1C09A

Rubredoxin v44a cp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFEEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Modulation of the redox potential of the [Fe(SCys)(4)] site in rubredoxin by the orientation of a peptide dipole.
pubmed doi rcsb
molecule tags Electron transport
total genus 9
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1c09A00
2PYAA 4ME3A 1LTLA 2M4YA 6RXNA 1IROA 1RB9A 3RZ6A 1E8JA 1S30A 1NNQA 1BQ9A 2LCQA 2GMGA 1LKOA 1T9OA 4YWMA 1RDGA 1B13A 1IU5A 1IRNA 4K9FA 2DSXA 3PZAA 1B2OA 3KYWA 1B71A 2HR5A 1LKPA 1IU6A 1YV1A 3KYXA 4POFA 8RXNA 1DVBA 1SMMA 1QYBA 1T9QA 3KYUA 2VL6A 1YK5A 1BQ8A 3QVDA 1S24A 2MS3A 3RYGA 1T9PA 5AI2A 2KKDA 2QL0A 1BFYA 1CAAA 4YWLA 1R0FA 4AR3A 1FHHA 1R0GA 4TPUA 1R0IA 5IY0A 1YUZA 1JYBA 1RDVA 2V3BB 1BE7A 1B2JA 1LKMA 3KYVA 5AI3A 1CADA 4POGA 1C09A 2PVEA 1SMUA 3MPSA 1RYTA 1YUXA 7RXNA 4AR5A 1ZRPA 3RZTA 2KN9A 1DX8A 1S2ZA 3SS2A 1R0HA 4AR4A 1YK4A 3KYYA 4RXNA 2K2DA 2PVXA 1H7VA 1R0JA 1RWDA 3PWFA 1QCVA 5RXNA 1SMWA 1BRFA 1FHMA 4AR6A 2RDVA 3A44A 1VCXA
chains in the Genus database with same CATH superfamily
3ZG6A 2M4YA 2CR8A 5MLC3 3VPBE 6RXNA 2APOB 4A3EL 5M3FL 1TWCL 3RZ6A 2A6HD 4B8CD 3B0AB 3LWQB 1T9OA 1RDGA 2XJQA 3K35A 1B13A 5C4XL 1IRNA 3LWPB 2JI1A 2A69D 3K7AL 3GTOL 2WB1P 2XJTA 2WAQP 5IYCL 1B71A 5C3EL 3LWOB 3PL5A 2ERSA 8RXNA 2JI3A 2O5JD 1QYBA 1T9QA 3S1RL 3QVDA 3FDJA 2MS3A 3WWNB 2NVTL 2KKDA 4ZN3B 4U671 1PFWA 5MGNA 1CAAA 4YWLA 2R93L 2Z3RB 2JA8L 5H1Sc 2CKAA 1R0GA 3HAXC 4X6AL 3S15L 2XJVA 1YUZA 2NVXL 2V3BB 3PKJA 4UY81 3S1QL 1LKMA 3KYVA 3S16L 1CADA 1TWAL 4POGA 1C09A 3HOWL 3HJWB 1VZHA 5EIOC 1YUXA 4A3BL 2H12A 1ZRPA 3S1ML 3RZTA 3MQKB 1S2ZA 3SS2A 2PPTA 3H0GL 4A3LL 3GTML 5EINC 2V0FA 4G6BA 1R0JA 2XJRA 1RWDA 4Y7NL 3LWVB 2BE5D 3J7Z1 5JVG1 3PWFA 5RXNA 5DM71 1RYQA 1FHMA 1I50L 3I4ML 4AR6A 2RDVA 3S14L 5C44L 1P7PA 3RZDL 2PYAA 3LPEB 3J7Y1 3QQCE 2C6AA 5IP7L 2C6BA 2JI2A 4Y52L 3PO3L 1E8JA 1S30A 2J9UB 2R7ZL 1NNQA 1OWCA 2E2HL 3HOYL 5IP9L 3HOZL 2AYJA 1IU5A 4C2M1 1F4LA 2NYDA 4XGHA 3GTQL 2DSXA 3PZAA 5MFPA 5AN9H 5M5YL 1K83L 2JA6L 2JA5L 1QQTA 1SFOL 4TVMA 1IU6A 3FKIL 3KYXA 4JADA 4AI1A 3HOXL 3GTJL 4AHYA 3PIO1 1S24A 1T9PA 5C4JL 5AI2A 2E2IL 2QL0A 5FLML 2A68D 1Y1WL 4AI2A 2CKCA 3HOUL 5M5WL 1JYBA 5K2ME 5IYDL 2VUML 1RDVA 2ERJA 1VZGA 4JAFA 4A3CL 4XXBB 5MF6A 1RYTA 2B5ID 7RXNA 2E2JL 4AR5A 4BBSL 3MSUA 4JAGA 4A3DL 4V196 1YK4A 3HKZP 2NVQL 4A93L 1TWGL 1NXGA 3GTGL 1TWHL 4C3HL 3GTLL 5DM61 4ME3A 1LTLA 3NFPI 2M6OA 3M4OL 1IROA 2XJUA 4BBRL 2AUSB 4BY7L 1BQ9A 5FJ8L 2GMGA 2M4VA 3PO2L 5MFZA 3LWRB 1Z92B 1PFUA 3WWLA 3KYWA 2HR5A 1LKPA 1YV1A 4POFA 4A3GL 1SMMA 3CQZL 2R92L 3H9BA 2AQCA 2VL6A 2Z3QB 3HOVL 3PIP1 4A3ML 3RYGA 2B63L 4C3JL 2V0EA 1OWBA 1ODHA 1R0FA 1PZXA 3LNLA 4A3FL 3HJYB 2XJSA 2PSMC 1PFVA 3GTKL 5IYBL 1BE7A 1SMUA 2EY4E 2Y0SP 2HVYC 4JAEA 4AI3A 3IU3I 3KYYA 2PVXA 2RFKB 4C3IL 4E6YA 4BY1L 5GAHc 1IW7D 1QCVA 1SMWA 5GAGc 1WCML 1VZIA 5M3ML 4LHLA 3S2HL 4AYBP 4AHXA 4AHWA 1RB9A 1I3QL 2A6ED 1PFYA 2LCQA 3JR7A 1LKOA 4LHNA 4YWMA 3H3VM 3P8BA 3PKIA 4K9FA 4A3KL 3B08B 1B2OA 5GAEc 1DVBA 1I6HL 3KYUA 1NXEA 2NVYL 1YK5A 1BQ8A 2L0ZA 1TWFL 3I4NL 4A3IL 3GTPL 3H99A 3RZOL 1BFYA 4AR3A 1FHHA 5JVH1 4TPUA 1R0IA 5IY0A 2PMZP 1R9TL 1B2JA 4WFN1 2M6PA 5AI3A 3P2AA 4A3JL 2PVEA 4ZN1B 2YU9L 4GS7D 3M3YL 3MPSA 4QIWP 1WJVA 2ZIXA 2KN9A 1DX8A 3S17L 1Y1VL 1R0HA 4AR4A 2K2DA 4RXNA 3H97A 3S2DL 2JA7L 3H9CA 1H7VA 4BXXL 1BRFA 5M5XL 5GADc 4AI0A 3S1NL 4AHZA 2XJPA 3A44A 1VCXA
chains in the Genus database with same CATH topology
5DM61 2PYAA 3LPEB 4ME3A 1LTLA 2M4YA 4LHLA 3ZG6A 2CR8A 5MLC3 3QQCE 3J7Y1 2C6AA 3NFPI 2C6BA 2M6OA 2JI2A 3VPBE 4AHXA 6RXNA 1IROA 4AHWA 1RB9A 3RZ6A 1E8JA 1S30A 2J9UB 2A6HD 4B8CD 2XJUA 2A6ED 1NNQA 1BQ9A 2LCQA 3B0AB 1OWCA 2GMGA 2M4VA 1LKOA 4LHNA 1T9OA 4YWMA 1RDGA 2XJQA 3K35A 1B13A 2AYJA 3P8BA 1IU5A 1IRNA 2NYDA 4XGHA 2JI1A 3PKIA 5MFZA 4K9FA 2A69D 2DSXA 3PZAA 3B08B 5MFPA 1Z92B 2XJTA 5AN9H 3WWLA 1B2OA 3KYWA 1B71A 2HR5A 1LKPA 4TVMA 1IU6A 5GAEc 1YV1A 3KYXA 4POFA 2ERSA 8RXNA 4JADA 1DVBA 2JI3A 4AI1A 1SMMA 2O5JD 1QYBA 1T9QA 3KYUA 1NXEA 2VL6A 4AHYA 2Z3QB 1YK5A 1BQ8A 2L0ZA 3PIO1 3PIP1 3QVDA 1S24A 2MS3A 3RYGA 3WWNB 1T9PA 5AI2A 2KKDA 4ZN3B 2QL0A 4U671 5MGNA 1BFYA 1CAAA 2V0EA 2A68D 4YWLA 1OWBA 1ODHA 2Z3RB 1R0FA 4AR3A 4AI2A 3LNLA 5H1Sc 1FHHA 2CKAA 2CKCA 5JVH1 1R0GA 4TPUA 1R0IA 2XJSA 2XJVA 5IY0A 2PSMC 1YUZA 1JYBA 5K2ME 1RDVA 2V3BB 2ERJA 3PKJA 1VZGA 4UY81 1BE7A 4JAFA 1B2JA 1LKMA 4WFN1 2M6PA 3KYVA 5AI3A 3P2AA 1CADA 4POGA 4XXBB 1C09A 2PVEA 4ZN1B 4GS7D 5MF6A 1SMUA 3MPSA 1RYTA 1VZHA 5EIOC 2B5ID 1YUXA 7RXNA 2H12A 4AR5A 1WJVA 1ZRPA 4JAEA 3MSUA 3RZTA 2ZIXA 2KN9A 4JAGA 4AI3A 1DX8A 1S2ZA 3SS2A 2PPTA 4V196 3IU3I 1R0HA 4AR4A 1YK4A 5EINC 3KYYA 2K2DA 2V0FA 4RXNA 4G6BA 2PVXA 1NXGA 1H7VA 1R0JA 2XJRA 1RWDA 4E6YA 2BE5D 3J7Z1 5JVG1 3PWFA 5GAHc 1IW7D 1QCVA 5RXNA 5DM71 1SMWA 5GAGc 1BRFA 1RYQA 1FHMA 4AR6A 5GADc 4AI0A 2RDVA 4AHZA 1VZIA 2XJPA 3A44A 1VCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYA A;  4ME3 A;  1LTL A;  2M4Y A;  6RXN A;  1IRO A;  1RB9 A;  3RZ6 A;  1E8J A;  1S30 A;  1NNQ A;  1BQ9 A;  2LCQ A;  2GMG A;  1LKO A;  1T9O A;  4YWM A;  1RDG A;  1B13 A;  1IU5 A;  1IRN A;  4K9F A;  2DSX A;  3PZA A;  1B2O A;  3KYW A;  1B71 A;  2HR5 A;  1LKP A;  1IU6 A;  1YV1 A;  3KYX A;  4POF A;  8RXN A;  1DVB A;  1SMM A;  1QYB A;  1T9Q A;  3KYU A;  2VL6 A;  1YK5 A;  1BQ8 A;  3QVD A;  1S24 A;  2MS3 A;  3RYG A;  1T9P A;  5AI2 A;  2KKD A;  2QL0 A;  1BFY A;  1CAA A;  4YWL A;  1R0F A;  4AR3 A;  1FHH A;  1R0G A;  4TPU A;  1R0I A;  5IY0 A;  1YUZ A;  1JYB A;  1RDV A;  2V3B B;  1BE7 A;  1B2J A;  1LKM A;  3KYV A;  5AI3 A;  1CAD A;  4POG A;  1C09 A;  2PVE A;  1SMU A;  3MPS A;  1RYT A;  1YUX A;  7RXN A;  4AR5 A;  1ZRP A;  3RZT A;  2KN9 A;  1DX8 A;  1S2Z A;  3SS2 A;  1R0H A;  4AR4 A;  1YK4 A;  3KYY A;  4RXN A;  2K2D A;  2PVX A;  1H7V A;  1R0J A;  1RWD A;  3PWF A;  1QCV A;  5RXN A;  1SMW A;  1BRF A;  1FHM A;  4AR6 A;  2RDV A;  3A44 A;  1VCX A; 
#chains in the Genus database with same CATH topology
 3ZG6 A;  2M4Y A;  2CR8 A;  5MLC 3;  3VPB E;  6RXN A;  2APO B;  4A3E L;  5M3F L;  1TWC L;  3RZ6 A;  2A6H D;  4B8C D;  3B0A B;  3LWQ B;  1T9O A;  1RDG A;  2XJQ A;  3K35 A;  1B13 A;  5C4X L;  1IRN A;  3LWP B;  2JI1 A;  2A69 D;  3K7A L;  3GTO L;  2WB1 P;  2XJT A;  2WAQ P;  5IYC L;  1B71 A;  5C3E L;  3LWO B;  3PL5 A;  2ERS A;  8RXN A;  2JI3 A;  2O5J D;  1QYB A;  1T9Q A;  3S1R L;  3QVD A;  3FDJ A;  2MS3 A;  3WWN B;  2NVT L;  2KKD A;  4ZN3 B;  4U67 1;  1PFW A;  5MGN A;  1CAA A;  4YWL A;  2R93 L;  2Z3R B;  2JA8 L;  5H1S c;  2CKA A;  1R0G A;  3HAX C;  4X6A L;  3S15 L;  2XJV A;  1YUZ A;  2NVX L;  2V3B B;  3PKJ A;  4UY8 1;  3S1Q L;  1LKM A;  3KYV A;  3S16 L;  1CAD A;  1TWA L;  4POG A;  1C09 A;  3HOW L;  3HJW B;  1VZH A;  5EIO C;  1YUX A;  4A3B L;  2H12 A;  1ZRP A;  3S1M L;  3RZT A;  3MQK B;  1S2Z A;  3SS2 A;  2PPT A;  3H0G L;  4A3L L;  3GTM L;  5EIN C;  2V0F A;  4G6B A;  1R0J A;  2XJR A;  1RWD A;  4Y7N L;  3LWV B;  2BE5 D;  3J7Z 1;  5JVG 1;  3PWF A;  5RXN A;  5DM7 1;  1RYQ A;  1FHM A;  1I50 L;  3I4M L;  4AR6 A;  2RDV A;  3S14 L;  5C44 L;  1P7P A;  3RZD L;  2PYA A;  3LPE B;  3J7Y 1;  3QQC E;  2C6A A;  5IP7 L;  2C6B A;  2JI2 A;  4Y52 L;  3PO3 L;  1E8J A;  1S30 A;  2J9U B;  2R7Z L;  1NNQ A;  1OWC A;  2E2H L;  3HOY L;  5IP9 L;  3HOZ L;  2AYJ A;  1IU5 A;  4C2M 1;  1F4L A;  2NYD A;  4XGH A;  3GTQ L;  2DSX A;  3PZA A;  5MFP A;  5AN9 H;  5M5Y L;  1K83 L;  2JA6 L;  2JA5 L;  1QQT A;  1SFO L;  4TVM A;  1IU6 A;  3FKI L;  3KYX A;  4JAD A;  4AI1 A;  3HOX L;  3GTJ L;  4AHY A;  3PIO 1;  1S24 A;  1T9P A;  5C4J L;  5AI2 A;  2E2I L;  2QL0 A;  5FLM L;  2A68 D;  1Y1W L;  4AI2 A;  2CKC A;  3HOU L;  5M5W L;  1JYB A;  5K2M E;  5IYD L;  2VUM L;  1RDV A;  2ERJ A;  1VZG A;  4JAF A;  4A3C L;  4XXB B;  5MF6 A;  1RYT A;  2B5I D;  7RXN A;  2E2J L;  4AR5 A;  4BBS L;  3MSU A;  4JAG A;  4A3D L;  4V19 6;  1YK4 A;  3HKZ P;  2NVQ L;  4A93 L;  1TWG L;  1NXG A;  3GTG L;  1TWH L;  4C3H L;  3GTL L;  5DM6 1;  4ME3 A;  1LTL A;  3NFP I;  2M6O A;  3M4O L;  1IRO A;  2XJU A;  4BBR L;  2AUS B;  4BY7 L;  1BQ9 A;  5FJ8 L;  2GMG A;  2M4V A;  3PO2 L;  5MFZ A;  3LWR B;  1Z92 B;  1PFU A;  3WWL A;  3KYW A;  2HR5 A;  1LKP A;  1YV1 A;  4POF A;  4A3G L;  1SMM A;  3CQZ L;  2R92 L;  3H9B A;  2AQC A;  2VL6 A;  2Z3Q B;  3HOV L;  3PIP 1;  4A3M L;  3RYG A;  2B63 L;  4C3J L;  2V0E A;  1OWB A;  1ODH A;  1R0F A;  1PZX A;  3LNL A;  4A3F L;  3HJY B;  2XJS A;  2PSM C;  1PFV A;  3GTK L;  5IYB L;  1BE7 A;  1SMU A;  2EY4 E;  2Y0S P;  2HVY C;  4JAE A;  4AI3 A;  3IU3 I;  3KYY A;  2PVX A;  2RFK B;  4C3I L;  4E6Y A;  4BY1 L;  5GAH c;  1IW7 D;  1QCV A;  1SMW A;  5GAG c;  1WCM L;  1VZI A;  5M3M L;  4LHL A;  3S2H L;  4AYB P;  4AHX A;  4AHW A;  1RB9 A;  1I3Q L;  2A6E D;  1PFY A;  2LCQ A;  3JR7 A;  1LKO A;  4LHN A;  4YWM A;  3H3V M;  3P8B A;  3PKI A;  4K9F A;  4A3K L;  3B08 B;  1B2O A;  5GAE c;  1DVB A;  1I6H L;  3KYU A;  1NXE A;  2NVY L;  1YK5 A;  1BQ8 A;  2L0Z A;  1TWF L;  3I4N L;  4A3I L;  3GTP L;  3H99 A;  3RZO L;  1BFY A;  4AR3 A;  1FHH A;  5JVH 1;  4TPU A;  1R0I A;  5IY0 A;  2PMZ P;  1R9T L;  1B2J A;  4WFN 1;  2M6P A;  5AI3 A;  3P2A A;  4A3J L;  2PVE A;  4ZN1 B;  2YU9 L;  4GS7 D;  3M3Y L;  3MPS A;  4QIW P;  1WJV A;  2ZIX A;  2KN9 A;  1DX8 A;  3S17 L;  1Y1V L;  1R0H A;  4AR4 A;  2K2D A;  4RXN A;  3H97 A;  3S2D L;  2JA7 L;  3H9C A;  1H7V A;  4BXX L;  1BRF A;  5M5X L;  5GAD c;  4AI0 A;  3S1N L;  4AHZ A;  2XJP A;  3A44 A;  1VCX A; 
#chains in the Genus database with same CATH homology
 5DM6 1;  2PYA A;  3LPE B;  4ME3 A;  1LTL A;  2M4Y A;  4LHL A;  3ZG6 A;  2CR8 A;  5MLC 3;  3QQC E;  3J7Y 1;  2C6A A;  3NFP I;  2C6B A;  2M6O A;  2JI2 A;  3VPB E;  4AHX A;  6RXN A;  1IRO A;  4AHW A;  1RB9 A;  3RZ6 A;  1E8J A;  1S30 A;  2J9U B;  2A6H D;  4B8C D;  2XJU A;  2A6E D;  1NNQ A;  1BQ9 A;  2LCQ A;  3B0A B;  1OWC A;  2GMG A;  2M4V A;  1LKO A;  4LHN A;  1T9O A;  4YWM A;  1RDG A;  2XJQ A;  3K35 A;  1B13 A;  2AYJ A;  3P8B A;  1IU5 A;  1IRN A;  2NYD A;  4XGH A;  2JI1 A;  3PKI A;  5MFZ A;  4K9F A;  2A69 D;  2DSX A;  3PZA A;  3B08 B;  5MFP A;  1Z92 B;  2XJT A;  5AN9 H;  3WWL A;  1B2O A;  3KYW A;  1B71 A;  2HR5 A;  1LKP A;  4TVM A;  1IU6 A;  5GAE c;  1YV1 A;  3KYX A;  4POF A;  2ERS A;  8RXN A;  4JAD A;  1DVB A;  2JI3 A;  4AI1 A;  1SMM A;  2O5J D;  1QYB A;  1T9Q A;  3KYU A;  1NXE A;  2VL6 A;  4AHY A;  2Z3Q B;  1YK5 A;  1BQ8 A;  2L0Z A;  3PIO 1;  3PIP 1;  3QVD A;  1S24 A;  2MS3 A;  3RYG A;  3WWN B;  1T9P A;  5AI2 A;  2KKD A;  4ZN3 B;  2QL0 A;  4U67 1;  5MGN A;  1BFY A;  1CAA A;  2V0E A;  2A68 D;  4YWL A;  1OWB A;  1ODH A;  2Z3R B;  1R0F A;  4AR3 A;  4AI2 A;  3LNL A;  5H1S c;  1FHH A;  2CKA A;  2CKC A;  5JVH 1;  1R0G A;  4TPU A;  1R0I A;  2XJS A;  2XJV A;  5IY0 A;  2PSM C;  1YUZ A;  1JYB A;  5K2M E;  1RDV A;  2V3B B;  2ERJ A;  3PKJ A;  1VZG A;  4UY8 1;  1BE7 A;  4JAF A;  1B2J A;  1LKM A;  4WFN 1;  2M6P A;  3KYV A;  5AI3 A;  3P2A A;  1CAD A;  4POG A;  4XXB B;  1C09 A;  2PVE A;  4ZN1 B;  4GS7 D;  5MF6 A;  1SMU A;  3MPS A;  1RYT A;  1VZH A;  5EIO C;  2B5I D;  1YUX A;  7RXN A;  2H12 A;  4AR5 A;  1WJV A;  1ZRP A;  4JAE A;  3MSU A;  3RZT A;  2ZIX A;  2KN9 A;  4JAG A;  4AI3 A;  1DX8 A;  1S2Z A;  3SS2 A;  2PPT A;  4V19 6;  3IU3 I;  1R0H A;  4AR4 A;  1YK4 A;  5EIN C;  3KYY A;  2K2D A;  2V0F A;  4RXN A;  4G6B A;  2PVX A;  1NXG A;  1H7V A;  1R0J A;  2XJR A;  1RWD A;  4E6Y A;  2BE5 D;  3J7Z 1;  5JVG 1;  3PWF A;  5GAH c;  1IW7 D;  1QCV A;  5RXN A;  5DM7 1;  1SMW A;  5GAG c;  1BRF A;  1RYQ A;  1FHM A;  4AR6 A;  5GAD c;  4AI0 A;  2RDV A;  4AHZ A;  1VZI A;  2XJP A;  3A44 A;  1VCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...