A;  4NXN Q;  2R92 H;  4YWM A;  4JI5 Q;  1XTD A;  4C3J H;  1D8L A;  3H3V H;  1ASZ A;  1NTG A;  4P72 A;  2HT1 A;  1PFS A;  4A3E G;  4B3T Q;  3T1H L;  1S3O A;  4HIO A;  3CMA A;  1VQK A;  4L5Q A;  4ME3 A;  3KF6 B;  2VL6 A;  4HID A;  4POG A;  2I5M X;  3TS0 A;  3RLF A;  1JYB A;  2MO0 A;  2B63 H;  4JYA L;  2KBN A;  4O2D A;  3I4N H;  5IP9 G;  5IE8 A;  2PYA A;  4UP7 A;  2Q2U A;  1YEZ A;  2Z0S A;  3UDX A;  3A74 A;  1KD1 C;  1P16 A;  3NEM A;  1HR0 Q;  4A3I G;  1RDG A;  5C4J H;  1FL0 A;  3TRE A;  5C4X G;  3CCE A;  3W1G A;  1IBM Q;  2Y0S E;  2NN6 I;  1UE5 A;  1FGU A;  4DKA C;  1U5K A;  2UUB Q;  1GO3 E;  4GKJ Q;  5EAY A;  1QVF A;  4NXM L;  5M5Y H;  3CAM A;  2Q2H A;  2RHS B;  3RZ6 A;  4L5T A;  1XJV A;  1K73 C;  4K9F A;  2YU9 H;  3M3Y H;  2ALY B;  1SRO A;  3CPW A;  1BE7 A;  1NMG A;  5HY6 A;  3F2B A;  3RN5 A;  2HIX A;  3U58 A;  1K8A C;  2I0Q A;  4P74 A;  3K80 C;  1AH9 A;  2K50 A;  5BR8 L;  1HZC A;  3MEF A;  4X62 Q;  1DX8 A;  2ATW A;  1CAD A;  5M3M H;  1SMW A;  1QVG A;  4IFD G;  2RDV A;  1SR3 A;  1PH3 A;  1KRT A;  1XMQ Q;  3CC2 A;  2R6G A;  2Z6K C;  4A3D H;  2MO1 A;  1SLJ A;  1I5F A;  3I2Z A;  1FJG Q;  4LFB L;  4QQB X;  3S1N H;  1VQG A;  3PUW A;  4GKK L;  1MKH A;  4A3M G;  1VCX A;  2RCN A;  5IYC H;  2UXB Q;  4AR4 A;  3T1Y L;  4KI0 A;  4GLV B;  4H02 A;  1EIY B;  1YI2 A;  1VQH A;  2LXJ A;  4C2M H;  1VQ8 A;  3CC4 A;  4JG2 A;  1UE6 A;  1SRU A;  5IWA Q;  2I5H A;  4LF4 L;  1O7I A;  1B2J A;  2JA9 A;  3GTJ H;  4LF5 L;  4A93 G;  4X6A H;  4Y52 H;  3JAM c;  3GTG H;  1N32 L;  4DR1 Q;  2AMC B;  1A62 A;  2CQO A;  2UXB L;  2C35 B;  2Z6K A;  3KF6 A;  3T1H Q;  4DR4 Q;  1PH4 A;  1E22 A;  3GTP H;  1VQO A;  1C9O A;  1QVC A;  3HKS A;  2ES2 A;  1BQ9 A;  2R7Z G;  1VQI A;  2YYZ A;  3HOV G;  3K0X A;  1VS0 A;  2JA7 H;  4JI4 Q;  3HOU H;  4LF7 L;  4GLA C;  1NMF A;  3CW2 C;  3TQY A;  4DV2 Q;  4LFB Q;  2CWP A;  5GAD C;  3I4M H;  4LF6 L;  2R7F A;  3GDE A;  5JEA J;  5AI3 A;  4IFD I;  1X3E A;  3CCJ A;  2CWA A;  5IP7 G;  5C44 G;  1T9O A;  4DV7 Q;  1EFW A;  3IRB A;  4IPC A;  3PIO A;  1PH1 A;  1EWI A;  1Z9F A;  4POF A;  4GKJ L;  1RYT A;  4QL5 A;  4DUZ Q;  3TS2 A;  4YY3 L;  1NNQ A;  1LM0 A;  1SMX A;  4GOP C;  3PF5 A;  2M4Y A;  6RXN A;  2VQF L;  2Y0S G;  2UU9 Q;  2F52 A;  1JT8 A;  5AJ3 Q;  5FLM G;  3HFZ B;  5C0X I;  2K75 A;  5C44 H;  2V3B B;  2K52 A;  3KYW A;  3ERS X;  1ASY A;  3D0F A;  3NBH B;  4GN5 A;  4DV1 Q;  1QYB A;  1Q86 C;  2A1A A;  4A76 A;  4JI2 L;  3S2D H;  3HKZ E;  2IX0 A;  3F1Z A;  1EQR A;  3PZA A;  1E3P A;  2AWN A;  4AR3 A;  5IYB G;  3I7F A;  1YVC A;  2BA0 A;  5HGQ A;  5LMN Q;  2R7Z H;  1HNW Q;  1B2O A;  1CSP A;  4DV5 L;  2E5L L;  2OWO A;  1E24 A;  4A3B G;  1V9P A;  3HKZ G;  4HJA A;  1N34 L;  3GO5 A;  4TPU A;  1X65 A;  4EQ5 A;  3GTL H;  1VQL A;  1HNZ Q;  4DNI A;  5IWA L;  2ID0 A;  1HNW L;  4DR6 L;  1RWD A;  5FJ8 G;  4A3J H;  2F4V Q;  3NEN A;  2R93 G;  4JI3 L;  4BY1 H;  2PQA A;  2K5N A;  5E7N A;  4LFC L;  3BZK A;  3ULP A;  4UY8 C;  2ZM6 L;  4IPD A;  4QGU A;  4NXN L;  4GOP A;  3AQQ A;  2ZJP A;  4HIM A;  3CCM A;  1I6H H;  1VQ5 A;  1R0G A;  4C3I H;  3PWF A;  4C3H H;  4JBK A;  3RLO A;  3UE1 A;  2ZJR A;  1L1O C;  5C0X J;  2BA1 A;  1EQQ A;  3CCL A;  3J80 c;  4P71 A;  1I50 H;  5LMN L;  2IHF A;  3PCO B;  4LUO A;  4DV3 L;  4A3C H;  1H7V A;  2JJQ A;  1VQE A;  2VS1 A;  1IL2 A;  1C7Y A;  2VW9 A;  4KHP Q;  1FHH A;  3AFQ A;  1VQB A;  3F2D A;  3G48 A;  4JI0 Q;  1SMU A;  3KYH C;  1QZG A;  4ALP A;  2B29 A;  2WP8 J;  3ZJY C;  1I3Q H;  1X9N A;  1OXS C;  2PMZ E;  4AQY Q;  3J7Z C;  3A0J A;  1XNR L;  4B3R L;  4QY7 A;  3FKI G;  3SGI A;  4DV0 L;  5JEA G;  4PZ6 A;  1K83 H;  7RXN A;  1S24 A;  1RIP A;  1XMO L;  3PIP A;  1B8A A;  1PH8 A;  2K5H A;  1HNX L;  4LF4 Q;  4AR5 A;  3KF8 B;  4AQY L;  3I4N G;  2CFM A;  2RHQ B;  1YIT A;  1IBL L;  4PMW A;  3CC7 A;  1S72 A;  4LFA L;  1NE3 A;  3HOW G;  1N32 Q;  1S30 A;  3KYX A;  4DR7 L;  1B71 A;  4DR4 L;  4DV6 L;  1CAA A;  3U4V A;  1VQF A;  1PVO A;  4BY1 G;  3ULJ A;  2PVE A;  4A3E H;  5FJ8 H;  3S1M H;  3GTQ H;  1J5E L;  4IPH A;  4HJ8 A;  4JOI A;  1PH7 A;  1E1T A;  4LF7 Q;  2NVT H;  2HHH L;  3I55 A;  3PGZ A;  3CCQ A;  1XPU A;  2R92 G;  2F4V L;  2QL0 A;  3E0E A;  3CXC A;  1IU5 A;  4UPA A;  3H0G H;  3AYH B;  2QEX A;  4DV6 Q;  3GTK H;  4IO9 A;  1MJE A;  4DV7 L;  5AI2 A;  1JE5 A;  3SS2 A;  1DGS A;  1Q1E A;  3CQZ H;  2JQO A;  4IJL A;  1N8R C;  4DK6 C;  4BBS G;  1TXY A;  2XTI A;  1X3G A;  1B7Y B;  3OTO Q;  4MZ9 A;  1JJ2 A;  4XTC S;  1Y14 B;  3A44 A;  3JC6 2;  1N33 Q;  3S15 H;  4JI8 L;  4A75 A;  1EOV A;  1N9W A;  3J81 j;  3FP9 A;  4L5R C;  1U0L A;  2OCE A;  1QCV A;  1N36 L;  4WJ4 A;  1VQJ A;  4JI6 L;  3E9H A;  3PSI A;  2GMG A;  3PO3 G;  3M4Q A;  1R0H A;  4EX5 A;  1WOC A;  4JI2 Q;  4JCV E;  3S24 A;  2OTL A;  2R93 H;  3U50 C;  2E2H H;  4X64 L;  5ELO A;  1EUJ A;  3FKI H;  1IXR A;  1UWV A;  1GM5 A;  4DR2 L;  4JI0 L;  3PUZ A;  2E2I H;  1QUQ B;  1WCM G;  1L1O B;  1G29 1;  4LUV A;  1N33 L;  4OXP A;  3H3V I;  1YUZ A;  1YNX A;  4JC0 A;  3I4O A;  4QJF A;  1V43 A;  1YJN A;  1K9M C;  4LF9 L;  1VQC A;  3UDI A;  1MJC A;  1IZ6 A;  2WAQ G;  3BZC A;  3LGJ A;  3Q8D A;  1KAW A;  4P73 A;  1Q82 C;  1Q81 C;  3ER0 A;  5LMU Q;  2QGQ A;  4JI7 L;  4X66 L;  1WJJ A;  3ULL A;  4YY3 Q;  1HR0 L;  4A3C G;  4JI5 L;  1PA6 A;  2OQK A;  2JA7 G;  2WFW A;  2UU9 L;  2UUA Q;  2FXQ A;  3K7U C;  3OTO L;  3KOJ A;  1UEB A;  2A19 A;  3PO2 G;  4NB3 A;  1GKH A;  2JA8 G;  3JC6 3;  1M90 C;  4IPG A;  1RDV A;  3KJO A;  4AR6 A;  5IT9 c;  3KJP A;  3RYG A;  1CKN A;  1T9H A;  3DLL A;  4HJ7 A;  1J5E Q;  1BVS A;  5H1S E;  2HR5 A;  1HH2 P;  5ELN A;  4BXX G;  2KKD A;  3HOZ H;  4A3J G;  2D62 A;  2KN9 A;  4XIG S;  4DR2 Q;  2PNH A;  3RZO H;  3KLW A;  4GN4 B;  3HOZ G;  4JBM A;  4BXX H;  2CKZ B;  3AFP A;  1R0J A;  1IYJ B;  2V1C C;  4DK3 C;  1QZH A;  1VQP A;  3S1R H;  3FHW A;  2JA6 H;  3HOY G;  3S14 H;  1H95 A;  2GN5 A;  4A3M H;  4JV5 Q;  3JAM i;  4OX9 Q;  2JE6 I;  3PUV A;  1JMC A;  3PUY A;  5IYD G;  3CF5 A;  3A5U A;  2PI2 A;  4DV2 L;  4HJ5 A;  1Y1W H;  2GVA A;  2A8V A;  1YBY A;  2NVX H;  2BH2 A;  5IYB H;  4JBW A;  2GVB A;  4UP8 A;  5M3M G;  3MPS A;  1JJC B;  1Q8K A;  2MS3 A;  1VQD A;  4JI8 Q;  3UE0 A;  2UUA L;  3AEV A;  2L15 A;  4B3R Q;  4JV5 L;  2H5X A;  3WWV A;  1OTC A;  3JC6 6;  2EQS A;  4BBR G;  1XMO Q;  4X62 L;  4IOA A;  4DUZ L;  4MTN A;  3BJU A;  2ZTE A;  4IOC A;  2MQH A;  1KQS A;  1NY4 A;  4WJ3 M;  5LMN W;  1KL9 A;  4OWX B;  1LUZ A;  2AWO A;  1HR0 W;  4DR7 Q;  2HQL A;  3STB C;  4PG3 A;  1PH6 A;  3T1Y Q;  2UUB L;  4A3I H;  1TWC H;  5IP7 H;  1VQA A;  5LMU L;  4JI7 Q;  3M7N A;  3MXN B;  4DR5 Q;  1YK4 A;  5IP9 H;  1YIJ A;  3RLN A;  3I4M G;  1CUK A;  2F3I A;  1TWH H;  1IRO A;  2LSS A;  3PV0 A;  4R1J A;  3UDF A;  2QA4 A;  4IFD J;  2E8G A;  3HOU G;  1Z47 A;  4BBS H;  1VQ6 A;  1I94 Q;  3HOV H;  2PQA B;  2Q2T A;  1FHM A;  4BA1 I;  3RZD H;  2UXD Q;  3EN2 A;  1HNZ L;  4P75 A;  1A8V A;  1S40 A;  4DR6 Q;  1W2B A;  3CCS A;  5AJ3 L;  4A4I A;  4A3F G;  2LXK A;  4IJH A;  4A93 H;  1VQ4 A;  2WB1 E;  4KLK A;  2VQE Q;  4OWT B;  1X56 A;  1TWF H;  1EIF A;  1PV4 A;  2YV5 A;  5M3F G;  3L7Z C;  2ZTC A;  5IYC G;  2IY5 B;  5GAG C;  1NJI C;  1AE2 A;  1OXT A;  4BY7 G;  2WB1 G;  1EYG A;  3BU2 A;  4PZ7 A;  4AIM A;  4DV5 Q;  2E5L Q;  1FJG L;  3HOW H;  1LKO A;  3GTM H;  2PI2 E;  2YTV A;  3F8T A;  5GQO A;  1IBM L;  1G6P A;  4R4T A;  2UXC Q;  1WI5 A;  3U4Z A;  2JEA I;  1X55 A;  1WYD A;  3KYU A;  4YWK A;  1X54 A;  2UXD L;  2JEB I;  2UUC Q;  3M4P A;  2CCZ A;  1OXX K;  4YCW A;  4LF5 Q;  1R0F A;  2K4K A;  4JI3 Q;  1Y1V G;  2N78 A;  3PF4 A;  1G51 A;  1N36 Q;  3RR5 A;  3GTO H;  3HOX H;  3F2C A;  4DR3 L;  2OTJ A;  5JJK A;  3RZT A;  4UP9 A;  1KRS A;  4DV4 Q;  2VNU D;  3J81 c;  4OO1 I;  1RB9 A;  1MIU A;  4A3K H;  1E1O A;  2IT1 A;  2WAQ E;  4J15 A;  3CD6 A;  2LCQ A;  2ZTD A;  5C4X H;  2JA5 H;  1Q1B A;  1BRF A;  2NZO A;  3OYY A;  3UDG A;  2KCM A;  3KDF A;  1YHQ A;  5K36 G;  4JBJ A;  4JOI C;  2K2D A;  1GVP A;  2OQ0 A;  5GAH C;  1PH9 A;  3CCV A;  4BA2 I;  2KHJ A;  3CPF A;  1A63 A;  2B63 G;  2RF4 A;  4KHP L;  1DVB A;  1T9P A;  1LKM A;  4OWW B;  4OX9 L;  1E7Z A;  2ZM6 Q;  3DM3 A;  1XPR A;  4X65 L;  4YHH L;  1E8J A;  2DUD A;  2NVQ H;  2NVY H;  1B70 B;  1JB7 A;  2AHO B;  1PH5 A;  1K8G A;  3G4S A;  1L2F A;  1TWG H;  2VZA A;  3D31 A;  1SN8 A;  1XNR Q;  4A3L H;  4LWC A;  4DR1 L;  3TEH B;  1YHA A;  1KIX A;  4HIK A; 
#chains in the Genus database with same CATH topology
 4A3E B;  1YUX A;  3S17 H;  3J81 E;  3TSS A;  2A5H A;  5IY0 A;  3EBE A;  3CRK C;  3GD7 A;  3CCR A;  3MXN A;  4J8Q A;  1W3S A;  1SE8 A;  2EY4 E;  1L0W A;  2HIV A;  5GRO A;  1UE1 A;  4QUC A;  1K83 B;  5BR8 Q;  2K14 A;  2XIW A;  4AH6 A;  3J80 L;  2PVX A;  4LF8 L;  2N55 A;  2F0G A;  4X65 Q;  4YHH Q;  3LWP B;  4R4C A;  4BBR H;  2RKS A;  4DV3 Q;  1QG7 A;  1G91 A;  2D0P A;  1A0I A;  3P8B A;  3B0A B;  1YZ6 A;  4NPS A;  1BBX C;  5CYU A;  3AMU A;  5DEH A;  1CQV A;  5GAE C;  3C2P A;  1TKW B;  4RMF A;  4X66 Q;  2VUM G;  5IYD H;  3K5L A;  1XNQ Q;  4F8M A;  1YHB A;  1FNU A;  3I56 A;  1WTO A;  4QIW E;  4ZN3 B;  5M5W H;  1IKM A;  2JA6 G;  3HOY H;  3E0J A;  1F9R A;  4LW1 A;  3NEL A;  2EYM A;  1IRN A;  2B2V A;  3MSU A;  1TS2 A;  4KV6 A;  1B2T A;  2A68 C;  2JXM B;  4OON A;  3S2D L;  1KAA A;  1SYG A;  2KHI A;  2WAC A;  2HDM A;  1SMM A;  4QIW B;  4C2M B;  2JA8 H;  1PTO H;  2IHE A;  3HOV B;  2NB0 A;  4U67 1;  3S17 L;  5LL6 X;  2EYH A;  2R7Z B;  1RF2 D;  5M3F B;  1E2Z A;  5FO7 B;  4B3S L;  1J6Q A;  4A3K G;  3P1H A;  3PUX A;  2VUM H;  1YK5 A;  3HOX G;  2B39 A;  1KDC A;  2IJ0 A;  4YCV A;  4FXK C;  1L1O A;  4B3M Q;  1SYD A;  3HOV L;  3KYV A;  1R0I A;  3QVD A;  1IBK L;  4HCS A;  2XN9 C;  1ESR A;  1K3R A;  1Y1V L;  4ILW A;  2N49 A;  1LTL A;  2L1B A;  3D6W A;  3TBI B;  1AW7 A;  1QOH A;  3S1N B;  4PQX A;  4K0K Q;  1LKP A;  1YV1 A;  1NBW A;  4GKK Q;  3VDY A;  2XGT A;  4OO1 G;  3EIV A;  4LFC Q;  1WFQ A;  3H0G G;  1HZ9 A;  1LYL A;  2EYJ A;  1EY9 A;  2AUS B;  4KHZ A;  5I9P A;  3H3V H;  1ASZ A;  4MIU A;  2K33 A;  1UUP A;  2HT1 A;  1PFS A;  3OWF A;  4C3J B;  2IPK D;  1LTA D;  3CMA A;  3NFP I;  3RZD B;  3P75 A;  2I5M X;  1JYB A;  2MO0 A;  4OO1 H;  2WB1 B;  2Q8I B;  4FXD A;  3NEM A;  1YNN D;  1RDG A;  2K32 A;  1H9K A;  3W1G A;  5M9O A;  2ERS A;  1QVF A;  1K73 C;  2RHS B;  1HHV A;  3RZ6 A;  3M3Y H;  4WJW A;  1CHP D;  5HY6 A;  4KY5 A;  1GXD C;  2HIX A;  3PIO 3;  1K8A C;  2I0Q A;  1G2T A;  1QVG A;  1PH3 A;  4IZ8 A;  2Z6K C;  4ZRZ A;  2EYP A;  4ZK9 B;  1F2Y A;  3VR4 A;  2D9U A;  1I6H B;  1I4P A;  1KLG D;  2B63 B;  5IYC H;  1EYD A;  1RKN A;  2PQE A;  1VQH A;  2EVB A;  2J0T D;  4JG2 A;  4G4K A;  5J22 A;  1O7I A;  2JA9 A;  2KOL A;  3SR1 A;  1N32 L;  2AMC B;  1A62 A;  1DXM A;  2CQO A;  2C35 B;  2Z6K A;  3KF6 A;  3MEH A;  4V19 0;  4DR4 Q;  3J80 E;  2F0T A;  3GTP H;  3BDC A;  3HKS A;  2ES2 A;  4DK0 A;  3HOV G;  1VS0 A;  1F9P A;  2P5Z X;  5EIO C;  2X6G A;  2VB3 X;  4PNY A;  4IFD I;  3BDL A;  1EFW A;  1TQO A;  3PIO A;  4IPC A;  4XT1 B;  2L4N A;  4PV1 C;  1ILP A;  1PFN A;  2O5I C;  1ODH A;  3V2T A;  4QL5 A;  2XJP A;  1SMX A;  3ZYY X;  4RFB A;  2Y0S G;  1SJE D;  2O5J D;  2K75 A;  2K52 A;  3ERS X;  5I9O A;  4A3F L;  1Q86 C;  4JVZ A;  1DZ1 A;  3PZA A;  2R7Z H;  3S14 L;  2F0I A;  2Z4I A;  2OWO A;  1KDA A;  3WDN A;  1V9P A;  1OWB A;  4G6B A;  3I70 A;  3I4N L;  1ML0 D;  4TPU A;  1X65 A;  1HNZ Q;  1ENA A;  1JOR A;  1TWG B;  2WAQ P;  1STG A;  4IUR A;  5FJ8 G;  2F4V Q;  2R93 G;  2PSM C;  3Q22 A;  1B53 A;  3CQZ L;  3HGB A;  2RCF A;  1IW7 D;  4MN3 A;  3R93 A;  3HOY B;  4DK1 A;  4NXN L;  3AQQ A;  1I4X A;  3CCM A;  5JVH 1;  2R61 A;  1VQ5 A;  4DGZ A;  5EIN C;  3S2H B;  3EFX D;  1GUO A;  5C4X B;  3K6O A;  1Y8O B;  1I50 H;  2K5W A;  2IHF A;  1SNM A;  2GA4 B;  1H7V A;  2B2U C;  2SDF A;  4ID6 A;  1C7Y A;  3A7A B;  1FHH A;  3AFQ A;  4B9X A;  4JI0 Q;  1SMU A;  1QZG A;  3P2A A;  1ROD A;  1S5E D;  1I3Q H;  1W6J A;  4AQY Q;  1EY4 A;  4B3R L;  4QY7 A;  2JA7 L;  4K6L A;  1AP0 A;  1S24 A;  1RIP A;  1XMO L;  1I50 B;  5M5W L;  1B8A A;  3J7A F;  3T16 A;  4AQY L;  4K8J A;  2RHQ B;  4QF4 A;  1N32 Q;  1K83 L;  3CC7 A;  3HOU B;  4H13 C;  1K28 A;  3KYX A;  1TWF L;  4DR4 L;  3U4V A;  2I46 A;  1VQF A;  5ELE A;  2EJF C;  5FJ8 H;  4ZUJ A;  2HHH L;  2K04 A;  1DOL A;  2DN8 A;  1H9S A;  1XPU A;  2C9O A;  1C48 A;  3E0E A;  3IL8 A;  3GTQ B;  2QEX A;  5FOB B;  1BOS A;  4CDC C;  3TZU A;  1PZK D;  3ERO A;  4O1N A;  3VYR A;  3SS2 A;  3CQZ H;  4IJL A;  2VUM L;  1SEB D;  5EJW A;  4DK6 C;  1TWH B;  2CKA A;  4OIJ A;  2QDL A;  1Y14 B;  3JC6 2;  3S15 H;  4QMG A;  4R8N A;  4C2M 1;  4WJ4 A;  1N36 L;  1SNQ A;  1VQJ A;  2GMG A;  1I50 L;  3OMG A;  3M4Q A;  1R0H A;  3S24 A;  3U50 C;  1GM5 A;  1EUJ A;  1K8O A;  1L1O B;  4I7A A;  2RSO A;  3H3V I;  1YUZ A;  1K9M C;  2PZU A;  2AUK A;  1VQC A;  3UDI A;  1MJC A;  2DY7 A;  1KAW A;  1VZI A;  1Y69 U;  1Q81 C;  2QGQ A;  3MAQ A;  5ELB A;  4YY3 Q;  4A3C G;  2XJQ A;  4JI5 L;  1PA6 A;  2AQ3 B;  4MTK A;  2FXQ A;  3K7U C;  1TVX A;  3OTO L;  5JPN C;  4FXG C;  4NB3 A;  5GAH c;  3HOZ L;  2JA8 G;  1X3Q A;  2KEC A;  1RDV A;  4AR6 A;  2JA6 B;  3DLL A;  4C3I L;  5JPM C;  4RWS C;  3GTG L;  1J5E Q;  4DAV A;  1HH2 P;  5ELN A;  4A3J G;  2D62 A;  5ISR A;  4DR2 Q;  3RZO H;  3KLW A;  4GN4 B;  3KLS A;  5JVH 3;  2Z8L A;  1YNJ C;  2V1C C;  4DK3 C;  1QZH A;  1VQP A;  3DWP A;  3FHW A;  2GN5 A;  4OX9 Q;  2NBF A;  4FVM A;  2SNS A;  3H9C A;  3NWS A;  3PUY A;  5IYD G;  4DV2 L;  4HJ5 A;  1EIG A;  1YBY A;  2NVX H;  1V1P A;  2GVB A;  1Q8K A;  1JJC B;  1VQD A;  3H94 A;  2UUA L;  4B3R Q;  4IFD H;  3I91 A;  3WWN B;  3S15 L;  2H5X A;  1OTC A;  1GOZ A;  2EQS A;  4BBR G;  1XMO Q;  3GTO B;  5IGG A;  4X62 L;  1RYQ A;  3BJU A;  2ZTE A;  4QIW P;  4KKS A;  4Q5V A;  2JA8 L;  5GAE c;  1NY4 A;  5I6Y A;  1KL9 A;  4OWX B;  1HR0 W;  3R8B A;  2HQL A;  4A3K L;  4PG3 A;  3PKJ A;  5IGF A;  4JAE A;  1SE4 A;  1VQA A;  4BBS L;  3E3X A;  4JAG A;  3S15 B;  3MXN B;  4LHL A;  3LWR B;  4DF7 A;  4IFD J;  2LSS A;  4CHT B;  4B9W A;  2JA7 B;  2QA4 A;  3HJW B;  4RGM A;  3HOU G;  4K5X A;  1R9T L;  3HOV H;  4HTH A;  2PQA B;  5DAU A;  3EN2 A;  2NZ1 D;  2AYJ A;  5FLX E;  3D8G A;  1S40 A;  4DR6 Q;  5AJ3 L;  4A4I A;  3A8I E;  4A3F G;  4A93 H;  2NVQ B;  2WB1 E;  4EGV A;  1PV4 A;  3S2H L;  2PMZ P;  3TP6 A;  3A8J E;  2ZTC A;  3E6Z X;  5IYC G;  3S1M L;  2IY5 B;  2B63 L;  2WB1 G;  4IUU A;  4AIM A;  3HOW H;  3A7L A;  1D6E C;  1JR0 D;  1G6P A;  5I6W A;  1KAB A;  4LHN A;  4WRD A;  3J7Z 1;  2L5T A;  2EXZ A;  5CR3 A;  4YWK A;  1X54 A;  5EKK A;  2F3W A;  2JEB I;  2UUC Q;  4YCW A;  1Y1V G;  2DJG C;  2N78 A;  5C4X L;  2R3Z A;  5KYL A;  2CR8 A;  3GTO H;  1KRS A;  2VNU D;  4OO1 I;  4A3K H;  1D5X C;  1G6Z A;  3MFG A;  3M4O B;  5IOD A;  3HOX L;  1BRF A;  4U67 3;  2NZO A;  3UDG A;  4JOI C;  3RD4 A;  3CCV A;  3DM1 A;  4HR7 B;  2KHJ A;  1HTL D;  3CPF A;  1A63 A;  2B63 G;  1T9P A;  3PIP 3;  1E7Z A;  1SAP A;  4XGH A;  4OX9 L;  4KJO A;  4X65 L;  4YHH L;  5KEE A;  5G3L D;  4EQO A;  1K8G A;  1YHA A;  1GJX A;  1HA6 A;  1STE A;  1BBU A;  2NVY L;  4DV4 L;  3IAY A;  1HNX Q;  1WTQ A;  1PYS B;  2EZV A;  4A3B H;  2EPB A;  2J4X A;  1QNK A;  1BBW A;  1PFV A;  3K57 A;  4BY7 B;  5C0X H;  2L0Z A;  2XWB B;  1OO9 B;  3I4M L;  1KTK A;  2OEO A;  4A3G H;  4Y7N L;  2F0H A;  3NBH A;  1B44 D;  3I73 A;  1HQR D;  3B08 B;  3J80 i;  5FLM H;  3SK8 A;  5MFZ A;  4DU9 A;  1P8L A;  2PPB C;  1XPO A;  1F9Q A;  5JAV A;  3E9I A;  1I4H A;  2VQF Q;  3DEO A;  2NZH A;  2Y0S B;  5C4J L;  3KK7 A;  3GTO L;  1PYB A;  3RNU A;  5JJI A;  1NSN S;  2M2L A;  3MWY W;  2F0N A;  4FF3 A;  1ZRP A;  5C3E G;  2F4I A;  3ONA B;  1YJ9 A;  3CP0 A;  4DPG A;  1FVI A;  2LMC B;  3SEB A;  3S1R B;  1N34 Q;  2NN6 G;  1V1Q A;  2B2Y A;  1XWE A;  2J7Z A;  1IBK Q;  4R4I A;  4KTA A;  4PZ8 A;  1XYI A;  4B3T L;  3K7A H;  3LPE B;  2XJR A;  4LF6 Q;  3S1M B;  1VMC A;  3NE5 B;  4A3F B;  2KQ3 A;  3SVM A;  1JIC A;  5C3X A;  1EFI D;  1VQM A;  1MSH A;  3B6Y A;  3MA2 B;  3M4O H;  1K0R A;  3S1Q H;  2QEJ C;  2VQE L;  2ICE C;  3H15 A;  4LF9 Q;  3S1N H;  1OXV A;  3KDF B;  4DV1 L;  1BQQ T;  2VB2 X;  4AYB B;  1KHI A;  5ELF A;  2YTX A;  1ZKO A;  3QOL A;  4LF8 Q;  2MUY A;  4Y7N H;  3M3Y B;  3W5O A;  1EEF D;  5FLM L;  1RCV D;  2MGS A;  4TVA B;  1PFY A;  2E2I L;  2EIF A;  4AYB E;  2APO B;  1XMQ L;  2I5L X;  3OMC A;  3M85 A;  1BQ8 A;  4R4O A;  1XNQ L;  2F0P A;  5M3F H;  1HJP A;  3IFT A;  4LUZ A;  5KGU A;  3NQI A;  4GN3 B;  4K2L A;  4R4Q A;  1EY7 A;  3RZO L;  4EVO A;  1J9O A;  3Q23 A;  1UE7 A;  4L5S A;  3G7L A;  1LAC A;  4YWM A;  4C3J H;  2A6H C;  1D8L A;  3L9A X;  3ITP A;  4P72 A;  4AYB P;  4A3E G;  3T1H L;  4L5Q A;  3Q0A A;  1EL0 A;  1M8A A;  3TS0 A;  4KD3 A;  4AHZ A;  2KBN A;  4O2D A;  5IP9 G;  2PYA A;  2Q2U A;  1LTG D;  1YEZ A;  2JA6 L;  2AUJ D;  3UDX A;  2JA5 B;  1HA5 A;  2LY7 A;  5D3D A;  4KKT A;  5D14 A;  5M5Y L;  1PTO C;  1IBM Q;  1CT1 D;  1FGB D;  2NN6 I;  5IGD A;  2CQA A;  1UE5 A;  1DCZ A;  1FGU A;  2RSN A;  1U5K A;  2Q8T A;  2UUB Q;  1GO3 E;  4GKJ Q;  4NXM L;  1T5X D;  3CAM A;  4UDU C;  5C44 L;  2ALY B;  3PO2 L;  3C3L A;  1BE7 A;  3H09 A;  4ULL A;  1PFM A;  3RN5 A;  1DYQ A;  1DOM A;  1BNZ A;  2XNA C;  3KF8 A;  3M7G A;  1AH9 A;  2XRQ D;  1DX8 A;  4TRD A;  1CAD A;  1SMW A;  2F0O A;  2RDV A;  2EJM A;  4K0K L;  1STN A;  4A3D H;  2MO1 A;  1I5F A;  1VQG A;  2AQC A;  1S5B D;  4GKK L;  2RA4 A;  5BN3 A;  1WCM L;  4AR4 A;  3OOC A;  3T1Y L;  4KI0 A;  4H02 A;  2C6A A;  2LXJ A;  1BCP C;  4C2M H;  2JA8 B;  1CTM A;  3DWA A;  4A3L L;  2I5H A;  1B2J A;  3NTK A;  1QWY A;  4F7X A;  1VQO A;  1KNE A;  3DWQ A;  3HG9 A;  3QOJ A;  2A69 D;  2R7Z G;  1VQI A;  1R9T B;  3TQY A;  5ELC A;  4LFB Q;  5GAD C;  4I7Z C;  4N8F A;  1HCZ A;  3GDE A;  5CMD A;  3CCJ A;  1SJH D;  5LHY 1;  3QQC E;  1U4M A;  1WVL A;  2CWA A;  5IP7 G;  3IRB A;  1K8M A;  1I4R A;  4DUZ Q;  4GOP C;  2M4Y A;  2UU9 Q;  2F52 A;  1WCM B;  5AJ3 Q;  1ILQ A;  5C0X I;  5C44 H;  3MC0 B;  1QYB A;  4Z9C B;  1VZG A;  4CGY B;  3F1Z A;  2AWN A;  4AR3 A;  2EY5 A;  3I7F A;  1A3V A;  1HNW Q;  1B2O A;  3S1R L;  1E24 A;  5IGB A;  4FF2 A;  3EQL C;  4EQ5 A;  2CW0 C;  5I2X A;  1SE2 A;  2BDN A;  4DNI A;  1VQL A;  4QB4 A;  1HNW L;  1RWD A;  5J39 A;  4BY1 H;  2PQA A;  2K5N A;  4C3H L;  1KDB A;  1ENF A;  1ICF B;  4WOR A;  4B08 A;  1CA5 A;  3BZK A;  1B1Z A;  5HUR A;  4X3U A;  4IPD A;  3EJI A;  2ZJP A;  2CH4 A;  4JBK A;  2K1B A;  2ZJR A;  3X3M A;  3CCL A;  4JW0 A;  5LMN L;  2A74 C;  3PCO B;  5JEA H;  4DV3 L;  1VQE A;  1GHK A;  4XT3 B;  4BWG B;  3S16 L;  3KYH C;  3QWN A;  4LAA A;  2WP8 J;  1VDZ A;  1OXS C;  2M00 A;  3SGI A;  3VA5 A;  4ME5 A;  2WII B;  1V1P B;  3I4M B;  2K5H A;  1WTX A;  1HNX L;  1B50 A;  3LWQ B;  1BF4 A;  1STY A;  4LFA L;  3I72 A;  3M3Y L;  4L8J A;  1NE3 A;  1PRT B;  3DHQ A;  5CBE E;  4DR7 L;  4DV6 L;  1PVO A;  4AI3 A;  2EDG A;  1SYF A;  3K7A L;  3NQT A;  1GUG A;  4IPH A;  4A3J B;  2IL8 A;  2NVT H;  3WOF A;  3PGZ A;  3I55 A;  3C46 A;  1EU3 A;  2F4V L;  4KJN A;  2QL0 A;  1IU5 A;  1QE6 A;  3H0G H;  3R2T A;  4UPA A;  4DV6 Q;  1RJT A;  4ZAI A;  4KMU C;  5AI2 A;  2RDF A;  4AI0 A;  1N8R C;  4G7Z C;  1SYB A;  2XTI A;  2Q8R E;  3OTO Q;  4XTC S;  2RVL A;  4KK7 A;  1TU2 B;  5IP7 L;  1N33 Q;  5FO9 B;  3FKI L;  1N9W A;  2PZW A;  5IT9 E;  3PIP 1;  1QCV A;  1GUW A;  3E9H A;  2JSO A;  3PQI A;  3PO3 G;  4ZLT F;  1B9N A;  4JCV E;  1QCB D;  2OTL A;  2AQ2 B;  4X3T A;  2QKI C;  4JI0 L;  4DR2 L;  3PUZ A;  2E2I H;  1N33 L;  2YU9 B;  4LUV A;  1I6V C;  4JC0 A;  1XX8 A;  3Q8D A;  4P73 A;  1WJJ A;  3ULL A;  1TY2 A;  1HR0 L;  2OQK A;  1PXU A;  3T53 B;  5C4H A;  2UUA Q;  5IT9 L;  2JA7 G;  1LO5 D;  4FYD A;  4C3H G;  2E74 C;  3NHH A;  2Z1C A;  1XXG A;  1GKH A;  2FFK B;  1M90 C;  5T1I A;  3S17 B;  3N6R A;  2M6O A;  4HMI A;  2HR5 A;  2L9H A;  1U4P A;  3HOZ H;  3D6C A;  3FPP A;  2B2W A;  4XIG S;  4KN7 C;  3AFP A;  1R0J A;  1IYJ B;  1S5F D;  3FEW X;  2JA6 H;  3HOY G;  3AU7 A;  4IUP A;  3S14 H;  4A3M H;  4JV5 Q;  3JAM i;  2PO4 A;  3PUV A;  1JMC A;  1QJO A;  5IGE A;  1Y1W H;  2IW3 A;  3SE0 A;  2Z3Q B;  5IYB H;  2F0D A;  2R93 L;  2F0F A;  5M3M G;  1AZP A;  4A3E L;  2QCP X;  2MS3 A;  4DFA A;  1CI3 M;  4JV5 L;  3WWV A;  3JC6 6;  3MTS A;  2HVY C;  3MFY A;  1EEI D;  4KD4 A;  5EPJ A;  3K35 A;  4AHX A;  4WJ3 M;  5LMN W;  4A3D L;  3MXP A;  1PLF A;  1UEA B;  4DR7 Q;  3QO2 A;  3WWL A;  2RDH A;  1PH6 A;  3M4O L;  1B3Q A;  4A3I H;  2JA5 L;  1TWC H;  2F1M A;  1EWC A;  3DXJ C;  1GUT A;  3S1N L;  3I4M G;  3RLN A;  1D5M C;  1TWH H;  4AHW A;  3PV0 A;  4R1J A;  3UDF A;  2KJX A;  2E8G A;  3HKZ B;  2C5C A;  4BBS H;  2ENB A;  1ZYR D;  1VQ6 A;  5LL6 S;  3PO2 B;  1B4O A;  3CU7 A;  3RZD H;  1HNZ L;  5EBC A;  4X3S A;  4P75 A;  1J8I A;  3V05 A;  3KLR A;  4IUN A;  3GTJ B;  4XXB B;  1JOO A;  3NBI A;  4K8I A;  4FF4 A;  4CKE A;  2N88 A;  5E3F A;  4OWT B;  1TWF H;  1EIF A;  1VMP A;  4QCL A;  4OHJ A;  4TKO B;  4IUV A;  3A8K E;  2WIN B;  3FDJ A;  1IKL A;  1V1O A;  5GAG C;  4BY7 G;  1AE2 A;  1OXT A;  1EYG A;  1G2S A;  4PZ7 A;  4A3D B;  4DV5 Q;  3H6M A;  2E76 C;  3GTM H;  4DNT B;  1HQM C;  5GQO A;  1JWM D;  1WI5 A;  1CQF A;  2JN4 A;  5ELD A;  2I07 B;  4B8C D;  1HUM A;  4GZY C;  2CCZ A;  1OXX K;  2K4K A;  3PF4 A;  5FKA C;  3F2C A;  5JJK A;  2KVM A;  4RHR A;  4DV4 Q;  4FNF A;  3OIP A;  3GTK L;  1MIU A;  2NTS A;  3GTM B;  3CD6 A;  2ZTD A;  1LV9 A;  5C4X H;  1TWC L;  4GS7 D;  2JA5 H;  5MLC 3;  2KCN A;  1FNW A;  2B5I D;  5C3E B;  2KCM A;  5K36 G;  1YHQ A;  5EPK A;  2K2D A;  3U9O A;  2OQ0 A;  5GAH C;  5L37 A;  4YIJ A;  2RF4 A;  4KHP L;  1DVB A;  3KLS X;  4XYQ A;  1LKM A;  1CFM A;  2NVQ H;  2DUD A;  2CHB D;  2MJ8 A;  1JB7 A;  5FO8 B;  4XQJ A;  2AHO B;  3G4S A;  1L2F A;  1TWG H;  2VZA A;  3D31 A;  1HPC A;  1SN8 A;  4IAL A;  4DAY A;  4ZKC B;  4DR1 L;  1XNR Q;  5KND A;  1KIX A;  4HIK A;  1AZQ A;  1X3F A;  4IN3 A;  1Q12 A;  3O13 A;  1SNC A;  1T9Q A;  1FD7 D;  4JI4 L;  1D7Q A;  1VCI A;  1IBL Q;  5FK9 C;  2DNC A;  1KXL A;  3F2U A;  1PH2 A;  3S2D B;  1QUQ A;  5M3M B;  4AYB G;  1MGS A;  2L11 A;  4LNQ A;  4DAM A;  4GNX B;  3VR3 A;  1SND A;  3TZD A;  3NUC A;  5EPL A;  1H9S B;  2UUC L;  1X6O A;  1S5D D;  1KC8 C;  3OSO A;  2E75 C;  2A6E C;  2E2J H;  1C09 A;  2L12 A;  2KHS A;  2D0O A;  4X6A L;  2NTT A;  3NWT A;  4MHE A;  1DOK A;  3Q6S A;  3PMF A;  5FLX c;  1Q3L A;  1CSQ A;  1YNJ D;  3FVQ A;  2B8F A;  1JE4 A;  1JOK A;  2Z6B A;  4JI6 Q;  2R92 L;  1TWF B;  3ICE A;  3S14 B;  1H9J A;  1IU6 A;  1HZB A;  5M5X H;  4IQZ A;  2FJ2 A;  5EBD A;  4A3L G;  4DR5 L;  4ODG A;  1HRJ A;  3LX0 A;  3TP7 A;  4O0A A;  2XJV A;  1TWG L;  3KYY A;  2JK8 A;  4YCU A;  3CKI B;  1F2Z A;  1FYC A;  5K36 H;  3QG1 A;  1BKB A;  2F3V A;  2EY6 A;  3G71 A;  2JA5 G;  1B13 A;  1PRT F;  5COY A;  1BFY A;  1E0B A;  2EXD A;  1WD1 A;  1AFP A;  3K8A A;  1NXE A;  1Q46 A;  4LFA Q;  1QQT A;  2O4X A;  4A3D G;  2Y0S P;  5E4X A;  4YWL A;  1PDQ A;  3CCU A;  1PZX A;  4GNX C;  2ZXR A;  4RG1 A;  1IW7 C;  1NCV A;  1Y8P B;  5C44 B;  2EOT A;  5IYC L;  3G6E A;  4BY1 L;  5JJL A;  3HOU L;  3J81 i;  3M9B A;  3HOW L;  2MNA A;  1I3Q L;  4DV0 Q;  2AKW B;  1DD2 A;  1SMY D;  3N52 A;  1JJG A;  3CRL C;  1VQN A;  1T5E A;  2FMC A;  2ZT9 C;  2CKC A;  4E6I A;  2Z9H A;  3K81 C;  3R3O A;  4DUY L;  2K03 A;  1S2Z A;  5CV4 A;  3E5S A;  4NDX A;  1SSO A;  3GTJ L;  4RXN A;  4BBR L;  1RDP D;  4RH6 A;  1GD7 A;  4NXM Q;  4NXN Q;  2R92 H;  5KNC A;  3HP3 A;  3KBG A;  2KED A;  5CV8 A;  2G9D A;  4B3T Q;  1S3O A;  3GTL B;  4HN7 A;  3OW7 A;  4HID A;  4POG A;  1EOT A;  3RLF A;  1WTP A;  1NUC A;  1ET9 A;  2KEE A;  5IE8 A;  4UP7 A;  5DM7 1;  2Z0S A;  1HR0 Q;  3A74 A;  1P16 A;  2ERJ A;  5C4J H;  1SXT A;  1FL0 A;  1ZYR C;  4LMQ D;  3CCE A;  1CZW A;  2Y0S E;  2E2J B;  1SYE A;  5AFW A;  2PZT A;  4DKA C;  2X6L A;  4WFN 1;  3PO3 B;  4O42 A;  5M5Y H;  2Q2H A;  1XJV A;  4N9P A;  4RKL A;  3U58 A;  2K50 A;  1WTH A;  5BR8 L;  1HZC A;  2F0U A;  5M3M H;  1SFO B;  5C6A A;  1XMQ Q;  4L63 B;  4CJ2 C;  2R6G A;  4WFN 3;  4C3I G;  4LFB L;  4QQB X;  1E2W A;  2MPM A;  1HTP A;  2LFN A;  2PMZ B;  3J81 L;  3H97 A;  4UAI A;  1MKH A;  4K2K A;  1U9R A;  1O78 A;  2UXB Q;  1MHW C;  1Z92 B;  1EIY B;  1YI2 A;  3CC4 A;  2RBM A;  3G6J B;  4H44 C;  4FF1 A;  1D2B A;  3GTK B;  1AEX A;  5IWA Q;  4LF4 L;  4LF5 L;  3GTJ H;  2WKD A;  3JAM c;  4ZUI A;  1XTC D;  3GTG H;  2JI3 A;  2UXB L;  3T1H Q;  1TS3 A;  2R92 B;  2D5D A;  4RKB A;  1C9O A;  2NN6 H;  2HUG A;  1QVC A;  1I6H L;  3I4L A;  2YYZ A;  3K0X A;  2K7V A;  2JA7 H;  1CM9 A;  1GUS A;  4GLA C;  5CV9 A;  1NMF A;  4RAU C;  2CWP A;  1SMY C;  1DON A;  5J1Z A;  1TR5 A;  1R4Q B;  4DA2 A;  3C1E A;  5JEA J;  5AI3 A;  2NVX L;  2A6E D;  1U4R A;  1T9O A;  4J6H A;  1PH1 A;  4DXG A;  1Z9F A;  4GKJ L;  5M3F L;  1RYT A;  3TS2 A;  4YY3 L;  1LM0 A;  2K5Q A;  2VQF L;  5IOC A;  4V0B A;  2WAQ B;  5FLM G;  2NYZ D;  2XJT A;  3KYW A;  3AB9 A;  1Y1W L;  2A6H D;  4GN5 A;  1X32 A;  3V96 A;  2A1A A;  2F03 A;  4JI2 L;  1IYV A;  3X3N A;  3HKZ E;  1A3T A;  1EQR A;  1MD2 D;  2B2U A;  5HGQ A;  2NVQ L;  2BA0 A;  3BVM A;  5LMN Q;  2ZXP A;  1EYC A;  2DNE A;  4DV5 L;  1IL8 A;  4A3B G;  1PZI D;  4A3M B;  4A3J L;  3HKZ G;  1N34 L;  3GO5 A;  4AI2 A;  1GHJ A;  3GTL H;  2ID0 A;  4HSV A;  2OXP A;  4P2C B;  4G7O C;  4CBV A;  3URY A;  4LFC L;  1RHP A;  1RTO A;  4UY8 C;  2ZM6 L;  4QGU A;  2QIL A;  1I6H H;  2EYL A;  4C3H H;  4C3J L;  3RLO A;  3UE1 A;  1LT4 D;  2V0E A;  2RFK B;  1EQV A;  3VR5 A;  3K5O A;  3RZD L;  5C0X J;  1EY6 A;  4P71 A;  3H99 A;  4AHY A;  4LUO A;  5EKI A;  3PIO 1;  2JJQ A;  2VS1 A;  1IL2 A;  4AI1 A;  4KHP Q;  2VW9 A;  3MQK B;  1L0X B;  4LJZ C;  3ZG6 A;  1ESF A;  4ZYS A;  3S16 B;  3GTP L;  4ALP A;  2B29 A;  5E1F A;  2MHV A;  1X9N A;  5E4W C;  2KUM A;  1XNR L;  3A0J A;  3FKI G;  4M1U B;  5GAG c;  4C56 C;  7RXN A;  3P20 A;  1MI2 A;  3T13 A;  3K0Y A;  5CV5 A;  1HXY D;  4AR5 A;  4LF4 Q;  3KF8 B;  2PCF B;  3SK4 A;  3I4N G;  1YIT A;  3D4D A;  4JK1 C;  1IBL L;  5DNF A;  2HDL A;  3HOW G;  1S30 A;  3CQZ B;  3HRZ C;  3C1F A;  1B71 A;  2IX3 A;  2KA7 A;  2BCO A;  4BY1 G;  3ULJ A;  2NWG A;  5C4Z A;  3EVQ A;  3GTQ H;  4H7B A;  4HJ8 A;  4JOI A;  2A73 B;  2NUC A;  1PH7 A;  1E1T A;  1AN8 A;  1CK1 A;  3CCQ A;  4K6D A;  4XXE A;  1TS5 A;  3LWU A;  5IIF A;  3GTK H;  4IO9 A;  2YU9 L;  1MJE A;  2R7Z L;  2JQO A;  1WTR A;  4BBS G;  1EY0 A;  3TP5 A;  1X3G A;  1B7Y B;  4ABN A;  4MZ9 A;  4H0L C;  1JWU D;  1I4G A;  4JI8 L;  4A75 A;  1EOV A;  1JCK B;  1U0L A;  2OCE A;  4JI6 L;  3PSI A;  4EX5 A;  1WOC A;  4JI2 Q;  5D3I B;  2E2H H;  5ELO A;  3FKI H;  1IXR A;  4TVM A;  1UWV A;  1WCM G;  1G29 1;  1DM0 B;  5D65 A;  4Y7N B;  1H9M A;  4OXP A;  1VF7 A;  3I4O A;  4QJF A;  1V43 A;  3SDZ A;  2WAQ G;  1IZ6 A;  3LGJ A;  4KKU A;  5A2Q E;  3NXW A;  1PZJ D;  1Q82 C;  1EZ6 A;  2ICI A;  5C4J B;  5LMU Q;  4X66 L;  4JI7 L;  3PO3 L;  2JP1 A;  3S2H H;  3KOJ A;  2A19 A;  4JAF A;  3PO2 G;  4OL7 A;  3JC6 3;  3RUZ A;  4IPG A;  3KJO A;  4CKC A;  3RYG A;  3HAX C;  5H1S E;  3KBX A;  2HQE A;  2KKD A;  4F87 A;  3ND8 A;  2HCC A;  2PNH A;  3HOZ G;  1S5C D;  2CKZ B;  5A2Q L;  1TWA L;  4RGT A;  5CBA E;  3S1R H;  1H95 A;  1NR4 A;  4X3K A;  3JAM L;  1L0Y B;  5G3L F;  3HS0 C;  3A5U A;  2BH2 A;  2GVA A;  4U68 A;  4JBW A;  3MPS A;  3AEV A;  4M8A A;  2L15 A;  1ENC A;  5IYD L;  1SBB B;  4DUZ L;  4IOA A;  4MTN A;  1HFN A;  4RHS A;  2FMM A;  4IOC A;  1KQS A;  2E2H L;  3HJY B;  1HFG A;  1LUZ A;  5AN9 H;  1KNA A;  3WOE A;  3T1Y Q;  1PRT D;  3U9S A;  3M7N A;  2RQX A;  1YK4 A;  3IFD A;  5IP9 H;  1YIJ A;  1HUN A;  1BO0 A;  1CUK A;  1VZH A;  3P7J A;  1IRO A;  3DUZ A;  3I4N B;  4A3B L;  1F77 A;  1Z47 A;  5EGT A;  1I94 Q;  3T56 B;  5MFP A;  4CDD C;  2Q2T A;  1FHM A;  1EY5 A;  4BA1 I;  3FPU B;  4BY1 B;  3RZO B;  2F0K A;  2O5J C;  4PMC A;  1WTW A;  4IJH A;  3VYS A;  5KYI A;  3K58 A;  4N8X 1;  2VQE Q;  2M9V A;  1E2V A;  3TDQ A;  4Y52 L;  2YV5 A;  2J9U B;  3FDT A;  2G9H D;  3L7Z C;  5KNB A;  1NJI C;  2F0V A;  2E5L Q;  5KRU A;  1STB A;  4A3K B;  1TWC B;  2KCC A;  2PI2 E;  2YTV A;  3F8T A;  3M4Y A;  4E6Y A;  4R4T A;  5KIX A;  1ET6 A;  2UXC Q;  3HOX B;  2JEA I;  1X55 A;  1WYD A;  2UXD L;  1JOQ A;  1ICW A;  2K5D A;  4LF5 Q;  4JI3 Q;  4KHV A;  3J7A V;  1YNN C;  1G51 A;  1N36 Q;  1LT3 D;  1PTO D;  1C4Q A;  4RA8 A;  4DR3 L;  3SK6 A;  3RZT A;  2OTJ A;  4DXF A;  3GV6 A;  2OF1 A;  1E1O A;  2IT1 A;  2LCQ A;  5EQ0 A;  3I3C A;  4C3H B;  5COR A;  2PPT A;  4C3I B;  4ZN1 B;  4HMJ A;  3D4R A;  5CV6 A;  1GVP A;  1NNX A;  1JQY D;  5FJ8 L;  3LWE A;  1I4Q A;  2K05 A;  3NSW A;  5C5M A;  1F4L A;  3H0G B;  3DM3 A;  3MHB A;  3NP8 A;  4RCO A;  2L0C A;  1PH5 A;  2R93 H;  4JAD A;  1A15 A;  4A3L H;  5DM7 3;  2E2D C;  3TEH B;  3PIP A;  1Q7Y C;  3DEP A;  3FMC A;  4C3J G;  4ZKB B;  1HZA A;  2XWJ B;  1VQ9 A;  4APV A;  1QB5 D;  3W1B A;  1BCP D;  3IU3 I;  1F9S A;  3NTH A;  5CGK A;  3J7A 5;  3CME A;  2DSX A;  2FHT A;  1YJW A;  2H1E A;  1Z6H A;  4A3I L;  4JYA Q;  4K5W A;  3J7Y W;  2A69 C;  4B3M L;  2CW0 D;  2K5V A;  2DJF C;  5H1S c;  1I3Q B;  1TWH L;  5M5Y B;  4A3G G;  5IYB L;  5GAD c;  1VQ7 A;  5DM6 3;  2F0M A;  3OW2 A;  1X3P A;  1H9R A;  1UNS A;  1I94 L;  5C0X G;  4BY7 L;  2N3S A;  5RXN A;  3OPO A;  5DLQ E;  1NXG A;  4BXX L;  4Q0F A;  4JI1 Q;  3VR6 A;  1SYC A;  1OXU A;  4HJ9 A;  4GNX A;  1Y1W G;  3A5Z B;  2TMP A;  4NP5 A;  1PHJ A;  3H3V C;  3LWV B;  1AE3 A;  4MNO A;  2Z3R B;  2KEN A;  1TII D;  2DGY A;  1VF5 C;  2V0F A;  2N8N A;  4JI1 L;  1PFB A;  2B3G A;  4X64 Q;  1A2U A;  3K7A B;  3VYT A;  4A93 B;  3W2D A;  4PMB A;  2IX1 A;  1CKM A;  4IUT A;  3RN2 A;  2NVT B;  4QUF A;  4XQQ A;  5I2Y A;  3T4A C;  4K14 A;  2MFI A;  4CKB A;  2EJG C;  3LWO B;  1M1K C;  3PO2 H;  2UXC L;  5TSS A;  4RGN A;  2B8G A;  2R7D A;  4FDB A;  2ZJQ A;  3T51 B;  2HHH Q;  2JYO A;  5C3E H;  4CJ0 B;  5CC4 A;  2V4D A;  3KUP A;  3L2P A;  4DUY Q;  1JB3 A;  3ND9 A;  2TSS A;  4GOP B;  1SFO H;  3BDO A;  3STB D;  3KFU A;  4GS3 A;  4DR3 Q;  1PRT C;  4EQP A;  1Y1V H;  2ASB A;  8RXN A;  1WCM H;  1RL2 A;  3S16 H;  4DAY B;  2NYD A;  3D3R A;  1W6K A;  1C0A A;  2ZIX A;  3PO3 H;  1LTB D;  2K6A A;  2BH8 A;  2Q2I A;  2B2Y C;  2FIN B;  1Y8N B;  2K28 A;  1ZXT A;  2KCT A;  2VY3 A;  2L55 A;  3BVG A;  4RCN A;  5C5L A;  1D1I A;  3L0O A;  4OIK A;  4BY7 H;  3SK5 A;  2PW5 A;  1CKN B;  3R2I A;  2LS0 1;  1JWS D;  1R9T H;  5JVG 1;  4B3S Q;  5J3B A;  4GLX A;  3TP8 A;  3RMH A;  3TRZ A;  4NKL A;  2YTY A;  2ZXO A;  4TQU S;  5BN5 A;  4A3F H;  1EIH A;  1CKO A;  1PYW D;  2A68 D;  1TWA H;  5MF6 A;  4JI5 Q;  1XTD A;  3BS1 A;  1STA A;  1O7Z A;  1NTG A;  4HIO A;  1VQK A;  1TWA B;  4ME3 A;  3KF6 B;  2VL6 A;  2XJU A;  1B9M A;  2F0Q A;  2B63 H;  4JYA L;  2M6P A;  3EA6 A;  3I4N H;  1KD1 C;  1LTI D;  1TY0 A;  3H91 A;  3A54 A;  4A3I G;  5C3E L;  3TRE A;  5C4X G;  2E2J L;  4R9W A;  1UAP A;  1BUV T;  3GV3 A;  2QF7 A;  2BOS A;  3CHB D;  5EAY A;  5CV7 A;  3BYT B;  4K5V A;  4L5T A;  2YU9 H;  4K9F A;  2HCI A;  2EY2 A;  1SRO A;  3CPW A;  2BDO A;  1NMG A;  3F2B A;  4P74 A;  3K80 C;  4HSP A;  4A3G B;  2G5D A;  4NW2 A;  4XDX A;  3MEF A;  4X62 Q;  4IFD G;  2ATW A;  4ZQ3 A;  1SR3 A;  1KRT A;  3CC2 A;  1CHQ D;  1SLJ A;  3I2Z A;  2CH4 W;  1FJG Q;  5JJZ A;  1Q8I A;  3PUW A;  4FP5 D;  4A3B B;  4A3M G;  3BG3 A;  1VCX A;  4IUQ A;  2EYF A;  2RCN A;  4DN4 M;  4GLV B;  1VQ8 A;  1UE6 A;  1SRU A;  2BE5 D;  1KLU D;  3BVZ A;  3FRP B;  4X6A H;  2XJS A;  1OWC A;  4A93 G;  4Y52 H;  1TT2 A;  4DR1 Q;  2DY8 A;  2H4O A;  2QW7 A;  1DJR D;  1WD0 A;  1E22 A;  1PH4 A;  3A55 A;  4LK1 C;  1BQ9 A;  4NMZ A;  1SE3 A;  4JI4 Q;  3HOU H;  4LF7 L;  5M5X L;  1GUN A;  3H3V M;  3CW2 C;  4DV2 Q;  5JVG 3;  4OEM B;  3I4M H;  3K59 A;  4LF6 L;  2R7F A;  3SHL A;  4A3G L;  1X3E A;  4S3S A;  3NK9 A;  1WTV A;  5C44 G;  4DV7 Q;  1PTO F;  1PMR A;  1EWI A;  2EYO A;  4XQN A;  3LNL A;  1ZEQ X;  4UHV A;  4POF A;  4HED A;  1FR3 A;  2CVR A;  3BZD B;  1NNQ A;  4BS9 A;  3PF5 A;  2E2I B;  3JR7 A;  6RXN A;  3FKI B;  4DNR B;  1JT8 A;  1SNO A;  3HFZ B;  1EYA A;  4XYO A;  2V3B B;  1ASY A;  3D0F A;  3NBH B;  4DV1 Q;  4A76 A;  2F0E A;  3S2D H;  1BXT A;  4RGO S;  2IX0 A;  3OHX C;  3HOW B;  1E3P A;  2NVX B;  5IYB G;  1YVC A;  1Z7T A;  2B2V C;  1CSP A;  2E5L L;  5IGC A;  1PTO B;  4HJA A;  1SNP A;  5EKL A;  5IWA L;  4OEL B;  1U4L A;  4R8I A;  1CA6 A;  3VA7 A;  4DR6 L;  4A3J H;  3MXG A;  4TSS A;  3NEN A;  4JI3 L;  5E7N A;  2XRS D;  3ULP A;  1PFU A;  4GOP A;  4BBS B;  4HIM A;  1R0G A;  2HD3 A;  4C3I H;  3PWF A;  3OWE B;  1L1O C;  2BA1 A;  3HZX A;  1EQQ A;  3J80 c;  3QR8 A;  4A3C H;  4A3I B;  4C1N K;  5M3M L;  3GTM L;  2PYK A;  1VQB A;  3F2D A;  3G48 A;  4BBR B;  3ZJY C;  2PMZ E;  3J7Z C;  1TS4 A;  4KN4 C;  2SNM A;  4DV0 L;  2WB1 P;  1BR9 A;  4PZ6 A;  1K83 H;  2BE5 C;  1II3 A;  5JEA G;  3NTI A;  3D4W A;  3S9W A;  1PH8 A;  1LT6 D;  3L3O C;  2EE1 A;  2JI2 A;  2CFM A;  3JAM E;  1MBY A;  4PMW A;  5A35 A;  1S72 A;  3TME A;  5C3W A;  3H9B A;  2F0S A;  1CAA A;  4CJ1 B;  3GTP B;  2PVE A;  4A3E H;  3S1M H;  1EY8 A;  1J5E L;  1G8Z D;  5BN4 A;  1IHZ A;  2O2L D;  4FO2 A;  4LF7 Q;  5JOB A;  2M4V A;  2X69 A;  3DMU A;  2R92 G;  3CXC A;  5M5X B;  3AYH B;  2SOB A;  3GTQ L;  3QJY A;  1F2M A;  1RTN A;  4DV7 L;  1JE5 A;  1DGS A;  1Q1E A;  4CDF C;  1TXY A;  3I8Z A;  2RDG A;  3Q24 A;  1JJ2 A;  2MP1 A;  1EZ8 A;  1STH A;  3A44 A;  3PL5 A;  3OIQ A;  3J81 j;  3FP9 A;  4L5R C;  3GQB A;  4A93 L;  2B2W C;  1FNV A;  2PW7 A;  4A3C L;  5K5P A;  4UY8 1;  2OT2 A;  3VPB E;  1V8Q A;  4X64 L;  1RD9 D;  1QUQ B;  3QIA A;  3W3A A;  1ONL A;  3HEJ A;  1YNX A;  4LF9 L;  1YJN A;  3K5M A;  1EQT A;  1Y1V B;  5FLX L;  3BZC A;  2H12 A;  3I90 A;  3GTL L;  4N9T A;  3ER0 A;  1QIL A;  2WFW A;  3GP7 A;  1Y1W B;  2UU9 L;  1UEB A;  4F88 A;  3ERQ A;  2XSC A;  4ZCK A;  1A2T A;  2F0W A;  3J7Y 1;  4CDE C;  3BYY B;  1EWH A;  5IT9 c;  3KJP A;  1CKN A;  1T9H A;  4HJ7 A;  1Q90 A;  1BVS A;  2PNR C;  1O7L A;  3GTG B;  2D2C C;  4BXX G;  2AQ1 B;  2KN9 A;  1C8C A;  4BXX H;  4JBM A;  2B2T C;  1LTR D;  2Z4H A;  2WV6 D;  4EQN A;  5M5W B;  2JE6 I;  1LTS D;  1P7P A;  1NR2 A;  3CF5 A;  2C6B A;  2PI2 A;  2A8V A;  2F0L A;  1BCP B;  4UP8 A;  4JI8 Q;  3UE0 A;  1CZG A;  1F2L A;  2B2T A;  1IYU A;  1MSG A;  2WKC A;  5T1G A;  1SDF A;  3H0G L;  1D5Z C;  2MQH A;  2E2H B;  2AWO A;  1B3A A;  1JC7 A;  3STB C;  2QDB A;  2UUB L;  2VUM B;  4J1M A;  5NUC A;  5IP7 H;  3S1Q B;  4G57 A;  1A6X A;  5LMU L;  4JI7 Q;  1SFO L;  4HCE A;  1K0S A;  3PKI A;  5K2M E;  4DR5 Q;  3VR2 A;  1BCP F;  1WJV A;  4KY6 A;  2F3I A;  1K3B C;  1QNU A;  3MVV A;  2VXW A;  1S4Z A;  5IP9 L;  2UXD Q;  1EU4 A;  1A8V A;  5I4D A;  2R93 B;  1O7Y A;  1W2B A;  3CCS A;  3S1Q L;  1M4V A;  2NVY B;  3SXH A;  2LXK A;  1VQ4 A;  4KLK A;  2IWH A;  4C1N I;  4L6T B;  1X56 A;  4HAE A;  1NAP A;  3A56 A;  5M3F G;  3TN2 A;  5MGN A;  3MZ5 A;  3BU2 A;  3MXU A;  1FJG L;  3QB3 A;  1LKO A;  1R4P B;  4OGQ C;  1A3U A;  5F2D A;  1BDO A;  1IBM L;  3VYU A;  3U4Z A;  3NPP A;  3KYU A;  1PFW A;  2F0J A;  3M4P A;  2EY1 A;  4A3M L;  1R0F A;  5DM6 1;  1LLR D;  4JPB W;  3RR5 A;  3HOX H;  3IKJ A;  1O80 A;  4UP9 A;  3UI2 A;  3J81 c;  4DAP A;  1RB9 A;  1LAB A;  2WAQ E;  4I65 A;  5HGT A;  4J15 A;  1LT5 D;  4G7H C;  1Q1B A;  3OYY A;  1D1K A;  3KDF A;  3HOY L;  4JBJ A;  1PH9 A;  4KY7 A;  4BA2 I;  3K5N A;  4V19 6;  4OWW B;  2XVS A;  2NVT L;  2JI1 A;  2ZM6 Q;  3LNN A;  1XPR A;  1E8J A;  2NVY H;  1B70 B;  2LKV A;  3HKZ P;  3HOZ B;  1LTT D;  4LWC A;  2SEB D;  2K01 A; 
#chains in the Genus database with same CATH homology
 1X3F A;  1BBU A;  1YUX A;  1HZA A;  3S17 H;  1VQ9 A;  4APV A;  1Q12 A;  5IY0 A;  4DV4 L;  3W1B A;  1HNX Q;  3EBE A;  3IU3 I;  1PYS B;  1T9Q A;  4A3B H;  3GD7 A;  3CCR A;  4JI4 L;  1D7Q A;  1VCI A;  1IBL Q;  1BBW A;  1SE8 A;  1W3S A;  1KXL A;  1L0W A;  3J7A 5;  3CME A;  2HIV A;  1PH2 A;  2DSX A;  1YJW A;  2L0Z A;  5GRO A;  1QUQ A;  1UE1 A;  4AYB G;  5BR8 Q;  4A3G H;  4LNQ A;  4DAM A;  4JYA Q;  2K14 A;  4GNX B;  4AH6 A;  2PVX A;  4B3M L;  4LF8 L;  3J80 i;  2K5V A;  3B08 B;  5H1S c;  4X65 Q;  5FLM H;  4YHH Q;  5MFZ A;  1P8L A;  2UUC L;  1XPO A;  4R4C A;  1X6O A;  3E9I A;  4BBR H;  2VQF Q;  4DV3 Q;  4A3G G;  2D0P A;  5GAD c;  1A0I A;  3P8B A;  3B0A B;  1YZ6 A;  2NZH A;  4NPS A;  3OW2 A;  1KC8 C;  1VQ7 A;  1I94 L;  5C0X G;  1C09 A;  2N3S A;  5GAE C;  5RXN A;  2E2J H;  2D0O A;  1NXG A;  5DLQ E;  4RMF A;  4X66 Q;  1PYB A;  4JI1 Q;  3RNU A;  2VUM G;  1OXU A;  5FLX c;  4HJ9 A;  4GNX A;  1Y1W G;  1XNQ Q;  5IYD H;  3A5Z B;  5JJI A;  4LF9 Q;  1PHJ A;  1CSQ A;  1YHB A;  4MNO A;  1AE3 A;  2Z3R B;  1ZRP A;  5C3E G;  3I56 A;  2KEN A;  4QIW E;  4ZN3 B;  5M5W H;  4JI6 Q;  2DGY A;  1YJ9 A;  2JA6 G;  3HOY H;  3CP0 A;  2V0F A;  2N8N A;  4DPG A;  3ICE A;  1FVI A;  4LW1 A;  1N34 Q;  3NEL A;  4JI1 L;  2B3G A;  2NN6 G;  1IU6 A;  1IRN A;  1HZB A;  5M5X H;  1V1Q A;  4X64 Q;  4A3L G;  3MSU A;  4DR5 L;  1IBK Q;  4R4I A;  2IX1 A;  1CKM A;  3RN2 A;  4B3T L;  4PZ8 A;  4OON A;  4O0A A;  2XJV A;  3K7A H;  3LPE B;  2XJR A;  2MFI A;  4LF6 Q;  2KHI A;  3KYY A;  1SMM A;  2JK8 A;  4YCU A;  2JA8 H;  1M1K C;  2IHE A;  3PO2 H;  2UXC L;  2R7D A;  4U67 1;  4FDB A;  3S2H H;  2ZJQ A;  1BKB A;  2HHH Q;  3G71 A;  1VQM A;  2JA5 G;  1B13 A;  5C3E H;  1BFY A;  2EXD A;  3B6Y A;  3M4O H;  3L2P A;  4DUY Q;  1J6Q A;  1NXE A;  1K0R A;  3K8A A;  4A3K G;  4B3S L;  1Q46 A;  4LFA Q;  4GOP B;  1SFO H;  3PUX A;  2VQE L;  3S1Q H;  3STB D;  3KFU A;  2VUM H;  4A3D G;  3H15 A;  1YK5 A;  4YWL A;  1OXV A;  3KDF B;  4GS3 A;  3HOX G;  3CCU A;  4GNX C;  4DV1 L;  4DR3 Q;  4RG1 A;  1Y1V H;  1KHI A;  2ASB A;  4YCV A;  8RXN A;  1WCM H;  2YTX A;  1L1O A;  3G6E A;  4B3M Q;  4LF8 Q;  1RL2 A;  3KYV A;  4Y7N H;  1R0I A;  5JJL A;  3QVD A;  1IBK L;  3J81 i;  4DAY B;  2NYD A;  3S16 H;  1K3R A;  3W5O A;  4K0K L;  1C0A A;  2ZIX A;  3M9B A;  3PO3 H;  2MNA A;  2N49 A;  1LTL A;  2BH8 A;  2Q2I A;  4DV0 Q;  2AKW B;  4TVA B;  1JJG A;  2KCT A;  2EIF A;  1VQN A;  2VY3 A;  4AYB E;  1XMQ L;  4K0K Q;  2I5L X;  3L0O A;  3M85 A;  1LKP A;  4BY7 H;  2CKC A;  1BQ8 A;  1YV1 A;  1CKN B;  4R4O A;  5M3F H;  1HJP A;  1NBW A;  4LUZ A;  3K81 C;  1XNQ L;  4GKK Q;  3VDY A;  1Q7Y C;  1R9T H;  5JVG 1;  4DUY L;  4B3S Q;  4GN3 B;  5J3B A;  1S2Z A;  4GLX A;  4R4Q A;  2XGT A;  3TRZ A;  4OO1 G;  3EIV A;  2YTY A;  4TQU S;  4LFC Q;  1WFQ A;  3H0G G;  1HZ9 A;  4L5S A;  1LYL A;  1UE7 A;  4A3F H;  4RXN A;  1CKO A;  4NXM Q;  2A68 D;  1TWA H;  1GD7 A;  4KHZ A;  4NXN Q;  5MF6 A;  4YWM A;  4JI5 Q;  1XTD A;  4C3J H;  1D8L A;  3H3V H;  1ASZ A;  1NTG A;  4P72 A;  2HT1 A;  1PFS A;  4A3E G;  4B3T Q;  3T1H L;  1S3O A;  4HIO A;  3CMA A;  1VQK A;  3NFP I;  4L5Q A;  4ME3 A;  3KF6 B;  2VL6 A;  2XJU A;  4HID A;  4POG A;  2I5M X;  3TS0 A;  3RLF A;  1JYB A;  2MO0 A;  3I4N G;  4AHZ A;  2B63 H;  4JYA L;  2M6P A;  2KBN A;  4O2D A;  3I4N H;  5IP9 G;  5IE8 A;  2PYA A;  4UP7 A;  2Q2U A;  5DM7 1;  1YEZ A;  2Z0S A;  3UDX A;  3A74 A;  1KD1 C;  1P16 A;  3NEM A;  2ERJ A;  1HR0 Q;  4A3I G;  1RDG A;  5C4J H;  1FL0 A;  3TRE A;  5C4X G;  3CCE A;  3W1G A;  1IBM Q;  2Y0S E;  2NN6 I;  1UE5 A;  1FGU A;  4DKA C;  1U5K A;  2ERS A;  2UUB Q;  4WFN 1;  1GO3 E;  4GKJ Q;  5EAY A;  1QVF A;  4NXM L;  5M5Y H;  3CAM A;  2Q2H A;  2RHS B;  3RZ6 A;  4L5T A;  1XJV A;  1K73 C;  4K9F A;  2YU9 H;  3M3Y H;  2ALY B;  1SRO A;  3CPW A;  1BE7 A;  1NMG A;  5HY6 A;  3F2B A;  3RN5 A;  2HIX A;  3U58 A;  1K8A C;  2I0Q A;  4P74 A;  3K80 C;  1AH9 A;  2K50 A;  5BR8 L;  1HZC A;  3MEF A;  4X62 Q;  1DX8 A;  2ATW A;  1CAD A;  5M3M H;  1SMW A;  1QVG A;  4IFD G;  2RDV A;  1SR3 A;  1PH3 A;  1KRT A;  1XMQ Q;  3CC2 A;  2R6G A;  2Z6K C;  4A3D H;  2MO1 A;  1SLJ A;  1I5F A;  3I2Z A;  1FJG Q;  4LFB L;  4QQB X;  3S1N H;  1VQG A;  3PUW A;  4GKK L;  1MKH A;  4A3M G;  1VCX A;  2RCN A;  5IYC H;  2UXB Q;  4AR4 A;  3T1Y L;  4KI0 A;  1Z92 B;  4GLV B;  4H02 A;  1EIY B;  1YI2 A;  2C6A A;  1VQH A;  2LXJ A;  4C2M H;  1VQ8 A;  3CC4 A;  4JG2 A;  1UE6 A;  1SRU A;  5IWA Q;  2BE5 D;  2I5H A;  1O7I A;  1B2J A;  2JA9 A;  2XJS A;  1OWC A;  3GTJ H;  4LF5 L;  4LF4 L;  3JAM c;  4A93 G;  4Y52 H;  3GTG H;  1N32 L;  4DR1 Q;  2AMC B;  1A62 A;  2CQO A;  2JI3 A;  2UXB L;  2C35 B;  2Z6K A;  3KF6 A;  3T1H Q;  4DR4 Q;  1PH4 A;  1E22 A;  3GTP H;  1VQO A;  1C9O A;  1QVC A;  3HKS A;  2ES2 A;  1BQ9 A;  2A69 D;  2R7Z G;  1VQI A;  2YYZ A;  3HOV G;  3K0X A;  1VS0 A;  2JA7 H;  4JI4 Q;  3HOU H;  4LF7 L;  5EIO C;  4GLA C;  1NMF A;  3CW2 C;  3TQY A;  4DV2 Q;  4LFB Q;  2CWP A;  5GAD C;  3I4M H;  4LF6 L;  2R7F A;  3GDE A;  5JEA J;  5AI3 A;  4IFD I;  2A6E D;  1X3E A;  3CCJ A;  3QQC E;  2CWA A;  5IP7 G;  5C44 G;  1T9O A;  4DV7 Q;  1EFW A;  3IRB A;  4IPC A;  3PIO A;  1PH1 A;  1EWI A;  4X6A H;  3LNL A;  1ODH A;  1Z9F A;  4POF A;  4GKJ L;  1RYT A;  4QL5 A;  4DUZ Q;  3TS2 A;  4YY3 L;  1NNQ A;  2XJP A;  1SMX A;  1LM0 A;  4GOP C;  3PF5 A;  2M4Y A;  6RXN A;  2VQF L;  2Y0S G;  2UU9 Q;  2F52 A;  1JT8 A;  5AJ3 Q;  2O5J D;  5FLM G;  3HFZ B;  5C0X I;  2K75 A;  5C44 H;  2V3B B;  2XJT A;  3KYW A;  2K52 A;  3ERS X;  3D0F A;  1ASY A;  3NBH B;  2A6H D;  4GN5 A;  1QYB A;  4DV1 Q;  1Q86 C;  2A1A A;  4A76 A;  4JI2 L;  3S2D H;  1VZG A;  3HKZ E;  2IX0 A;  3F1Z A;  1EQR A;  1E3P A;  3PZA A;  2AWN A;  4AR3 A;  5IYB G;  3I7F A;  1YVC A;  2BA0 A;  5HGQ A;  5LMN Q;  2R7Z H;  1HNW Q;  1B2O A;  1CSP A;  4DV5 L;  2E5L L;  2OWO A;  1E24 A;  4A3B G;  1V9P A;  3HKZ G;  4HJA A;  1OWB A;  4G6B A;  1N34 L;  3GO5 A;  4TPU A;  4AI2 A;  1X65 A;  4EQ5 A;  3GTL H;  1VQL A;  1HNZ Q;  4DNI A;  5IWA L;  2ID0 A;  1HNW L;  4DR6 L;  1RWD A;  5FJ8 G;  4A3J H;  2F4V Q;  3NEN A;  2R93 G;  4JI3 L;  4BY1 H;  2PSM C;  2PQA A;  2K5N A;  5E7N A;  4LFC L;  3BZK A;  5K36 G;  1IW7 D;  3ULP A;  4UY8 C;  2ZM6 L;  4IPD A;  4QGU A;  4NXN L;  4GOP A;  3AQQ A;  2ZJP A;  4HIM A;  3CCM A;  5JVH 1;  1VQ5 A;  1I6H H;  1R0G A;  4C3I H;  5EIN C;  3PWF A;  4C3H H;  4JBK A;  3RLO A;  3UE1 A;  2V0E A;  2ZJR A;  1L1O C;  5C0X J;  2BA1 A;  1EQQ A;  3CCL A;  3J80 c;  4P71 A;  1I50 H;  4AHY A;  2IHF A;  3PCO B;  4LUO A;  5LMN L;  4DV3 L;  4A3C H;  1H7V A;  3PIO 1;  2JJQ A;  1VQE A;  2VS1 A;  1IL2 A;  4AI1 A;  1C7Y A;  2VW9 A;  4KHP Q;  1FHH A;  3AFQ A;  1VQB A;  3F2D A;  3G48 A;  4JI0 Q;  1SMU A;  3ZG6 A;  3KYH C;  1QZG A;  4ALP A;  3P2A A;  2B29 A;  2WP8 J;  3ZJY C;  1I3Q H;  1X9N A;  1OXS C;  2PMZ E;  4AQY Q;  3J7Z C;  3A0J A;  1XNR L;  4B3R L;  4QY7 A;  3FKI G;  3SGI A;  4DV0 L;  5GAG c;  5JEA G;  4PZ6 A;  1K83 H;  7RXN A;  1S24 A;  1RIP A;  1XMO L;  3PIP A;  1B8A A;  1PH8 A;  2K5H A;  1HNX L;  4LF4 Q;  4AR5 A;  3KF8 B;  4AQY L;  2JI2 A;  2CFM A;  2RHQ B;  1YIT A;  1IBL L;  4PMW A;  3CC7 A;  1S72 A;  4LFA L;  1NE3 A;  3HOW G;  1N32 Q;  1S30 A;  3KYX A;  4DR7 L;  1B71 A;  4DR4 L;  4DV6 L;  1CAA A;  3U4V A;  1VQF A;  2R92 H;  1PVO A;  4BY1 G;  4AI3 A;  3ULJ A;  2PVE A;  4A3E H;  5FJ8 H;  3S1M H;  3GTQ H;  1J5E L;  4IPH A;  4HJ8 A;  4JOI A;  1PH7 A;  1E1T A;  4LF7 Q;  2NVT H;  2M4V A;  2HHH L;  3I55 A;  3PGZ A;  3CCQ A;  1XPU A;  2R92 G;  2F4V L;  2QL0 A;  3E0E A;  3CXC A;  1IU5 A;  4UPA A;  3H0G H;  3AYH B;  2QEX A;  4DV6 Q;  3GTK H;  4IO9 A;  1MJE A;  4DV7 L;  5AI2 A;  1JE5 A;  3SS2 A;  4AI0 A;  1DGS A;  1Q1E A;  2JQO A;  3CQZ H;  4IJL A;  4DK6 C;  1N8R C;  4BBS G;  1TXY A;  2XTI A;  2CKA A;  1X3G A;  1B7Y B;  3OTO Q;  4MZ9 A;  1JJ2 A;  4XTC S;  1Y14 B;  3A44 A;  3JC6 2;  1N33 Q;  3S15 H;  4JI8 L;  4A75 A;  1EOV A;  1N9W A;  3J81 j;  3FP9 A;  4L5R C;  3PIP 1;  1U0L A;  1QCV A;  2OCE A;  1N36 L;  1VQJ A;  4WJ4 A;  4JI6 L;  3E9H A;  3PSI A;  2GMG A;  3PO3 G;  3M4Q A;  1R0H A;  4EX5 A;  1WOC A;  4JI2 Q;  4JCV E;  3S24 A;  2OTL A;  2R93 H;  4UY8 1;  3U50 C;  2E2H H;  3VPB E;  5ELO A;  1EUJ A;  3FKI H;  1IXR A;  4TVM A;  1UWV A;  4X64 L;  4DR2 L;  3PUZ A;  1GM5 A;  1QUQ B;  1WCM G;  1L1O B;  1G29 1;  4LUV A;  2E2I H;  4OXP A;  1N33 L;  3H3V I;  1YUZ A;  1YNX A;  4JC0 A;  3I4O A;  4QJF A;  1V43 A;  1YJN A;  1K9M C;  4LF9 L;  1VQC A;  3UDI A;  1MJC A;  1IZ6 A;  2WAQ G;  3BZC A;  3LGJ A;  2H12 A;  1KAW A;  1VZI A;  3Q8D A;  4P73 A;  1Q82 C;  1Q81 C;  3ER0 A;  5LMU Q;  2QGQ A;  4JI7 L;  4X66 L;  1WJJ A;  3ULL A;  4YY3 Q;  1HR0 L;  4A3C G;  2XJQ A;  4JI5 L;  1PA6 A;  2OQK A;  2JA7 G;  2WFW A;  2UU9 L;  2UUA Q;  2FXQ A;  3K7U C;  3OTO L;  3KOJ A;  1UEB A;  2A19 A;  4JAF A;  3PO2 G;  4NB3 A;  5GAH c;  1GKH A;  2JA8 G;  3JC6 3;  1M90 C;  4IPG A;  3J7Y 1;  1RDV A;  3KJO A;  4AR6 A;  5IT9 c;  3KJP A;  3RYG A;  1CKN A;  1T9H A;  2M6O A;  3DLL A;  4HJ7 A;  1J5E Q;  1BVS A;  5H1S E;  2HR5 A;  1HH2 P;  5ELN A;  4BXX G;  2KKD A;  3HOZ H;  4A3J G;  2D62 A;  2KN9 A;  4XIG S;  4DR2 Q;  2PNH A;  3RZO H;  3KLW A;  4GN4 B;  3HOZ G;  4JBM A;  4BXX H;  2CKZ B;  3AFP A;  1R0J A;  1IYJ B;  2V1C C;  4DK3 C;  1QZH A;  1VQP A;  3S1R H;  3FHW A;  2JA6 H;  3HOY G;  3S14 H;  1H95 A;  2GN5 A;  4A3M H;  4JV5 Q;  3JAM i;  4OX9 Q;  2JE6 I;  3PUV A;  1JMC A;  3PUY A;  5IYD G;  2C6B A;  3A5U A;  2PI2 A;  3CF5 A;  4DV2 L;  4HJ5 A;  2GVA A;  1Y1W H;  1YBY A;  2NVX H;  2A8V A;  2Z3Q B;  5IYB H;  2BH2 A;  4JBW A;  2GVB A;  4UP8 A;  5M3M G;  3MPS A;  1JJC B;  1Q8K A;  2MS3 A;  1VQD A;  4JI8 Q;  3UE0 A;  2UUA L;  3AEV A;  2L15 A;  4B3R Q;  3WWN B;  4JV5 L;  2H5X A;  3WWV A;  1OTC A;  3JC6 6;  2EQS A;  4BBR G;  1XMO Q;  4X62 L;  4IOA A;  4DUZ L;  1RYQ A;  4MTN A;  3BJU A;  3K35 A;  2ZTE A;  4IOC A;  2MQH A;  1KQS A;  5GAE c;  4AHX A;  1NY4 A;  4WJ3 M;  5LMN W;  1KL9 A;  4OWX B;  1LUZ A;  2AWO A;  1HR0 W;  4DR7 Q;  5AN9 H;  2HQL A;  3WWL A;  3STB C;  4PG3 A;  3PKJ A;  1PH6 A;  3T1Y Q;  2UUB L;  4JAE A;  4A3I H;  1TWC H;  5IP7 H;  1VQA A;  5LMU L;  4JAG A;  4JI7 Q;  3M7N A;  3PKI A;  3MXN B;  4LHL A;  5K2M E;  1YK4 A;  4DR5 Q;  5IP9 H;  1YIJ A;  3RLN A;  3I4M G;  1WJV A;  1CUK A;  1VZH A;  2F3I A;  1TWH H;  1IRO A;  4AHW A;  2LSS A;  3PV0 A;  4R1J A;  3UDF A;  2QA4 A;  4IFD J;  2E8G A;  3HOU G;  1Z47 A;  4BBS H;  1VQ6 A;  1I94 Q;  3HOV H;  2PQA B;  2Q2T A;  5MFP A;  1FHM A;  4BA1 I;  3RZD H;  2UXD Q;  3EN2 A;  1HNZ L;  2AYJ A;  4P75 A;  1A8V A;  1S40 A;  4DR6 Q;  1W2B A;  3CCS A;  5AJ3 L;  4XXB B;  4A4I A;  4A3F G;  2LXK A;  4IJH A;  4A93 H;  1VQ4 A;  2WB1 E;  4KLK A;  2VQE Q;  4OWT B;  1X56 A;  1TWF H;  1EIF A;  1PV4 A;  2YV5 A;  2J9U B;  5M3F G;  3L7Z C;  5MGN A;  2ZTC A;  5IYC G;  2IY5 B;  5GAG C;  1NJI C;  1AE2 A;  1OXT A;  4BY7 G;  2WB1 G;  1EYG A;  3BU2 A;  4PZ7 A;  4AIM A;  4DV5 Q;  2E5L Q;  1FJG L;  3HOW H;  1LKO A;  3GTM H;  2PI2 E;  2YTV A;  3F8T A;  5GQO A;  1IBM L;  4E6Y A;  1G6P A;  4R4T A;  2UXC Q;  1WI5 A;  4LHN A;  3U4Z A;  3J7Z 1;  2JEA I;  1X55 A;  1WYD A;  3KYU A;  4JI0 L;  4YWK A;  1X54 A;  2UXD L;  4B8C D;  2JEB I;  2UUC Q;  3M4P A;  2CCZ A;  1OXX K;  4YCW A;  4LF5 Q;  1R0F A;  2K4K A;  4JI3 Q;  1Y1V G;  2N78 A;  5DM6 1;  3PF4 A;  2CR8 A;  1G51 A;  1N36 Q;  3RR5 A;  3GTO H;  3HOX H;  3F2C A;  4DR3 L;  2OTJ A;  5JJK A;  3RZT A;  4UP9 A;  1KRS A;  4DV4 Q;  2VNU D;  3J81 c;  4OO1 I;  1RB9 A;  1MIU A;  4A3K H;  1E1O A;  2IT1 A;  2WAQ E;  4J15 A;  3CD6 A;  2LCQ A;  2ZTD A;  5C4X H;  2JA5 H;  1Q1B A;  4GS7 D;  1BRF A;  5MLC 3;  2PPT A;  2NZO A;  2B5I D;  4ZN1 B;  2KCM A;  3KDF A;  3OYY A;  3UDG A;  4JBJ A;  1YHQ A;  4JOI C;  2K2D A;  1GVP A;  2OQ0 A;  5GAH C;  1PH9 A;  3CCV A;  4BA2 I;  2KHJ A;  3CPF A;  1A63 A;  2B63 G;  2RF4 A;  4KHP L;  1DVB A;  4V19 6;  1T9P A;  1LKM A;  4OWW B;  2JI1 A;  1E7Z A;  4OX9 L;  4XGH A;  3DM3 A;  2ZM6 Q;  4X65 L;  4YHH L;  1E8J A;  2DUD A;  1XPR A;  2NVQ H;  2NVY H;  1B70 B;  1JB7 A;  2AHO B;  1PH5 A;  4JAD A;  3G4S A;  1L2F A;  1TWG H;  2VZA A;  3D31 A;  1SN8 A;  1K8G A;  1XNR Q;  4A3L H;  4LWC A;  4DR1 L;  3TEH B;  1YHA A;  1KIX A;  4HIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...