1CAAA

X-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
53
structure length
53
Chain Sequence
AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title X-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium Pyrococcus furiosus.
pubmed rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 11
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1992-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1caaA00
2RDVA 1LTLA 1IROA 1B71A 1JYBA 1B2OA 1BE7A 1SMUA 2PVEA 1R0FA 1CADA 5AI2A 1IU5A 1S24A 2HR5A 1R0JA 2QL0A 1DVBA 2VL6A 1VCXA 8RXNA 4TPUA 1T9QA 1B13A 1IRNA 1BQ8A 1CAAA 2PVXA 1S2ZA 1FHHA 3QVDA 1QYBA 5RXNA 1H7VA 2DSXA 1RDGA 2K2DA 2LCQA 1RB9A 3MPSA 4AR6A 3KYYA 4RXNA 2GMGA 3KYXA 1LKMA 1S30A 1YK4A 2KKDA 1SMWA 3A44A 1LKPA 3KYWA 5AI3A 1SMMA 1YUZA 3SS2A 1R0HA 1BFYA 3PZAA 4POGA 1BQ9A 3RYGA 1E8JA 1R0IA 7RXNA 1RDVA 4ME3A 4YWMA 4AR3A 2V3BB 4K9FA 2M4YA 1R0GA 4YWLA 1RWDA 1YK5A 1YUXA 3PWFA 1IU6A 2MS3A 2PYAA 1BRFA 4AR5A 1QCVA 2KN9A 6RXNA 1C09A 1RYTA 1LKOA 4POFA 3KYVA 5IY0A 1YV1A 3KYUA 1NNQA 4AR4A 1ZRPA 1FHMA 3RZ6A 1B2JA 1T9OA 1T9PA 3RZTA 1DX8A
chains in the Genus database with same CATH superfamily
2E2HL 1IROA 2XJSA 4ZN3B 1JYBA 1B2OA 4AI1A 5IP7L 1P7PA 1CADA 3M4OL 3GTGL 4A3DL 1IU5A 4A3IL 3HJWB 5GAGc 4JAFA 2M4VA 1TWGL 4TPUA 2H12A 3NFPI 3HOXL 1B13A 1BQ8A 2PVXA 1S2ZA 2A6HD 1ODHA 5IYDL 3FDJA 3WWLA 1H7VA 1K83L 3H3VM 2LCQA 2AQCA 2JA7L 4AI0A 1Y1VL 1LKMA 1PFYA 2KKDA 4C3JL 2PSMC 5C4XL 1YUZA 1Y1WL 3PZAA 3B0AB 4BXXL 4Y52L 2A6ED 3LWOB 5M3FL 1RDVA 2XJRA 3PO3L 2XJQA 2V0FA 4Y7NL 1YK5A 1PZXA 1R9TL 1IU6A 2ERSA 4A3GL 3GTKL 2CKAA 5M5WL 3LWVB 1FHMA 3J7Y1 3PL5A 1B2JA 1VZIA 1NXGA 5M5YL 4A3JL 2V0EA 2RDVA 4A3KL 1BE7A 3MSUA 1SMUA 2PVEA 3PIP1 3LWRB 5EIOC 2PMZP 2BE5D 4BBSL 1S24A 3H97A 2CR8A 4X6AL 5AN9H 8RXNA 2PPTA 1PFWA 5IYBL 3LWPB 2XJTA 5MLC3 5C4JL 5C3EL 3S1ML 1CAAA 2ERJA 3QVDA 1NXEA 3LPEB 2DSXA 4ZN1B 4TVMA 3LNLA 2NVYL 3HOVL 3S16L 3KYYA 4AI2A 2NVXL 4A3FL 3H9BA 3HOYL 3P8BA 4AHWA 1R0HA 4WFN1 4A3ML 4AI3A 2WAQP 2Y0SP 1TWCL 5GAHc 2JA8L 2E2IL 3RYGA 3PO2L 4C2M1 5DM61 4ME3A 2V3BB 2R92L 1QQTA 2JA6L 1YUXA 4G6BA 1RYQA 3I4NL 1OWBA 1QCVA 4POFA 3IU3I 3MQKB 2M6PA 1Z92B 4AR4A 3HJYB 4JADA 2YU9L 3S2DL 5GADc 2JI2A 4XXBB 3HAXC 2R7ZL 4A3EL 1LTLA 5M5XL 3S2HL 2RFKB 1WJVA 3HOUL 1R0JA 1DVBA 3GTJL 3ZG6A 1TWAL 3HOWL 4LHNA 2B5ID 1T9QA 4UY81 4BY7L 5K2ME 1FHHA 2NYDA 2APOB 1QYBA 1IW7D 4AHYA 2XJUA 2L0ZA 2Z3RB 3GTLL 5EINC 5MFPA 5GAEc 3MPSA 5C44L 1VZGA 3KYXA 1YK4A 3RZDL 1SMWA 2JA5L 2ZIXA 1I6HL 3VPBE 5AI3A 1SMMA 3J7Z1 1BFYA 3K35A 4AYBP 1BQ9A 2E2JL 1SFOL 1R0IA 4YWMA 3GTML 2C6AA 5JVG1 4YWLA 1RWDA 3I4ML 1I50L 2CKCA 3S1RL 3PWFA 1PFUA 1BRFA 1TWHL 2JI1A 2KN9A 4XGHA 1C09A 1LKOA 3K7AL 3KYVA 4E6YA 5IY0A 3KYUA 2XJPA 1ZRPA 2O5JD 4AHXA 4C3HL 2Z3QB 1T9OA 4JAGA 3M3YL 3H99A 3H0GL 1B71A 3LWQB 4V196 3GTOL 2M6OA 4LHLA 1R0FA 4B8CD 3S15L 3RZOL 2VUML 4U671 4GS7D 3S14L 5AI2A 4A3CL 3P2AA 2HR5A 3S1NL 2WB1P 2QL0A 3S17L 4C3IL 2VL6A 1VCXA 4BY1L 3PKIA 4AHZA 2B63L 5MGNA 1PFVA 1WCML 1IRNA 1VZHA 2J9UB 3FKIL 2AUSB 3HKZP 4BBRL 3B08B 5RXNA 3PIO1 2NVQL 1RDGA 2JI3A 2K2DA 2HVYC 5MFZA 5FJ8L 1RB9A 4AR6A 1OWCA 2GMGA 4RXNA 1S30A 1TWFL 3A44A 5H1Sc 1LKPA 3KYWA 3SS2A 4A3BL 4JAEA 2EY4E 3HOZL 3H9CA 2R93L 4POGA 1E8JA 4A93L 7RXNA 3GTPL 2A69D 3GTQL 4AR3A 4K9FA 2M4YA 1R0GA 4QIWP 3JR7A 3S1QL 5JVH1 3QQCE 2XJVA 2MS3A 2PYAA 2A68D 5M3ML 4AR5A 6RXNA 2AYJA 3CQZL 1RYTA 5IYCL 3WWNB 1YV1A 1NNQA 2NVTL 3RZ6A 1F4LA 5IP9L 1I3QL 3PKJA 5DM71 1T9PA 3RZTA 1DX8A 5MF6A 5FLML 4A3LL 2C6BA
chains in the Genus database with same CATH topology
2RDVA 1LTLA 1IROA 2XJSA 1B71A 1JYBA 4ZN3B 1B2OA 4V196 2M6OA 1BE7A 3MSUA 1SMUA 2PVEA 4LHLA 4AI1A 1R0FA 3PIP1 4B8CD 1CADA 5EIOC 2BE5D 4U671 1WJVA 4GS7D 5AI2A 1IU5A 3P2AA 1S24A 2HR5A 2CR8A 1R0JA 2QL0A 1DVBA 5GAGc 5AN9H 2VL6A 1VCXA 4JAFA 2PPTA 3ZG6A 8RXNA 3PKIA 2M4VA 4AHZA 2XJTA 5MGNA 4LHNA 4TPUA 5MLC3 2H12A 2B5ID 3NFPI 1T9QA 4UY81 1B13A 1IRNA 1BQ8A 1CAAA 2ERJA 1VZHA 2PVXA 1S2ZA 5K2ME 2J9UB 1FHHA 3QVDA 2NYDA 2A6HD 1ODHA 1QYBA 1IW7D 3B08B 4AHYA 2XJUA 5RXNA 2L0ZA 3PIO1 3WWLA 2Z3RB 5EINC 1NXEA 1H7VA 3LPEB 2DSXA 1RDGA 2JI3A 4ZN1B 2K2DA 4TVMA 3LNLA 2LCQA 5MFPA 5GAEc 5MFZA 1RB9A 3MPSA 4AR6A 3KYYA 4AI2A 1OWCA 1VZGA 2GMGA 3KYXA 4RXNA 4AI0A 1LKMA 1S30A 1YK4A 3P8BA 1SMWA 2KKDA 3A44A 4AHWA 2PSMC 2ZIXA 5H1Sc 3VPBE 1LKPA 3KYWA 5AI3A 1SMMA 1YUZA 3SS2A 3J7Z1 1R0HA 4JAEA 4WFN1 1BFYA 3K35A 3PZAA 4AI3A 4POGA 3B0AB 1BQ9A 5GAHc 2A6ED 3RYGA 1E8JA 1R0IA 7RXNA 5DM61 2A69D 1RDVA 2XJRA 4ME3A 4YWMA 4AR3A 2C6AA 2V3BB 4K9FA 2M4YA 2XJQA 1R0GA 5JVG1 2V0FA 4YWLA 1RWDA 2CKCA 5JVH1 1YK5A 3QQCE 1YUXA 3PWFA 4G6BA 2XJVA 1RYQA 1IU6A 2MS3A 2PYAA 2A68D 2ERSA 1BRFA 2JI1A 4AR5A 1OWBA 1QCVA 2KN9A 6RXNA 2AYJA 1C09A 4XGHA 1RYTA 1LKOA 4POFA 3IU3I 3KYVA 4E6YA 2CKAA 3WWNB 5IY0A 1YV1A 3KYUA 1NNQA 2M6PA 2XJPA 1Z92B 1ZRPA 4AR4A 4JADA 2O5JD 1FHMA 4AHXA 3J7Y1 3RZ6A 1B2JA 5GADc 1VZIA 2JI2A 1NXGA 3PKJA 5DM71 4XXBB 2Z3QB 1T9OA 1T9PA 4JAGA 3RZTA 1DX8A 2V0EA 5MF6A 2C6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDV A;  1LTL A;  1IRO A;  1B71 A;  1JYB A;  1B2O A;  1BE7 A;  1SMU A;  2PVE A;  1R0F A;  1CAD A;  5AI2 A;  1IU5 A;  1S24 A;  2HR5 A;  1R0J A;  2QL0 A;  1DVB A;  2VL6 A;  1VCX A;  8RXN A;  4TPU A;  1T9Q A;  1B13 A;  1IRN A;  1BQ8 A;  1CAA A;  2PVX A;  1S2Z A;  1FHH A;  3QVD A;  1QYB A;  5RXN A;  1H7V A;  2DSX A;  1RDG A;  2K2D A;  2LCQ A;  1RB9 A;  3MPS A;  4AR6 A;  3KYY A;  4RXN A;  2GMG A;  3KYX A;  1LKM A;  1S30 A;  1YK4 A;  2KKD A;  1SMW A;  3A44 A;  1LKP A;  3KYW A;  5AI3 A;  1SMM A;  1YUZ A;  3SS2 A;  1R0H A;  1BFY A;  3PZA A;  4POG A;  1BQ9 A;  3RYG A;  1E8J A;  1R0I A;  7RXN A;  1RDV A;  4ME3 A;  4YWM A;  4AR3 A;  2V3B B;  4K9F A;  2M4Y A;  1R0G A;  4YWL A;  1RWD A;  1YK5 A;  1YUX A;  3PWF A;  1IU6 A;  2MS3 A;  2PYA A;  1BRF A;  4AR5 A;  1QCV A;  2KN9 A;  6RXN A;  1C09 A;  1RYT A;  1LKO A;  4POF A;  3KYV A;  5IY0 A;  1YV1 A;  3KYU A;  1NNQ A;  4AR4 A;  1ZRP A;  1FHM A;  3RZ6 A;  1B2J A;  1T9O A;  1T9P A;  3RZT A;  1DX8 A; 
#chains in the Genus database with same CATH topology
 2E2H L;  1IRO A;  2XJS A;  4ZN3 B;  1JYB A;  1B2O A;  4AI1 A;  5IP7 L;  1P7P A;  1CAD A;  3M4O L;  3GTG L;  4A3D L;  1IU5 A;  4A3I L;  3HJW B;  5GAG c;  4JAF A;  2M4V A;  1TWG L;  4TPU A;  2H12 A;  3NFP I;  3HOX L;  1B13 A;  1BQ8 A;  2PVX A;  1S2Z A;  2A6H D;  1ODH A;  5IYD L;  3FDJ A;  3WWL A;  1H7V A;  1K83 L;  3H3V M;  2LCQ A;  2AQC A;  2JA7 L;  4AI0 A;  1Y1V L;  1LKM A;  1PFY A;  2KKD A;  4C3J L;  2PSM C;  5C4X L;  1YUZ A;  1Y1W L;  3PZA A;  3B0A B;  4BXX L;  4Y52 L;  2A6E D;  3LWO B;  5M3F L;  1RDV A;  2XJR A;  3PO3 L;  2XJQ A;  2V0F A;  4Y7N L;  1YK5 A;  1PZX A;  1R9T L;  1IU6 A;  2ERS A;  4A3G L;  3GTK L;  2CKA A;  5M5W L;  3LWV B;  1FHM A;  3J7Y 1;  3PL5 A;  1B2J A;  1VZI A;  1NXG A;  5M5Y L;  4A3J L;  2V0E A;  2RDV A;  4A3K L;  1BE7 A;  3MSU A;  1SMU A;  2PVE A;  3PIP 1;  3LWR B;  5EIO C;  2PMZ P;  2BE5 D;  4BBS L;  1S24 A;  3H97 A;  2CR8 A;  4X6A L;  5AN9 H;  8RXN A;  2PPT A;  1PFW A;  5IYB L;  3LWP B;  2XJT A;  5MLC 3;  5C4J L;  5C3E L;  3S1M L;  1CAA A;  2ERJ A;  3QVD A;  1NXE A;  3LPE B;  2DSX A;  4ZN1 B;  4TVM A;  3LNL A;  2NVY L;  3HOV L;  3S16 L;  3KYY A;  4AI2 A;  2NVX L;  4A3F L;  3H9B A;  3HOY L;  3P8B A;  4AHW A;  1R0H A;  4WFN 1;  4A3M L;  4AI3 A;  2WAQ P;  2Y0S P;  1TWC L;  5GAH c;  2JA8 L;  2E2I L;  3RYG A;  3PO2 L;  4C2M 1;  5DM6 1;  4ME3 A;  2V3B B;  2R92 L;  1QQT A;  2JA6 L;  1YUX A;  4G6B A;  1RYQ A;  3I4N L;  1OWB A;  1QCV A;  4POF A;  3IU3 I;  3MQK B;  2M6P A;  1Z92 B;  4AR4 A;  3HJY B;  4JAD A;  2YU9 L;  3S2D L;  5GAD c;  2JI2 A;  4XXB B;  3HAX C;  2R7Z L;  4A3E L;  1LTL A;  5M5X L;  3S2H L;  2RFK B;  1WJV A;  3HOU L;  1R0J A;  1DVB A;  3GTJ L;  3ZG6 A;  1TWA L;  3HOW L;  4LHN A;  2B5I D;  1T9Q A;  4UY8 1;  4BY7 L;  5K2M E;  1FHH A;  2NYD A;  2APO B;  1QYB A;  1IW7 D;  4AHY A;  2XJU A;  2L0Z A;  2Z3R B;  3GTL L;  5EIN C;  5MFP A;  5GAE c;  3MPS A;  5C44 L;  1VZG A;  3KYX A;  1YK4 A;  3RZD L;  1SMW A;  2JA5 L;  2ZIX A;  1I6H L;  3VPB E;  5AI3 A;  1SMM A;  3J7Z 1;  1BFY A;  3K35 A;  4AYB P;  1BQ9 A;  2E2J L;  1SFO L;  1R0I A;  4YWM A;  3GTM L;  2C6A A;  5JVG 1;  4YWL A;  1RWD A;  3I4M L;  1I50 L;  2CKC A;  3S1R L;  3PWF A;  1PFU A;  1BRF A;  1TWH L;  2JI1 A;  2KN9 A;  4XGH A;  1C09 A;  1LKO A;  3K7A L;  3KYV A;  4E6Y A;  5IY0 A;  3KYU A;  2XJP A;  1ZRP A;  2O5J D;  4AHX A;  4C3H L;  2Z3Q B;  1T9O A;  4JAG A;  3M3Y L;  3H99 A;  3H0G L;  1B71 A;  3LWQ B;  4V19 6;  3GTO L;  2M6O A;  4LHL A;  1R0F A;  4B8C D;  3S15 L;  3RZO L;  2VUM L;  4U67 1;  4GS7 D;  3S14 L;  5AI2 A;  4A3C L;  3P2A A;  2HR5 A;  3S1N L;  2WB1 P;  2QL0 A;  3S17 L;  4C3I L;  2VL6 A;  1VCX A;  4BY1 L;  3PKI A;  4AHZ A;  2B63 L;  5MGN A;  1PFV A;  1WCM L;  1IRN A;  1VZH A;  2J9U B;  3FKI L;  2AUS B;  3HKZ P;  4BBR L;  3B08 B;  5RXN A;  3PIO 1;  2NVQ L;  1RDG A;  2JI3 A;  2K2D A;  2HVY C;  5MFZ A;  5FJ8 L;  1RB9 A;  4AR6 A;  1OWC A;  2GMG A;  4RXN A;  1S30 A;  1TWF L;  3A44 A;  5H1S c;  1LKP A;  3KYW A;  3SS2 A;  4A3B L;  4JAE A;  2EY4 E;  3HOZ L;  3H9C A;  2R93 L;  4POG A;  1E8J A;  4A93 L;  7RXN A;  3GTP L;  2A69 D;  3GTQ L;  4AR3 A;  4K9F A;  2M4Y A;  1R0G A;  4QIW P;  3JR7 A;  3S1Q L;  5JVH 1;  3QQC E;  2XJV A;  2MS3 A;  2PYA A;  2A68 D;  5M3M L;  4AR5 A;  6RXN A;  2AYJ A;  3CQZ L;  1RYT A;  5IYC L;  3WWN B;  1YV1 A;  1NNQ A;  2NVT L;  3RZ6 A;  1F4L A;  5IP9 L;  1I3Q L;  3PKJ A;  5DM7 1;  1T9P A;  3RZT A;  1DX8 A;  5MF6 A;  5FLM L;  4A3L L;  2C6B A; 
#chains in the Genus database with same CATH homology
 2RDV A;  1LTL A;  1IRO A;  2XJS A;  1B71 A;  1JYB A;  4ZN3 B;  1B2O A;  4V19 6;  2M6O A;  1BE7 A;  3MSU A;  1SMU A;  2PVE A;  4LHL A;  4AI1 A;  1R0F A;  3PIP 1;  4B8C D;  1CAD A;  5EIO C;  2BE5 D;  4U67 1;  1WJV A;  4GS7 D;  5AI2 A;  1IU5 A;  3P2A A;  1S24 A;  2HR5 A;  2CR8 A;  1R0J A;  2QL0 A;  1DVB A;  5GAG c;  5AN9 H;  2VL6 A;  1VCX A;  4JAF A;  2PPT A;  3ZG6 A;  8RXN A;  3PKI A;  2M4V A;  4AHZ A;  2XJT A;  5MGN A;  4LHN A;  4TPU A;  5MLC 3;  2H12 A;  2B5I D;  3NFP I;  1T9Q A;  4UY8 1;  1B13 A;  1IRN A;  1BQ8 A;  1CAA A;  2ERJ A;  1VZH A;  2PVX A;  1S2Z A;  5K2M E;  2J9U B;  1FHH A;  3QVD A;  2NYD A;  2A6H D;  1ODH A;  1QYB A;  1IW7 D;  3B08 B;  4AHY A;  2XJU A;  5RXN A;  2L0Z A;  3PIO 1;  3WWL A;  2Z3R B;  5EIN C;  1NXE A;  1H7V A;  3LPE B;  2DSX A;  1RDG A;  2JI3 A;  4ZN1 B;  2K2D A;  4TVM A;  3LNL A;  2LCQ A;  5MFP A;  5GAE c;  5MFZ A;  1RB9 A;  3MPS A;  4AR6 A;  3KYY A;  4AI2 A;  1OWC A;  1VZG A;  2GMG A;  3KYX A;  4RXN A;  4AI0 A;  1LKM A;  1S30 A;  1YK4 A;  3P8B A;  1SMW A;  2KKD A;  3A44 A;  4AHW A;  2PSM C;  2ZIX A;  5H1S c;  3VPB E;  1LKP A;  3KYW A;  5AI3 A;  1SMM A;  1YUZ A;  3SS2 A;  3J7Z 1;  1R0H A;  4JAE A;  4WFN 1;  1BFY A;  3K35 A;  3PZA A;  4AI3 A;  4POG A;  3B0A B;  1BQ9 A;  5GAH c;  2A6E D;  3RYG A;  1E8J A;  1R0I A;  7RXN A;  5DM6 1;  2A69 D;  1RDV A;  2XJR A;  4ME3 A;  4YWM A;  4AR3 A;  2C6A A;  2V3B B;  4K9F A;  2M4Y A;  2XJQ A;  1R0G A;  5JVG 1;  2V0F A;  4YWL A;  1RWD A;  2CKC A;  5JVH 1;  1YK5 A;  3QQC E;  1YUX A;  3PWF A;  4G6B A;  2XJV A;  1RYQ A;  1IU6 A;  2MS3 A;  2PYA A;  2A68 D;  2ERS A;  1BRF A;  2JI1 A;  4AR5 A;  1OWB A;  1QCV A;  2KN9 A;  6RXN A;  2AYJ A;  1C09 A;  4XGH A;  1RYT A;  1LKO A;  4POF A;  3IU3 I;  3KYV A;  4E6Y A;  2CKA A;  3WWN B;  5IY0 A;  1YV1 A;  3KYU A;  1NNQ A;  2M6P A;  2XJP A;  1Z92 B;  1ZRP A;  4AR4 A;  4JAD A;  2O5J D;  1FHM A;  4AHX A;  3J7Y 1;  3RZ6 A;  1B2J A;  5GAD c;  1VZI A;  2JI2 A;  1NXG A;  3PKJ A;  5DM7 1;  4XXB B;  2Z3Q B;  1T9O A;  1T9P A;  4JAG A;  3RZT A;  1DX8 A;  2V0E A;  5MF6 A;  2C6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...