1C09A

Rubredoxin v44a cp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFEEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Modulation of the redox potential of the [Fe(SCys)(4)] site in rubredoxin by the orientation of a peptide dipole.
pubmed doi rcsb
molecule tags Electron transport
total genus 9
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1c09A00
3MPSA 1IROA 4RXNA 1LKMA 1CADA 5RXNA 3KYWA 1BQ8A 4YWLA 1H7VA 5AI2A 1IU6A 1S24A 4YWMA 2M4YA 4AR6A 3KYXA 5IY0A 1LTLA 2KKDA 1LKPA 1B13A 1SMUA 3PZAA 1VCXA 4ME3A 1QYBA 1FHHA 2VL6A 1R0IA 2GMGA 3RYGA 3SS2A 1QCVA 2RDVA 1LKOA 2LCQA 1ZRPA 1YV1A 1RB9A 4K9FA 4AR5A 2PYAA 2V3BB 1BQ9A 4POFA 1BFYA 2MS3A 3KYUA 2QL0A 6RXNA 1B2JA 1E8JA 1SMWA 1YK4A 3PWFA 1B71A 2PVXA 1FHMA 1YK5A 4AR4A 1C09A 3RZ6A 1DX8A 1R0HA 8RXNA 1R0GA 1RDGA 1T9PA 1CAAA 3KYYA 5AI3A 1JYBA 1B2OA 1T9OA 1DVBA 2KN9A 1SMMA 4POGA 1BE7A 1T9QA 1R0JA 4TPUA 1R0FA 1NNQA 2PVEA 1S2ZA 1S30A 1IRNA 1BRFA 1RDVA 2DSXA 2K2DA 1YUZA 3QVDA 2HR5A 1YUXA 1RYTA 4AR3A 3KYVA 3RZTA 7RXNA 1RWDA 1IU5A 3A44A
chains in the Genus database with same CATH superfamily
3MPSA 4JAEA 3K35A 3KYWA 4A3JL 3HOZL 2JI1A 3H3VM 1S24A 3GTPL 1LTLA 4C2M1 1SMUA 3PZAA 3S16L 4ME3A 4AI3A 5JVH1 4WFN1 1QYBA 5M3ML 2A6ED 2VL6A 1R0IA 3RYGA 3MQKB 4K9FA 4AR5A 5FJ8L 2ERJA 2PYAA 5FLML 2ERSA 4A3DL 2MS3A 4A3EL 2JA7L 2PSMC 4ZN3B 2PVXA 3S17L 2HVYC 2NVXL 3RZ6A 1DX8A 1R0HA 5MGNA 3I4ML 3IU3I 1CAAA 1TWCL 1SFOL 1I3QL 4C3HL 1B2OA 4E6YA 1T9OA 1SMMA 1BE7A 4C3IL 3LWVB 4AHXA 5GAHc 1IRNA 2M6PA 1PFUA 1RDVA 2K2DA 1YUZA 3QVDA 2R92L 4XXBB 1YUXA 4XGHA 2WAQP 4A3IL 2A68D 3RZTA 2JI2A 7RXNA 4QIWP 3HOXL 5EIOC 4Y7NL 2XJUA 3PIO1 4V196 2PPTA 1H7VA 4AR6A 1NXEA 2V0EA 3PIP1 3WWNB 1IW7D 2KKDA 3B0AB 5C4JL 2CR8A 3VPBE 4A3BL 3GTLL 4BBSL 3H0GL 3LWQB 2BE5D 1FHHA 5MFPA 5GAEc 4LHLA 2XJRA 2B63L 1YV1A 2M6OA 2E2IL 4C3JL 1ODHA 3LPEB 2V3BB 4A3ML 1BQ9A 3S1ML 3HAXC 3S2DL 3PKJA 4AHWA 1PFWA 5MLC3 1F4LA 5MF6A 2NVQL 3S1NL 1WJVA 2Y0SP 2XJQA 2NYDA 3KYYA 3HOWL 1JYBA 2KN9A 4POGA 2Z3QB 2ZIXA 1PFYA 5AN9H 1R0FA 1S2ZA 1S30A 3MSUA 3WWLA 5C44L 2DSXA 3FKIL 3H9BA 2HR5A 3HOVL 4AHZA 4A3FL 4BBRL 5C3EL 3GTJL 4B8CD 1Z92B 2E2JL 3KYVA 3HOYL 3M3YL 5RXNA 3A44A 3RZOL 2M4VA 4JADA 3P2AA 3B08B 1BQ8A 4YWLA 3S15L 3I4NL 1WCML 1IU6A 2M4YA 4A3LL 5IY0A 3P8BA 4AYBP 2JA6L 5GADc 5IYCL 2XJVA 2GMGA 3SS2A 2CKCA 1QCVA 1VZHA 1ZRPA 2R93L 4UY81 3RZDL 2RFKB 1QQTA 4POFA 1BFYA 1P7PA 1PFVA 3KYUA 2QL0A 2AUSB 6RXNA 1R9TL 1E8JA 1SMWA 4AI2A 3JR7A 2JA5L 2APOB 4AI0A 3HOUL 1FHMA 1YK5A 4AR4A 2EY4E 1Y1WL 4A3KL 5M3FL 8RXNA 1R0GA 4JAGA 1T9PA 3GTKL 5M5YL 3HJWB 1OWCA 5C4XL 3LWRB 5AI3A 4X6AL 1DVBA 2VUML 1Y1VL 1TWAL 4TPUA 5JVG1 1PZXA 4GS7D 1I50L 5IP7L 2L0ZA 2NVTL 3FDJA 3S1RL 5MFZA 2R7ZL 2CKAA 2H12A 2JA8L 4Y52L 2V0FA 1RYTA 4LHNA 5DM61 4AR3A 3CQZL 4ZN1B 3K7AL 3GTML 4A3GL 1TWFL 1IU5A 4A3CL 2PMZP 1IROA 2XJPA 4RXNA 1LKMA 1CADA 4AI1A 5AI2A 4YWMA 3KYXA 5K2ME 2NVYL 2XJSA 1LKPA 4U671 3QQCE 1B13A 2C6BA 1TWGL 1TWHL 2Z3RB 1VCXA 4TVMA 3NFPI 2RDVA 1LKOA 1K83L 2LCQA 3H9CA 1RB9A 1NXGA 3HJYB 5GAGc 2A6HD 4JAFA 3LNLA 3LWOB 3PL5A 1B2JA 2J9UB 5IYDL 1YK4A 1VZGA 3S14L 3PWFA 1B71A 5DM71 3GTOL 1C09A 3LWPB 3H97A 3GTQL 4BY1L 5M5XL 3S1QL 1RDGA 2WB1P 5H1Sc 3PO3L 4BXXL 2O5JD 2XJTA 3HKZP 2JI3A 2B5ID 1RYQA 4BY7L 3J7Z1 5IYBL 2AYJA 1T9QA 1R0JA 1NNQA 2PVEA 3H99A 1I6HL 1VZIA 4A93L 3S2HL 3PO2L 1BRFA 3PKIA 1OWBA 5M5WL 2E2HL 3ZG6A 3GTGL 4G6BA 2A69D 2C6AA 4AHYA 2YU9L 5IP9L 3M4OL 1RWDA 5EINC 3J7Y1 2AQCA
chains in the Genus database with same CATH topology
3MPSA 4JAEA 1IROA 2XJPA 4RXNA 5EIOC 1LKMA 2M4VA 4JADA 2XJUA 3K35A 1CADA 3P2AA 5RXNA 3PIO1 3KYWA 3B08B 4V196 1BQ8A 2PPTA 4YWLA 4AI1A 1H7VA 2JI1A 5AI2A 1IU6A 1S24A 4YWMA 2M4YA 4AR6A 1NXEA 2V0EA 3KYXA 3WWNB 5K2ME 3PIP1 1IW7D 2XJSA 1LTLA 5IY0A 2KKDA 3B0AB 1LKPA 3P8BA 4U671 3QQCE 1B13A 1SMUA 2C6BA 2CR8A 3VPBE 2Z3RB 3PZAA 1VCXA 4ME3A 4TVMA 2BE5D 4AI3A 5GADc 1QYBA 3NFPI 4WFN1 5JVH1 1FHHA 2A6ED 2VL6A 5MFPA 1R0IA 2XJVA 2GMGA 3RYGA 2CKCA 1QCVA 1VZHA 2RDVA 3SS2A 1LKOA 2LCQA 5GAEc 4LHLA 2XJRA 1ZRPA 1YV1A 1RB9A 2M6OA 4K9FA 4AR5A 4UY81 2ERJA 2PYAA 1ODHA 3LPEB 1NXGA 2V3BB 5GAGc 2A6HD 1BQ9A 4JAFA 2ERSA 3LNLA 4POFA 1BFYA 3PKJA 2MS3A 3KYUA 4AHWA 2QL0A 6RXNA 1B2JA 1E8JA 2J9UB 1SMWA 1VZGA 1YK4A 4AI2A 3PWFA 1B71A 2PSMC 5DM71 4AI0A 2PVXA 4ZN3B 1FHMA 1YK5A 5MLC3 4AR4A 5MF6A 1C09A 3RZ6A 1DX8A 1R0HA 8RXNA 1R0GA 1RDGA 5MGNA 4JAGA 5H1Sc 1T9PA 3IU3I 2O5JD 2XJTA 1WJVA 1CAAA 1OWCA 2XJQA 2NYDA 2JI3A 3KYYA 5AI3A 2B5ID 1JYBA 1RYQA 1B2OA 4E6YA 1T9OA 1DVBA 2KN9A 3J7Z1 1SMMA 4POGA 1BE7A 2Z3QB 2ZIXA 2AYJA 1T9QA 1R0JA 5AN9H 4TPUA 1R0FA 5JVG1 1NNQA 2PVEA 4GS7D 1S2ZA 4AHXA 2L0ZA 1VZIA 5GAHc 1S30A 1IRNA 3MSUA 1BRFA 2M6PA 3WWLA 1RDVA 3PKIA 2DSXA 2K2DA 1YUZA 5MFZA 3QVDA 1OWBA 2HR5A 4AHZA 2CKAA 2H12A 3ZG6A 4XXBB 1YUXA 4G6BA 4XGHA 2A69D 1RYTA 2V0FA 4LHNA 5DM61 4B8CD 4AR3A 1Z92B 3KYVA 4ZN1B 2C6AA 2A68D 4AHYA 3RZTA 2JI2A 7RXNA 1RWDA 5EINC 3J7Y1 1IU5A 3A44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPS A;  1IRO A;  4RXN A;  1LKM A;  1CAD A;  5RXN A;  3KYW A;  1BQ8 A;  4YWL A;  1H7V A;  5AI2 A;  1IU6 A;  1S24 A;  4YWM A;  2M4Y A;  4AR6 A;  3KYX A;  5IY0 A;  1LTL A;  2KKD A;  1LKP A;  1B13 A;  1SMU A;  3PZA A;  1VCX A;  4ME3 A;  1QYB A;  1FHH A;  2VL6 A;  1R0I A;  2GMG A;  3RYG A;  3SS2 A;  1QCV A;  2RDV A;  1LKO A;  2LCQ A;  1ZRP A;  1YV1 A;  1RB9 A;  4K9F A;  4AR5 A;  2PYA A;  2V3B B;  1BQ9 A;  4POF A;  1BFY A;  2MS3 A;  3KYU A;  2QL0 A;  6RXN A;  1B2J A;  1E8J A;  1SMW A;  1YK4 A;  3PWF A;  1B71 A;  2PVX A;  1FHM A;  1YK5 A;  4AR4 A;  1C09 A;  3RZ6 A;  1DX8 A;  1R0H A;  8RXN A;  1R0G A;  1RDG A;  1T9P A;  1CAA A;  3KYY A;  5AI3 A;  1JYB A;  1B2O A;  1T9O A;  1DVB A;  2KN9 A;  1SMM A;  4POG A;  1BE7 A;  1T9Q A;  1R0J A;  4TPU A;  1R0F A;  1NNQ A;  2PVE A;  1S2Z A;  1S30 A;  1IRN A;  1BRF A;  1RDV A;  2DSX A;  2K2D A;  1YUZ A;  3QVD A;  2HR5 A;  1YUX A;  1RYT A;  4AR3 A;  3KYV A;  3RZT A;  7RXN A;  1RWD A;  1IU5 A;  3A44 A; 
#chains in the Genus database with same CATH topology
 3MPS A;  4JAE A;  3K35 A;  3KYW A;  4A3J L;  3HOZ L;  2JI1 A;  3H3V M;  1S24 A;  3GTP L;  1LTL A;  4C2M 1;  1SMU A;  3PZA A;  3S16 L;  4ME3 A;  4AI3 A;  5JVH 1;  4WFN 1;  1QYB A;  5M3M L;  2A6E D;  2VL6 A;  1R0I A;  3RYG A;  3MQK B;  4K9F A;  4AR5 A;  5FJ8 L;  2ERJ A;  2PYA A;  5FLM L;  2ERS A;  4A3D L;  2MS3 A;  4A3E L;  2JA7 L;  2PSM C;  4ZN3 B;  2PVX A;  3S17 L;  2HVY C;  2NVX L;  3RZ6 A;  1DX8 A;  1R0H A;  5MGN A;  3I4M L;  3IU3 I;  1CAA A;  1TWC L;  1SFO L;  1I3Q L;  4C3H L;  1B2O A;  4E6Y A;  1T9O A;  1SMM A;  1BE7 A;  4C3I L;  3LWV B;  4AHX A;  5GAH c;  1IRN A;  2M6P A;  1PFU A;  1RDV A;  2K2D A;  1YUZ A;  3QVD A;  2R92 L;  4XXB B;  1YUX A;  4XGH A;  2WAQ P;  4A3I L;  2A68 D;  3RZT A;  2JI2 A;  7RXN A;  4QIW P;  3HOX L;  5EIO C;  4Y7N L;  2XJU A;  3PIO 1;  4V19 6;  2PPT A;  1H7V A;  4AR6 A;  1NXE A;  2V0E A;  3PIP 1;  3WWN B;  1IW7 D;  2KKD A;  3B0A B;  5C4J L;  2CR8 A;  3VPB E;  4A3B L;  3GTL L;  4BBS L;  3H0G L;  3LWQ B;  2BE5 D;  1FHH A;  5MFP A;  5GAE c;  4LHL A;  2XJR A;  2B63 L;  1YV1 A;  2M6O A;  2E2I L;  4C3J L;  1ODH A;  3LPE B;  2V3B B;  4A3M L;  1BQ9 A;  3S1M L;  3HAX C;  3S2D L;  3PKJ A;  4AHW A;  1PFW A;  5MLC 3;  1F4L A;  5MF6 A;  2NVQ L;  3S1N L;  1WJV A;  2Y0S P;  2XJQ A;  2NYD A;  3KYY A;  3HOW L;  1JYB A;  2KN9 A;  4POG A;  2Z3Q B;  2ZIX A;  1PFY A;  5AN9 H;  1R0F A;  1S2Z A;  1S30 A;  3MSU A;  3WWL A;  5C44 L;  2DSX A;  3FKI L;  3H9B A;  2HR5 A;  3HOV L;  4AHZ A;  4A3F L;  4BBR L;  5C3E L;  3GTJ L;  4B8C D;  1Z92 B;  2E2J L;  3KYV A;  3HOY L;  3M3Y L;  5RXN A;  3A44 A;  3RZO L;  2M4V A;  4JAD A;  3P2A A;  3B08 B;  1BQ8 A;  4YWL A;  3S15 L;  3I4N L;  1WCM L;  1IU6 A;  2M4Y A;  4A3L L;  5IY0 A;  3P8B A;  4AYB P;  2JA6 L;  5GAD c;  5IYC L;  2XJV A;  2GMG A;  3SS2 A;  2CKC A;  1QCV A;  1VZH A;  1ZRP A;  2R93 L;  4UY8 1;  3RZD L;  2RFK B;  1QQT A;  4POF A;  1BFY A;  1P7P A;  1PFV A;  3KYU A;  2QL0 A;  2AUS B;  6RXN A;  1R9T L;  1E8J A;  1SMW A;  4AI2 A;  3JR7 A;  2JA5 L;  2APO B;  4AI0 A;  3HOU L;  1FHM A;  1YK5 A;  4AR4 A;  2EY4 E;  1Y1W L;  4A3K L;  5M3F L;  8RXN A;  1R0G A;  4JAG A;  1T9P A;  3GTK L;  5M5Y L;  3HJW B;  1OWC A;  5C4X L;  3LWR B;  5AI3 A;  4X6A L;  1DVB A;  2VUM L;  1Y1V L;  1TWA L;  4TPU A;  5JVG 1;  1PZX A;  4GS7 D;  1I50 L;  5IP7 L;  2L0Z A;  2NVT L;  3FDJ A;  3S1R L;  5MFZ A;  2R7Z L;  2CKA A;  2H12 A;  2JA8 L;  4Y52 L;  2V0F A;  1RYT A;  4LHN A;  5DM6 1;  4AR3 A;  3CQZ L;  4ZN1 B;  3K7A L;  3GTM L;  4A3G L;  1TWF L;  1IU5 A;  4A3C L;  2PMZ P;  1IRO A;  2XJP A;  4RXN A;  1LKM A;  1CAD A;  4AI1 A;  5AI2 A;  4YWM A;  3KYX A;  5K2M E;  2NVY L;  2XJS A;  1LKP A;  4U67 1;  3QQC E;  1B13 A;  2C6B A;  1TWG L;  1TWH L;  2Z3R B;  1VCX A;  4TVM A;  3NFP I;  2RDV A;  1LKO A;  1K83 L;  2LCQ A;  3H9C A;  1RB9 A;  1NXG A;  3HJY B;  5GAG c;  2A6H D;  4JAF A;  3LNL A;  3LWO B;  3PL5 A;  1B2J A;  2J9U B;  5IYD L;  1YK4 A;  1VZG A;  3S14 L;  3PWF A;  1B71 A;  5DM7 1;  3GTO L;  1C09 A;  3LWP B;  3H97 A;  3GTQ L;  4BY1 L;  5M5X L;  3S1Q L;  1RDG A;  2WB1 P;  5H1S c;  3PO3 L;  4BXX L;  2O5J D;  2XJT A;  3HKZ P;  2JI3 A;  2B5I D;  1RYQ A;  4BY7 L;  3J7Z 1;  5IYB L;  2AYJ A;  1T9Q A;  1R0J A;  1NNQ A;  2PVE A;  3H99 A;  1I6H L;  1VZI A;  4A93 L;  3S2H L;  3PO2 L;  1BRF A;  3PKI A;  1OWB A;  5M5W L;  2E2H L;  3ZG6 A;  3GTG L;  4G6B A;  2A69 D;  2C6A A;  4AHY A;  2YU9 L;  5IP9 L;  3M4O L;  1RWD A;  5EIN C;  3J7Y 1;  2AQC A; 
#chains in the Genus database with same CATH homology
 3MPS A;  4JAE A;  1IRO A;  2XJP A;  4RXN A;  5EIO C;  1LKM A;  2M4V A;  4JAD A;  2XJU A;  3K35 A;  1CAD A;  3P2A A;  5RXN A;  3PIO 1;  3KYW A;  3B08 B;  4V19 6;  1BQ8 A;  2PPT A;  4YWL A;  4AI1 A;  1H7V A;  2JI1 A;  5AI2 A;  1IU6 A;  1S24 A;  4YWM A;  2M4Y A;  4AR6 A;  1NXE A;  2V0E A;  3KYX A;  3WWN B;  5K2M E;  3PIP 1;  1IW7 D;  2XJS A;  1LTL A;  5IY0 A;  2KKD A;  3B0A B;  1LKP A;  3P8B A;  4U67 1;  3QQC E;  1B13 A;  1SMU A;  2C6B A;  2CR8 A;  3VPB E;  2Z3R B;  3PZA A;  1VCX A;  4ME3 A;  4TVM A;  2BE5 D;  4AI3 A;  5GAD c;  1QYB A;  3NFP I;  4WFN 1;  5JVH 1;  1FHH A;  2A6E D;  2VL6 A;  5MFP A;  1R0I A;  2XJV A;  2GMG A;  3RYG A;  2CKC A;  1QCV A;  1VZH A;  2RDV A;  3SS2 A;  1LKO A;  2LCQ A;  5GAE c;  4LHL A;  2XJR A;  1ZRP A;  1YV1 A;  1RB9 A;  2M6O A;  4K9F A;  4AR5 A;  4UY8 1;  2ERJ A;  2PYA A;  1ODH A;  3LPE B;  1NXG A;  2V3B B;  5GAG c;  2A6H D;  1BQ9 A;  4JAF A;  2ERS A;  3LNL A;  4POF A;  1BFY A;  3PKJ A;  2MS3 A;  3KYU A;  4AHW A;  2QL0 A;  6RXN A;  1B2J A;  1E8J A;  2J9U B;  1SMW A;  1VZG A;  1YK4 A;  4AI2 A;  3PWF A;  1B71 A;  2PSM C;  5DM7 1;  4AI0 A;  2PVX A;  4ZN3 B;  1FHM A;  1YK5 A;  5MLC 3;  4AR4 A;  5MF6 A;  1C09 A;  3RZ6 A;  1DX8 A;  1R0H A;  8RXN A;  1R0G A;  1RDG A;  5MGN A;  4JAG A;  5H1S c;  1T9P A;  3IU3 I;  2O5J D;  2XJT A;  1WJV A;  1CAA A;  1OWC A;  2XJQ A;  2NYD A;  2JI3 A;  3KYY A;  5AI3 A;  2B5I D;  1JYB A;  1RYQ A;  1B2O A;  4E6Y A;  1T9O A;  1DVB A;  2KN9 A;  3J7Z 1;  1SMM A;  4POG A;  1BE7 A;  2Z3Q B;  2ZIX A;  2AYJ A;  1T9Q A;  1R0J A;  5AN9 H;  4TPU A;  1R0F A;  5JVG 1;  1NNQ A;  2PVE A;  4GS7 D;  1S2Z A;  4AHX A;  2L0Z A;  1VZI A;  5GAH c;  1S30 A;  1IRN A;  3MSU A;  1BRF A;  2M6P A;  3WWL A;  1RDV A;  3PKI A;  2DSX A;  2K2D A;  1YUZ A;  5MFZ A;  3QVD A;  1OWB A;  2HR5 A;  4AHZ A;  2CKA A;  2H12 A;  3ZG6 A;  4XXB B;  1YUX A;  4G6B A;  4XGH A;  2A69 D;  1RYT A;  2V0F A;  4LHN A;  5DM6 1;  4B8C D;  4AR3 A;  1Z92 B;  3KYV A;  4ZN1 B;  2C6A A;  2A68 D;  4AHY A;  3RZT A;  2JI2 A;  7RXN A;  1RWD A;  5EIN C;  3J7Y 1;  1IU5 A;  3A44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...