1FHMA

X-ray crystal structure of reduced rubredoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Leucine 41 is a gate for water entry in the reduction of Clostridium pasteurianum rubredoxin.
pubmed rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 9
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1fhmA00
2MS3A 1CAAA 4POFA 1RDVA 3KYXA 1IU5A 3MPSA 5AI2A 1RWDA 4AR5A 1E8JA 1YUZA 4AR3A 1QYBA 3A44A 4YWMA 2KN9A 3SS2A 1BQ8A 1R0FA 1JYBA 4RXNA 1YV1A 1B2OA 1BQ9A 1LKOA 1R0HA 2M4YA 1ZRPA 1SMWA 4ME3A 1IRNA 1T9QA 1H7VA 4K9FA 1CADA 1YK5A 2DSXA 8RXNA 2KKDA 1S30A 1T9OA 1LTLA 2V3BB 5IY0A 1S24A 1LKMA 1T9PA 4POGA 1VCXA 2RDVA 1YUXA 1R0JA 2K2DA 1IU6A 1NNQA 1YK4A 1LKPA 1B13A 1SMMA 3PZAA 1BRFA 2PVEA 1DX8A 3KYUA 1B2JA 6RXNA 4TPUA 4AR4A 3RZTA 3RZ6A 2VL6A 1R0IA 3KYWA 1SMUA 1BFYA 2LCQA 7RXNA 3QVDA 3PWFA 1RYTA 2GMGA 1IROA 1QCVA 1BE7A 5AI3A 1R0GA 4AR6A 2QL0A 2PYAA 1RDGA 1FHHA 3KYYA 1S2ZA 1RB9A 1B71A 1FHMA 2HR5A 1C09A 4YWLA 1DVBA 3RYGA 5RXNA 2PVXA 3KYVA
chains in the Genus database with same CATH superfamily
3PIP1 5MGNA 1RDVA 1R9TL 3LWRB 1IU5A 4LHNA 5MFPA 5C4XL 3HOVL 1YUZA 1PZXA 2CR8A 1VZIA 4JAGA 1PFWA 2AYJA 5DM61 3SS2A 1R0FA 4WFN1 3M3YL 3NFPI 1YV1A 1BQ9A 5FJ8L 2M4YA 1ZRPA 3S1QL 4ME3A 2XJPA 4Y52L 3S2DL 1P7PA 2A6HD 3HOZL 5M5WL 2L0ZA 2V3BB 2PSMC 3GTKL 1R0JA 5C4JL 3K35A 1LKPA 2JI3A 5MFZA 5IYCL 5EIOC 2JA8L 4QIWP 3PZAA 1BRFA 1DX8A 2J9UB 1TWCL 3KYUA 1B2JA 5EINC 4C3JL 1I50L 2H12A 1I6HL 3I4NL 4V196 3RZTA 5MLC3 1R0IA 1BFYA 4C3HL 7RXNA 3H0GL 3HOWL 5C3EL 4JAFA 5AN9H 5IP7L 1NXEA 5GAGc 1FHHA 3KYYA 5K2ME 4AHZA 3FKIL 3HJYB 2HR5A 1DVBA 4AHXA 4C3IL 3IU3I 2PVXA 4JAEA 4BBSL 3PO2L 1K83L 3GTJL 4POFA 3MPSA 3HOXL 1RWDA 2RFKB 3LWQB 2NVQL 4AR3A 2NVYL 2NVTL 1QQTA 3S14L 4E6YA 2XJSA 3WWLA 2V0FA 2KN9A 3GTGL 1BQ8A 1JYBA 4RXNA 3K7AL 4A3GL 3HKZP 1Y1WL 3LNLA 2APOB 1LKOA 1R0HA 2Z3QB 5C44L 4BY7L 4TVMA 4K9FA 3PIO1 4AI0A 3S16L 3M4OL 1LKMA 1T9PA 4POGA 1VCXA 2K2DA 1YK4A 2HVYC 1B13A 4LHLA 5H1Sc 2VUML 5M3FL 4XGHA 2WAQP 3P2AA 3KYWA 2M6PA 1NXGA 3CQZL 3J7Z1 1SMUA 4A3EL 3PKIA 2A69D 2AQCA 3GTQL 2E2IL 4C2M1 4A3ML 1QCVA 5AI3A 2PYAA 3RZOL 3HJWB 4A3JL 2JA6L 1RB9A 5MF6A 3GTLL 1FHMA 3H97A 3QQCE 2JI1A 3WWNB 2Y0SP 5RXNA 3HOUL 2M4VA 3MQKB 2JI2A 2MS3A 2M6OA 2EY4E 3KYXA 2AUSB 5AI2A 2NYDA 2R93L 1I3QL 4BBRL 3PO3L 1QYBA 2NVXL 1TWAL 4YWMA 5IP9L 5GAEc 1VZGA 2JA7L 1F4LA 1RYQA 3ZG6A 1B2OA 3H99A 3RZDL 3HOYL 1SMWA 2A6ED 1H7VA 1CADA 3H3VM 2KKDA 1S30A 3J7Y1 4XXBB 4GS7D 5IY0A 4ZN1B 2RDVA 1YUXA 2C6AA 1NNQA 2WB1P 4Y7NL 4ZN3B 1PFYA 2XJRA 5IYDL 6RXNA 3GTOL 4AR4A 5DM71 2LCQA 2B63L 2GMGA 1IROA 4AR6A 3PL5A 4G6BA 4AI2A 1TWHL 4AI1A 3MSUA 4X6AL 1B71A 5FLML 4AYBP 5GAHc 1C09A 3S1NL 3LWVB 3RYGA 3HAXC 3LWPB 2C6BA 2ERSA 3KYVA 2CKCA 5M5YL 3P8BA 1CAAA 1Z92B 4BY1L 4AR5A 1E8JA 1PFUA 2PMZP 3A44A 3B0AB 3LWOB 3JR7A 3VPBE 5JVH1 2R7ZL 4A3FL 2XJUA 1IW7D 5JVG1 3S17L 3LPEB 3H9CA 2R92L 1IRNA 1T9QA 3S1ML 3S2HL 3H9BA 2E2HL 1YK5A 2DSXA 8RXNA 1T9OA 4A3IL 4A3DL 1LTLA 3B08B 5GADc 1S24A 4AHWA 4A3CL 1IU6A 1SFOL 4A93L 2V0EA 1SMMA 2PVEA 1Y1VL 2O5JD 2CKAA 4A3KL 4JADA 4TPUA 2ERJA 2XJQA 1WCML 4AI3A 5IYBL 3RZ6A 2JA5L 2YU9L 2VL6A 4U671 1TWFL 4BXXL 3GTPL 2PPTA 3GTML 3QVDA 1PFVA 3PWFA 2A68D 1RYTA 2ZIXA 1BE7A 5M3ML 2XJVA 2B5ID 1R0GA 2BE5D 2QL0A 2E2JL 1RDGA 3PKJA 4A3BL 1S2ZA 3FDJA 2XJTA 1VZHA 1WJVA 1OWCA 3I4ML 1TWGL 1ODHA 4YWLA 3S1RL 1OWBA 3S15L 4A3LL 2Z3RB 4AHYA 4UY81 4B8CD 5M5XL
chains in the Genus database with same CATH topology
3PIP1 2JI2A 2MS3A 2M6OA 3P8BA 1CAAA 4POFA 5MGNA 1RDVA 3KYXA 1IU5A 4LHNA 1Z92B 3MPSA 5AI2A 5MFPA 2NYDA 1RWDA 4AR5A 1E8JA 1YUZA 4AR3A 1QYBA 2CR8A 1VZIA 3A44A 4JAGA 4YWMA 4E6YA 2XJSA 2AYJA 3WWLA 5DM61 2V0FA 2KN9A 5GAEc 3SS2A 3B0AB 1BQ8A 1R0FA 4WFN1 1JYBA 4RXNA 1VZGA 3VPBE 5JVH1 1RYQA 2XJUA 3NFPI 3ZG6A 1IW7D 1YV1A 1B2OA 5JVG1 3LNLA 1BQ9A 1LKOA 3LPEB 1R0HA 2M4YA 1ZRPA 1SMWA 2Z3QB 4ME3A 1IRNA 1T9QA 4TVMA 2XJPA 2A6ED 1H7VA 4K9FA 3PIO1 1CADA 1YK5A 2DSXA 8RXNA 2KKDA 1S30A 3J7Y1 1T9OA 2A6HD 4AI0A 4XXBB 1LTLA 3B08B 2L0ZA 2V3BB 5GADc 2PSMC 4GS7D 1S24A 1LKMA 1T9PA 4ZN1B 1VCXA 5IY0A 4POGA 4AHWA 2RDVA 1YUXA 1R0JA 2K2DA 1IU6A 2C6AA 1NNQA 1YK4A 3K35A 1LKPA 2V0EA 1B13A 2JI3A 4LHLA 5MFZA 5H1Sc 4ZN3B 5EIOC 1SMMA 3PZAA 1BRFA 4XGHA 2PVEA 1DX8A 2J9UB 2XJRA 3KYUA 1B2JA 2CKAA 5EINC 2O5JD 3P2AA 6RXNA 2H12A 4JADA 4TPUA 4AR4A 5DM71 2ERJA 2XJQA 4AI3A 4V196 3RZTA 3RZ6A 5MLC3 2VL6A 1R0IA 3KYWA 4U671 2M6PA 1NXGA 3J7Z1 1SMUA 2PPTA 1BFYA 3PKIA 2LCQA 2A69D 7RXNA 3QVDA 3PWFA 2A68D 1RYTA 2GMGA 1IROA 1QCVA 2ZIXA 1BE7A 5AI3A 2XJVA 2B5ID 4JAFA 1R0GA 5AN9H 4AR6A 2BE5D 2QL0A 2PYAA 1NXEA 1RDGA 5GAGc 4G6BA 3PKJA 1FHHA 4AI2A 3KYYA 5K2ME 4AHZA 4AI1A 1S2ZA 1RB9A 5MF6A 2XJTA 1VZHA 3MSUA 1B71A 1FHMA 1WJVA 1OWCA 5GAHc 2HR5A 1ODHA 1C09A 4YWLA 1DVBA 3QQCE 3RYGA 2JI1A 4AHXA 3WWNB 1OWBA 2C6BA 3IU3I 5RXNA 2ERSA 2PVXA 4JAEA 2Z3RB 4AHYA 4UY81 3KYVA 4B8CD 2M4VA 2CKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MS3 A;  1CAA A;  4POF A;  1RDV A;  3KYX A;  1IU5 A;  3MPS A;  5AI2 A;  1RWD A;  4AR5 A;  1E8J A;  1YUZ A;  4AR3 A;  1QYB A;  3A44 A;  4YWM A;  2KN9 A;  3SS2 A;  1BQ8 A;  1R0F A;  1JYB A;  4RXN A;  1YV1 A;  1B2O A;  1BQ9 A;  1LKO A;  1R0H A;  2M4Y A;  1ZRP A;  1SMW A;  4ME3 A;  1IRN A;  1T9Q A;  1H7V A;  4K9F A;  1CAD A;  1YK5 A;  2DSX A;  8RXN A;  2KKD A;  1S30 A;  1T9O A;  1LTL A;  2V3B B;  5IY0 A;  1S24 A;  1LKM A;  1T9P A;  4POG A;  1VCX A;  2RDV A;  1YUX A;  1R0J A;  2K2D A;  1IU6 A;  1NNQ A;  1YK4 A;  1LKP A;  1B13 A;  1SMM A;  3PZA A;  1BRF A;  2PVE A;  1DX8 A;  3KYU A;  1B2J A;  6RXN A;  4TPU A;  4AR4 A;  3RZT A;  3RZ6 A;  2VL6 A;  1R0I A;  3KYW A;  1SMU A;  1BFY A;  2LCQ A;  7RXN A;  3QVD A;  3PWF A;  1RYT A;  2GMG A;  1IRO A;  1QCV A;  1BE7 A;  5AI3 A;  1R0G A;  4AR6 A;  2QL0 A;  2PYA A;  1RDG A;  1FHH A;  3KYY A;  1S2Z A;  1RB9 A;  1B71 A;  1FHM A;  2HR5 A;  1C09 A;  4YWL A;  1DVB A;  3RYG A;  5RXN A;  2PVX A;  3KYV A; 
#chains in the Genus database with same CATH topology
 3PIP 1;  5MGN A;  1RDV A;  1R9T L;  3LWR B;  1IU5 A;  4LHN A;  5MFP A;  5C4X L;  3HOV L;  1YUZ A;  1PZX A;  2CR8 A;  1VZI A;  4JAG A;  1PFW A;  2AYJ A;  5DM6 1;  3SS2 A;  1R0F A;  4WFN 1;  3M3Y L;  3NFP I;  1YV1 A;  1BQ9 A;  5FJ8 L;  2M4Y A;  1ZRP A;  3S1Q L;  4ME3 A;  2XJP A;  4Y52 L;  3S2D L;  1P7P A;  2A6H D;  3HOZ L;  5M5W L;  2L0Z A;  2V3B B;  2PSM C;  3GTK L;  1R0J A;  5C4J L;  3K35 A;  1LKP A;  2JI3 A;  5MFZ A;  5IYC L;  5EIO C;  2JA8 L;  4QIW P;  3PZA A;  1BRF A;  1DX8 A;  2J9U B;  1TWC L;  3KYU A;  1B2J A;  5EIN C;  4C3J L;  1I50 L;  2H12 A;  1I6H L;  3I4N L;  4V19 6;  3RZT A;  5MLC 3;  1R0I A;  1BFY A;  4C3H L;  7RXN A;  3H0G L;  3HOW L;  5C3E L;  4JAF A;  5AN9 H;  5IP7 L;  1NXE A;  5GAG c;  1FHH A;  3KYY A;  5K2M E;  4AHZ A;  3FKI L;  3HJY B;  2HR5 A;  1DVB A;  4AHX A;  4C3I L;  3IU3 I;  2PVX A;  4JAE A;  4BBS L;  3PO2 L;  1K83 L;  3GTJ L;  4POF A;  3MPS A;  3HOX L;  1RWD A;  2RFK B;  3LWQ B;  2NVQ L;  4AR3 A;  2NVY L;  2NVT L;  1QQT A;  3S14 L;  4E6Y A;  2XJS A;  3WWL A;  2V0F A;  2KN9 A;  3GTG L;  1BQ8 A;  1JYB A;  4RXN A;  3K7A L;  4A3G L;  3HKZ P;  1Y1W L;  3LNL A;  2APO B;  1LKO A;  1R0H A;  2Z3Q B;  5C44 L;  4BY7 L;  4TVM A;  4K9F A;  3PIO 1;  4AI0 A;  3S16 L;  3M4O L;  1LKM A;  1T9P A;  4POG A;  1VCX A;  2K2D A;  1YK4 A;  2HVY C;  1B13 A;  4LHL A;  5H1S c;  2VUM L;  5M3F L;  4XGH A;  2WAQ P;  3P2A A;  3KYW A;  2M6P A;  1NXG A;  3CQZ L;  3J7Z 1;  1SMU A;  4A3E L;  3PKI A;  2A69 D;  2AQC A;  3GTQ L;  2E2I L;  4C2M 1;  4A3M L;  1QCV A;  5AI3 A;  2PYA A;  3RZO L;  3HJW B;  4A3J L;  2JA6 L;  1RB9 A;  5MF6 A;  3GTL L;  1FHM A;  3H97 A;  3QQC E;  2JI1 A;  3WWN B;  2Y0S P;  5RXN A;  3HOU L;  2M4V A;  3MQK B;  2JI2 A;  2MS3 A;  2M6O A;  2EY4 E;  3KYX A;  2AUS B;  5AI2 A;  2NYD A;  2R93 L;  1I3Q L;  4BBR L;  3PO3 L;  1QYB A;  2NVX L;  1TWA L;  4YWM A;  5IP9 L;  5GAE c;  1VZG A;  2JA7 L;  1F4L A;  1RYQ A;  3ZG6 A;  1B2O A;  3H99 A;  3RZD L;  3HOY L;  1SMW A;  2A6E D;  1H7V A;  1CAD A;  3H3V M;  2KKD A;  1S30 A;  3J7Y 1;  4XXB B;  4GS7 D;  5IY0 A;  4ZN1 B;  2RDV A;  1YUX A;  2C6A A;  1NNQ A;  2WB1 P;  4Y7N L;  4ZN3 B;  1PFY A;  2XJR A;  5IYD L;  6RXN A;  3GTO L;  4AR4 A;  5DM7 1;  2LCQ A;  2B63 L;  2GMG A;  1IRO A;  4AR6 A;  3PL5 A;  4G6B A;  4AI2 A;  1TWH L;  4AI1 A;  3MSU A;  4X6A L;  1B71 A;  5FLM L;  4AYB P;  5GAH c;  1C09 A;  3S1N L;  3LWV B;  3RYG A;  3HAX C;  3LWP B;  2C6B A;  2ERS A;  3KYV A;  2CKC A;  5M5Y L;  3P8B A;  1CAA A;  1Z92 B;  4BY1 L;  4AR5 A;  1E8J A;  1PFU A;  2PMZ P;  3A44 A;  3B0A B;  3LWO B;  3JR7 A;  3VPB E;  5JVH 1;  2R7Z L;  4A3F L;  2XJU A;  1IW7 D;  5JVG 1;  3S17 L;  3LPE B;  3H9C A;  2R92 L;  1IRN A;  1T9Q A;  3S1M L;  3S2H L;  3H9B A;  2E2H L;  1YK5 A;  2DSX A;  8RXN A;  1T9O A;  4A3I L;  4A3D L;  1LTL A;  3B08 B;  5GAD c;  1S24 A;  4AHW A;  4A3C L;  1IU6 A;  1SFO L;  4A93 L;  2V0E A;  1SMM A;  2PVE A;  1Y1V L;  2O5J D;  2CKA A;  4A3K L;  4JAD A;  4TPU A;  2ERJ A;  2XJQ A;  1WCM L;  4AI3 A;  5IYB L;  3RZ6 A;  2JA5 L;  2YU9 L;  2VL6 A;  4U67 1;  1TWF L;  4BXX L;  3GTP L;  2PPT A;  3GTM L;  3QVD A;  1PFV A;  3PWF A;  2A68 D;  1RYT A;  2ZIX A;  1BE7 A;  5M3M L;  2XJV A;  2B5I D;  1R0G A;  2BE5 D;  2QL0 A;  2E2J L;  1RDG A;  3PKJ A;  4A3B L;  1S2Z A;  3FDJ A;  2XJT A;  1VZH A;  1WJV A;  1OWC A;  3I4M L;  1TWG L;  1ODH A;  4YWL A;  3S1R L;  1OWB A;  3S15 L;  4A3L L;  2Z3R B;  4AHY A;  4UY8 1;  4B8C D;  5M5X L; 
#chains in the Genus database with same CATH homology
 3PIP 1;  2JI2 A;  2MS3 A;  2M6O A;  3P8B A;  1CAA A;  4POF A;  5MGN A;  1RDV A;  3KYX A;  1IU5 A;  4LHN A;  1Z92 B;  3MPS A;  5AI2 A;  5MFP A;  2NYD A;  1RWD A;  4AR5 A;  1E8J A;  1YUZ A;  4AR3 A;  1QYB A;  2CR8 A;  1VZI A;  3A44 A;  4JAG A;  4YWM A;  4E6Y A;  2XJS A;  2AYJ A;  3WWL A;  5DM6 1;  2V0F A;  2KN9 A;  5GAE c;  3SS2 A;  3B0A B;  1BQ8 A;  1R0F A;  4WFN 1;  1JYB A;  4RXN A;  1VZG A;  3VPB E;  5JVH 1;  1RYQ A;  2XJU A;  3NFP I;  3ZG6 A;  1IW7 D;  1YV1 A;  1B2O A;  5JVG 1;  3LNL A;  1BQ9 A;  1LKO A;  3LPE B;  1R0H A;  2M4Y A;  1ZRP A;  1SMW A;  2Z3Q B;  4ME3 A;  1IRN A;  1T9Q A;  4TVM A;  2XJP A;  2A6E D;  1H7V A;  4K9F A;  3PIO 1;  1CAD A;  1YK5 A;  2DSX A;  8RXN A;  2KKD A;  1S30 A;  3J7Y 1;  1T9O A;  2A6H D;  4AI0 A;  4XXB B;  1LTL A;  3B08 B;  2L0Z A;  2V3B B;  5GAD c;  2PSM C;  4GS7 D;  1S24 A;  1LKM A;  1T9P A;  4ZN1 B;  1VCX A;  5IY0 A;  4POG A;  4AHW A;  2RDV A;  1YUX A;  1R0J A;  2K2D A;  1IU6 A;  2C6A A;  1NNQ A;  1YK4 A;  3K35 A;  1LKP A;  2V0E A;  1B13 A;  2JI3 A;  4LHL A;  5MFZ A;  5H1S c;  4ZN3 B;  5EIO C;  1SMM A;  3PZA A;  1BRF A;  4XGH A;  2PVE A;  1DX8 A;  2J9U B;  2XJR A;  3KYU A;  1B2J A;  2CKA A;  5EIN C;  2O5J D;  3P2A A;  6RXN A;  2H12 A;  4JAD A;  4TPU A;  4AR4 A;  5DM7 1;  2ERJ A;  2XJQ A;  4AI3 A;  4V19 6;  3RZT A;  3RZ6 A;  5MLC 3;  2VL6 A;  1R0I A;  3KYW A;  4U67 1;  2M6P A;  1NXG A;  3J7Z 1;  1SMU A;  2PPT A;  1BFY A;  3PKI A;  2LCQ A;  2A69 D;  7RXN A;  3QVD A;  3PWF A;  2A68 D;  1RYT A;  2GMG A;  1IRO A;  1QCV A;  2ZIX A;  1BE7 A;  5AI3 A;  2XJV A;  2B5I D;  4JAF A;  1R0G A;  5AN9 H;  4AR6 A;  2BE5 D;  2QL0 A;  2PYA A;  1NXE A;  1RDG A;  5GAG c;  4G6B A;  3PKJ A;  1FHH A;  4AI2 A;  3KYY A;  5K2M E;  4AHZ A;  4AI1 A;  1S2Z A;  1RB9 A;  5MF6 A;  2XJT A;  1VZH A;  3MSU A;  1B71 A;  1FHM A;  1WJV A;  1OWC A;  5GAH c;  2HR5 A;  1ODH A;  1C09 A;  4YWL A;  1DVB A;  3QQC E;  3RYG A;  2JI1 A;  4AHX A;  3WWN B;  1OWB A;  2C6B A;  3IU3 I;  5RXN A;  2ERS A;  2PVX A;  4JAE A;  2Z3R B;  4AHY A;  4UY8 1;  3KYV A;  4B8C D;  2M4V A;  2CKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...