4POGA

Mcm-ssdna co-crystal structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication, dna binding protein/dna
total genus 57
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pogA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pogA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pogA01
1UEBA 1GD7A 1Q46A 2WB1E 1L1OA 4DV6L 2JA8G 2MO0A 4KHPL 2QL0A 2PI2E 1N34L 4JV5Q 1PVOA 4GLAC 3U4VA 4ME3A 4AYBG 2CKZB 4GOPA 3CD6A 1YEZA 1JYBA 3SS2A 1T9OA 1XNQL 4OX9L 1YUXA 2EIFA 3CC2A 3CCLA 4A3IH 2MO1A 2OQ0A 1T9PA 1N9WA 1Y1WH 2IX1A 3OTOQ 3HOWG 4NXML 4A93H 1I50H 1HNZQ 1S40A 1C0AA 1VQEA 1HZ9A 4YCUA 5JJKA 1R0JA 3CMEA 4DUYQ 2MFIA 4H02A 4JOIA 4DK6C 3F2BA 2E2HH 1NMFA 3HKZE 4ALPA 2OCEA 3AYHB 4MNOA 2Y0SG 4R4QA 3S1RH 1TWCH 1J6QA 2NN6G 5FLMG 3G6EA 1K0RA 2WP8J 2QA4A 1EYGA 2R92G 1X3FA 5IYDH 1G6PA 1E8JA 3UDIA 4A4IA 4K0KQ 1PH4A 3M85A 2CFMA 3W1BA 1U0LA 4LF8Q 2KHJA 1EOVA 1VCXA 3GTKH 4JI7Q 4L5SA 4PZ7A 2UXDL 1VQDA 1SROA 1XPOA 3I4MH 1JJ2A 3GDEA 4QIWE 1PH7A 1VQCA 3D0FA 1HR0Q 5IYCG 4TVAB 1YZ6A 4HIOA 1Q1EA 3CPFA 3M4PA 4DR3Q 1VQ4A 2Q2HA 4AYBE 2UUBL 1JT8A 4R4IA 3UDXA 2ZM6L 4C3HH 2RCNA 4JI4Q 3PSIA 1PV4A 1YK4A 3D31A 1G291 3RR5A 4BY1G 4AQYL 2I5MX 3CCUA 1VQJA 1Q81C 4LF9Q 4DR6L 2PQAA 2PYAA 1KAWA 5GAEC 1XMQL 1H7VA 1KC8C 2RHQB 4JBWA 2HHHL 1PH6A 4HJ8A 2PVEA 1KHIA 1VQBA 2NN6I 2YTXA 2JA5G 1CUKA 2VNUD 1OXUA 5LMNQ 1FVIA 3WWVA 3RN2A 2B3GA 4JI5Q 3I7FA 4JV5L 5LMNW 1B7YB 2JA9A 2YTYA 4A3KG 4DR1Q 4BXXH 3PUZA 1RYTA 1DGSA 2N8NA 4J15A 5GAGC 2R93G 4NPSA 1C09A 3OW2A 3AFQA 4C2MH 1IL2A 1LKPA 4DNIA 2K2DA 2KKDA 2DUDA 4JCVE 1FL0A 4NB3A 1V43A 1Q1BA 4MTNA 5H1SE 4DV5Q 1SFOH 2RHSB 5J3BA 1UWVA 5C44G 4JOIC 3PIOA 3OTOL 3RNUA 1KQSA 1HNZL 4IPCA 4C3IH 3T1HQ 2K5NA 4OWXB 1PFSA 2MS3A 2MQHA 1ZRPA 1GVPA 2R6GA 3H0GH 3W1GA 3J80c 1X9NA 2VUMH 4A3BH 3PUVA 2JA6G 1LM0A 2KBNA 3CCQA 2PNHA 1VQOA 3EBEA 3KLWA 1RL2A 4K0KL 3F2DA 1OXXK 1UE7A 3AFPA 1I94Q 2L15A 1IBMQ 4LF8L 3MEFA 1NE3A 1A0IA 4JI7L 5GADC 2HIVA 4LF6Q 1QCVA 1VQIA 3H15A 3DLLA 3HOUG 4QQBX 1EFWA 1K8AC 1T9HA 3S1NH 4OWTB 3NENA 1HR0L 3CQZH 4DR3L 2GVBA 3PUWA 4IOCA 1PYSB 4LF7Q 1TWAH 4A3JG 4LUOA 1EUJA 1IU5A 4JYAQ 4K9FA 6RXNA 4DV7L 1HNWQ 2E5LL 4JI4L 3ULPA 2D0OA 2JE6I 2JEBI 2KCMA 1NTGA 1UE6A 4R4TA 3H3VH 1IYJB 4RG1A 3F1ZA 2WAQE 4LF9L 5IT9c 1R0HA 1B8AA 2K5HA 4DV4L 3I4NH 1YHBA 2KN9A 4O2DA 4DPGA 4GOPB 3I2ZA 1MKHA 3AEVA 4BBSG 4A3CH 4IJLA 3L2PA 4A3DG 3J81c 3DM3A 3J80i 4B3RQ 3CW2C 2DSXA 4UP8A 2JK8A 2MNAA 5M3MG 5LMNL 1H95A 3MPSA 4HJ7A 2B63H 1QYBA 1B70B 4JI5L 1A63A 1GO3E 3PUXA 1FGUA 4DR1L 5M3FG 1M1KC 4MZ9A 4RMFA 2OQKA 2IT1A 2R7FA 3HKSA 1AE3A 2ZTCA 3M4OH 4JI2Q 2JA8H 1LKOA 3CCJA 4DV5L 5IP9H 3KF6B 1QVGA 3G48A 2ZTEA 2KCTA 2PI2A 3CMAA 4A3MH 4PZ6A 4X64Q 3T1HL 1IU6A 1EQRA 5M5WH 2CWPA 2UU9Q 4JI6Q 3PIPA 1IROA 4DKAC 4PMWA 1B2OA 5FJ8G 3CCSA 2I0QA 1FJGQ 4AR5A 4TPUA 1WI5A 4A3FG 3HOWH 4HJAA 2RDVA 4JI0Q 3U50C 3J7ZC 4YY3Q 2R7ZG 3VDYA 3ULJA 1VQ7A 5DLQE 3T1YQ 3HOXG 3STBC 1WFQA 3BJUA 4X6AH 4B3MQ 1I94L 2HQLA 1IBML 1Y14B 1Q86C 2VL6A 2K4KA 1YJWA 4IPHA 3GTLH 4QL5A 3MXNB 1OXTA 4UP9A 4LF6L 2JEAI 3J81i 4PG3A 5ELNA 3PZAA 4QJFA 3RZOH 1CKNB 1CSQA 1S2ZA 3KYVA 1JJCB 2PQAB 1VQ5A 2AWOA 1XNRQ 4OO1I 3UE1A 5C4XG 1CAAA 3G4SA 1K73C 2ZTDA 4AR3A 4LUZA 3GTJH 1ASYA 4JYAL 1HNWL 1Y1VG 5JJIA 1BRFA 1K3RA 1MIUA 1FHMA 1OXSC 2V1CC 3TREA 2NZHA 2OTJA 1X55A 3FHWA 5JEAG 1SMXA 5M5XH 3TQYA 4B3TQ 3RYGA 3KF6A 4BA2I 3JC63 2H5XA 4O0AA 2WFWA 1IBLQ 4JBJA 1LKMA 1C9OA 1JE5A 1RDVA 3KYWA 1V9PA 1IRNA 2JQOA 4BY1H 4B3RL 1BBUA 5IYBG 1Q7YC 3TS2A 4DV3Q 1XTDA 4GKJQ 2LXJA 5ELOA 4BBRG 1LTLA 3JC66 5IY0A 1PH5A 1R0GA 1PH1A 2ZJQA 1BQ9A 1TWGH 1YNXA 4JI2L 3Q8DA 5FLXc 4YWLA 5AJ3Q 4A3EG 4YHHQ 3UE0A 4A3KH 1Q8KA 3K7UC 4YWKA 1J5EQ 1N32Q 3EIVA 2LCQA 3L7ZC 2NVXH 1CKNA 1V1QA 2R93H 1BQ8A 3BU2A 3PV0A 4A3IG 1D8LA 3FKIG 4QY7A 2UU9L 4JI6L 1R0FA 4Y7NH 3CF5A 1Y1WG 1EIYB 1FJGL 2IY5B 4P73A 1E7ZA 1L1OC 3ZJYC 3ER0A 1Z9FA 5IE8A 4DV0Q 5C3EG 1DX8A 4JI0L 4GLXA 4YY3L 4JI1Q 4DR5Q 3ERSX 2RF4A 2K50A 3T1YL 4GOPC 2LXKA 3HOVG 4B3ML 2UUCQ 2JJQA 1LUZA 1EIFA 1CSPA 2Z0SA 3I4OA 1L0WA 4DAMA 1IBKQ 4B3SQ 1TXYA 4DR7Q 1UE1A 2UXBL 1AH9A 5EAYA 4A3GH 2BA1A 4A3LH 3S16H 5JEAJ 1XNRL 2WAQG 4TQUS 4X65Q 2Q2UA 2B29A 1FHHA 4UY8C 1K8GA 1KRTA 4DR2Q 2HT1A 3S15H 4BY7H 3KDFA 1HNXQ 1MJCA 4LF5Q 2F3IA 4DUYL 3I4MG 3HOUH 1KL9A 2FXQA 2KENA 3AQQA 3K0XA 1VQNA 1Z47A 2EXDA 4EX5A 4L5QA 3KF8B 4UP7A 4R4OA 4DUZQ 1XMOQ 4IO9A 1PH2A 1DVBA 4DV2Q 3CCVA 1QZHA 5E7NA 3RLFA 2NVQH 3GTOH 4GN4B 5HGQA 1YVCA 2BA0A 1QUQA 2EQSA 2Z6KA 4R4CA 1R9TH 2QEXA 1NJIC 1KIXA 1K9MC 4LF4Q 1BBWA 4DV3L 4GKJL 1I3QH 2N78A 4XIGS 4X66Q 3S1QH 2F4VQ 1PA6A 1SMMA 3BZKA 3L0OA 1XPUA 3GTGH 5M3MH 3HOZG 4RXNA 3S17H 2VZAA 3PF4A 5IP7G 5AJ3L 1VQMA 4YHHL 1PH3A 1J5EL 3GTPH 5M3FH 4DR4Q 2UXBQ 2PMZE 3A44A 3K81C 3RZ6A 1YITA 2NVYH 2AMCB 3I55A 1VQLA 1NBWA 4JC0A 2JA7H 1S72A 4LFBQ 2E8GA 3JAMc 1WCMG 2ATWA 4X62Q 3RZDH 4OXPA 2A19A 2VQFQ 1YJ9A 3A0JA 1A62A 4DV0L 3GTMH 1RIPA 4AR6A 4JI1L 4DR5L 5JJLA 1NMGA 3H0GG 4HJ9A 2VUMG 4POFA 4IPDA 2UUCL 1NY4A 3F2CA 1GKHA 2V3BB 1P8LA 1BE7A 1JB7A 2YU9H 2UXCQ 3PUYA 4DR7L 2ZJRA 1IBKL 4B3SL 4GKKQ 3RLNA 5GQOA 3QVDA 4KHZA 3RLOA 2NVTH 2R7ZH 2UUAQ 3PGZA 1HZBA 2IX0A 3HOXH 4X65L 2VW9A 3G71A 1SN8A 3KJOA 4LFCQ 1P16A 4DR2L 4OONA 3PO3G 5C0XG 1Q82C 1KRSA 4EQ5A 3KOJA 1HNXL 4LF5L 2GVAA 2KHIA 3M3YH 1D7QA 1VQ8A 1OXVA 1YUZA 2N49A 1E1OA 2QGQA 1RWDA 1IZ6A 1QVCA 2CQOA 1X56A 4HIKA 1C7YA 1ASZA 3PO2G 4DUZL 1A8VA 3PF5A 1S24A 1Y1VH 4DV2L 2K14A 1K83H 5K36G 4PZ8A 2YTVA 4DV1Q 4AIMA 3A5UA 1RDGA 1VQPA 3KFUA 4LF4L 4XTCS 5FLMH 3JAMi 1M90C 2R92H 4A3CG 3W5OA 1YHAA 2AWNA 3UDFA 1VQFA 4X66L 4P71A 2F4VL 1YBYA 3CCEA 5BR8Q 5GAHC 5HY6A 4LF7L 3HFZB 3KJPA 3CCRA 4GNXB 1N36Q 4A76A 3BZCA 4IFDG 3HOYG 1YV1A 2M4YA 4DR4L 5C0XI 5IYCH 3S2DH 1IXRA 1YHQA 2IHEA 1MJEA 4WJ4A 1G51A 1WOCA 5IP9G 4QGUA 1WJJA 1X65A 5IWAQ 1PHJA 2C35B 1S3OA 1PH8A 4LFBL 4A3EH 4X62L 2VQFL 4A3MG 3NBHB 1EQQA 1AE2A 1QZGA 2BH2A 1O7IA 4WJ3M 2Q2TA 3H3VI 3FKIH 3TEHB 3ULLA 1HH2P 5C0XJ 3KDFB 3CP0A 1EWIA 2CCZA 2UXCL 1RB9A 4A75A 4JI3Q 2R7DA 2AHOB 4FDBA 4IPGA 5C3EH 3E9IA 2VQEQ 2JA5H 3S1MH 4GKKL 2UUAL 2F52A 3U58A 2BH8A 4LFCL 1BVSA 1N33Q 3HOVH 4KI0A 4UPAA 1GM5A 3JC62 3CC4A 4IFDI 4X64L 1CKOA 2GN5A 5LMUQ 3TRZA 1QUQB 4P72A 4A93G 1X6OA 4GNXA 2AKWB 3NELA 1U5KA 5C44H 1YI2A 1VS0A 3M9BA 1XJVA 4LW1A 4IJHA 4BA1I 3F8TA 4DV1L 1SMWA 7RXNA 2YV5A 2I5LX 4GN3B 3I56A 1OTCA 2LSSA 4IFDJ 1HZAA 1HR0W 4HIMA 2JA6H 3CC7A 1VQGA 1QVFA 5IYDG 1B71A 4DV7Q 3PCOB 2DGYA 3IRBA 1S30A 2CWAA 2E5LQ 4HIDA 3K8AA 3RZTA 5BR8L 1R0IA 2D62A 2I5HA 5RXNA 4DV4Q 1N36L 1YK5A 4L5RC 4P74A 2PVXA 1E22A 3E0EA 1HJPA 2E2IH 2IHFA 3TS0A 2Y0SE 8RXNA 3E9HA 1X54A 4IOAA 4P75A 4A3JH 2OTLA 1LYLA 1SE8A 1VQHA 4DAYB 1E3PA 2K5VA 4B3TL 5IWAL 1HZCA 2NZOA 3HOZH 3OYYA 4JI8Q 4HJ5A 5IP7H 1IBLL 1Q12A 1I5FA 1VQ6A 3CXCA 3CPWA 3K7AH 4LFAQ 1X3GA 4YCVA 3B6YA 1YJNA 3ICEA 1B2JA 1XPRA 4NXNQ 3A74A 3GD7A 4BBSH 1UE5A 1WCMH 4A3DH 4JI3L 4POGA 4DK3C 1X3EA 2HIXA 1WYDA 2VQEL 3KYUA 2D0PA 3PWFA 1CADA 2A1AA 3J81j 4BXXG 2GMGA 1N33L 1KXLA 1N32L 3U4ZA 4DV6Q 4A3GG 4A3LG 1SR3A 5LMUL 1TWFH 4GNXC 4KHPQ 1PYBA 4C3JH 1N34Q 1VQ9A 4GS3A 4KLKA 1CKMA 4JG2A 4BY7G 1VQKA 3M4QA 3S2HH 2OWOA 3LGJA 3PO3H 1E1TA 2VS1A 3CAMA 4JBKA 4OX9Q 1XNQQ 4A3BG 4Y52H 2XGTA 1JMCA 1KD1C 5FJ8H 4GN5A 4NXMQ 5M5YH 3EN2A 4A3FH 2XTIA 2ES2A 1BKBA 2YYZA 3PO2H 2ID0A 3A5ZB 3STBD 3J7A5 1L1OB 3M7NA 2WB1G 1T9QA 1SLJA 5AI3A 1W3SA 4OWWB 1E24A 3GO5A 1VQAA 5GROA 4LUVA 3UDGA 1SMUA 2ALYB 2Q2IA 2A8VA 2VY3A 1YIJA 2HR5A 1B13A 4YWMA 3FP9A 5C4XH 1JJGA 1W2BA 3KYXA 2ASBA 3GTQH 2UXDQ 4LWCA 1XMOL 4LNQA 1L2FA 3NEMA 2Z6KC 4JI8L 3KYHC 4R1JA 3HOYH 5AI2A 5C4JH 3K80C 2N3SA 2UUBQ 1PH9A 3I4NG 3S14H 4GLVB 2E2JH 4LFAL 4L5TA 3HKZG 1I6HH 2ZM6Q 2JA7G 4NXNL 2K75A 3S24A 4APVA 3CCMA 4JBMA 1BFYA 4YCWA 4OO1G 2ZJPA 4AR4A 4AQYQ 1N8RC 1NNQA 4DR6Q 2K52A 4AH6A 2B63G 1SRUA 1XMQQ 1TWHH 1VCIA 5IYBH 3KYYA 2HHHQ 3SGIA 3RN5A 4BBRH
chains in the Genus database with same CATH superfamily
4KN4C 5EKKA 2J0TD 1CFMA 1N34L 4JV5Q 2B2WA 3U4VA 2HUGA 4GOPA 3CD6A 4OX9L 2EIFA 3BVGA 3D4RA 4ULLA 2LS01 1I3QL 4O42A 1JWMD 4NXML 2SDFA 1VQEA 1QE6A 4YCUA 1NCVA 3CMEA 3GTGL 4JOIA 4OO1I 2E2HH 1NMFA 5CMDA 2OCEA 1CA6A 2Y0SG 5D3IB 3S1RH 1PZXA 2NN6G 4FXDA 2WP8J 1PRTC 4V190 1G6PA 1E8JA 1U4LA 2JA7L 2M2LA 3M85A 2CFMA 1SMYD 1EOVA 2B2YA 3GTKB 1F9SA 5C3WA 4L5SA 3A8KE 4RCOA 1VQDA 1JJ2A 3GDEA 4TVAB 2UUBL 3CPFA 1VQ4A 4AYBE 3V05A 3UDXA 4B08A 5TSSA 1AEXA 1PV4A 1YK4A 1BCPD 1G291 4AQYL 4XXBB 2JI3A 4DR6L 1CI3M 2MJ8A 2FFKB 1XMQL 1EY4A 1KDBA 2RHQB 1KC8C 1DYQA 2IWHA 1PH6A 4HJ8A 4P2CB 1KHIA 1VQBA 2NN6I 2VNUD 2K32A 4EGVA 5LMNQ 4JV5L 3I7FA 5LMNW 1K83L 4BXXH 2C6AA 4IQZA 2ERSA 2R93G 3K5LA 1C09A 3AFQA 1LKPA 4DNIA 4DV5Q 4MTNA 1PH8A 3IAYA 5C44G 1KQSA 5FO9B 2K1BA 3TP8A 3GTJL 3T1HQ 4C3IB 2K5NA 4OWXB 2Z3QB 1ZRPA 2A69D 1LT5D 1X9NA 5FLXE 5DM71 1LM0A 3CCQA 3R2IA 4ZAIA 1RL2A 2EE1A 1SYGA 1OXXK 1I94Q 2WV6D 3LWUA 1NE3A 2EOTA 1A0IA 3QR8A 2CW0C 2F0DA 3H15A 2XSCA 4KD3A 1I3QB 4CDCC 1T9HA 3MHBA 3S1NH 3NENA 2A74C 4IOCA 4F8MA 4LF7Q 2F4IA 1W6KA 2PZTA 1EUJA 3K35A 1OWCA 2JA5L 3GTGB 3NTHA 5IGDA 1W6JA 3ULPA 2JEBI 1S4ZA 1NTGA 3NTKA 3F1ZA 2WAQE 4O2DA 4DPGA 4GOPB 4X3UA 1ZEQX 2L12A 2Z6BA 3KLSX 4NP5A 3T56B 4BBSG 3AEVA 2JA7B 4IJLA 3L2PA 4K8IA 3KK7A 5NUCA 2DSXA 2MNAA 5M3MG 5LMNL 4XXEA 4HJ7A 1QYBA 1B70B 3PUXA 1KLGD 5M3FG 1E0BA 2OQKA 1XWEA 2IT1A 2R7FA 2RBMA 1K8OA 2ZTCA 3C1EA 1IHZA 3D6WA 3CCJA 4V0BA 4DV5L 3G48A 4UHVA 3C3LA 4A3MH 3T1HL 3A7AB 4RHRA 3H9CA 1FJGQ 3GQBA 4TPUA 3HOWH 4HJAA 4A3JL 3T1YQ 1K83B 1H9KA 1I94L 3B0AB 2K4KA 3JAME 5CV7A 4UP9A 5EINC 3J81i 3DUZA 4PG3A 3PZAA 1MSHA 4XDXA 1CSQA 4JK1C 3S1QL 3DEPA 3Q6SA 2IPKD 5C4XG 3LWVB 3GTJB 5JJIA 4LHLA 1MIUA 1OXSC 2B8FA 2NZHA 1X55A 4XQJA 3PKJA 5MLC3 2NYDA 3A8JE 3DWQA 4BA2I 2AQ3B 1PTOH 2WFWA 1IBLQ 4WJWA 5C5MA 1STYA 4LMQD 1D5ZC 2JQOA 3SK8A 5H1Sc 2SNMA 3TS2A 4GKJQ 2KEDA 2B2VC 1HA5A 2YU9L 1H9SA 1BQ9A 1TWGH 2NVTL 3R8BA 4A3EG 3HOXL 4A3KH 1Q8KA 3K7UC 2QDLA 4YWKA 1N32Q 1EY0A 2XJVA 1UAPA 2NVXB 1HRJA 1V1QA 5EGTA 3BU2A 3PV0A 3O13A 3FKIG 4OIKA 1EU3A 1Y1WG 1EIYB 5KYLA 1FJGL 4E6YA 3ZG6A 3H3VC 4JI1Q 2K50A 2MPMA 4GOPC 3T1YL 1Y1VL 2LXKA 3NQTA 5JPNC 4DAMA 3BVMA 1SJHD 1TXYA 3X3NA 3NSWA 4A3GH 4A3LH 1QQTA 4UY8C 3S15B 2BDOA 4DR2Q 3I4LA 1I4QA 1GHJA 4LF5Q 2F3IA 4DUYL 2FXQA 4EQPA 4EX5A 1STBA 4DGZA 1ONLA 3AMUA 1LTAD 5D65A 3R2TA 4R4OA 4A3JB 1DVBA 2B2YC 3NP8A 3CCVA 3C1FA 5E7NA 2F0SA 4DV2Q 3DWAA 4GKJL 1NR2A 2HDLA 3DWPA 4X66Q 1PZJD 2RDFA 1H9MA 3E5SA 1PA6A 1GUSA 3S1QB 2ZXPA 3MA2B 4B8CD 4FF1A 2VZAA 3PF4A 5IP7G 1VQMA 2DNEA 3S1RL 3K81C 2O5IC 2AMCB 2ZIXA 4LFBQ 3GTOH 4OXPA 2VQFQ 1YJ9A 1A62A 5JJLA 5C44L 4JI1L 1ZYRC 1NMGA 3H0GG 4E6IA 3PIO1 1EIGA 1C4QA 2YU9B 2K5DA 1DM0B 1D5XC 3U9SA 4GKKQ 2F0KA 3RLNA 3QVDA 1LTBD 2Z4HA 2R7ZH 2NVTB 3TN2A 3HOXB 3G71A 1L0YB 1HUMA 4DR2L 3PO3G 1KRSA 3KOJA 4LF5L 2RFKB 3J7Z1 1YUZA 2QGQA 1QVCA 4O1NA 3PO2G 5ELEA 1B2TA 1S24A 1H9SB 4DV2L 1Y1VB 2K14A 5C6AA 4DV1Q 4G4KA 1RDGA 1VQPA 3KFUA 4XTCS 3MWYW 1M90C 5GAGc 3UDFA 4X66L 3J7Y1 1YBYA 4BBSL 5GAHC 2EY1A 5EQ0A 3HFZB 1MSGA 4ZK9B 1TS3A 4HCSA 1GJXA 1WTPA 2XJPA 3S2DH 1YHQA 1KAAA 1ICWA 4U68A 3SEBA 1MJEA 3LWQB 5IP9G 4QGUA 1WJJA 5IWAQ 1PHJA 4LFBL 2DJGC 3E0JA 3DMUA 2VQFL 1AE2A 2MHVA 1O7IA 4UAIA 3IL8A 4BS9A 1BDOA 2Q2TA 2ICEC 1HH2P 5C0XJ 1E2WA 2M6PA 2OT2A 4RKLA 1EWIA 1RB9A 4K2KA 4JI3Q 2AHOB 4GKKL 3E9IA 3S1MH 2L11A 2D9UA 4G7HC 2M00A 4N9PA 3HOVH 1H9RA 4KI0A 4UPAA 1DONA 3JC62 4DK0A 4KY5A 5K5PA 5DM63 3TRZA 4P72A 4R9WA 4G57A 4GNXA 5IGGA 4U671 1STNA 4YIJA 3M9BA 4RGTA 5C44B 2F0QA 3ERQA 1F2ZA 2ICIA 4DV1L 1MD2D 4IFDJ 1HZAA 5C4JL 4HIMA 2JA6H 1L0XB 2EY2A 1P7PA 5FO8B 2DGYA 2E5LQ 1ILQA 3K8AA 3J7AV 2D62A 2ZXRA 3D4WA 3R3OA 4HAEA 3QQCE 4L5RC 1TWHL 4FYDA 2AQ2B 4DN4M 1BR9A 1HJPA 2PMZP 2IHFA 3TS0A 2Y0SE 3E9HA 4IOAA 1X54A 1FYCA 5JVH1 1VQHA 2A6HC 1E3PA 2K5VA 5IWAL 1A2UA 1LTSD 3OYYA 4HJ5A 3RD4A 3CXCA 3NWSA 3B6YA 3MSUA 3P2AA 2VB2X 2KA7A 3TBIB 2BCOA 2EDGA 2XIWA 2A68D 1EFID 4K8JA 1DJRD 4A93L 1IYUA 2LMCB 2XJSA 4BBSB 2RDGA 4A3DH 4JI3L 1KTKA 1WYDA 2F0UA 3N52A 1PYWD 3H09A 4ZUJA 4L63B 5IYDL 4X3TA 4C3JH 1LV9A 1CKMA 3M4QA 3S2HH 1O78A 1LT4D 1SAPA 1E1TA 2VS1A 3CAMA 4JBKA 2PW5A 4KKSA 1O80A 2F0GA 3VA7A 3EN2A 3VR6A 4WORA 1TWGL 5EKLA 2X6LA 2ID0A 3A5ZB 3STBD 2BE5C 3LNLA 4IUUA 1E24A 5T1IA 3FDTA 1RODA 2Q2IA 3LWOB 2WB1P 4V196 2Z9HA 4YWMA 1Y8PB 5E4WC 2HVYC 3PIO3 3GTQH 2UXDQ 4K14A 1B50A 3K80C 2N3SA 4NMZA 5C4JB 3S14H 4JPBW 1CHQD 1LTGD 2JA7G 2O4XA 4A3LL 4APVA 3CCMA 1BFYA 4YCWA 1FR3A 1G2TA 3L3OC 2K52A 4AH6A 3HKZP 1TWHB 3H0GL 2HHHQ 4BBRH 1UEBA 1GD7A 2WB1E 1X32A 5HGTA 1L1OA 5IT9E 2EVBA 2MO0A 2F0HA 4ME3A 2CKZB 4JVZA 2F3VA 1JYBA 3SS2A 4WRDA 1K28A 4RHSA 3J81E 1MI2A 1T9OA 1YUXA 2FMMA 4A3IH 1T9PA 1GXDC 5GADc 1N9WA 4A93B 3C2PA 1S40A 2QEJC 2AQ1B 4H02A 4DK6C 4R8IA 3PMFA 3HKZE 3QOLA 4ALPA 4LHNA 4CKBA 4R4QA 2K28A 1TWCH 3G6EA 5IGCA 4A4IA 1PH4A 3OPOA 3W1BA 1U0LA 4LF8Q 4AI0A 3GTOL 1STHA 2UXDL 2B63L 5I4DA 1V1OA 3ONAB 1PH7A 4QIWE 1J9OA 1VQCA 1PDQA 1Q1EA 2Q2HA 4KD4A 5COYA 2K03A 3MFYA 1TWGB 1NXEA 3DM1A 2PZWA 2C6BA 2JA8L 4JI4Q 1JICA 1WTOA 3MXNA 3RR5A 3D31A 1QOHA 3CCUA 3D8GA 2PQAA 5GAEC 1H7VA 3EROA 2QCPX 3VYRA 4U673 2HHHL 2PVEA 3HS0C 2JA5G 1A3TA 1SYBA 1OXUA 1FVIA 3WWVA 4KKTA 4JI5Q 3AB9A 2JA9A 1XYIA 4X6AL 4DR1Q 4J15A 2N8NA 2F1MA 4C2MH 4JAGA 2KKDA 2DUDA 4JCVE 3TMEA 1G91A 1SMYC 2ENBA 2F0TA 3WDNA 4CDDC 1IKLA 2R6GA 1GVPA 4A3BH 3WWNB 2VUMH 3H0GB 3PUVA 5JVH3 2EYMA 2KBNA 4RGNA 1VQOA 1CHPD 1SBBB 3H97A 2B39A 3EBEA 3KLWA 5FK9C 2HD3A 2L15A 4LF8L 1DCZA 4G7OC 1QNUA 4BY1L 5GADC 2E76C 2H4OA 1MBYA 4L6TB 3S9WA 1J8IA 5K2ME 3CQZH 4TSSA 1TWAH 2A5HA 2DJFC 4LUOA 4A3JG 1IU5A 1QG7A 3S1ML 6RXNA 1HNWQ 4JI4L 1F9QA 2D0OA 2KCMA 4TRDA 4R4TA 4RG1A 1R0HA 2K5HA 3I4NH 4DV4L 1YNJD 1YHBA 3HRZC 1DOKA 2CHBD 3FPPA 4J8QA 1MKHA 4CHTB 4OO1H 2JN4A 1T5XD 2RSNA 1JCKB 2D2CC 2F0LA 3TZDA 3GTOB 3J80i 4B3RQ 3CW2C 2JK8A 1STEA 1PXUA 2B63B 4JI5L 2A69C 4IFDH 1IYVA 4DR1L 2CKCA 3MVVA 4MZ9A 1LABA 2JA6L 3M4OH 1QJOA 5E4XA 2JA8B 2LY7A 3S16L 3KF6B 2PI2A 4AYBB 4PZ6A 3GTMH 1HXYD 1HQMC 3HOUL 5FJ8G 1ILPA 1B2OA 1WI5A 3J7ZC 4YY3Q 3OSOA 3ULJA 3HOXG 3BJUA 2AUJD 4HMIA 1VZIA 2VL6A 3DEOA 3L9AX 5MFZA 4IPHA 4OIJA 3GTLH 1R9TL 1JWUD 2NN6H 3MXNB 2C9OA 4XQNA 3RZOH 1S2ZA 2PQAB 4K5XA 3CKIB 3UE1A 4AYBP 4A3DL 1Z6HA 2ZTDA 4LUZA 3SR1A 4K5VA 1HNWL 1Y1VG 1BRFA 1FHMA 4NW2A 1SSOA 3WOFA 2OTJA 3FRPB 5JEAG 5M5XH 1Y69U 4B3TQ 4RGOS 2NVYL 2AUSB 1LKMA 1JE5A 1RDVA 1AZPA 1CM9A 1V9PA 3RZDL 3S2HL 4M1UB 4BY1B 4B3RL 1TS5A 2WKDA 1Q7YC 4DV3Q 2VXWA 1XTDA 2LXJA 5F2DA 5ELOA 2EY6A 4KK7A 3S1MB 3OMCA 1YNXA 3Q8DA 1IW7D 5FLXc 2VB3X 4DK1A 2B2TA 3L7ZC 4PNYA 4CBVA 1O7YA 1B4OA 2R93H 3TP5A 3VR2A 2P5ZX 1R0FA 4Y7NH 4P73A 3ZJYC 1L1OC 3CHBD 3ER0A 2RCFA 3H91A 4YY3L 3ERSX 2H1EA 3M4YA 4WFN3 1LUZA 1EIFA 2JA6B 1IBKQ 2AYJA 1UE1A 4LAAA 3OW7A 5EAYA 3S16B 2HT1A 1B9MA 1KRTA 4BY7H 1EY7A 1A15A 1U4RA 1HNXQ 1AZQA 3HOUB 2KENA 1VQNA 2WAQP 4PMBA 1PTOD 1Z47A 4BBRL 2F0NA 5BN4A 4L5QA 4KN7C 1NXGA 4S3SA 3VR3A 4UP7A 4DUZQ 2TSSA 4IO9A 3TSSA 2NVQH 3RLFA 1BO0A 5HGQA 4FO2A 1YVCA 1R9TB 1K9MC 1TY2A 3X3MA 4DV3L 1SNDA 4A3IL 2F4VQ 1EIHA 3BS1A 4A3DB 1GUNA 3F2UA 3L0OA 1XPUA 5C3EL 5M3MH 4F7XA 2KCNA 3GTPH 2NTSA 5ELBA 5M3FH 1SNOA 3A44A 3RZ6A 2NVYB 1Z92B 1K0SA 4B9XA 5EPJA 3JAMc 4X62Q 2A19A 3RZDB 3S2HB 4CGYB 4XQQA 4HJ9A 4CDFC 3NUCA 2O5JC 4POFA 4IPDA 5IGFA 1NY4A 1PFNA 3D4DA 1P8LA 1BE7A 3NE5B 4DAYA 1JB7A 1EWCA 2ZJRA 1IBKL 1SE4A 3RLOA 3QWNA 4KHZA 4HCEA 3Q0AA 2VW9A 1KNAA 1EOTA 4OONA 1RHPA 3SE0A 1HNXL 3M3YH 5CR3A 1I4HA 2XNAC 1OXVA 5JOBA 2CQOA 2M9VA 4HIKA 5MFPA 1C7YA 4JW0A 4DUZL 3PF5A 1GUGA 5K36G 3HOZL 5A2QE 2YTVA 4Q5VA 1PRTD 5FLMH 4CJ0B 2R92H 1YHAA 2AWNA 1KLUD 1VQFA 4P71A 2F4VL 1Q90A 4ME5A 1WCML 4LF7L 4G6BA 1GUWA 3BZCA 2K7VA 2VUML 3MFGA 1TS4A 4BBRB 5IYCH 3VYUA 1VF5C 2M6OA 3V96A 1TWFL 4ZCKA 1S3OA 1XXGA 3MAQA 5DM61 4A3EH 4X62L 2OF1A 4A3MG 3NBHB 2BH2A 4WJ3M 4Y52L 4KHVA 4A3IB 3FKIH 3CP0A 5IOCA 5FJ8L 3WOEA 5M5YL 3HGBA 4A75A 2NBFA 2G9HD 1B1ZA 2VQEQ 5C3EB 2JA5B 3U58A 1N33Q 5G3LD 2F0IA 1I4XA 3FVQA 1D1IA 5CV6A 3CC4A 5FOBB 1CKOA 3HG9A 4A93G 2F0FA 3HJYB 2PPTA 4IUVA 1U5KA 1VS0A 4IJHA 4CKEA 3HOYL 1JC7A 1HQRD 3R93A 1HR0W 1TU2B 1VQGA 3CC7A 5IYDG 2PZUA 4DV7Q 3PCOB 1S30A 2RKSA 3H6MA 2A73B 3H94A 4HIDA 1R0IA 2EYFA 5RXNA 2CW0D 1YK5A 3MZ5A 4RA8A 5E1FA 4AI1A 3P20A 3E0EA 2E2IH 4XYQA 2OTLA 1LYLA 1SE8A 4DAYB 3VPBE 3I3CA 4IUQA 2NZOA 3HOZB 1IBLL 5CYUA 2NYZD 5IP7H 3GTLL 1EEID 1XPRA 3RZOL 2G5DA 1NNXA 3GD7A 1ESFA 3QG1A 1WCMB 3U9OA 2EZVA 2B2TC 2VQEL 3KYUA 2D0PA 2XRSD 2CH4W 2EXZA 2E2HL 2VUMB 1CZWA 1N33L 1KXLA 1N32L 3VR4A 3U4ZA 5M5XL 4XT3B 4A3GG 4A3LG 1WVLA 1TWFB 4KHPQ 4GS3A 3MXUA 4JG2A 1MHWC 4QMGA 3PO3H 5J39A 3NHHA 1VDZA 2KQ3A 1KD1C 3I90A 4GN5A 5M5YB 4A3FH 2XJUA 1A3UA 2KEEA 3PO2H 3EJIA 1PMRA 3G7LA 1T9QA 3QIAA 1SLJA 2PSMC 1W3SA 4OWWB 1CZGA 1SMUA 4Y7NL 2ALYB 5HURA 2E2DC 2HR5A 3J80E 1B13A 2Z3RB 4IN3A 3FP9A 3FPUB 1W2BA 2X6GA 2ASBA 1O7ZA 4LWCA 1WTWA 2V0EA 3KYHC 4BXXL 4R1JA 5C3XA 5AI2A 3HOYB 1RTNA 4ZN1B 4JADA 2E2JH 4L5TA 5MF6A 4EQOA 2ZM6Q 3S24A 1PFYA 4ZLTF 1N8RC 1BCPF 4BY7L 1NNQA 3HP3A 3SVMA 2B63G 1VCIA 2H12A 5IYBH 2CQAA 4EVOA 5CORA 3RN5A 4N8X1 1QNKA 1G8ZD 2JA8G 4KHPL 3OWFA 2MGSA 4UDUC 2NVQL 4GLAC 4AYBG 3ND8A 4L8JA 3IFDA 4QUCA 1YEZA 3GTLB 5IT9L 3RZOB 3CCLA 3SK4A 2MO1A 2OQ0A 4PQXA 3S1NL 1JOOA 3SDZA 2CVRA 1SYDA 3J81L 2MFIA 3F2BA 3NPPA 2E2HB 3IU3I 1EY9A 1TY0A 1PTOF 3D3RA 3S1RB 1J6QA 5M5XB 4ZYSA 1K0RA 2QA4A 1EYGA 4M8AA 2MP1A 4K0KQ 2F0OA 3UDIA 3LWEA 2Y0SP 1F9PA 2KHJA 2PMZB 1VCXA 3GTKH 4JI7Q 4PZ7A 2F03A 3MQKB 3I4MH 4DR3Q 1YZ6A 4HIOA 3M4PA 3PIP3 1JT8A 4H0LC 4R4IA 2XWBB 2ZM6L 4C3HH 2RCNA 1AN8A 1SE2A 3PSIA 3FMCA 4RCNA 4BY1G 5I9OA 4LF9Q 5KNDA 1S5CD 4A3ML 1BOSA 2AUKA 2V4DA 3HOWL 4X3KA 2X69A 1B7YB 2YTYA 3PUZA 1DGSA 5GAGC 1D5MC 2EPBA 4NPSA 5FLML 2R92L 1V43A 1Q1BA 2WACA 1SYEA 2RHSB 3PIOA 1UWVA 3RNUA 4BY7B 4IPCA 5T1GA 4C3IH 1ZYRD 1I4RA 1PFSA 4GZYC 1U4MA 3W1GA 3BDCA 2JA6G 2A6ED 4ZKCB 1STAA 1XTCD 1X3PA 2PNRC 5IYCL 2PNHA 4RH6A 5CV8A 4K0KL 2TMPA 2NVQB 5EIOC 2WB1B 1IBMQ 4JI7L 2HIVA 4LF6Q 1QCVA 3DLLA 3HOUG 5D3DA 1K8AC 3S1NB 4DR3L 2HCIA 1EYCA 1CQVA 1PYSB 2DN8A 1YNND 4JYAQ 3W2DA 1VZGA 2V0FA 2E5LL 1PFUA 2JE6I 5I2XA 1TKWB 4JAFA 1UE6A 3H3VH 1IYJB 4A3KL 1RD9D 1SDFA 4LF9L 5IT9c 3J7AF 4XT1B 5BN3A 3HKZB 4A3CH 2FHTA 4A3DG 3J81c 1JE4A 4UP8A 1H95A 3MPSA 5JAVA 1A63A 1GO3E 2IX3A 1FGUA 1M1KC 1R4PB 4RMFA 4DNTB 3HKSA 1AE3A 1R4QB 4JI2Q 2QKIC 4C3JG 4A3GL 1QVGA 5G3LF 2ZTEA 5EJWA 1VF7A 2CR8A 4X64Q 3DXJC 4A3MB 1EQRA 5DAUA 1MGSA 2CWPA 2UU9Q 4JI6Q 4DKAC 1F77A 1BCPB 2B2UA 3HOWB 3I8ZA 1SNPA 2RDVA 3U50C 3BYTB 5J1ZA 1VQ7A 5DLQE 3NQIA 4B3MQ 1IBML 1Q86C 1WTXA 4Q0FA 4QL5A 5EBCA 4LF6L 2JEAI 2R92B 4QJFA 1CKNB 3KYVA 4QIWP 3BDLA 1XNRQ 2RQXA 1LT3D 4IUTA 3G4SA 1K73C 3GTJH 4AR3A 1ASYA 4JYAL 1SNMA 4H7BA 4RGMA 4I7AA 3TREA 3FHWA 4F87A 1EY8A 1SMXA 3EA6A 1HTLD 1PFBA 3TQYA 3T16A 2XJQA 3KF6A 3SHLA 1SYFA 1SYCA 2F0EA 2H5XA 1PTOB 4JBJA 1IRNA 1TQOA 2EYLA 4BBRG 1LTLA 3JC66 1V1PA 4ZQ3A 1R0GA 4A3FL 2ZJQA 4WFN1 5IODA 4FXGC 2A6HD 1RJTA 3N6RA 4JI2L 2R7ZL 3URYA 5AJ3Q 1DOMA 3UE0A 2Q8RE 4A3KB 4IALA 4IURA 3EIVA 2NVXH 1C48A 1BQ8A 3OOCA 4A3IG 1LACA 4MTKA 3LWRB 2UU9L 4JI6L 4TKOB 3CF5A 3HAXC 1DXMA 3KLSA 1E7ZA 4DAVA 4DV0Q 5C3EG 1DX8A 4DR5Q 2RF4A 4B3ML 2UUCQ 4AHYA 5FKAC 4RFBA 1CSPA 1L0WA 4DR7Q 3OMGA 1Q3LA 1AH9A 1HTPA 1QILA 1TT2A 2BA1A 1XNRL 1FNUA 4A3GB 4KJNA 4TQUS 4X65Q 2B29A 1FHHA 2Q2UA 3S15H 2Z4IA 2F0MA 1RKNA 5IYBL 1KL9A 1TVXA 3K0XA 3AQQA 5I9PA 1FGBD 1EZ6A 3BG3A 4NDXA 3S2DL 1EYAA 1XMOQ 1GUOA 1PH2A 1IW7C 2JYOA 1QZHA 2PQEA 4GN4B 5FLXL 2XVSA 1BCPC 2EQSA 3CRLC 1QUQA 4R4CA 2Z6KA 3T4AC 4C56C 1NJIC 4LF4Q 2L1BA 3I70A 2N78A 4XIGS 3S1QH 2XJTA 3MXGA 4MIUA 1LLRD 3BZKA 3HOZG 1RF2D 3S17H 5AJ3L 5KEEA 2RA4A 3HOVL 4ZKBB 2AQCA 2QDBA 3V2TA 1ZXTA 1YITA 3I55A 1B9NA 4CKCA 4KJOA 2R3ZA 3NTIA 1S72A 2E8GA 1X3QA 1WCMG 2ATWA 3FDJA 3GTKL 4DV0L 4AR6A 4DR5L 2KUMA 2VUMG 3I4ML 2UUCL 1GKHA 2V3BB 1PTOC 1S5DD 2YU9H 4PMCA 4A3FB 4DR7L 1B44D 1EZ8A 2NVTH 2R7ZB 3D6CA 4C3HL 2UUAQ 3PGZA 3RUZA 1HZBA 2IX0A 3HOXH 4X65L 4LFCQ 4KV6A 2K05A 4BWGB 5I6WA 2EY4E 3LX0A 5C0XG 1Q82C 3NXWA 4AI3A 2WIIB 2K5QA 2KHIA 1VQ8A 2N49A 1E1OA 1E2ZA 3K58A 1V1PB 1Y1VH 2WINB 2DNCA 1Y8NB 4AIMA 4X3SA 3KBGA 3K5OA 3HZXA 1FNWA 1NR4A 5EBDA 5JEAH 1WD1A 1BBXC 2EJGC 3MXPA 4LF4L 5A2QL 2F0PA 3NK9A 3CCEA 4C2M1 3JAML 3KJPA 3CCRA 1N36Q 1VMCA 4A76A 4IFDG 3HOYG 2M4YA 3GV6A 4J6HA 5C0XI 3S2DB 1G51A 2L55A 1AFPA 1X65A 4C3JL 2C35B 2LKVA 5A35A 4ODGA 4DU9A 3A8IE 4IUPA 3TEHB 4HTHA 5C5LA 2CCZA 4K6LA 2K04A 4IPGA 1ENCA 1EWHA 2E74C 2UUAL 2F52A 2BH8A 4LFCL 2APOB 3P8BA 1BVSA 3HOVB 3P7JA 1GM5A 3H99A 2F0VA 2IJ0A 2RVLA 4IFDI 1QUQB 2B2UC 4H44C 4A3CL 2CKAA 2IL8A 1X6OA 2WAQB 2JXMB 5C44H 1YI2A 1PZID 5LL6X 4BA1I 3GTQL 1BNZA 3F8TA 3A55A 3I73A 3I4MB 4GN3B 1SNCA 3BYYB 2LSSA 3S14L 1QVFA 1B71A 4C1NK 4C3HB 1ESRA 3IRBA 4ZN3B 2NZ1D 1E2VA 2XN9C 3NBHA 3E3XA 1LTID 4HSVA 1N36L 1I4GA 4OGQC 1GUTA 3VA5A 1I4PA 5CV5A 4P74A 4I7ZC 1E22A 4DXFA 1ZKOA 4ILWA 8RXNA 2N55A 3CU7A 4B3TL 1EYDA 3IFTA 1RTOA 3AU7A 3MTSA 2BDNA 3K7AH 4LFAQ 4YCVA 1YJNA 4NXNQ 2K5WA 2Q8IB 4BBSH 1UE5A 3CRKC 4POGA 4DK3C 3PWFA 2A1AA 3J81j 4BXXG 2B5ID 2GMGA 4CJ2C 4RWSC 1TWCL 4DV6Q 1SR3A 1PYBA 4C3JB 4BY7G 1UEAB 1VQKA 2JP1A 4DFAA 2PYKA 2OWOA 4R8NA 1XNQQ 1JR0D 2XGTA 1QWYA 2PO4A 5AN9H 1JMCA 2XTIA 2ES2A 4CDEC 1BKBA 2EYJA 2NB0A 3NBIA 1STGA 1WTRA 2WB1G 3M7NA 2OEOA 1ML0D 4GS7D 2SOBA 3E6ZX 5K36H 1IKMA 5AI3A 2NVXL 4DA2A 3GO5A 1VQAA 3M7GA 3UDGA 3SK6A 2A8VA 2VY3A 1F2MA 1IL8A 2D5DA 5C4XH 1JJGA 1AP0A 3GTQB 3PQIA 4LNQA 1OWBA 3NEMA 2Z6KC 5KGUA 3J80L 4QB4A 1OO9B 5C4JH 1HCZA 3S14B 1V8QA 4GLVB 4LFAL 3HKZG 5CV4A 1I6HH 1PFMA 4NXNL 5KIXA 4JBMA 2ZJPA 3S15L 1KDAA 3Q24A 1TWHH 3KYYA 2ERJA 4A3BL 1Q46A 4DV6L 4F88A 2QL0A 2PI2E 1PVOA 5KRUA 4AHXA 3VR5A 3TZUA 1XNQL 4MN3A 3CC2A 3HOWG 4A93H 1T5EA 1Y1WH 2IX1A 3OTOQ 1AW7A 3CQZL 1I50H 1HNZQ 1C0AA 1TWAL 2ZXOA 2FMCA 1G6ZA 1HZ9A 3A54A 5JJKA 1R0JA 4DUYQ 3S17L 3PIP1 3AYHB 2EYPA 4MNOA 2KCCA 4G7ZC 1PLFA 5FLMG 1TWCB 3I4NL 2R92G 1X3FA 5IYDH 3QO2A 4AHZA 1UUPA 1GOZA 5ELCA 4XYOA 1SROA 1XPOA 1HR0Q 3D0FA 5IYCG 1HPCA 2J9UB 1U9RA 3M4OL 3K5NA 5LL6S 3OHXC 4DXGA 1Q81C 2I5MX 1VQJA 2SNSA 2PYAA 1KAWA 4LJZC 2DY7A 3I72A 3GTML 4JBWA 1RDPD 3OIQA 4HSPA 2I46A 3NWTA 1SE3A 3LWPB 2YTXA 1CUKA 2B2WC 1NUCA 4RAUC 3RN2A 2B3GA 4KY7A 4ABNA 4A3KG 1RYTA 5EPKA 1ENFA 3EFXD 2QF7A 3OW2A 1IL2A 4C2MB 5IGBA 3GV3A 2K2DA 4NB3A 5H1SE 1FL0A 1SFOH 5J3BA 3OTOL 4JOIC 1HNZL 3IKJA 2Z8LA 5GAHc 2MQHA 2MS3A 3J80c 1LTRD 2O5JD 3H0GH 4A3BB 4H13C 2Q8TA 1LO5D 1LT6D 5JVG1 3I91A 3F2DA 2O2LD 1UE7A 2HCCA 3AFPA 1JB3A 3MEFA 4KMUC 1S5ED 1PFVA 1VQIA 2KECA 4HMJA 1EFWA 1TR5A 1C8CA 4QQBX 4OWTB 1HR0L 1DZ1A 2GVBA 3CQZB 3PUWA 5DNFA 1TWAB 4NKLA 4K9FA 1NAPA 4DV7L 3S17B 5KNBA 5DM73 5IIFA 2F0WA 4FF2A 1B8AA 3I4NB 2BOSA 2R93L 2KN9A 1U4PA 1WTHA 3I2ZA 2A68C 2EYHA 2CH4A 1SJED 2DY8A 3DM3A 1A2TA 5CGKA 1QCBD 4ZRZA 2B63H 3KF8A 2A6EC 5L37A 1JQYD 1RYQA 3KLRA 4J1MA 3M4OB 4FF4A 2JA8H 1LKOA 3T53B 2K33A 5IP9H 5EPLA 2KCTA 1CT1D 2XWJB 3CMAA 1Z7TA 2EJMA 1IU6A 1SEBD 1M4VA 3VYSA 5M5WH 5ELFA 2PPBC 3PIPA 1IROA 3CCSA 4PMWA 3GTMB 2I0QA 3K59A 4AR5A 1CTMA 4A3FG 1YNNC 4JI0Q 2R7ZG 5C4ZA 1JOQA 3EVQA 3VDYA 3HEJA 1WFQA 3STBC 4X6AH 3FEWX 1JORA 2QILA 2HQLA 1Y14B 2Y0SB 1YJWA 1S5FD 2K6AA 3SXHA 3K7AL 2I07B 1OXTA 2UXBQ 5ELNA 2EYOA 1S5BD 1JJCB 5BN5A 1VQ5A 2AWOA 4B9WA 4HR7B 1CAAA 3RMHA 5J22A 4XGHA 5M3ML 2FINB 1K3RA 1II3A 2OXPA 1EL0A 2V1CC 3GTPL 5M3FL 2NWGA 1SNQA 1EY6A 1TS2A 2ZT9C 3RYGA 3VYTA 5LHY1 3JC63 4O0AA 1D2BA 1C9OA 3KYWA 4MHEA 4BY1H 2G9DA 1BBUA 5IYBG 3PKIA 1NSNS 3BVZA 3LPEB 1PH5A 5IY0A 3K5MA 1UNSA 1PH1A 2RDHA 5KYIA 1BQQT 4YWLA 3MC0B 2QW7A 4YHHQ 1J5EQ 2LCQA 1CKNA 2R61A 2R93B 1D8LA 4QY7A 3M3YL 3T51B 4Y7NB 2IY5B 3ITPA 1LTTD 3HJWB 2KOLA 1Z9FA 5IE8A 4JI0L 5C4XL 3MEHA 5CC4A 4GLXA 1VMPA 1F2YA 5FO7B 1RCVD 3HOVG 2JJQA 3TP7A 1B53A 2GA4B 1WTVA 1K3BC 2Z0SA 3I4OA 5CBAE 1EQTA 2LFNA 4DF7A 4B3SQ 4KY6A 2UXBL 1I6HL 3S16H 1B3AA 3OIPA 5JEAJ 2WAQG 3C46A 1K8GA 1FD7D 3A56A 3KDFA 1MJCA 4Z9CB 1ODHA 3I4MG 3HOUH 1M8AA 1Y8OB 4K6DA 2EXDA 1VZHA 1B3QA 3KF8B 4C3HG 1PZKD 4FP5D 3P75A 5ELDA 4A3EL 2BA0A 1KIXA 3K7AB 4K5WA 2QEXA 1R9TH 1BBWA 1PRTF 2MUYA 5IGEA 1ENAA 5CV9A 3J7YW 1I3QH 5CBEE 1D1KA 3FKIL 3A7LA 2E75C 3TDQA 1Y1WL 3Q23A 1SMMA 4QCLA 1I50L 1HA6A 3PL5A 3GTGH 4LK1C 4RXNA 5M3MB 3LNNA 1PH3A 4YHHL 2NUCA 1J5EL 3GTPB 2J7ZA 4DR4Q 5M3FB 3GP7A 2PMZE 5JVG3 2NVYH 1VQLA 1CQFA 1NBWA 4JC0A 1ET9A 2JA7H 3RZDH 1GHKA 4C3IG 3A0JA 4FVMA 1RIPA 3KBXA 3BZDB 1PFWA 4PV1C 1O7LA 5MGNA 3F2CA 1KNEA 4DAPA 5D14A 2L9HA 2UXCQ 2N88A 3PUYA 4OHJA 4B3SL 5GQOA 1H9JA 3K0YA 4QIWB 1SN8A 3KJOA 1P16A 1EEFD 4EQ5A 3ND9A 1D7QA 2GVAA 3P1HA 4IZ8A 3M3YB 5GAEc 1RWDA 1IZ6A 2E2IL 2EY5A 1X56A 2KJXA 3W3AA 4TVMA 2FJ2A 1ASZA 5C4XB 1A8VA 4KTAA 1K83H 4PZ8A 5IP7L 2JI2A 3A5UA 3H3VM 2Z1CA 4AHWA 1D6EC 1YNJC 3JAMi 1Q8IA 3H9BA 1I6HB 4A3CG 4AI2A 1XX8A 3W5OA 3JR7A 4CJ1B 1SFOL 4JAEA 5BR8Q 5HY6A 2WKCA 5EKIA 1SXTA 4GNXB 3UI2A 1ET6A 1WTQA 1YV1A 1EU4A 5KNCA 1HFGA 5DEHA 2L0CA 4DR4L 1FNVA 4WJ4A 1IXRA 2IHEA 1WOCA 4A3EB 3B08B 2SEBD 1EQQA 1QZGA 1WJVA 3PO3L 3DHQA 2F0JA 3H3VI 3ULLA 3Q22A 3FKIB 1A6XA 3KDFB 1Y1WB 1KABA 1I50B 2UXCL 1HUNA 2R7DA 4FDBA 1TIID 5C3EH 2JA5H 3PO2L 5I2YA 1BF4A 3SK5A 4X64L 4IUNA 2GN5A 5LMUQ 5JJZA 4RKBA 5ISRA 2AKWB 4EQNA 3NELA 4OELB 4OEMB 1XJVA 4N9TA 5E3FA 4LW1A 1HFNA 4I65A 2F3WA 1EY5A 1SMWA 7RXNA 1I6VC 2I5LX 2YV5A 4HN7A 3I56A 1OTCA 2XJRA 4UY81 5M9OA 2E2JL 4HEDA 5JPMC 2CWAA 1F2LA 1BXTA 5IP9L 4K2LA 4FNFA 3RZTA 2IW3A 3BDOA 5BR8L 2I5HA 4DV4Q 4ID6A 5M5WL 2PVXA 4QUFA 2E2IB 2HQEA 5C4HA 4P75A 4ZUIA 4A3JH 3TP6A 1HZCA 4FF3A 3HOZH 2BE5D 4JI8Q 1Q12A 1I5FA 1VQ6A 1DD2A 1CA5A 2JI1A 3CPWA 1X3GA 3ICEA 3QJYA 1CK1A 1B2JA 5AFWA 3T13A 1DOLA 1JWSD 2KHSA 1SFOB 3A74A 2XRQD 3QB3A 2L0ZA 1WCMH 1PRTB 1X3EA 2HIXA 2RSOA 1CADA 4KKUA 3NFPI 1BUVT 2B8GA 1QB5D 1TWFH 5LMUL 4GNXC 1N34Q 1HHVA 1VQ9A 2M4VA 4KLKA 3QOJA 2HDMA 2KVMA 3LGJA 5C0XH 3PO3B 3K6OA 4Y52H 4OX9Q 4A3BG 3EQLC 1ICFB 1EQVA 2C5CA 2NTTA 5FJ8H 4NXMQ 5M5YH 3KUPA 2YYZA 3PO2B 3J7A5 1L1OB 2L5TA 1A3VA 1G2SA 5GROA 1K8MA 4LUVA 1YIJA 3K57A 2PCFB 1WD0A 3WWLA 3KYXA 1XMOL 4FXKC 2JSOA 1L2FA 4JI8L 5I6YA 3HOYH 2EJFC 3G6JB 4QF4A 2UUBQ 3I4NG 1PH9A 3OWEB 2J4XA 1F9RA 2E2JB 2B2VA 4OO1G 2K75A 2L4NA 4C1NI 4N8FA 4AR4A 1KDCA 4OL7A 4AQYQ 4DNRB 1F4LA 4DR6Q 2PW7A 3ZYYX 4C3IL 1SRUA 1XMQQ 5M5WB 1JOKA 2K01A 3SGIA
chains in the Genus database with same CATH topology
1N34L 4JV5Q 3U4VA 4GOPA 3CD6A 4OX9L 2EIFA 4NXML 1VQEA 4YCUA 3CMEA 4OO1I 4JOIA 2E2HH 1NMFA 2OCEA 2Y0SG 3S1RH 2NN6G 2WP8J 1G6PA 1E8JA 3M85A 2CFMA 1EOVA 4L5SA 1VQDA 1JJ2A 3GDEA 4TVAB 2UUBL 3CPFA 1VQ4A 4AYBE 3UDXA 1PV4A 1YK4A 1G291 4AQYL 4XXBB 2JI3A 4DR6L 1XMQL 1KC8C 2RHQB 1PH6A 4HJ8A 1KHIA 1VQBA 2NN6I 2VNUD 5LMNQ 4JV5L 3I7FA 5LMNW 4BXXH 2C6AA 2ERSA 2R93G 1C09A 3AFQA 1LKPA 4DNIA 4DV5Q 4MTNA 1PH8A 5C44G 1KQSA 3T1HQ 2K5NA 4OWXB 2Z3QB 1ZRPA 2A69D 1X9NA 5DM71 1LM0A 3CCQA 1RL2A 1OXXK 1I94Q 1NE3A 1A0IA 3H15A 3S1NH 1T9HA 3NENA 4IOCA 4LF7Q 1EUJA 3K35A 1OWCA 3ULPA 2JEBI 1NTGA 3F1ZA 2WAQE 4O2DA 4DPGA 4GOPB 4BBSG 3AEVA 4IJLA 3L2PA 2DSXA 2MNAA 5M3MG 5LMNL 4HJ7A 1QYBA 1B70B 3PUXA 5M3FG 2OQKA 2IT1A 2R7FA 2ZTCA 3CCJA 4DV5L 3G48A 4A3MH 3T1HL 1FJGQ 4TPUA 3HOWH 4HJAA 3T1YQ 1I94L 3B0AB 2K4KA 4UP9A 5EINC 3J81i 4PG3A 3PZAA 1CSQA 5C4XG 5JJIA 4LHLA 1MIUA 1OXSC 2NZHA 1X55A 3PKJA 5MLC3 2NYDA 4BA2I 2WFWA 1IBLQ 2JQOA 5H1Sc 3TS2A 4GKJQ 1BQ9A 1TWGH 4A3EG 4A3KH 1Q8KA 3K7UC 4YWKA 1N32Q 2XJVA 1V1QA 3BU2A 3PV0A 3FKIG 1Y1WG 1EIYB 1FJGL 4E6YA 3ZG6A 4JI1Q 2K50A 3T1YL 4GOPC 2LXKA 4DAMA 1TXYA 4A3GH 4A3LH 4UY8C 4DR2Q 4LF5Q 2F3IA 4DUYL 2FXQA 4EX5A 4R4OA 1DVBA 4DV2Q 3CCVA 5E7NA 4GKJL 4X66Q 1PA6A 4B8CD 2VZAA 3PF4A 5IP7G 1VQMA 3K81C 2AMCB 2ZIXA 4LFBQ 3GTOH 4OXPA 2VQFQ 1YJ9A 1A62A 5JJLA 4JI1L 1NMGA 3H0GG 3PIO1 4GKKQ 3RLNA 2R7ZH 3QVDA 3G71A 4DR2L 3PO3G 1KRSA 3KOJA 4LF5L 3J7Z1 1YUZA 2QGQA 1QVCA 3PO2G 1S24A 4DV2L 2K14A 4DV1Q 1RDGA 1VQPA 3KFUA 4XTCS 1M90C 5GAGc 3UDFA 4X66L 3J7Y1 1YBYA 5GAHC 3HFZB 2XJPA 3S2DH 1YHQA 1MJEA 5IP9G 4QGUA 1WJJA 5IWAQ 1PHJA 4LFBL 2VQFL 1AE2A 1O7IA 2Q2TA 1HH2P 5C0XJ 2M6PA 1EWIA 1RB9A 4JI3Q 2AHOB 4GKKL 3E9IA 3S1MH 3HOVH 4KI0A 4UPAA 3JC62 3TRZA 4P72A 4GNXA 4U671 3M9BA 4DV1L 4IFDJ 1HZAA 2JA6H 4HIMA 2DGYA 2E5LQ 3K8AA 2D62A 3QQCE 4L5RC 1HJPA 2IHFA 3TS0A 2Y0SE 3E9HA 4IOAA 1X54A 5JVH1 1VQHA 1E3PA 2K5VA 5IWAL 3OYYA 4HJ5A 3CXCA 3B6YA 3MSUA 3P2AA 2A68D 2XJSA 4A3DH 4JI3L 1WYDA 4C3JH 1CKMA 3M4QA 3S2HH 1E1TA 2VS1A 3CAMA 4JBKA 3EN2A 2ID0A 3A5ZB 3STBD 3LNLA 1E24A 2Q2IA 4V196 4YWMA 3GTQH 2UXDQ 3K80C 2N3SA 3S14H 2JA7G 4APVA 3CCMA 1BFYA 4YCWA 2K52A 4AH6A 2HHHQ 4BBRH 1UEBA 1GD7A 2WB1E 1L1OA 2MO0A 4ME3A 2CKZB 1JYBA 3SS2A 1T9OA 1YUXA 4A3IH 1T9PA 1N9WA 5GADc 1S40A 4H02A 4DK6C 3HKZE 4ALPA 4LHNA 4R4QA 1TWCH 3G6EA 4A4IA 1PH4A 3W1BA 1U0LA 4LF8Q 4AI0A 2UXDL 1PH7A 4QIWE 1VQCA 1Q1EA 2Q2HA 1NXEA 2C6BA 4JI4Q 3RR5A 3D31A 3CCUA 2PQAA 5GAEC 1H7VA 2HHHL 2PVEA 2JA5G 1OXUA 1FVIA 3WWVA 4JI5Q 2JA9A 4DR1Q 4J15A 2N8NA 4C2MH 4JAGA 2KKDA 2DUDA 4JCVE 2R6GA 1GVPA 4A3BH 3WWNB 2VUMH 3PUVA 1VQOA 2KBNA 3EBEA 3KLWA 2L15A 4LF8L 5GADC 5K2ME 3CQZH 1TWAH 4A3JG 4LUOA 1IU5A 6RXNA 1HNWQ 4JI4L 2D0OA 2KCMA 4R4TA 4RG1A 1R0HA 2K5HA 3I4NH 4DV4L 1YHBA 1MKHA 3J80i 4B3RQ 3CW2C 2JK8A 4JI5L 4DR1L 2CKCA 4MZ9A 3M4OH 3KF6B 2PI2A 4PZ6A 3GTMH 5FJ8G 1B2OA 1WI5A 3J7ZC 4YY3Q 3ULJA 3HOXG 3BJUA 1VZIA 2VL6A 5MFZA 4IPHA 3GTLH 3MXNB 3RZOH 1S2ZA 2PQAB 3UE1A 2ZTDA 4LUZA 1HNWL 1Y1VG 1BRFA 1FHMA 2OTJA 5JEAG 5M5XH 4B3TQ 1LKMA 1JE5A 1RDVA 1V9PA 4B3RL 1Q7YC 4DV3Q 1XTDA 2LXJA 5ELOA 1YNXA 3Q8DA 1IW7D 5FLXc 3L7ZC 2R93H 1R0FA 4Y7NH 4P73A 3ZJYC 1L1OC 3ER0A 4YY3L 3ERSX 1LUZA 1EIFA 1IBKQ 2AYJA 1UE1A 5EAYA 2HT1A 1KRTA 4BY7H 1HNXQ 2KENA 1VQNA 1Z47A 4L5QA 1NXGA 4UP7A 4DUZQ 4IO9A 2NVQH 3RLFA 5HGQA 1YVCA 1K9MC 4DV3L 2F4VQ 3L0OA 1XPUA 5M3MH 3GTPH 5M3FH 3A44A 3RZ6A 1Z92B 3JAMc 4X62Q 2A19A 4HJ9A 4POFA 4IPDA 1NY4A 1P8LA 1BE7A 1JB7A 2ZJRA 1IBKL 3RLOA 4KHZA 2VW9A 4OONA 1HNXL 3M3YH 1OXVA 2CQOA 4HIKA 5MFPA 1C7YA 4DUZL 3PF5A 5K36G 2YTVA 5FLMH 2R92H 1YHAA 2AWNA 1VQFA 4P71A 2F4VL 4LF7L 4G6BA 3BZCA 5IYCH 2M6OA 1S3OA 5DM61 4A3EH 4X62L 4A3MG 3NBHB 2BH2A 4WJ3M 3FKIH 3CP0A 4A75A 2VQEQ 3U58A 1N33Q 3CC4A 1CKOA 4A93G 2PPTA 1U5KA 1VS0A 4IJHA 1HR0W 3CC7A 1VQGA 5IYDG 4DV7Q 3PCOB 1S30A 4HIDA 1R0IA 5RXNA 1YK5A 4AI1A 3E0EA 2E2IH 2OTLA 1LYLA 1SE8A 4DAYB 3VPBE 2NZOA 1IBLL 5IP7H 1XPRA 3GD7A 2VQEL 3KYUA 2D0PA 1N33L 1KXLA 1N32L 3U4ZA 4A3GG 4A3LG 4KHPQ 4GS3A 4JG2A 3PO3H 1KD1C 4GN5A 4A3FH 2XJUA 3PO2H 1T9QA 1SLJA 2PSMC 1W3SA 4OWWB 1SMUA 2ALYB 2HR5A 1B13A 2Z3RB 3FP9A 1W2BA 2ASBA 4LWCA 2V0EA 3KYHC 4R1JA 5AI2A 4ZN1B 4JADA 2E2JH 4L5TA 5MF6A 2ZM6Q 3S24A 1N8RC 1NNQA 2B63G 1VCIA 2H12A 5IYBH 3RN5A 2JA8G 4KHPL 4GLAC 4AYBG 1YEZA 3CCLA 2MO1A 2OQ0A 2MFIA 3F2BA 3IU3I 1J6QA 1K0RA 2QA4A 1EYGA 4K0KQ 3UDIA 2KHJA 1VCXA 3GTKH 4JI7Q 4PZ7A 3I4MH 4DR3Q 1YZ6A 4HIOA 3M4PA 1JT8A 4R4IA 2ZM6L 4C3HH 2RCNA 3PSIA 4BY1G 4LF9Q 1B7YB 2YTYA 3PUZA 1DGSA 5GAGC 4NPSA 1V43A 1Q1BA 2RHSB 3PIOA 1UWVA 3RNUA 4IPCA 4C3IH 1PFSA 3W1GA 2JA6G 2A6ED 2PNHA 4K0KL 5EIOC 1IBMQ 4JI7L 2HIVA 4LF6Q 1QCVA 3DLLA 3HOUG 1K8AC 4DR3L 1PYSB 4JYAQ 1VZGA 2V0FA 2E5LL 2JE6I 1UE6A 4JAFA 3H3VH 1IYJB 4LF9L 5IT9c 4A3CH 4A3DG 3J81c 4UP8A 1H95A 3MPSA 1A63A 1GO3E 1FGUA 1M1KC 4RMFA 3HKSA 1AE3A 4JI2Q 1QVGA 2ZTEA 2CR8A 4X64Q 1EQRA 2CWPA 2UU9Q 4JI6Q 4DKAC 2RDVA 3U50C 1VQ7A 5DLQE 4B3MQ 1IBML 1Q86C 4QL5A 4LF6L 2JEAI 4QJFA 1CKNB 3KYVA 1XNRQ 3G4SA 1K73C 3GTJH 4AR3A 1ASYA 4JYAL 3TREA 3FHWA 1SMXA 3TQYA 2XJQA 3KF6A 2H5XA 4JBJA 1IRNA 4BBRG 1LTLA 3JC66 1R0GA 2ZJQA 4WFN1 2A6HD 4JI2L 5AJ3Q 3UE0A 3EIVA 2NVXH 1BQ8A 4A3IG 2UU9L 4JI6L 3CF5A 1E7ZA 4DV0Q 5C3EG 1DX8A 4DR5Q 2RF4A 4B3ML 2UUCQ 4AHYA 1CSPA 1L0WA 4DR7Q 1AH9A 2BA1A 1XNRL 4TQUS 4X65Q 2Q2UA 2B29A 1FHHA 3S15H 1KL9A 3K0XA 3AQQA 1XMOQ 1PH2A 1QZHA 4GN4B 2EQSA 4R4CA 1QUQA 2Z6KA 4LF4Q 1NJIC 2N78A 4XIGS 3S1QH 2XJTA 3BZKA 3HOZG 3S17H 5AJ3L 1YITA 3I55A 1S72A 2E8GA 1WCMG 2ATWA 4DV0L 4AR6A 4DR5L 2VUMG 2UUCL 1GKHA 2V3BB 2YU9H 4DR7L 2NVTH 2UUAQ 3PGZA 1HZBA 2IX0A 3HOXH 4X65L 4LFCQ 5C0XG 1Q82C 4AI3A 2KHIA 1VQ8A 2N49A 1E1OA 1Y1VH 4AIMA 4LF4L 3CCEA 3KJPA 3CCRA 1N36Q 4A76A 4IFDG 3HOYG 2M4YA 5C0XI 1G51A 1X65A 2C35B 3TEHB 2CCZA 4IPGA 2UUAL 2F52A 2BH8A 4LFCL 1BVSA 3P8BA 1GM5A 4IFDI 1QUQB 2CKAA 1X6OA 5C44H 1YI2A 4BA1I 3F8TA 4GN3B 2LSSA 1QVFA 1B71A 3IRBA 4ZN3B 1N36L 4P74A 1E22A 8RXNA 4B3TL 3K7AH 4LFAQ 4YCVA 1YJNA 4NXNQ 4BBSH 1UE5A 4POGA 4DK3C 3PWFA 2A1AA 3J81j 4BXXG 2B5ID 2GMGA 4DV6Q 1SR3A 1PYBA 4BY7G 1VQKA 2OWOA 1XNQQ 2XGTA 1JMCA 5AN9H 2XTIA 2ES2A 1BKBA 3M7NA 2WB1G 4GS7D 5AI3A 3GO5A 1VQAA 3UDGA 2A8VA 2VY3A 5C4XH 1JJGA 4LNQA 1OWBA 3NEMA 2Z6KC 5C4JH 4GLVB 4LFAL 3HKZG 1I6HH 4NXNL 4JBMA 2ZJPA 1TWHH 3KYYA 2ERJA 1Q46A 4DV6L 2QL0A 2PI2E 1PVOA 4AHXA 1XNQL 3CC2A 3HOWG 4A93H 1Y1WH 2IX1A 3OTOQ 1I50H 1HNZQ 1C0AA 1HZ9A 5JJKA 1R0JA 4DUYQ 3PIP1 3AYHB 4MNOA 5FLMG 2R92G 1X3FA 5IYDH 4AHZA 1SROA 1XPOA 1HR0Q 3D0FA 5IYCG 2J9UB 1Q81C 2I5MX 1VQJA 2PYAA 1KAWA 4JBWA 2YTXA 1CUKA 3RN2A 2B3GA 4A3KG 1RYTA 3OW2A 1IL2A 2K2DA 4NB3A 5H1SE 1FL0A 1SFOH 5J3BA 3OTOL 4JOIC 1HNZL 5GAHc 2MQHA 2MS3A 3J80c 2O5JD 3H0GH 5JVG1 3F2DA 1UE7A 3AFPA 3MEFA 1VQIA 4QQBX 1EFWA 4OWTB 1HR0L 2GVBA 3PUWA 4K9FA 4DV7L 1B8AA 2KN9A 3I2ZA 3DM3A 2B63H 1RYQA 2JA8H 1LKOA 5IP9H 2KCTA 3CMAA 1IU6A 5M5WH 3PIPA 1IROA 3CCSA 4PMWA 2I0QA 4AR5A 4A3FG 4JI0Q 2R7ZG 3VDYA 3STBC 1WFQA 4X6AH 2HQLA 1Y14B 1YJWA 1OXTA 2UXBQ 5ELNA 1JJCB 1VQ5A 2AWOA 1CAAA 4XGHA 1K3RA 2V1CC 3RYGA 3JC63 4O0AA 1C9OA 3KYWA 4BY1H 1BBUA 5IYBG 3PKIA 3LPEB 1PH5A 5IY0A 1PH1A 4YWLA 4YHHQ 1J5EQ 2LCQA 1CKNA 1D8LA 4QY7A 2IY5B 1Z9FA 5IE8A 4JI0L 4GLXA 3HOVG 2JJQA 2Z0SA 3I4OA 4B3SQ 2UXBL 3S16H 5JEAJ 2WAQG 1K8GA 3KDFA 1MJCA 1ODHA 3I4MG 3HOUH 2EXDA 1VZHA 3KF8B 2BA0A 1KIXA 1R9TH 2QEXA 1BBWA 1I3QH 1SMMA 3GTGH 4RXNA 1PH3A 4YHHL 1J5EL 4DR4Q 2PMZE 2NVYH 1VQLA 1NBWA 4JC0A 2JA7H 3RZDH 3A0JA 1RIPA 5MGNA 3F2CA 2UXCQ 3PUYA 4B3SL 5GQOA 1SN8A 3KJOA 1P16A 4EQ5A 1D7QA 2GVAA 5GAEc 1RWDA 1IZ6A 1X56A 4TVMA 1ASZA 1A8VA 1K83H 4PZ8A 2JI2A 3A5UA 4AHWA 3JAMi 4A3CG 4AI2A 3W5OA 4JAEA 5BR8Q 5HY6A 4GNXB 1YV1A 4DR4L 4WJ4A 1IXRA 2IHEA 1WOCA 3B08B 1EQQA 1QZGA 1WJVA 3H3VI 3ULLA 3KDFB 2UXCL 2R7DA 4FDBA 5C3EH 2JA5H 4X64L 2GN5A 5LMUQ 2AKWB 3NELA 1XJVA 4LW1A 1SMWA 7RXNA 2YV5A 2I5LX 3I56A 1OTCA 2XJRA 4UY81 2CWAA 3RZTA 5BR8L 2I5HA 4DV4Q 2PVXA 4P75A 4A3JH 1HZCA 3HOZH 2BE5D 4JI8Q 1Q12A 1I5FA 1VQ6A 2JI1A 3CPWA 1X3GA 3ICEA 1B2JA 3A74A 2L0ZA 1WCMH 1X3EA 2HIXA 1CADA 3NFPI 5LMUL 4GNXC 1TWFH 1N34Q 1VQ9A 2M4VA 4KLKA 3LGJA 4Y52H 4OX9Q 4A3BG 5FJ8H 4NXMQ 5M5YH 2YYZA 3J7A5 1L1OB 5GROA 4LUVA 1YIJA 3WWLA 3KYXA 1XMOL 1L2FA 4JI8L 3HOYH 2UUBQ 3I4NG 1PH9A 4OO1G 2K75A 4AR4A 4AQYQ 4DR6Q 1SRUA 1XMQQ 3SGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEB A;  1GD7 A;  1Q46 A;  2WB1 E;  1L1O A;  4DV6 L;  2JA8 G;  2MO0 A;  4KHP L;  2QL0 A;  2PI2 E;  1N34 L;  4JV5 Q;  1PVO A;  4GLA C;  3U4V A;  4ME3 A;  4AYB G;  2CKZ B;  4GOP A;  3CD6 A;  1YEZ A;  1JYB A;  3SS2 A;  1T9O A;  1XNQ L;  4OX9 L;  1YUX A;  2EIF A;  3CC2 A;  3CCL A;  4A3I H;  2MO1 A;  2OQ0 A;  1T9P A;  1N9W A;  1Y1W H;  2IX1 A;  3OTO Q;  3HOW G;  4NXM L;  4A93 H;  1I50 H;  1HNZ Q;  1S40 A;  1C0A A;  1VQE A;  1HZ9 A;  4YCU A;  5JJK A;  1R0J A;  3CME A;  4DUY Q;  2MFI A;  4H02 A;  4JOI A;  4DK6 C;  3F2B A;  2E2H H;  1NMF A;  3HKZ E;  4ALP A;  2OCE A;  3AYH B;  4MNO A;  2Y0S G;  4R4Q A;  3S1R H;  1TWC H;  1J6Q A;  2NN6 G;  5FLM G;  3G6E A;  1K0R A;  2WP8 J;  2QA4 A;  1EYG A;  2R92 G;  1X3F A;  5IYD H;  1G6P A;  1E8J A;  3UDI A;  4A4I A;  4K0K Q;  1PH4 A;  3M85 A;  2CFM A;  3W1B A;  1U0L A;  4LF8 Q;  2KHJ A;  1EOV A;  1VCX A;  3GTK H;  4JI7 Q;  4L5S A;  4PZ7 A;  2UXD L;  1VQD A;  1SRO A;  1XPO A;  3I4M H;  1JJ2 A;  3GDE A;  4QIW E;  1PH7 A;  1VQC A;  3D0F A;  1HR0 Q;  5IYC G;  4TVA B;  1YZ6 A;  4HIO A;  1Q1E A;  3CPF A;  3M4P A;  4DR3 Q;  1VQ4 A;  2Q2H A;  4AYB E;  2UUB L;  1JT8 A;  4R4I A;  3UDX A;  2ZM6 L;  4C3H H;  2RCN A;  4JI4 Q;  3PSI A;  1PV4 A;  1YK4 A;  3D31 A;  1G29 1;  3RR5 A;  4BY1 G;  4AQY L;  2I5M X;  3CCU A;  1VQJ A;  1Q81 C;  4LF9 Q;  4DR6 L;  2PQA A;  2PYA A;  1KAW A;  5GAE C;  1XMQ L;  1H7V A;  1KC8 C;  2RHQ B;  4JBW A;  2HHH L;  1PH6 A;  4HJ8 A;  2PVE A;  1KHI A;  1VQB A;  2NN6 I;  2YTX A;  2JA5 G;  1CUK A;  2VNU D;  1OXU A;  5LMN Q;  1FVI A;  3WWV A;  3RN2 A;  2B3G A;  4JI5 Q;  3I7F A;  4JV5 L;  5LMN W;  1B7Y B;  2JA9 A;  2YTY A;  4A3K G;  4DR1 Q;  4BXX H;  3PUZ A;  1RYT A;  1DGS A;  2N8N A;  4J15 A;  5GAG C;  2R93 G;  4NPS A;  1C09 A;  3OW2 A;  3AFQ A;  4C2M H;  1IL2 A;  1LKP A;  4DNI A;  2K2D A;  2KKD A;  2DUD A;  4JCV E;  1FL0 A;  4NB3 A;  1V43 A;  1Q1B A;  4MTN A;  5H1S E;  4DV5 Q;  1SFO H;  2RHS B;  5J3B A;  1UWV A;  5C44 G;  4JOI C;  3PIO A;  3OTO L;  3RNU A;  1KQS A;  1HNZ L;  4IPC A;  4C3I H;  3T1H Q;  2K5N A;  4OWX B;  1PFS A;  2MS3 A;  2MQH A;  1ZRP A;  1GVP A;  2R6G A;  3H0G H;  3W1G A;  3J80 c;  1X9N A;  2VUM H;  4A3B H;  3PUV A;  2JA6 G;  1LM0 A;  2KBN A;  3CCQ A;  2PNH A;  1VQO A;  3EBE A;  3KLW A;  1RL2 A;  4K0K L;  3F2D A;  1OXX K;  1UE7 A;  3AFP A;  1I94 Q;  2L15 A;  1IBM Q;  4LF8 L;  3MEF A;  1NE3 A;  1A0I A;  4JI7 L;  5GAD C;  2HIV A;  4LF6 Q;  1QCV A;  1VQI A;  3H15 A;  3DLL A;  3HOU G;  4QQB X;  1EFW A;  1K8A C;  1T9H A;  3S1N H;  4OWT B;  3NEN A;  1HR0 L;  3CQZ H;  4DR3 L;  2GVB A;  3PUW A;  4IOC A;  1PYS B;  4LF7 Q;  1TWA H;  4A3J G;  4LUO A;  1EUJ A;  1IU5 A;  4JYA Q;  4K9F A;  6RXN A;  4DV7 L;  1HNW Q;  2E5L L;  4JI4 L;  3ULP A;  2D0O A;  2JE6 I;  2JEB I;  2KCM A;  1NTG A;  1UE6 A;  4R4T A;  3H3V H;  1IYJ B;  4RG1 A;  3F1Z A;  2WAQ E;  4LF9 L;  5IT9 c;  1R0H A;  1B8A A;  2K5H A;  4DV4 L;  3I4N H;  1YHB A;  2KN9 A;  4O2D A;  4DPG A;  4GOP B;  3I2Z A;  1MKH A;  3AEV A;  4BBS G;  4A3C H;  4IJL A;  3L2P A;  4A3D G;  3J81 c;  3DM3 A;  3J80 i;  4B3R Q;  3CW2 C;  2DSX A;  4UP8 A;  2JK8 A;  2MNA A;  5M3M G;  5LMN L;  1H95 A;  3MPS A;  4HJ7 A;  2B63 H;  1QYB A;  1B70 B;  4JI5 L;  1A63 A;  1GO3 E;  3PUX A;  1FGU A;  4DR1 L;  5M3F G;  1M1K C;  4MZ9 A;  4RMF A;  2OQK A;  2IT1 A;  2R7F A;  3HKS A;  1AE3 A;  2ZTC A;  3M4O H;  4JI2 Q;  2JA8 H;  1LKO A;  3CCJ A;  4DV5 L;  5IP9 H;  3KF6 B;  1QVG A;  3G48 A;  2ZTE A;  2KCT A;  2PI2 A;  3CMA A;  4A3M H;  4PZ6 A;  4X64 Q;  3T1H L;  1IU6 A;  1EQR A;  5M5W H;  2CWP A;  2UU9 Q;  4JI6 Q;  3PIP A;  1IRO A;  4DKA C;  4PMW A;  1B2O A;  5FJ8 G;  3CCS A;  2I0Q A;  1FJG Q;  4AR5 A;  4TPU A;  1WI5 A;  4A3F G;  3HOW H;  4HJA A;  2RDV A;  4JI0 Q;  3U50 C;  3J7Z C;  4YY3 Q;  2R7Z G;  3VDY A;  3ULJ A;  1VQ7 A;  5DLQ E;  3T1Y Q;  3HOX G;  3STB C;  1WFQ A;  3BJU A;  4X6A H;  4B3M Q;  1I94 L;  2HQL A;  1IBM L;  1Y14 B;  1Q86 C;  2VL6 A;  2K4K A;  1YJW A;  4IPH A;  3GTL H;  4QL5 A;  3MXN B;  1OXT A;  4UP9 A;  4LF6 L;  2JEA I;  3J81 i;  4PG3 A;  5ELN A;  3PZA A;  4QJF A;  3RZO H;  1CKN B;  1CSQ A;  1S2Z A;  3KYV A;  1JJC B;  2PQA B;  1VQ5 A;  2AWO A;  1XNR Q;  4OO1 I;  3UE1 A;  5C4X G;  1CAA A;  3G4S A;  1K73 C;  2ZTD A;  4AR3 A;  4LUZ A;  3GTJ H;  1ASY A;  4JYA L;  1HNW L;  1Y1V G;  5JJI A;  1BRF A;  1K3R A;  1MIU A;  1FHM A;  1OXS C;  2V1C C;  3TRE A;  2NZH A;  2OTJ A;  1X55 A;  3FHW A;  5JEA G;  1SMX A;  5M5X H;  3TQY A;  4B3T Q;  3RYG A;  3KF6 A;  4BA2 I;  3JC6 3;  2H5X A;  4O0A A;  2WFW A;  1IBL Q;  4JBJ A;  1LKM A;  1C9O A;  1JE5 A;  1RDV A;  3KYW A;  1V9P A;  1IRN A;  2JQO A;  4BY1 H;  4B3R L;  1BBU A;  5IYB G;  1Q7Y C;  3TS2 A;  4DV3 Q;  1XTD A;  4GKJ Q;  2LXJ A;  5ELO A;  4BBR G;  1LTL A;  3JC6 6;  5IY0 A;  1PH5 A;  1R0G A;  1PH1 A;  2ZJQ A;  1BQ9 A;  1TWG H;  1YNX A;  4JI2 L;  3Q8D A;  5FLX c;  4YWL A;  5AJ3 Q;  4A3E G;  4YHH Q;  3UE0 A;  4A3K H;  1Q8K A;  3K7U C;  4YWK A;  1J5E Q;  1N32 Q;  3EIV A;  2LCQ A;  3L7Z C;  2NVX H;  1CKN A;  1V1Q A;  2R93 H;  1BQ8 A;  3BU2 A;  3PV0 A;  4A3I G;  1D8L A;  3FKI G;  4QY7 A;  2UU9 L;  4JI6 L;  1R0F A;  4Y7N H;  3CF5 A;  1Y1W G;  1EIY B;  1FJG L;  2IY5 B;  4P73 A;  1E7Z A;  1L1O C;  3ZJY C;  3ER0 A;  1Z9F A;  5IE8 A;  4DV0 Q;  5C3E G;  1DX8 A;  4JI0 L;  4GLX A;  4YY3 L;  4JI1 Q;  4DR5 Q;  3ERS X;  2RF4 A;  2K50 A;  3T1Y L;  4GOP C;  2LXK A;  3HOV G;  4B3M L;  2UUC Q;  2JJQ A;  1LUZ A;  1EIF A;  1CSP A;  2Z0S A;  3I4O A;  1L0W A;  4DAM A;  1IBK Q;  4B3S Q;  1TXY A;  4DR7 Q;  1UE1 A;  2UXB L;  1AH9 A;  5EAY A;  4A3G H;  2BA1 A;  4A3L H;  3S16 H;  5JEA J;  1XNR L;  2WAQ G;  4TQU S;  4X65 Q;  2Q2U A;  2B29 A;  1FHH A;  4UY8 C;  1K8G A;  1KRT A;  4DR2 Q;  2HT1 A;  3S15 H;  4BY7 H;  3KDF A;  1HNX Q;  1MJC A;  4LF5 Q;  2F3I A;  4DUY L;  3I4M G;  3HOU H;  1KL9 A;  2FXQ A;  2KEN A;  3AQQ A;  3K0X A;  1VQN A;  1Z47 A;  2EXD A;  4EX5 A;  4L5Q A;  3KF8 B;  4UP7 A;  4R4O A;  4DUZ Q;  1XMO Q;  4IO9 A;  1PH2 A;  1DVB A;  4DV2 Q;  3CCV A;  1QZH A;  5E7N A;  3RLF A;  2NVQ H;  3GTO H;  4GN4 B;  5HGQ A;  1YVC A;  2BA0 A;  1QUQ A;  2EQS A;  2Z6K A;  4R4C A;  1R9T H;  2QEX A;  1NJI C;  1KIX A;  1K9M C;  4LF4 Q;  1BBW A;  4DV3 L;  4GKJ L;  1I3Q H;  2N78 A;  4XIG S;  4X66 Q;  3S1Q H;  2F4V Q;  1PA6 A;  1SMM A;  3BZK A;  3L0O A;  1XPU A;  3GTG H;  5M3M H;  3HOZ G;  4RXN A;  3S17 H;  2VZA A;  3PF4 A;  5IP7 G;  5AJ3 L;  1VQM A;  4YHH L;  1PH3 A;  1J5E L;  3GTP H;  5M3F H;  4DR4 Q;  2UXB Q;  2PMZ E;  3A44 A;  3K81 C;  3RZ6 A;  1YIT A;  2NVY H;  2AMC B;  3I55 A;  1VQL A;  1NBW A;  4JC0 A;  2JA7 H;  1S72 A;  4LFB Q;  2E8G A;  3JAM c;  1WCM G;  2ATW A;  4X62 Q;  3RZD H;  4OXP A;  2A19 A;  2VQF Q;  1YJ9 A;  3A0J A;  1A62 A;  4DV0 L;  3GTM H;  1RIP A;  4AR6 A;  4JI1 L;  4DR5 L;  5JJL A;  1NMG A;  3H0G G;  4HJ9 A;  2VUM G;  4POF A;  4IPD A;  2UUC L;  1NY4 A;  3F2C A;  1GKH A;  2V3B B;  1P8L A;  1BE7 A;  1JB7 A;  2YU9 H;  2UXC Q;  3PUY A;  4DR7 L;  2ZJR A;  1IBK L;  4B3S L;  4GKK Q;  3RLN A;  5GQO A;  3QVD A;  4KHZ A;  3RLO A;  2NVT H;  2R7Z H;  2UUA Q;  3PGZ A;  1HZB A;  2IX0 A;  3HOX H;  4X65 L;  2VW9 A;  3G71 A;  1SN8 A;  3KJO A;  4LFC Q;  1P16 A;  4DR2 L;  4OON A;  3PO3 G;  5C0X G;  1Q82 C;  1KRS A;  4EQ5 A;  3KOJ A;  1HNX L;  4LF5 L;  2GVA A;  2KHI A;  3M3Y H;  1D7Q A;  1VQ8 A;  1OXV A;  1YUZ A;  2N49 A;  1E1O A;  2QGQ A;  1RWD A;  1IZ6 A;  1QVC A;  2CQO A;  1X56 A;  4HIK A;  1C7Y A;  1ASZ A;  3PO2 G;  4DUZ L;  1A8V A;  3PF5 A;  1S24 A;  1Y1V H;  4DV2 L;  2K14 A;  1K83 H;  5K36 G;  4PZ8 A;  2YTV A;  4DV1 Q;  4AIM A;  3A5U A;  1RDG A;  1VQP A;  3KFU A;  4LF4 L;  4XTC S;  5FLM H;  3JAM i;  1M90 C;  2R92 H;  4A3C G;  3W5O A;  1YHA A;  2AWN A;  3UDF A;  1VQF A;  4X66 L;  4P71 A;  2F4V L;  1YBY A;  3CCE A;  5BR8 Q;  5GAH C;  5HY6 A;  4LF7 L;  3HFZ B;  3KJP A;  3CCR A;  4GNX B;  1N36 Q;  4A76 A;  3BZC A;  4IFD G;  3HOY G;  1YV1 A;  2M4Y A;  4DR4 L;  5C0X I;  5IYC H;  3S2D H;  1IXR A;  1YHQ A;  2IHE A;  1MJE A;  4WJ4 A;  1G51 A;  1WOC A;  5IP9 G;  4QGU A;  1WJJ A;  1X65 A;  5IWA Q;  1PHJ A;  2C35 B;  1S3O A;  1PH8 A;  4LFB L;  4A3E H;  4X62 L;  2VQF L;  4A3M G;  3NBH B;  1EQQ A;  1AE2 A;  1QZG A;  2BH2 A;  1O7I A;  4WJ3 M;  2Q2T A;  3H3V I;  3FKI H;  3TEH B;  3ULL A;  1HH2 P;  5C0X J;  3KDF B;  3CP0 A;  1EWI A;  2CCZ A;  2UXC L;  1RB9 A;  4A75 A;  4JI3 Q;  2R7D A;  2AHO B;  4FDB A;  4IPG A;  5C3E H;  3E9I A;  2VQE Q;  2JA5 H;  3S1M H;  4GKK L;  2UUA L;  2F52 A;  3U58 A;  2BH8 A;  4LFC L;  1BVS A;  1N33 Q;  3HOV H;  4KI0 A;  4UPA A;  1GM5 A;  3JC6 2;  3CC4 A;  4IFD I;  4X64 L;  1CKO A;  2GN5 A;  5LMU Q;  3TRZ A;  1QUQ B;  4P72 A;  4A93 G;  1X6O A;  4GNX A;  2AKW B;  3NEL A;  1U5K A;  5C44 H;  1YI2 A;  1VS0 A;  3M9B A;  1XJV A;  4LW1 A;  4IJH A;  4BA1 I;  3F8T A;  4DV1 L;  1SMW A;  7RXN A;  2YV5 A;  2I5L X;  4GN3 B;  3I56 A;  1OTC A;  2LSS A;  4IFD J;  1HZA A;  1HR0 W;  4HIM A;  2JA6 H;  3CC7 A;  1VQG A;  1QVF A;  5IYD G;  1B71 A;  4DV7 Q;  3PCO B;  2DGY A;  3IRB A;  1S30 A;  2CWA A;  2E5L Q;  4HID A;  3K8A A;  3RZT A;  5BR8 L;  1R0I A;  2D62 A;  2I5H A;  5RXN A;  4DV4 Q;  1N36 L;  1YK5 A;  4L5R C;  4P74 A;  2PVX A;  1E22 A;  3E0E A;  1HJP A;  2E2I H;  2IHF A;  3TS0 A;  2Y0S E;  8RXN A;  3E9H A;  1X54 A;  4IOA A;  4P75 A;  4A3J H;  2OTL A;  1LYL A;  1SE8 A;  1VQH A;  4DAY B;  1E3P A;  2K5V A;  4B3T L;  5IWA L;  1HZC A;  2NZO A;  3HOZ H;  3OYY A;  4JI8 Q;  4HJ5 A;  5IP7 H;  1IBL L;  1Q12 A;  1I5F A;  1VQ6 A;  3CXC A;  3CPW A;  3K7A H;  4LFA Q;  1X3G A;  4YCV A;  3B6Y A;  1YJN A;  3ICE A;  1B2J A;  1XPR A;  4NXN Q;  3A74 A;  3GD7 A;  4BBS H;  1UE5 A;  1WCM H;  4A3D H;  4JI3 L;  4POG A;  4DK3 C;  1X3E A;  2HIX A;  1WYD A;  2VQE L;  3KYU A;  2D0P A;  3PWF A;  1CAD A;  2A1A A;  3J81 j;  4BXX G;  2GMG A;  1N33 L;  1KXL A;  1N32 L;  3U4Z A;  4DV6 Q;  4A3G G;  4A3L G;  1SR3 A;  5LMU L;  1TWF H;  4GNX C;  4KHP Q;  1PYB A;  4C3J H;  1N34 Q;  1VQ9 A;  4GS3 A;  4KLK A;  1CKM A;  4JG2 A;  4BY7 G;  1VQK A;  3M4Q A;  3S2H H;  2OWO A;  3LGJ A;  3PO3 H;  1E1T A;  2VS1 A;  3CAM A;  4JBK A;  4OX9 Q;  1XNQ Q;  4A3B G;  4Y52 H;  2XGT A;  1JMC A;  1KD1 C;  5FJ8 H;  4GN5 A;  4NXM Q;  5M5Y H;  3EN2 A;  4A3F H;  2XTI A;  2ES2 A;  1BKB A;  2YYZ A;  3PO2 H;  2ID0 A;  3A5Z B;  3STB D;  3J7A 5;  1L1O B;  3M7N A;  2WB1 G;  1T9Q A;  1SLJ A;  5AI3 A;  1W3S A;  4OWW B;  1E24 A;  3GO5 A;  1VQA A;  5GRO A;  4LUV A;  3UDG A;  1SMU A;  2ALY B;  2Q2I A;  2A8V A;  2VY3 A;  1YIJ A;  2HR5 A;  1B13 A;  4YWM A;  3FP9 A;  5C4X H;  1JJG A;  1W2B A;  3KYX A;  2ASB A;  3GTQ H;  2UXD Q;  4LWC A;  1XMO L;  4LNQ A;  1L2F A;  3NEM A;  2Z6K C;  4JI8 L;  3KYH C;  4R1J A;  3HOY H;  5AI2 A;  5C4J H;  3K80 C;  2N3S A;  2UUB Q;  1PH9 A;  3I4N G;  3S14 H;  4GLV B;  2E2J H;  4LFA L;  4L5T A;  3HKZ G;  1I6H H;  2ZM6 Q;  2JA7 G;  4NXN L;  2K75 A;  3S24 A;  4APV A;  3CCM A;  4JBM A;  1BFY A;  4YCW A;  4OO1 G;  2ZJP A;  4AR4 A;  4AQY Q;  1N8R C;  1NNQ A;  4DR6 Q;  2K52 A;  4AH6 A;  2B63 G;  1SRU A;  1XMQ Q;  1TWH H;  1VCI A;  5IYB H;  3KYY A;  2HHH Q;  3SGI A;  3RN5 A;  4BBR H; 
#chains in the Genus database with same CATH topology
 4KN4 C;  5EKK A;  2J0T D;  1CFM A;  1N34 L;  4JV5 Q;  2B2W A;  3U4V A;  2HUG A;  4GOP A;  3CD6 A;  4OX9 L;  2EIF A;  3BVG A;  3D4R A;  4ULL A;  2LS0 1;  1I3Q L;  4O42 A;  1JWM D;  4NXM L;  2SDF A;  1VQE A;  1QE6 A;  4YCU A;  1NCV A;  3CME A;  3GTG L;  4JOI A;  4OO1 I;  2E2H H;  1NMF A;  5CMD A;  2OCE A;  1CA6 A;  2Y0S G;  5D3I B;  3S1R H;  1PZX A;  2NN6 G;  4FXD A;  2WP8 J;  1PRT C;  4V19 0;  1G6P A;  1E8J A;  1U4L A;  2JA7 L;  2M2L A;  3M85 A;  2CFM A;  1SMY D;  1EOV A;  2B2Y A;  3GTK B;  1F9S A;  5C3W A;  4L5S A;  3A8K E;  4RCO A;  1VQD A;  1JJ2 A;  3GDE A;  4TVA B;  2UUB L;  3CPF A;  1VQ4 A;  4AYB E;  3V05 A;  3UDX A;  4B08 A;  5TSS A;  1AEX A;  1PV4 A;  1YK4 A;  1BCP D;  1G29 1;  4AQY L;  4XXB B;  2JI3 A;  4DR6 L;  1CI3 M;  2MJ8 A;  2FFK B;  1XMQ L;  1EY4 A;  1KDB A;  2RHQ B;  1KC8 C;  1DYQ A;  2IWH A;  1PH6 A;  4HJ8 A;  4P2C B;  1KHI A;  1VQB A;  2NN6 I;  2VNU D;  2K32 A;  4EGV A;  5LMN Q;  4JV5 L;  3I7F A;  5LMN W;  1K83 L;  4BXX H;  2C6A A;  4IQZ A;  2ERS A;  2R93 G;  3K5L A;  1C09 A;  3AFQ A;  1LKP A;  4DNI A;  4DV5 Q;  4MTN A;  1PH8 A;  3IAY A;  5C44 G;  1KQS A;  5FO9 B;  2K1B A;  3TP8 A;  3GTJ L;  3T1H Q;  4C3I B;  2K5N A;  4OWX B;  2Z3Q B;  1ZRP A;  2A69 D;  1LT5 D;  1X9N A;  5FLX E;  5DM7 1;  1LM0 A;  3CCQ A;  3R2I A;  4ZAI A;  1RL2 A;  2EE1 A;  1SYG A;  1OXX K;  1I94 Q;  2WV6 D;  3LWU A;  1NE3 A;  2EOT A;  1A0I A;  3QR8 A;  2CW0 C;  2F0D A;  3H15 A;  2XSC A;  4KD3 A;  1I3Q B;  4CDC C;  1T9H A;  3MHB A;  3S1N H;  3NEN A;  2A74 C;  4IOC A;  4F8M A;  4LF7 Q;  2F4I A;  1W6K A;  2PZT A;  1EUJ A;  3K35 A;  1OWC A;  2JA5 L;  3GTG B;  3NTH A;  5IGD A;  1W6J A;  3ULP A;  2JEB I;  1S4Z A;  1NTG A;  3NTK A;  3F1Z A;  2WAQ E;  4O2D A;  4DPG A;  4GOP B;  4X3U A;  1ZEQ X;  2L12 A;  2Z6B A;  3KLS X;  4NP5 A;  3T56 B;  4BBS G;  3AEV A;  2JA7 B;  4IJL A;  3L2P A;  4K8I A;  3KK7 A;  5NUC A;  2DSX A;  2MNA A;  5M3M G;  5LMN L;  4XXE A;  4HJ7 A;  1QYB A;  1B70 B;  3PUX A;  1KLG D;  5M3F G;  1E0B A;  2OQK A;  1XWE A;  2IT1 A;  2R7F A;  2RBM A;  1K8O A;  2ZTC A;  3C1E A;  1IHZ A;  3D6W A;  3CCJ A;  4V0B A;  4DV5 L;  3G48 A;  4UHV A;  3C3L A;  4A3M H;  3T1H L;  3A7A B;  4RHR A;  3H9C A;  1FJG Q;  3GQB A;  4TPU A;  3HOW H;  4HJA A;  4A3J L;  3T1Y Q;  1K83 B;  1H9K A;  1I94 L;  3B0A B;  2K4K A;  3JAM E;  5CV7 A;  4UP9 A;  5EIN C;  3J81 i;  3DUZ A;  4PG3 A;  3PZA A;  1MSH A;  4XDX A;  1CSQ A;  4JK1 C;  3S1Q L;  3DEP A;  3Q6S A;  2IPK D;  5C4X G;  3LWV B;  3GTJ B;  5JJI A;  4LHL A;  1MIU A;  1OXS C;  2B8F A;  2NZH A;  1X55 A;  4XQJ A;  3PKJ A;  5MLC 3;  2NYD A;  3A8J E;  3DWQ A;  4BA2 I;  2AQ3 B;  1PTO H;  2WFW A;  1IBL Q;  4WJW A;  5C5M A;  1STY A;  4LMQ D;  1D5Z C;  2JQO A;  3SK8 A;  5H1S c;  2SNM A;  3TS2 A;  4GKJ Q;  2KED A;  2B2V C;  1HA5 A;  2YU9 L;  1H9S A;  1BQ9 A;  1TWG H;  2NVT L;  3R8B A;  4A3E G;  3HOX L;  4A3K H;  1Q8K A;  3K7U C;  2QDL A;  4YWK A;  1N32 Q;  1EY0 A;  2XJV A;  1UAP A;  2NVX B;  1HRJ A;  1V1Q A;  5EGT A;  3BU2 A;  3PV0 A;  3O13 A;  3FKI G;  4OIK A;  1EU3 A;  1Y1W G;  1EIY B;  5KYL A;  1FJG L;  4E6Y A;  3ZG6 A;  3H3V C;  4JI1 Q;  2K50 A;  2MPM A;  4GOP C;  3T1Y L;  1Y1V L;  2LXK A;  3NQT A;  5JPN C;  4DAM A;  3BVM A;  1SJH D;  1TXY A;  3X3N A;  3NSW A;  4A3G H;  4A3L H;  1QQT A;  4UY8 C;  3S15 B;  2BDO A;  4DR2 Q;  3I4L A;  1I4Q A;  1GHJ A;  4LF5 Q;  2F3I A;  4DUY L;  2FXQ A;  4EQP A;  4EX5 A;  1STB A;  4DGZ A;  1ONL A;  3AMU A;  1LTA D;  5D65 A;  3R2T A;  4R4O A;  4A3J B;  1DVB A;  2B2Y C;  3NP8 A;  3CCV A;  3C1F A;  5E7N A;  2F0S A;  4DV2 Q;  3DWA A;  4GKJ L;  1NR2 A;  2HDL A;  3DWP A;  4X66 Q;  1PZJ D;  2RDF A;  1H9M A;  3E5S A;  1PA6 A;  1GUS A;  3S1Q B;  2ZXP A;  3MA2 B;  4B8C D;  4FF1 A;  2VZA A;  3PF4 A;  5IP7 G;  1VQM A;  2DNE A;  3S1R L;  3K81 C;  2O5I C;  2AMC B;  2ZIX A;  4LFB Q;  3GTO H;  4OXP A;  2VQF Q;  1YJ9 A;  1A62 A;  5JJL A;  5C44 L;  4JI1 L;  1ZYR C;  1NMG A;  3H0G G;  4E6I A;  3PIO 1;  1EIG A;  1C4Q A;  2YU9 B;  2K5D A;  1DM0 B;  1D5X C;  3U9S A;  4GKK Q;  2F0K A;  3RLN A;  3QVD A;  1LTB D;  2Z4H A;  2R7Z H;  2NVT B;  3TN2 A;  3HOX B;  3G71 A;  1L0Y B;  1HUM A;  4DR2 L;  3PO3 G;  1KRS A;  3KOJ A;  4LF5 L;  2RFK B;  3J7Z 1;  1YUZ A;  2QGQ A;  1QVC A;  4O1N A;  3PO2 G;  5ELE A;  1B2T A;  1S24 A;  1H9S B;  4DV2 L;  1Y1V B;  2K14 A;  5C6A A;  4DV1 Q;  4G4K A;  1RDG A;  1VQP A;  3KFU A;  4XTC S;  3MWY W;  1M90 C;  5GAG c;  3UDF A;  4X66 L;  3J7Y 1;  1YBY A;  4BBS L;  5GAH C;  2EY1 A;  5EQ0 A;  3HFZ B;  1MSG A;  4ZK9 B;  1TS3 A;  4HCS A;  1GJX A;  1WTP A;  2XJP A;  3S2D H;  1YHQ A;  1KAA A;  1ICW A;  4U68 A;  3SEB A;  1MJE A;  3LWQ B;  5IP9 G;  4QGU A;  1WJJ A;  5IWA Q;  1PHJ A;  4LFB L;  2DJG C;  3E0J A;  3DMU A;  2VQF L;  1AE2 A;  2MHV A;  1O7I A;  4UAI A;  3IL8 A;  4BS9 A;  1BDO A;  2Q2T A;  2ICE C;  1HH2 P;  5C0X J;  1E2W A;  2M6P A;  2OT2 A;  4RKL A;  1EWI A;  1RB9 A;  4K2K A;  4JI3 Q;  2AHO B;  4GKK L;  3E9I A;  3S1M H;  2L11 A;  2D9U A;  4G7H C;  2M00 A;  4N9P A;  3HOV H;  1H9R A;  4KI0 A;  4UPA A;  1DON A;  3JC6 2;  4DK0 A;  4KY5 A;  5K5P A;  5DM6 3;  3TRZ A;  4P72 A;  4R9W A;  4G57 A;  4GNX A;  5IGG A;  4U67 1;  1STN A;  4YIJ A;  3M9B A;  4RGT A;  5C44 B;  2F0Q A;  3ERQ A;  1F2Z A;  2ICI A;  4DV1 L;  1MD2 D;  4IFD J;  1HZA A;  5C4J L;  4HIM A;  2JA6 H;  1L0X B;  2EY2 A;  1P7P A;  5FO8 B;  2DGY A;  2E5L Q;  1ILQ A;  3K8A A;  3J7A V;  2D62 A;  2ZXR A;  3D4W A;  3R3O A;  4HAE A;  3QQC E;  4L5R C;  1TWH L;  4FYD A;  2AQ2 B;  4DN4 M;  1BR9 A;  1HJP A;  2PMZ P;  2IHF A;  3TS0 A;  2Y0S E;  3E9H A;  4IOA A;  1X54 A;  1FYC A;  5JVH 1;  1VQH A;  2A6H C;  1E3P A;  2K5V A;  5IWA L;  1A2U A;  1LTS D;  3OYY A;  4HJ5 A;  3RD4 A;  3CXC A;  3NWS A;  3B6Y A;  3MSU A;  3P2A A;  2VB2 X;  2KA7 A;  3TBI B;  2BCO A;  2EDG A;  2XIW A;  2A68 D;  1EFI D;  4K8J A;  1DJR D;  4A93 L;  1IYU A;  2LMC B;  2XJS A;  4BBS B;  2RDG A;  4A3D H;  4JI3 L;  1KTK A;  1WYD A;  2F0U A;  3N52 A;  1PYW D;  3H09 A;  4ZUJ A;  4L63 B;  5IYD L;  4X3T A;  4C3J H;  1LV9 A;  1CKM A;  3M4Q A;  3S2H H;  1O78 A;  1LT4 D;  1SAP A;  1E1T A;  2VS1 A;  3CAM A;  4JBK A;  2PW5 A;  4KKS A;  1O80 A;  2F0G A;  3VA7 A;  3EN2 A;  3VR6 A;  4WOR A;  1TWG L;  5EKL A;  2X6L A;  2ID0 A;  3A5Z B;  3STB D;  2BE5 C;  3LNL A;  4IUU A;  1E24 A;  5T1I A;  3FDT A;  1ROD A;  2Q2I A;  3LWO B;  2WB1 P;  4V19 6;  2Z9H A;  4YWM A;  1Y8P B;  5E4W C;  2HVY C;  3PIO 3;  3GTQ H;  2UXD Q;  4K14 A;  1B50 A;  3K80 C;  2N3S A;  4NMZ A;  5C4J B;  3S14 H;  4JPB W;  1CHQ D;  1LTG D;  2JA7 G;  2O4X A;  4A3L L;  4APV A;  3CCM A;  1BFY A;  4YCW A;  1FR3 A;  1G2T A;  3L3O C;  2K52 A;  4AH6 A;  3HKZ P;  1TWH B;  3H0G L;  2HHH Q;  4BBR H;  1UEB A;  1GD7 A;  2WB1 E;  1X32 A;  5HGT A;  1L1O A;  5IT9 E;  2EVB A;  2MO0 A;  2F0H A;  4ME3 A;  2CKZ B;  4JVZ A;  2F3V A;  1JYB A;  3SS2 A;  4WRD A;  1K28 A;  4RHS A;  3J81 E;  1MI2 A;  1T9O A;  1YUX A;  2FMM A;  4A3I H;  1T9P A;  1GXD C;  5GAD c;  1N9W A;  4A93 B;  3C2P A;  1S40 A;  2QEJ C;  2AQ1 B;  4H02 A;  4DK6 C;  4R8I A;  3PMF A;  3HKZ E;  3QOL A;  4ALP A;  4LHN A;  4CKB A;  4R4Q A;  2K28 A;  1TWC H;  3G6E A;  5IGC A;  4A4I A;  1PH4 A;  3OPO A;  3W1B A;  1U0L A;  4LF8 Q;  4AI0 A;  3GTO L;  1STH A;  2UXD L;  2B63 L;  5I4D A;  1V1O A;  3ONA B;  1PH7 A;  4QIW E;  1J9O A;  1VQC A;  1PDQ A;  1Q1E A;  2Q2H A;  4KD4 A;  5COY A;  2K03 A;  3MFY A;  1TWG B;  1NXE A;  3DM1 A;  2PZW A;  2C6B A;  2JA8 L;  4JI4 Q;  1JIC A;  1WTO A;  3MXN A;  3RR5 A;  3D31 A;  1QOH A;  3CCU A;  3D8G A;  2PQA A;  5GAE C;  1H7V A;  3ERO A;  2QCP X;  3VYR A;  4U67 3;  2HHH L;  2PVE A;  3HS0 C;  2JA5 G;  1A3T A;  1SYB A;  1OXU A;  1FVI A;  3WWV A;  4KKT A;  4JI5 Q;  3AB9 A;  2JA9 A;  1XYI A;  4X6A L;  4DR1 Q;  4J15 A;  2N8N A;  2F1M A;  4C2M H;  4JAG A;  2KKD A;  2DUD A;  4JCV E;  3TME A;  1G91 A;  1SMY C;  2ENB A;  2F0T A;  3WDN A;  4CDD C;  1IKL A;  2R6G A;  1GVP A;  4A3B H;  3WWN B;  2VUM H;  3H0G B;  3PUV A;  5JVH 3;  2EYM A;  2KBN A;  4RGN A;  1VQO A;  1CHP D;  1SBB B;  3H97 A;  2B39 A;  3EBE A;  3KLW A;  5FK9 C;  2HD3 A;  2L15 A;  4LF8 L;  1DCZ A;  4G7O C;  1QNU A;  4BY1 L;  5GAD C;  2E76 C;  2H4O A;  1MBY A;  4L6T B;  3S9W A;  1J8I A;  5K2M E;  3CQZ H;  4TSS A;  1TWA H;  2A5H A;  2DJF C;  4LUO A;  4A3J G;  1IU5 A;  1QG7 A;  3S1M L;  6RXN A;  1HNW Q;  4JI4 L;  1F9Q A;  2D0O A;  2KCM A;  4TRD A;  4R4T A;  4RG1 A;  1R0H A;  2K5H A;  3I4N H;  4DV4 L;  1YNJ D;  1YHB A;  3HRZ C;  1DOK A;  2CHB D;  3FPP A;  4J8Q A;  1MKH A;  4CHT B;  4OO1 H;  2JN4 A;  1T5X D;  2RSN A;  1JCK B;  2D2C C;  2F0L A;  3TZD A;  3GTO B;  3J80 i;  4B3R Q;  3CW2 C;  2JK8 A;  1STE A;  1PXU A;  2B63 B;  4JI5 L;  2A69 C;  4IFD H;  1IYV A;  4DR1 L;  2CKC A;  3MVV A;  4MZ9 A;  1LAB A;  2JA6 L;  3M4O H;  1QJO A;  5E4X A;  2JA8 B;  2LY7 A;  3S16 L;  3KF6 B;  2PI2 A;  4AYB B;  4PZ6 A;  3GTM H;  1HXY D;  1HQM C;  3HOU L;  5FJ8 G;  1ILP A;  1B2O A;  1WI5 A;  3J7Z C;  4YY3 Q;  3OSO A;  3ULJ A;  3HOX G;  3BJU A;  2AUJ D;  4HMI A;  1VZI A;  2VL6 A;  3DEO A;  3L9A X;  5MFZ A;  4IPH A;  4OIJ A;  3GTL H;  1R9T L;  1JWU D;  2NN6 H;  3MXN B;  2C9O A;  4XQN A;  3RZO H;  1S2Z A;  2PQA B;  4K5X A;  3CKI B;  3UE1 A;  4AYB P;  4A3D L;  1Z6H A;  2ZTD A;  4LUZ A;  3SR1 A;  4K5V A;  1HNW L;  1Y1V G;  1BRF A;  1FHM A;  4NW2 A;  1SSO A;  3WOF A;  2OTJ A;  3FRP B;  5JEA G;  5M5X H;  1Y69 U;  4B3T Q;  4RGO S;  2NVY L;  2AUS B;  1LKM A;  1JE5 A;  1RDV A;  1AZP A;  1CM9 A;  1V9P A;  3RZD L;  3S2H L;  4M1U B;  4BY1 B;  4B3R L;  1TS5 A;  2WKD A;  1Q7Y C;  4DV3 Q;  2VXW A;  1XTD A;  2LXJ A;  5F2D A;  5ELO A;  2EY6 A;  4KK7 A;  3S1M B;  3OMC A;  1YNX A;  3Q8D A;  1IW7 D;  5FLX c;  2VB3 X;  4DK1 A;  2B2T A;  3L7Z C;  4PNY A;  4CBV A;  1O7Y A;  1B4O A;  2R93 H;  3TP5 A;  3VR2 A;  2P5Z X;  1R0F A;  4Y7N H;  4P73 A;  3ZJY C;  1L1O C;  3CHB D;  3ER0 A;  2RCF A;  3H91 A;  4YY3 L;  3ERS X;  2H1E A;  3M4Y A;  4WFN 3;  1LUZ A;  1EIF A;  2JA6 B;  1IBK Q;  2AYJ A;  1UE1 A;  4LAA A;  3OW7 A;  5EAY A;  3S16 B;  2HT1 A;  1B9M A;  1KRT A;  4BY7 H;  1EY7 A;  1A15 A;  1U4R A;  1HNX Q;  1AZQ A;  3HOU B;  2KEN A;  1VQN A;  2WAQ P;  4PMB A;  1PTO D;  1Z47 A;  4BBR L;  2F0N A;  5BN4 A;  4L5Q A;  4KN7 C;  1NXG A;  4S3S A;  3VR3 A;  4UP7 A;  4DUZ Q;  2TSS A;  4IO9 A;  3TSS A;  2NVQ H;  3RLF A;  1BO0 A;  5HGQ A;  4FO2 A;  1YVC A;  1R9T B;  1K9M C;  1TY2 A;  3X3M A;  4DV3 L;  1SND A;  4A3I L;  2F4V Q;  1EIH A;  3BS1 A;  4A3D B;  1GUN A;  3F2U A;  3L0O A;  1XPU A;  5C3E L;  5M3M H;  4F7X A;  2KCN A;  3GTP H;  2NTS A;  5ELB A;  5M3F H;  1SNO A;  3A44 A;  3RZ6 A;  2NVY B;  1Z92 B;  1K0S A;  4B9X A;  5EPJ A;  3JAM c;  4X62 Q;  2A19 A;  3RZD B;  3S2H B;  4CGY B;  4XQQ A;  4HJ9 A;  4CDF C;  3NUC A;  2O5J C;  4POF A;  4IPD A;  5IGF A;  1NY4 A;  1PFN A;  3D4D A;  1P8L A;  1BE7 A;  3NE5 B;  4DAY A;  1JB7 A;  1EWC A;  2ZJR A;  1IBK L;  1SE4 A;  3RLO A;  3QWN A;  4KHZ A;  4HCE A;  3Q0A A;  2VW9 A;  1KNA A;  1EOT A;  4OON A;  1RHP A;  3SE0 A;  1HNX L;  3M3Y H;  5CR3 A;  1I4H A;  2XNA C;  1OXV A;  5JOB A;  2CQO A;  2M9V A;  4HIK A;  5MFP A;  1C7Y A;  4JW0 A;  4DUZ L;  3PF5 A;  1GUG A;  5K36 G;  3HOZ L;  5A2Q E;  2YTV A;  4Q5V A;  1PRT D;  5FLM H;  4CJ0 B;  2R92 H;  1YHA A;  2AWN A;  1KLU D;  1VQF A;  4P71 A;  2F4V L;  1Q90 A;  4ME5 A;  1WCM L;  4LF7 L;  4G6B A;  1GUW A;  3BZC A;  2K7V A;  2VUM L;  3MFG A;  1TS4 A;  4BBR B;  5IYC H;  3VYU A;  1VF5 C;  2M6O A;  3V96 A;  1TWF L;  4ZCK A;  1S3O A;  1XXG A;  3MAQ A;  5DM6 1;  4A3E H;  4X62 L;  2OF1 A;  4A3M G;  3NBH B;  2BH2 A;  4WJ3 M;  4Y52 L;  4KHV A;  4A3I B;  3FKI H;  3CP0 A;  5IOC A;  5FJ8 L;  3WOE A;  5M5Y L;  3HGB A;  4A75 A;  2NBF A;  2G9H D;  1B1Z A;  2VQE Q;  5C3E B;  2JA5 B;  3U58 A;  1N33 Q;  5G3L D;  2F0I A;  1I4X A;  3FVQ A;  1D1I A;  5CV6 A;  3CC4 A;  5FOB B;  1CKO A;  3HG9 A;  4A93 G;  2F0F A;  3HJY B;  2PPT A;  4IUV A;  1U5K A;  1VS0 A;  4IJH A;  4CKE A;  3HOY L;  1JC7 A;  1HQR D;  3R93 A;  1HR0 W;  1TU2 B;  1VQG A;  3CC7 A;  5IYD G;  2PZU A;  4DV7 Q;  3PCO B;  1S30 A;  2RKS A;  3H6M A;  2A73 B;  3H94 A;  4HID A;  1R0I A;  2EYF A;  5RXN A;  2CW0 D;  1YK5 A;  3MZ5 A;  4RA8 A;  5E1F A;  4AI1 A;  3P20 A;  3E0E A;  2E2I H;  4XYQ A;  2OTL A;  1LYL A;  1SE8 A;  4DAY B;  3VPB E;  3I3C A;  4IUQ A;  2NZO A;  3HOZ B;  1IBL L;  5CYU A;  2NYZ D;  5IP7 H;  3GTL L;  1EEI D;  1XPR A;  3RZO L;  2G5D A;  1NNX A;  3GD7 A;  1ESF A;  3QG1 A;  1WCM B;  3U9O A;  2EZV A;  2B2T C;  2VQE L;  3KYU A;  2D0P A;  2XRS D;  2CH4 W;  2EXZ A;  2E2H L;  2VUM B;  1CZW A;  1N33 L;  1KXL A;  1N32 L;  3VR4 A;  3U4Z A;  5M5X L;  4XT3 B;  4A3G G;  4A3L G;  1WVL A;  1TWF B;  4KHP Q;  4GS3 A;  3MXU A;  4JG2 A;  1MHW C;  4QMG A;  3PO3 H;  5J39 A;  3NHH A;  1VDZ A;  2KQ3 A;  1KD1 C;  3I90 A;  4GN5 A;  5M5Y B;  4A3F H;  2XJU A;  1A3U A;  2KEE A;  3PO2 H;  3EJI A;  1PMR A;  3G7L A;  1T9Q A;  3QIA A;  1SLJ A;  2PSM C;  1W3S A;  4OWW B;  1CZG A;  1SMU A;  4Y7N L;  2ALY B;  5HUR A;  2E2D C;  2HR5 A;  3J80 E;  1B13 A;  2Z3R B;  4IN3 A;  3FP9 A;  3FPU B;  1W2B A;  2X6G A;  2ASB A;  1O7Z A;  4LWC A;  1WTW A;  2V0E A;  3KYH C;  4BXX L;  4R1J A;  5C3X A;  5AI2 A;  3HOY B;  1RTN A;  4ZN1 B;  4JAD A;  2E2J H;  4L5T A;  5MF6 A;  4EQO A;  2ZM6 Q;  3S24 A;  1PFY A;  4ZLT F;  1N8R C;  1BCP F;  4BY7 L;  1NNQ A;  3HP3 A;  3SVM A;  2B63 G;  1VCI A;  2H12 A;  5IYB H;  2CQA A;  4EVO A;  5COR A;  3RN5 A;  4N8X 1;  1QNK A;  1G8Z D;  2JA8 G;  4KHP L;  3OWF A;  2MGS A;  4UDU C;  2NVQ L;  4GLA C;  4AYB G;  3ND8 A;  4L8J A;  3IFD A;  4QUC A;  1YEZ A;  3GTL B;  5IT9 L;  3RZO B;  3CCL A;  3SK4 A;  2MO1 A;  2OQ0 A;  4PQX A;  3S1N L;  1JOO A;  3SDZ A;  2CVR A;  1SYD A;  3J81 L;  2MFI A;  3F2B A;  3NPP A;  2E2H B;  3IU3 I;  1EY9 A;  1TY0 A;  1PTO F;  3D3R A;  3S1R B;  1J6Q A;  5M5X B;  4ZYS A;  1K0R A;  2QA4 A;  1EYG A;  4M8A A;  2MP1 A;  4K0K Q;  2F0O A;  3UDI A;  3LWE A;  2Y0S P;  1F9P A;  2KHJ A;  2PMZ B;  1VCX A;  3GTK H;  4JI7 Q;  4PZ7 A;  2F03 A;  3MQK B;  3I4M H;  4DR3 Q;  1YZ6 A;  4HIO A;  3M4P A;  3PIP 3;  1JT8 A;  4H0L C;  4R4I A;  2XWB B;  2ZM6 L;  4C3H H;  2RCN A;  1AN8 A;  1SE2 A;  3PSI A;  3FMC A;  4RCN A;  4BY1 G;  5I9O A;  4LF9 Q;  5KND A;  1S5C D;  4A3M L;  1BOS A;  2AUK A;  2V4D A;  3HOW L;  4X3K A;  2X69 A;  1B7Y B;  2YTY A;  3PUZ A;  1DGS A;  5GAG C;  1D5M C;  2EPB A;  4NPS A;  5FLM L;  2R92 L;  1V43 A;  1Q1B A;  2WAC A;  1SYE A;  2RHS B;  3PIO A;  1UWV A;  3RNU A;  4BY7 B;  4IPC A;  5T1G A;  4C3I H;  1ZYR D;  1I4R A;  1PFS A;  4GZY C;  1U4M A;  3W1G A;  3BDC A;  2JA6 G;  2A6E D;  4ZKC B;  1STA A;  1XTC D;  1X3P A;  2PNR C;  5IYC L;  2PNH A;  4RH6 A;  5CV8 A;  4K0K L;  2TMP A;  2NVQ B;  5EIO C;  2WB1 B;  1IBM Q;  4JI7 L;  2HIV A;  4LF6 Q;  1QCV A;  3DLL A;  3HOU G;  5D3D A;  1K8A C;  3S1N B;  4DR3 L;  2HCI A;  1EYC A;  1CQV A;  1PYS B;  2DN8 A;  1YNN D;  4JYA Q;  3W2D A;  1VZG A;  2V0F A;  2E5L L;  1PFU A;  2JE6 I;  5I2X A;  1TKW B;  4JAF A;  1UE6 A;  3H3V H;  1IYJ B;  4A3K L;  1RD9 D;  1SDF A;  4LF9 L;  5IT9 c;  3J7A F;  4XT1 B;  5BN3 A;  3HKZ B;  4A3C H;  2FHT A;  4A3D G;  3J81 c;  1JE4 A;  4UP8 A;  1H95 A;  3MPS A;  5JAV A;  1A63 A;  1GO3 E;  2IX3 A;  1FGU A;  1M1K C;  1R4P B;  4RMF A;  4DNT B;  3HKS A;  1AE3 A;  1R4Q B;  4JI2 Q;  2QKI C;  4C3J G;  4A3G L;  1QVG A;  5G3L F;  2ZTE A;  5EJW A;  1VF7 A;  2CR8 A;  4X64 Q;  3DXJ C;  4A3M B;  1EQR A;  5DAU A;  1MGS A;  2CWP A;  2UU9 Q;  4JI6 Q;  4DKA C;  1F77 A;  1BCP B;  2B2U A;  3HOW B;  3I8Z A;  1SNP A;  2RDV A;  3U50 C;  3BYT B;  5J1Z A;  1VQ7 A;  5DLQ E;  3NQI A;  4B3M Q;  1IBM L;  1Q86 C;  1WTX A;  4Q0F A;  4QL5 A;  5EBC A;  4LF6 L;  2JEA I;  2R92 B;  4QJF A;  1CKN B;  3KYV A;  4QIW P;  3BDL A;  1XNR Q;  2RQX A;  1LT3 D;  4IUT A;  3G4S A;  1K73 C;  3GTJ H;  4AR3 A;  1ASY A;  4JYA L;  1SNM A;  4H7B A;  4RGM A;  4I7A A;  3TRE A;  3FHW A;  4F87 A;  1EY8 A;  1SMX A;  3EA6 A;  1HTL D;  1PFB A;  3TQY A;  3T16 A;  2XJQ A;  3KF6 A;  3SHL A;  1SYF A;  1SYC A;  2F0E A;  2H5X A;  1PTO B;  4JBJ A;  1IRN A;  1TQO A;  2EYL A;  4BBR G;  1LTL A;  3JC6 6;  1V1P A;  4ZQ3 A;  1R0G A;  4A3F L;  2ZJQ A;  4WFN 1;  5IOD A;  4FXG C;  2A6H D;  1RJT A;  3N6R A;  4JI2 L;  2R7Z L;  3URY A;  5AJ3 Q;  1DOM A;  3UE0 A;  2Q8R E;  4A3K B;  4IAL A;  4IUR A;  3EIV A;  2NVX H;  1C48 A;  1BQ8 A;  3OOC A;  4A3I G;  1LAC A;  4MTK A;  3LWR B;  2UU9 L;  4JI6 L;  4TKO B;  3CF5 A;  3HAX C;  1DXM A;  3KLS A;  1E7Z A;  4DAV A;  4DV0 Q;  5C3E G;  1DX8 A;  4DR5 Q;  2RF4 A;  4B3M L;  2UUC Q;  4AHY A;  5FKA C;  4RFB A;  1CSP A;  1L0W A;  4DR7 Q;  3OMG A;  1Q3L A;  1AH9 A;  1HTP A;  1QIL A;  1TT2 A;  2BA1 A;  1XNR L;  1FNU A;  4A3G B;  4KJN A;  4TQU S;  4X65 Q;  2B29 A;  1FHH A;  2Q2U A;  3S15 H;  2Z4I A;  2F0M A;  1RKN A;  5IYB L;  1KL9 A;  1TVX A;  3K0X A;  3AQQ A;  5I9P A;  1FGB D;  1EZ6 A;  3BG3 A;  4NDX A;  3S2D L;  1EYA A;  1XMO Q;  1GUO A;  1PH2 A;  1IW7 C;  2JYO A;  1QZH A;  2PQE A;  4GN4 B;  5FLX L;  2XVS A;  1BCP C;  2EQS A;  3CRL C;  1QUQ A;  4R4C A;  2Z6K A;  3T4A C;  4C56 C;  1NJI C;  4LF4 Q;  2L1B A;  3I70 A;  2N78 A;  4XIG S;  3S1Q H;  2XJT A;  3MXG A;  4MIU A;  1LLR D;  3BZK A;  3HOZ G;  1RF2 D;  3S17 H;  5AJ3 L;  5KEE A;  2RA4 A;  3HOV L;  4ZKB B;  2AQC A;  2QDB A;  3V2T A;  1ZXT A;  1YIT A;  3I55 A;  1B9N A;  4CKC A;  4KJO A;  2R3Z A;  3NTI A;  1S72 A;  2E8G A;  1X3Q A;  1WCM G;  2ATW A;  3FDJ A;  3GTK L;  4DV0 L;  4AR6 A;  4DR5 L;  2KUM A;  2VUM G;  3I4M L;  2UUC L;  1GKH A;  2V3B B;  1PTO C;  1S5D D;  2YU9 H;  4PMC A;  4A3F B;  4DR7 L;  1B44 D;  1EZ8 A;  2NVT H;  2R7Z B;  3D6C A;  4C3H L;  2UUA Q;  3PGZ A;  3RUZ A;  1HZB A;  2IX0 A;  3HOX H;  4X65 L;  4LFC Q;  4KV6 A;  2K05 A;  4BWG B;  5I6W A;  2EY4 E;  3LX0 A;  5C0X G;  1Q82 C;  3NXW A;  4AI3 A;  2WII B;  2K5Q A;  2KHI A;  1VQ8 A;  2N49 A;  1E1O A;  1E2Z A;  3K58 A;  1V1P B;  1Y1V H;  2WIN B;  2DNC A;  1Y8N B;  4AIM A;  4X3S A;  3KBG A;  3K5O A;  3HZX A;  1FNW A;  1NR4 A;  5EBD A;  5JEA H;  1WD1 A;  1BBX C;  2EJG C;  3MXP A;  4LF4 L;  5A2Q L;  2F0P A;  3NK9 A;  3CCE A;  4C2M 1;  3JAM L;  3KJP A;  3CCR A;  1N36 Q;  1VMC A;  4A76 A;  4IFD G;  3HOY G;  2M4Y A;  3GV6 A;  4J6H A;  5C0X I;  3S2D B;  1G51 A;  2L55 A;  1AFP A;  1X65 A;  4C3J L;  2C35 B;  2LKV A;  5A35 A;  4ODG A;  4DU9 A;  3A8I E;  4IUP A;  3TEH B;  4HTH A;  5C5L A;  2CCZ A;  4K6L A;  2K04 A;  4IPG A;  1ENC A;  1EWH A;  2E74 C;  2UUA L;  2F52 A;  2BH8 A;  4LFC L;  2APO B;  3P8B A;  1BVS A;  3HOV B;  3P7J A;  1GM5 A;  3H99 A;  2F0V A;  2IJ0 A;  2RVL A;  4IFD I;  1QUQ B;  2B2U C;  4H44 C;  4A3C L;  2CKA A;  2IL8 A;  1X6O A;  2WAQ B;  2JXM B;  5C44 H;  1YI2 A;  1PZI D;  5LL6 X;  4BA1 I;  3GTQ L;  1BNZ A;  3F8T A;  3A55 A;  3I73 A;  3I4M B;  4GN3 B;  1SNC A;  3BYY B;  2LSS A;  3S14 L;  1QVF A;  1B71 A;  4C1N K;  4C3H B;  1ESR A;  3IRB A;  4ZN3 B;  2NZ1 D;  1E2V A;  2XN9 C;  3NBH A;  3E3X A;  1LTI D;  4HSV A;  1N36 L;  1I4G A;  4OGQ C;  1GUT A;  3VA5 A;  1I4P A;  5CV5 A;  4P74 A;  4I7Z C;  1E22 A;  4DXF A;  1ZKO A;  4ILW A;  8RXN A;  2N55 A;  3CU7 A;  4B3T L;  1EYD A;  3IFT A;  1RTO A;  3AU7 A;  3MTS A;  2BDN A;  3K7A H;  4LFA Q;  4YCV A;  1YJN A;  4NXN Q;  2K5W A;  2Q8I B;  4BBS H;  1UE5 A;  3CRK C;  4POG A;  4DK3 C;  3PWF A;  2A1A A;  3J81 j;  4BXX G;  2B5I D;  2GMG A;  4CJ2 C;  4RWS C;  1TWC L;  4DV6 Q;  1SR3 A;  1PYB A;  4C3J B;  4BY7 G;  1UEA B;  1VQK A;  2JP1 A;  4DFA A;  2PYK A;  2OWO A;  4R8N A;  1XNQ Q;  1JR0 D;  2XGT A;  1QWY A;  2PO4 A;  5AN9 H;  1JMC A;  2XTI A;  2ES2 A;  4CDE C;  1BKB A;  2EYJ A;  2NB0 A;  3NBI A;  1STG A;  1WTR A;  2WB1 G;  3M7N A;  2OEO A;  1ML0 D;  4GS7 D;  2SOB A;  3E6Z X;  5K36 H;  1IKM A;  5AI3 A;  2NVX L;  4DA2 A;  3GO5 A;  1VQA A;  3M7G A;  3UDG A;  3SK6 A;  2A8V A;  2VY3 A;  1F2M A;  1IL8 A;  2D5D A;  5C4X H;  1JJG A;  1AP0 A;  3GTQ B;  3PQI A;  4LNQ A;  1OWB A;  3NEM A;  2Z6K C;  5KGU A;  3J80 L;  4QB4 A;  1OO9 B;  5C4J H;  1HCZ A;  3S14 B;  1V8Q A;  4GLV B;  4LFA L;  3HKZ G;  5CV4 A;  1I6H H;  1PFM A;  4NXN L;  5KIX A;  4JBM A;  2ZJP A;  3S15 L;  1KDA A;  3Q24 A;  1TWH H;  3KYY A;  2ERJ A;  4A3B L;  1Q46 A;  4DV6 L;  4F88 A;  2QL0 A;  2PI2 E;  1PVO A;  5KRU A;  4AHX A;  3VR5 A;  3TZU A;  1XNQ L;  4MN3 A;  3CC2 A;  3HOW G;  4A93 H;  1T5E A;  1Y1W H;  2IX1 A;  3OTO Q;  1AW7 A;  3CQZ L;  1I50 H;  1HNZ Q;  1C0A A;  1TWA L;  2ZXO A;  2FMC A;  1G6Z A;  1HZ9 A;  3A54 A;  5JJK A;  1R0J A;  4DUY Q;  3S17 L;  3PIP 1;  3AYH B;  2EYP A;  4MNO A;  2KCC A;  4G7Z C;  1PLF A;  5FLM G;  1TWC B;  3I4N L;  2R92 G;  1X3F A;  5IYD H;  3QO2 A;  4AHZ A;  1UUP A;  1GOZ A;  5ELC A;  4XYO A;  1SRO A;  1XPO A;  1HR0 Q;  3D0F A;  5IYC G;  1HPC A;  2J9U B;  1U9R A;  3M4O L;  3K5N A;  5LL6 S;  3OHX C;  4DXG A;  1Q81 C;  2I5M X;  1VQJ A;  2SNS A;  2PYA A;  1KAW A;  4LJZ C;  2DY7 A;  3I72 A;  3GTM L;  4JBW A;  1RDP D;  3OIQ A;  4HSP A;  2I46 A;  3NWT A;  1SE3 A;  3LWP B;  2YTX A;  1CUK A;  2B2W C;  1NUC A;  4RAU C;  3RN2 A;  2B3G A;  4KY7 A;  4ABN A;  4A3K G;  1RYT A;  5EPK A;  1ENF A;  3EFX D;  2QF7 A;  3OW2 A;  1IL2 A;  4C2M B;  5IGB A;  3GV3 A;  2K2D A;  4NB3 A;  5H1S E;  1FL0 A;  1SFO H;  5J3B A;  3OTO L;  4JOI C;  1HNZ L;  3IKJ A;  2Z8L A;  5GAH c;  2MQH A;  2MS3 A;  3J80 c;  1LTR D;  2O5J D;  3H0G H;  4A3B B;  4H13 C;  2Q8T A;  1LO5 D;  1LT6 D;  5JVG 1;  3I91 A;  3F2D A;  2O2L D;  1UE7 A;  2HCC A;  3AFP A;  1JB3 A;  3MEF A;  4KMU C;  1S5E D;  1PFV A;  1VQI A;  2KEC A;  4HMJ A;  1EFW A;  1TR5 A;  1C8C A;  4QQB X;  4OWT B;  1HR0 L;  1DZ1 A;  2GVB A;  3CQZ B;  3PUW A;  5DNF A;  1TWA B;  4NKL A;  4K9F A;  1NAP A;  4DV7 L;  3S17 B;  5KNB A;  5DM7 3;  5IIF A;  2F0W A;  4FF2 A;  1B8A A;  3I4N B;  2BOS A;  2R93 L;  2KN9 A;  1U4P A;  1WTH A;  3I2Z A;  2A68 C;  2EYH A;  2CH4 A;  1SJE D;  2DY8 A;  3DM3 A;  1A2T A;  5CGK A;  1QCB D;  4ZRZ A;  2B63 H;  3KF8 A;  2A6E C;  5L37 A;  1JQY D;  1RYQ A;  3KLR A;  4J1M A;  3M4O B;  4FF4 A;  2JA8 H;  1LKO A;  3T53 B;  2K33 A;  5IP9 H;  5EPL A;  2KCT A;  1CT1 D;  2XWJ B;  3CMA A;  1Z7T A;  2EJM A;  1IU6 A;  1SEB D;  1M4V A;  3VYS A;  5M5W H;  5ELF A;  2PPB C;  3PIP A;  1IRO A;  3CCS A;  4PMW A;  3GTM B;  2I0Q A;  3K59 A;  4AR5 A;  1CTM A;  4A3F G;  1YNN C;  4JI0 Q;  2R7Z G;  5C4Z A;  1JOQ A;  3EVQ A;  3VDY A;  3HEJ A;  1WFQ A;  3STB C;  4X6A H;  3FEW X;  1JOR A;  2QIL A;  2HQL A;  1Y14 B;  2Y0S B;  1YJW A;  1S5F D;  2K6A A;  3SXH A;  3K7A L;  2I07 B;  1OXT A;  2UXB Q;  5ELN A;  2EYO A;  1S5B D;  1JJC B;  5BN5 A;  1VQ5 A;  2AWO A;  4B9W A;  4HR7 B;  1CAA A;  3RMH A;  5J22 A;  4XGH A;  5M3M L;  2FIN B;  1K3R A;  1II3 A;  2OXP A;  1EL0 A;  2V1C C;  3GTP L;  5M3F L;  2NWG A;  1SNQ A;  1EY6 A;  1TS2 A;  2ZT9 C;  3RYG A;  3VYT A;  5LHY 1;  3JC6 3;  4O0A A;  1D2B A;  1C9O A;  3KYW A;  4MHE A;  4BY1 H;  2G9D A;  1BBU A;  5IYB G;  3PKI A;  1NSN S;  3BVZ A;  3LPE B;  1PH5 A;  5IY0 A;  3K5M A;  1UNS A;  1PH1 A;  2RDH A;  5KYI A;  1BQQ T;  4YWL A;  3MC0 B;  2QW7 A;  4YHH Q;  1J5E Q;  2LCQ A;  1CKN A;  2R61 A;  2R93 B;  1D8L A;  4QY7 A;  3M3Y L;  3T51 B;  4Y7N B;  2IY5 B;  3ITP A;  1LTT D;  3HJW B;  2KOL A;  1Z9F A;  5IE8 A;  4JI0 L;  5C4X L;  3MEH A;  5CC4 A;  4GLX A;  1VMP A;  1F2Y A;  5FO7 B;  1RCV D;  3HOV G;  2JJQ A;  3TP7 A;  1B53 A;  2GA4 B;  1WTV A;  1K3B C;  2Z0S A;  3I4O A;  5CBA E;  1EQT A;  2LFN A;  4DF7 A;  4B3S Q;  4KY6 A;  2UXB L;  1I6H L;  3S16 H;  1B3A A;  3OIP A;  5JEA J;  2WAQ G;  3C46 A;  1K8G A;  1FD7 D;  3A56 A;  3KDF A;  1MJC A;  4Z9C B;  1ODH A;  3I4M G;  3HOU H;  1M8A A;  1Y8O B;  4K6D A;  2EXD A;  1VZH A;  1B3Q A;  3KF8 B;  4C3H G;  1PZK D;  4FP5 D;  3P75 A;  5ELD A;  4A3E L;  2BA0 A;  1KIX A;  3K7A B;  4K5W A;  2QEX A;  1R9T H;  1BBW A;  1PRT F;  2MUY A;  5IGE A;  1ENA A;  5CV9 A;  3J7Y W;  1I3Q H;  5CBE E;  1D1K A;  3FKI L;  3A7L A;  2E75 C;  3TDQ A;  1Y1W L;  3Q23 A;  1SMM A;  4QCL A;  1I50 L;  1HA6 A;  3PL5 A;  3GTG H;  4LK1 C;  4RXN A;  5M3M B;  3LNN A;  1PH3 A;  4YHH L;  2NUC A;  1J5E L;  3GTP B;  2J7Z A;  4DR4 Q;  5M3F B;  3GP7 A;  2PMZ E;  5JVG 3;  2NVY H;  1VQL A;  1CQF A;  1NBW A;  4JC0 A;  1ET9 A;  2JA7 H;  3RZD H;  1GHK A;  4C3I G;  3A0J A;  4FVM A;  1RIP A;  3KBX A;  3BZD B;  1PFW A;  4PV1 C;  1O7L A;  5MGN A;  3F2C A;  1KNE A;  4DAP A;  5D14 A;  2L9H A;  2UXC Q;  2N88 A;  3PUY A;  4OHJ A;  4B3S L;  5GQO A;  1H9J A;  3K0Y A;  4QIW B;  1SN8 A;  3KJO A;  1P16 A;  1EEF D;  4EQ5 A;  3ND9 A;  1D7Q A;  2GVA A;  3P1H A;  4IZ8 A;  3M3Y B;  5GAE c;  1RWD A;  1IZ6 A;  2E2I L;  2EY5 A;  1X56 A;  2KJX A;  3W3A A;  4TVM A;  2FJ2 A;  1ASZ A;  5C4X B;  1A8V A;  4KTA A;  1K83 H;  4PZ8 A;  5IP7 L;  2JI2 A;  3A5U A;  3H3V M;  2Z1C A;  4AHW A;  1D6E C;  1YNJ C;  3JAM i;  1Q8I A;  3H9B A;  1I6H B;  4A3C G;  4AI2 A;  1XX8 A;  3W5O A;  3JR7 A;  4CJ1 B;  1SFO L;  4JAE A;  5BR8 Q;  5HY6 A;  2WKC A;  5EKI A;  1SXT A;  4GNX B;  3UI2 A;  1ET6 A;  1WTQ A;  1YV1 A;  1EU4 A;  5KNC A;  1HFG A;  5DEH A;  2L0C A;  4DR4 L;  1FNV A;  4WJ4 A;  1IXR A;  2IHE A;  1WOC A;  4A3E B;  3B08 B;  2SEB D;  1EQQ A;  1QZG A;  1WJV A;  3PO3 L;  3DHQ A;  2F0J A;  3H3V I;  3ULL A;  3Q22 A;  3FKI B;  1A6X A;  3KDF B;  1Y1W B;  1KAB A;  1I50 B;  2UXC L;  1HUN A;  2R7D A;  4FDB A;  1TII D;  5C3E H;  2JA5 H;  3PO2 L;  5I2Y A;  1BF4 A;  3SK5 A;  4X64 L;  4IUN A;  2GN5 A;  5LMU Q;  5JJZ A;  4RKB A;  5ISR A;  2AKW B;  4EQN A;  3NEL A;  4OEL B;  4OEM B;  1XJV A;  4N9T A;  5E3F A;  4LW1 A;  1HFN A;  4I65 A;  2F3W A;  1EY5 A;  1SMW A;  7RXN A;  1I6V C;  2I5L X;  2YV5 A;  4HN7 A;  3I56 A;  1OTC A;  2XJR A;  4UY8 1;  5M9O A;  2E2J L;  4HED A;  5JPM C;  2CWA A;  1F2L A;  1BXT A;  5IP9 L;  4K2L A;  4FNF A;  3RZT A;  2IW3 A;  3BDO A;  5BR8 L;  2I5H A;  4DV4 Q;  4ID6 A;  5M5W L;  2PVX A;  4QUF A;  2E2I B;  2HQE A;  5C4H A;  4P75 A;  4ZUI A;  4A3J H;  3TP6 A;  1HZC A;  4FF3 A;  3HOZ H;  2BE5 D;  4JI8 Q;  1Q12 A;  1I5F A;  1VQ6 A;  1DD2 A;  1CA5 A;  2JI1 A;  3CPW A;  1X3G A;  3ICE A;  3QJY A;  1CK1 A;  1B2J A;  5AFW A;  3T13 A;  1DOL A;  1JWS D;  2KHS A;  1SFO B;  3A74 A;  2XRQ D;  3QB3 A;  2L0Z A;  1WCM H;  1PRT B;  1X3E A;  2HIX A;  2RSO A;  1CAD A;  4KKU A;  3NFP I;  1BUV T;  2B8G A;  1QB5 D;  1TWF H;  5LMU L;  4GNX C;  1N34 Q;  1HHV A;  1VQ9 A;  2M4V A;  4KLK A;  3QOJ A;  2HDM A;  2KVM A;  3LGJ A;  5C0X H;  3PO3 B;  3K6O A;  4Y52 H;  4OX9 Q;  4A3B G;  3EQL C;  1ICF B;  1EQV A;  2C5C A;  2NTT A;  5FJ8 H;  4NXM Q;  5M5Y H;  3KUP A;  2YYZ A;  3PO2 B;  3J7A 5;  1L1O B;  2L5T A;  1A3V A;  1G2S A;  5GRO A;  1K8M A;  4LUV A;  1YIJ A;  3K57 A;  2PCF B;  1WD0 A;  3WWL A;  3KYX A;  1XMO L;  4FXK C;  2JSO A;  1L2F A;  4JI8 L;  5I6Y A;  3HOY H;  2EJF C;  3G6J B;  4QF4 A;  2UUB Q;  3I4N G;  1PH9 A;  3OWE B;  2J4X A;  1F9R A;  2E2J B;  2B2V A;  4OO1 G;  2K75 A;  2L4N A;  4C1N I;  4N8F A;  4AR4 A;  1KDC A;  4OL7 A;  4AQY Q;  4DNR B;  1F4L A;  4DR6 Q;  2PW7 A;  3ZYY X;  4C3I L;  1SRU A;  1XMQ Q;  5M5W B;  1JOK A;  2K01 A;  3SGI A; 
#chains in the Genus database with same CATH homology
 1N34 L;  4JV5 Q;  3U4V A;  4GOP A;  3CD6 A;  4OX9 L;  2EIF A;  4NXM L;  1VQE A;  4YCU A;  3CME A;  4OO1 I;  4JOI A;  2E2H H;  1NMF A;  2OCE A;  2Y0S G;  3S1R H;  2NN6 G;  2WP8 J;  1G6P A;  1E8J A;  3M85 A;  2CFM A;  1EOV A;  4L5S A;  1VQD A;  1JJ2 A;  3GDE A;  4TVA B;  2UUB L;  3CPF A;  1VQ4 A;  4AYB E;  3UDX A;  1PV4 A;  1YK4 A;  1G29 1;  4AQY L;  4XXB B;  2JI3 A;  4DR6 L;  1XMQ L;  1KC8 C;  2RHQ B;  1PH6 A;  4HJ8 A;  1KHI A;  1VQB A;  2NN6 I;  2VNU D;  5LMN Q;  4JV5 L;  3I7F A;  5LMN W;  4BXX H;  2C6A A;  2ERS A;  2R93 G;  1C09 A;  3AFQ A;  1LKP A;  4DNI A;  4DV5 Q;  4MTN A;  1PH8 A;  5C44 G;  1KQS A;  3T1H Q;  2K5N A;  4OWX B;  2Z3Q B;  1ZRP A;  2A69 D;  1X9N A;  5DM7 1;  1LM0 A;  3CCQ A;  1RL2 A;  1OXX K;  1I94 Q;  1NE3 A;  1A0I A;  3H15 A;  3S1N H;  1T9H A;  3NEN A;  4IOC A;  4LF7 Q;  1EUJ A;  3K35 A;  1OWC A;  3ULP A;  2JEB I;  1NTG A;  3F1Z A;  2WAQ E;  4O2D A;  4DPG A;  4GOP B;  4BBS G;  3AEV A;  4IJL A;  3L2P A;  2DSX A;  2MNA A;  5M3M G;  5LMN L;  4HJ7 A;  1QYB A;  1B70 B;  3PUX A;  5M3F G;  2OQK A;  2IT1 A;  2R7F A;  2ZTC A;  3CCJ A;  4DV5 L;  3G48 A;  4A3M H;  3T1H L;  1FJG Q;  4TPU A;  3HOW H;  4HJA A;  3T1Y Q;  1I94 L;  3B0A B;  2K4K A;  4UP9 A;  5EIN C;  3J81 i;  4PG3 A;  3PZA A;  1CSQ A;  5C4X G;  5JJI A;  4LHL A;  1MIU A;  1OXS C;  2NZH A;  1X55 A;  3PKJ A;  5MLC 3;  2NYD A;  4BA2 I;  2WFW A;  1IBL Q;  2JQO A;  5H1S c;  3TS2 A;  4GKJ Q;  1BQ9 A;  1TWG H;  4A3E G;  4A3K H;  1Q8K A;  3K7U C;  4YWK A;  1N32 Q;  2XJV A;  1V1Q A;  3BU2 A;  3PV0 A;  3FKI G;  1Y1W G;  1EIY B;  1FJG L;  4E6Y A;  3ZG6 A;  4JI1 Q;  2K50 A;  3T1Y L;  4GOP C;  2LXK A;  4DAM A;  1TXY A;  4A3G H;  4A3L H;  4UY8 C;  4DR2 Q;  4LF5 Q;  2F3I A;  4DUY L;  2FXQ A;  4EX5 A;  4R4O A;  1DVB A;  4DV2 Q;  3CCV A;  5E7N A;  4GKJ L;  4X66 Q;  1PA6 A;  4B8C D;  2VZA A;  3PF4 A;  5IP7 G;  1VQM A;  3K81 C;  2AMC B;  2ZIX A;  4LFB Q;  3GTO H;  4OXP A;  2VQF Q;  1YJ9 A;  1A62 A;  5JJL A;  4JI1 L;  1NMG A;  3H0G G;  3PIO 1;  4GKK Q;  3RLN A;  2R7Z H;  3QVD A;  3G71 A;  4DR2 L;  3PO3 G;  1KRS A;  3KOJ A;  4LF5 L;  3J7Z 1;  1YUZ A;  2QGQ A;  1QVC A;  3PO2 G;  1S24 A;  4DV2 L;  2K14 A;  4DV1 Q;  1RDG A;  1VQP A;  3KFU A;  4XTC S;  1M90 C;  5GAG c;  3UDF A;  4X66 L;  3J7Y 1;  1YBY A;  5GAH C;  3HFZ B;  2XJP A;  3S2D H;  1YHQ A;  1MJE A;  5IP9 G;  4QGU A;  1WJJ A;  5IWA Q;  1PHJ A;  4LFB L;  2VQF L;  1AE2 A;  1O7I A;  2Q2T A;  1HH2 P;  5C0X J;  2M6P A;  1EWI A;  1RB9 A;  4JI3 Q;  2AHO B;  4GKK L;  3E9I A;  3S1M H;  3HOV H;  4KI0 A;  4UPA A;  3JC6 2;  3TRZ A;  4P72 A;  4GNX A;  4U67 1;  3M9B A;  4DV1 L;  4IFD J;  1HZA A;  2JA6 H;  4HIM A;  2DGY A;  2E5L Q;  3K8A A;  2D62 A;  3QQC E;  4L5R C;  1HJP A;  2IHF A;  3TS0 A;  2Y0S E;  3E9H A;  4IOA A;  1X54 A;  5JVH 1;  1VQH A;  1E3P A;  2K5V A;  5IWA L;  3OYY A;  4HJ5 A;  3CXC A;  3B6Y A;  3MSU A;  3P2A A;  2A68 D;  2XJS A;  4A3D H;  4JI3 L;  1WYD A;  4C3J H;  1CKM A;  3M4Q A;  3S2H H;  1E1T A;  2VS1 A;  3CAM A;  4JBK A;  3EN2 A;  2ID0 A;  3A5Z B;  3STB D;  3LNL A;  1E24 A;  2Q2I A;  4V19 6;  4YWM A;  3GTQ H;  2UXD Q;  3K80 C;  2N3S A;  3S14 H;  2JA7 G;  4APV A;  3CCM A;  1BFY A;  4YCW A;  2K52 A;  4AH6 A;  2HHH Q;  4BBR H;  1UEB A;  1GD7 A;  2WB1 E;  1L1O A;  2MO0 A;  4ME3 A;  2CKZ B;  1JYB A;  3SS2 A;  1T9O A;  1YUX A;  4A3I H;  1T9P A;  1N9W A;  5GAD c;  1S40 A;  4H02 A;  4DK6 C;  3HKZ E;  4ALP A;  4LHN A;  4R4Q A;  1TWC H;  3G6E A;  4A4I A;  1PH4 A;  3W1B A;  1U0L A;  4LF8 Q;  4AI0 A;  2UXD L;  1PH7 A;  4QIW E;  1VQC A;  1Q1E A;  2Q2H A;  1NXE A;  2C6B A;  4JI4 Q;  3RR5 A;  3D31 A;  3CCU A;  2PQA A;  5GAE C;  1H7V A;  2HHH L;  2PVE A;  2JA5 G;  1OXU A;  1FVI A;  3WWV A;  4JI5 Q;  2JA9 A;  4DR1 Q;  4J15 A;  2N8N A;  4C2M H;  4JAG A;  2KKD A;  2DUD A;  4JCV E;  2R6G A;  1GVP A;  4A3B H;  3WWN B;  2VUM H;  3PUV A;  1VQO A;  2KBN A;  3EBE A;  3KLW A;  2L15 A;  4LF8 L;  5GAD C;  5K2M E;  3CQZ H;  1TWA H;  4A3J G;  4LUO A;  1IU5 A;  6RXN A;  1HNW Q;  4JI4 L;  2D0O A;  2KCM A;  4R4T A;  4RG1 A;  1R0H A;  2K5H A;  3I4N H;  4DV4 L;  1YHB A;  1MKH A;  3J80 i;  4B3R Q;  3CW2 C;  2JK8 A;  4JI5 L;  4DR1 L;  2CKC A;  4MZ9 A;  3M4O H;  3KF6 B;  2PI2 A;  4PZ6 A;  3GTM H;  5FJ8 G;  1B2O A;  1WI5 A;  3J7Z C;  4YY3 Q;  3ULJ A;  3HOX G;  3BJU A;  1VZI A;  2VL6 A;  5MFZ A;  4IPH A;  3GTL H;  3MXN B;  3RZO H;  1S2Z A;  2PQA B;  3UE1 A;  2ZTD A;  4LUZ A;  1HNW L;  1Y1V G;  1BRF A;  1FHM A;  2OTJ A;  5JEA G;  5M5X H;  4B3T Q;  1LKM A;  1JE5 A;  1RDV A;  1V9P A;  4B3R L;  1Q7Y C;  4DV3 Q;  1XTD A;  2LXJ A;  5ELO A;  1YNX A;  3Q8D A;  1IW7 D;  5FLX c;  3L7Z C;  2R93 H;  1R0F A;  4Y7N H;  4P73 A;  3ZJY C;  1L1O C;  3ER0 A;  4YY3 L;  3ERS X;  1LUZ A;  1EIF A;  1IBK Q;  2AYJ A;  1UE1 A;  5EAY A;  2HT1 A;  1KRT A;  4BY7 H;  1HNX Q;  2KEN A;  1VQN A;  1Z47 A;  4L5Q A;  1NXG A;  4UP7 A;  4DUZ Q;  4IO9 A;  2NVQ H;  3RLF A;  5HGQ A;  1YVC A;  1K9M C;  4DV3 L;  2F4V Q;  3L0O A;  1XPU A;  5M3M H;  3GTP H;  5M3F H;  3A44 A;  3RZ6 A;  1Z92 B;  3JAM c;  4X62 Q;  2A19 A;  4HJ9 A;  4POF A;  4IPD A;  1NY4 A;  1P8L A;  1BE7 A;  1JB7 A;  2ZJR A;  1IBK L;  3RLO A;  4KHZ A;  2VW9 A;  4OON A;  1HNX L;  3M3Y H;  1OXV A;  2CQO A;  4HIK A;  5MFP A;  1C7Y A;  4DUZ L;  3PF5 A;  5K36 G;  2YTV A;  5FLM H;  2R92 H;  1YHA A;  2AWN A;  1VQF A;  4P71 A;  2F4V L;  4LF7 L;  4G6B A;  3BZC A;  5IYC H;  2M6O A;  1S3O A;  5DM6 1;  4A3E H;  4X62 L;  4A3M G;  3NBH B;  2BH2 A;  4WJ3 M;  3FKI H;  3CP0 A;  4A75 A;  2VQE Q;  3U58 A;  1N33 Q;  3CC4 A;  1CKO A;  4A93 G;  2PPT A;  1U5K A;  1VS0 A;  4IJH A;  1HR0 W;  3CC7 A;  1VQG A;  5IYD G;  4DV7 Q;  3PCO B;  1S30 A;  4HID A;  1R0I A;  5RXN A;  1YK5 A;  4AI1 A;  3E0E A;  2E2I H;  2OTL A;  1LYL A;  1SE8 A;  4DAY B;  3VPB E;  2NZO A;  1IBL L;  5IP7 H;  1XPR A;  3GD7 A;  2VQE L;  3KYU A;  2D0P A;  1N33 L;  1KXL A;  1N32 L;  3U4Z A;  4A3G G;  4A3L G;  4KHP Q;  4GS3 A;  4JG2 A;  3PO3 H;  1KD1 C;  4GN5 A;  4A3F H;  2XJU A;  3PO2 H;  1T9Q A;  1SLJ A;  2PSM C;  1W3S A;  4OWW B;  1SMU A;  2ALY B;  2HR5 A;  1B13 A;  2Z3R B;  3FP9 A;  1W2B A;  2ASB A;  4LWC A;  2V0E A;  3KYH C;  4R1J A;  5AI2 A;  4ZN1 B;  4JAD A;  2E2J H;  4L5T A;  5MF6 A;  2ZM6 Q;  3S24 A;  1N8R C;  1NNQ A;  2B63 G;  1VCI A;  2H12 A;  5IYB H;  3RN5 A;  2JA8 G;  4KHP L;  4GLA C;  4AYB G;  1YEZ A;  3CCL A;  2MO1 A;  2OQ0 A;  2MFI A;  3F2B A;  3IU3 I;  1J6Q A;  1K0R A;  2QA4 A;  1EYG A;  4K0K Q;  3UDI A;  2KHJ A;  1VCX A;  3GTK H;  4JI7 Q;  4PZ7 A;  3I4M H;  4DR3 Q;  1YZ6 A;  4HIO A;  3M4P A;  1JT8 A;  4R4I A;  2ZM6 L;  4C3H H;  2RCN A;  3PSI A;  4BY1 G;  4LF9 Q;  1B7Y B;  2YTY A;  3PUZ A;  1DGS A;  5GAG C;  4NPS A;  1V43 A;  1Q1B A;  2RHS B;  3PIO A;  1UWV A;  3RNU A;  4IPC A;  4C3I H;  1PFS A;  3W1G A;  2JA6 G;  2A6E D;  2PNH A;  4K0K L;  5EIO C;  1IBM Q;  4JI7 L;  2HIV A;  4LF6 Q;  1QCV A;  3DLL A;  3HOU G;  1K8A C;  4DR3 L;  1PYS B;  4JYA Q;  1VZG A;  2V0F A;  2E5L L;  2JE6 I;  1UE6 A;  4JAF A;  3H3V H;  1IYJ B;  4LF9 L;  5IT9 c;  4A3C H;  4A3D G;  3J81 c;  4UP8 A;  1H95 A;  3MPS A;  1A63 A;  1GO3 E;  1FGU A;  1M1K C;  4RMF A;  3HKS A;  1AE3 A;  4JI2 Q;  1QVG A;  2ZTE A;  2CR8 A;  4X64 Q;  1EQR A;  2CWP A;  2UU9 Q;  4JI6 Q;  4DKA C;  2RDV A;  3U50 C;  1VQ7 A;  5DLQ E;  4B3M Q;  1IBM L;  1Q86 C;  4QL5 A;  4LF6 L;  2JEA I;  4QJF A;  1CKN B;  3KYV A;  1XNR Q;  3G4S A;  1K73 C;  3GTJ H;  4AR3 A;  1ASY A;  4JYA L;  3TRE A;  3FHW A;  1SMX A;  3TQY A;  2XJQ A;  3KF6 A;  2H5X A;  4JBJ A;  1IRN A;  4BBR G;  1LTL A;  3JC6 6;  1R0G A;  2ZJQ A;  4WFN 1;  2A6H D;  4JI2 L;  5AJ3 Q;  3UE0 A;  3EIV A;  2NVX H;  1BQ8 A;  4A3I G;  2UU9 L;  4JI6 L;  3CF5 A;  1E7Z A;  4DV0 Q;  5C3E G;  1DX8 A;  4DR5 Q;  2RF4 A;  4B3M L;  2UUC Q;  4AHY A;  1CSP A;  1L0W A;  4DR7 Q;  1AH9 A;  2BA1 A;  1XNR L;  4TQU S;  4X65 Q;  2Q2U A;  2B29 A;  1FHH A;  3S15 H;  1KL9 A;  3K0X A;  3AQQ A;  1XMO Q;  1PH2 A;  1QZH A;  4GN4 B;  2EQS A;  4R4C A;  1QUQ A;  2Z6K A;  4LF4 Q;  1NJI C;  2N78 A;  4XIG S;  3S1Q H;  2XJT A;  3BZK A;  3HOZ G;  3S17 H;  5AJ3 L;  1YIT A;  3I55 A;  1S72 A;  2E8G A;  1WCM G;  2ATW A;  4DV0 L;  4AR6 A;  4DR5 L;  2VUM G;  2UUC L;  1GKH A;  2V3B B;  2YU9 H;  4DR7 L;  2NVT H;  2UUA Q;  3PGZ A;  1HZB A;  2IX0 A;  3HOX H;  4X65 L;  4LFC Q;  5C0X G;  1Q82 C;  4AI3 A;  2KHI A;  1VQ8 A;  2N49 A;  1E1O A;  1Y1V H;  4AIM A;  4LF4 L;  3CCE A;  3KJP A;  3CCR A;  1N36 Q;  4A76 A;  4IFD G;  3HOY G;  2M4Y A;  5C0X I;  1G51 A;  1X65 A;  2C35 B;  3TEH B;  2CCZ A;  4IPG A;  2UUA L;  2F52 A;  2BH8 A;  4LFC L;  1BVS A;  3P8B A;  1GM5 A;  4IFD I;  1QUQ B;  2CKA A;  1X6O A;  5C44 H;  1YI2 A;  4BA1 I;  3F8T A;  4GN3 B;  2LSS A;  1QVF A;  1B71 A;  3IRB A;  4ZN3 B;  1N36 L;  4P74 A;  1E22 A;  8RXN A;  4B3T L;  3K7A H;  4LFA Q;  4YCV A;  1YJN A;  4NXN Q;  4BBS H;  1UE5 A;  4POG A;  4DK3 C;  3PWF A;  2A1A A;  3J81 j;  4BXX G;  2B5I D;  2GMG A;  4DV6 Q;  1SR3 A;  1PYB A;  4BY7 G;  1VQK A;  2OWO A;  1XNQ Q;  2XGT A;  1JMC A;  5AN9 H;  2XTI A;  2ES2 A;  1BKB A;  3M7N A;  2WB1 G;  4GS7 D;  5AI3 A;  3GO5 A;  1VQA A;  3UDG A;  2A8V A;  2VY3 A;  5C4X H;  1JJG A;  4LNQ A;  1OWB A;  3NEM A;  2Z6K C;  5C4J H;  4GLV B;  4LFA L;  3HKZ G;  1I6H H;  4NXN L;  4JBM A;  2ZJP A;  1TWH H;  3KYY A;  2ERJ A;  1Q46 A;  4DV6 L;  2QL0 A;  2PI2 E;  1PVO A;  4AHX A;  1XNQ L;  3CC2 A;  3HOW G;  4A93 H;  1Y1W H;  2IX1 A;  3OTO Q;  1I50 H;  1HNZ Q;  1C0A A;  1HZ9 A;  5JJK A;  1R0J A;  4DUY Q;  3PIP 1;  3AYH B;  4MNO A;  5FLM G;  2R92 G;  1X3F A;  5IYD H;  4AHZ A;  1SRO A;  1XPO A;  1HR0 Q;  3D0F A;  5IYC G;  2J9U B;  1Q81 C;  2I5M X;  1VQJ A;  2PYA A;  1KAW A;  4JBW A;  2YTX A;  1CUK A;  3RN2 A;  2B3G A;  4A3K G;  1RYT A;  3OW2 A;  1IL2 A;  2K2D A;  4NB3 A;  5H1S E;  1FL0 A;  1SFO H;  5J3B A;  3OTO L;  4JOI C;  1HNZ L;  5GAH c;  2MQH A;  2MS3 A;  3J80 c;  2O5J D;  3H0G H;  5JVG 1;  3F2D A;  1UE7 A;  3AFP A;  3MEF A;  1VQI A;  4QQB X;  1EFW A;  4OWT B;  1HR0 L;  2GVB A;  3PUW A;  4K9F A;  4DV7 L;  1B8A A;  2KN9 A;  3I2Z A;  3DM3 A;  2B63 H;  1RYQ A;  2JA8 H;  1LKO A;  5IP9 H;  2KCT A;  3CMA A;  1IU6 A;  5M5W H;  3PIP A;  1IRO A;  3CCS A;  4PMW A;  2I0Q A;  4AR5 A;  4A3F G;  4JI0 Q;  2R7Z G;  3VDY A;  3STB C;  1WFQ A;  4X6A H;  2HQL A;  1Y14 B;  1YJW A;  1OXT A;  2UXB Q;  5ELN A;  1JJC B;  1VQ5 A;  2AWO A;  1CAA A;  4XGH A;  1K3R A;  2V1C C;  3RYG A;  3JC6 3;  4O0A A;  1C9O A;  3KYW A;  4BY1 H;  1BBU A;  5IYB G;  3PKI A;  3LPE B;  1PH5 A;  5IY0 A;  1PH1 A;  4YWL A;  4YHH Q;  1J5E Q;  2LCQ A;  1CKN A;  1D8L A;  4QY7 A;  2IY5 B;  1Z9F A;  5IE8 A;  4JI0 L;  4GLX A;  3HOV G;  2JJQ A;  2Z0S A;  3I4O A;  4B3S Q;  2UXB L;  3S16 H;  5JEA J;  2WAQ G;  1K8G A;  3KDF A;  1MJC A;  1ODH A;  3I4M G;  3HOU H;  2EXD A;  1VZH A;  3KF8 B;  2BA0 A;  1KIX A;  1R9T H;  2QEX A;  1BBW A;  1I3Q H;  1SMM A;  3GTG H;  4RXN A;  1PH3 A;  4YHH L;  1J5E L;  4DR4 Q;  2PMZ E;  2NVY H;  1VQL A;  1NBW A;  4JC0 A;  2JA7 H;  3RZD H;  3A0J A;  1RIP A;  5MGN A;  3F2C A;  2UXC Q;  3PUY A;  4B3S L;  5GQO A;  1SN8 A;  3KJO A;  1P16 A;  4EQ5 A;  1D7Q A;  2GVA A;  5GAE c;  1RWD A;  1IZ6 A;  1X56 A;  4TVM A;  1ASZ A;  1A8V A;  1K83 H;  4PZ8 A;  2JI2 A;  3A5U A;  4AHW A;  3JAM i;  4A3C G;  4AI2 A;  3W5O A;  4JAE A;  5BR8 Q;  5HY6 A;  4GNX B;  1YV1 A;  4DR4 L;  4WJ4 A;  1IXR A;  2IHE A;  1WOC A;  3B08 B;  1EQQ A;  1QZG A;  1WJV A;  3H3V I;  3ULL A;  3KDF B;  2UXC L;  2R7D A;  4FDB A;  5C3E H;  2JA5 H;  4X64 L;  2GN5 A;  5LMU Q;  2AKW B;  3NEL A;  1XJV A;  4LW1 A;  1SMW A;  7RXN A;  2YV5 A;  2I5L X;  3I56 A;  1OTC A;  2XJR A;  4UY8 1;  2CWA A;  3RZT A;  5BR8 L;  2I5H A;  4DV4 Q;  2PVX A;  4P75 A;  4A3J H;  1HZC A;  3HOZ H;  2BE5 D;  4JI8 Q;  1Q12 A;  1I5F A;  1VQ6 A;  2JI1 A;  3CPW A;  1X3G A;  3ICE A;  1B2J A;  3A74 A;  2L0Z A;  1WCM H;  1X3E A;  2HIX A;  1CAD A;  3NFP I;  5LMU L;  4GNX C;  1TWF H;  1N34 Q;  1VQ9 A;  2M4V A;  4KLK A;  3LGJ A;  4Y52 H;  4OX9 Q;  4A3B G;  5FJ8 H;  4NXM Q;  5M5Y H;  2YYZ A;  3J7A 5;  1L1O B;  5GRO A;  4LUV A;  1YIJ A;  3WWL A;  3KYX A;  1XMO L;  1L2F A;  4JI8 L;  3HOY H;  2UUB Q;  3I4N G;  1PH9 A;  4OO1 G;  2K75 A;  4AR4 A;  4AQY Q;  4DR6 Q;  1SRU A;  1XMQ Q;  3SGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...