4YWLA

Pyrococcus furiosus mcm n-terminal domain f179a point mutant pentameric ring
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSAVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
molecule keywords Cell division control protein 21
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ywlA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywlA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywlA01
1R0GA 1KAWA 1IXRA 4R4OA 1PH8A 1R0IA 4OX9Q 4IFDI 1HNWL 4AYBE 1VQDA 2YU9H 3CCSA 2R7FA 4L5RC 4JBWA 4PG3A 2ZJPA 1SMXA 1CKOA 4O0AA 2Q2UA 1FL0A 5M3FH 4LF7Q 3I4NH 4DR4L 2UXCL 3HOZH 2JEAI 2K5VA 3UDGA 1XMOL 5C0XI 3KYUA 4KHPL 2UXBL 2UXDQ 2RDVA 2YV5A 1PH6A 4DR3Q 2NVXH 4L5QA 3PCOB 2LCQA 1L1OA 1IZ6A 3JC66 3LGJA 4KI0A 2QA4A 2KENA 1SE8A 3U50C 1YITA 4X66Q 4LF8Q 2VY3A 4DR6Q 1N9WA 4DUYQ 2DUDA 2QGQA 2EIFA 4IO9A 4OWWB 3CD6A 2Y0SE 3GTPH 4OO1G 3EIVA 4LFAL 3FHWA 2K50A 3KYHC 3CCRA 1OXVA 2AMCB 2YTYA 1SMWA 3B6YA 3F8TA 4R4QA 4DV2L 2UU9L 1O7IA 1Q1BA 4P75A 2B63H 1S72A 5IYDG 4TPUA 1L0WA 3A74A 2K5NA 5HGQA 1R0FA 3K80C 4X64L 1KC8C 1CKNA 3PUYA 2ZM6L 3HOWG 5GROA 1K73C 2HR5A 2JA6H 4B3TQ 2Z6KA 5LMNL 2IHEA 2VQFL 4DPGA 3GTOH 1JYBA 2B3GA 4AR4A 3PUWA 4P73A 4OWXB 4P72A 1J5EQ 1PH4A 1LKOA 3S1RH 2JA7G 3U4VA 4GLXA 3S2HH 3BZKA 1K8GA 4DR5L 3RYGA 1IU5A 1OXUA 3M4QA 1FJGL 1YJ9A 3AYHB 2HIVA 2PMZE 2VUMH 2IY5B 1B8AA 1Q8KA 4UPAA 4JI1L 4DV1Q 2WP8J 3G71A 5JJKA 2L15A 3M9BA 3M4PA 5AI2A 2HHHQ 4B3MQ 1VQEA 3TRZA 3CCUA 2D62A 1S2ZA 2KN9A 4POGA 4TQUS 4LFAQ 4A93H 3IRBA 1B13A 4A4IA 2GN5A 2VL6A 1N36Q 1EQRA 2RF4A 1GM5A 2YTVA 2R6GA 1EFWA 3M7NA 2V1CC 4LF8L 1WCMG 1DX8A 4LFCL 2AWOA 2M4YA 1JE5A 3E9HA 4J15A 4YCWA 1U5KA 3STBD 2DSXA 4OWTB 1VQMA 1NJIC 1JJ2A 2ZJQA 4GNXA 4NPSA 1VQPA 4A3LG 1QYBA 4GKKL 5C4XG 1S24A 1BFYA 3UDXA 4LF7L 3KYVA 3FKIH 4DR4Q 5RXNA 3CF5A 4L5TA 1Z9FA 4JI3L 2NN6I 4A3IG 1PV4A 4JI3Q 3PO2G 1C9OA 2NVYH 5M5WH 3OTOQ 4LUVA 3OW2A 3BJUA 2R7ZH 4NB3A 5GAHC 4JI8L 4GN3B 3TEHB 1HR0Q 2OTJA 2A1AA 4A3JG 4DR3L 2CQOA 4X64Q 2IX0A 2MO1A 1NBWA 3I56A 4LFBL 1OXXK 2MQHA 3H0GG 3KOJA 3ULJA 2R93H 1XPUA 1YEZA 4R4IA 4Y7NH 3G48A 4IJLA 1X3GA 3AQQA 2E5LQ 4JI7Q 1LM0A 4BY1H 4Y52H 3UE0A 4DAYB 3HOYH 3J81c 1UWVA 1AE3A 2R7ZG 2ES2A 1Q12A 1HZCA 4IPHA 3CC7A 1M90C 2HT1A 3BU2A 4DR7L 1IRNA 4K0KL 2QL0A 3U58A 3CCQA 4A3KH 5JJLA 1VQ4A 4DUYL 2VUMG 4X6AH 4JI1Q 4DV1L 4JV5L 4JOIC 2OWOA 4A3BH 5DLQE 2N3SA 3GO5A 4C3HH 3CPFA 4JBKA 1X9NA 3GTKH 1VCXA 2NZHA 4GNXC 3A44A 4RXNA 4A93G 3CMEA 3T1HQ 1R0HA 3PUZA 1PH1A 2KBNA 3F1ZA 1HZBA 1KHIA 1VQCA 1T9QA 4O2DA 4K9FA 4JBJA 5FLMH 4A3MG 1HNWQ 3F2BA 2AWNA 5IP7H 4JOIA 1EIFA 4DK3C 3RZTA 1Y1VH 1VQ9A 2ZM6Q 2R92H 1D7QA 2KHIA 3K81C 1CKNB 3NEMA 5FLXc 4PZ6A 1EYGA 5IP9G 4GOPC 1EIYB 3MEFA 2PNHA 1IBMQ 2JA5G 3G4SA 4YCUA 5C4JH 2VS1A 1KQSA 2ATWA 3CCEA 4BA1I 1E1OA 1JJCB 2F52A 2EQSA 1X56A 3HKZG 3W1BA 5IP7G 4B3RQ 3PO2H 4RMFA 2HQLA 1RYTA 4LF4Q 1Q46A 1EOVA 1Y14B 3ERSX 2K2DA 2N78A 3KF6A 2UUAL 1MJCA 3D0FA 3L0OA 5HY6A 3CCLA 1HNZL 2IHFA 4JV5Q 2JE6I 3J81j 1C09A 2KKDA 3KLWA 1L1OB 2RHQB 3CW2C 5ELOA 4DV2Q 2K52A 4DV5Q 3H0GH 2LXJA 1B2OA 1K0RA 1PH5A 3GDEA 1VQHA 1KIXA 1Z47A 1CADA 1Q1EA 3HOWH 2ID0A 4DR2Q 1YNXA 4X66L 3GTLH 1VQAA 1C0AA 4HIOA 1X54A 1SMUA 3I4OA 3RZOH 1YI2A 4YCVA 2WB1G 2OCEA 2VQEQ 2I0QA 3I4NG 2UXDL 3S1QH 3UE1A 1PYBA 1PFSA 3HOZG 1IROA 3SGIA 1N34Q 1GKHA 4IFDG 1S30A 4QGUA 3L7ZC 4H02A 3OTOL 2VW9A 1TWAH 1LTLA 1J6QA 3H3VI 1UE6A 3U4ZA 3HOUH 2PI2A 1PH9A 1L1OC 2DGYA 5H1SE 4DUZL 3K8AA 4A3CG 1PA6A 3UDFA 1YHAA 4JC0A 7RXNA 2MO0A 4A3FH 1OTCA 4LUZA 1BQ9A 3T1YL 4JI6Q 3PF4A 1G51A 1E3PA 2JEBI 1YK4A 1WCMH 4ME3A 2RCNA 3RLNA 4DR7Q 1NE3A 4UP8A 1JB7A 1I94Q 1VQFA 5C0XG 1RDGA 4QIWE 4GN4B 1YVCA 2K14A 3MPSA 4K0KQ 3NBHB 4YHHQ 3CCMA 2BA0A 4IJHA 5C4XH 4YWMA 2MNAA 1RB9A 4B3RL 4A3LH 3PV0A 1XPOA 3NELA 1PVOA 4BXXG 1HH2P 4A3IH 4DV0L 4A3DH 4JI7L 2PQAA 2JA9A 4UP7A 1IBLQ 4GKJQ 1KRTA 1IBKL 5JJIA 1TXYA 2R7DA 2XTIA 3KJPA 1BBUA 4YWKA 4POFA 4A3JH 1Q82C 1HZ9A 2OTLA 2E2IH 3HKSA 2F3IA 4DV4L 4DR2L 3PGZA 3KYWA 1T9OA 2XGTA 3RNUA 4B3SQ 4JI4Q 1M1KC 4HJ5A 2E2JH 4OXPA 4B3SL 3STBC 1PH2A 5LMNQ 3KF8B 3HOYG 1E24A 3CMAA 1XTDA 4DV5L 1VQIA 1R0JA 5J3BA 1PH3A 1ASZA 4EQ5A 1KXLA 4YY3Q 3RR5A 4APVA 4BBRG 4OX9L 4C2MH 1LKPA 2IX1A 1UEBA 1B7YB 3EN2A 4BBSG 4AIMA 1VQLA 3J81i 3HOXG 4A3BG 1Q86C 3PIPA 4DV7L 1MJEA 1VQGA 1IL2A 3JAMi 4XTCS 3ULPA 1QZGA 4LUOA 2C35B 3M3YH 4X62Q 4DV3Q 4HIDA 3JAMc 3CPWA 2UUBQ 4R4TA 2E5LL 1I5FA 1XNRQ 1QCVA 5M5XH 1YUZA 3S15H 3TS2A 1UE1A 3FP9A 1YUXA 1WI5A 5FLMG 1FJGQ 1N34L 3KFUA 1SLJA 3KDFB 4BY7G 1OXSC 5FJ8G 1HR0L 2PQAB 5E7NA 4AQYQ 4EX5A 2Q2IA 2Q2TA 2UXCQ 1P8LA 4XIGS 5ELNA 3CC4A 2PVEA 1RIPA 2ALYB 2Z0SA 1Q81C 1S3OA 1YJNA 1A63A 1NMFA 1J5EL 2BA1A 3D31A 4JI5L 4LNQA 3A5UA 1B2JA 3DM3A 1VQNA 1IBLL 5K36G 2OQ0A 5IT9c 4BY1G 4NXMQ 4BY7H 4QQBX 1WYDA 4MZ9A 2NZOA 1XNQL 3SS2A 3BZCA 4R4CA 1IU6A 2BH8A 5IWAL 1JMCA 5AJ3Q 5LMUL 1VQ8A 1YV1A 3PWFA 3HOVH 1VQBA 4FDBA 2ZTCA 3S24A 5IYBG 3K7UC 1HNZQ 1L2FA 5GAEC 2UUCQ 4IFDJ 2UUAQ 2GMGA 2UUBL 1LYLA 4R1JA 1X65A 2UU9Q 1YBYA 3PSIA 5IYCG 1RL2A 1K9MC 5BR8Q 3I55A 3M4OH 1YHQA 2OQKA 1X55A 2K5HA 1N8RC 2JJQA 3MXNB 3A0JA 3HOVG 3NENA 4X65Q 2KCMA 4HJAA 1XNQQ 1IYJB 3RN5A 1OXTA 4DR6L 1BKBA 1E22A 4MTNA 3ZJYC 5IYBH 3F2CA 2AHOB 4BBSH 4LF4L 1XJVA 4DV6Q 1Y1VG 4NXNL 5IYCH 1MKHA 1XMOQ 2CFMA 4NXNQ 4UY8C 5IP9H 3GTMH 2UXBQ 1HJPA 2GVAA 3GTGH 1W3SA 2LXKA 4GN5A 4AYBG 1S40A 3HKZE 1D8LA 5AI3A 1EQQA 6RXNA 4HIKA 3RZ6A 1EWIA 5C44H 1VQ5A 3I4MG 1T9HA 1E8JA 4X65L 3S16H 1HZAA 4KHZA 1YIJA 3AEVA 3H3VH 4A3CH 2JK8A 4A3EG 2AKWB 4MNOA 4JI2Q 1XMQQ 4LFCQ 3JC62 2KCTA 1UE5A 5C3EG 4OONA 1TWFH 3KYYA 1JT8A 1I6HH 4DV3L 4X62L 4HJ8A 4BA2I 4GOPB 1HR0W 4L5SA 2F4VQ 3CP0A 4OO1I 1KL9A 1PHJA 1N32L 2PI2E 4TVAB 3L2PA 4HJ7A 4BXXH 1N32Q 2I5MX 1E1TA 4KLKA 4GLAC 1A8VA 2E8GA 5IWAQ 4A3EH 3W5OA 2EXDA 1T9PA 3S14H 5C3EH 5M5YH 2IT1A 1PYSB 4A3DG 1FGUA 4LFBQ 1B70B 1HNXQ 5EAYA 3ER0A 1WFQA 1YK5A 1KRSA 5GQOA 2CWAA 2K4KA 3QVDA 1CSPA 4KHPQ 2F4VL 3I2ZA 3RZDH 8RXNA 4JI5Q 2N8NA 3JC63 3GTQH 1SRUA 1A0IA 1VS0A 5IY0A 3KJOA 2NVQH 3PUVA 1XMQL 4JI2L 4PZ8A 4HIMA 3F2DA 4YWLA 1VQ6A 1AH9A 3HOUG 1ZRPA 1BE7A 2MFIA 3S2DH 4QJFA 4LF5L 3CC2A 4AR6A 4IOAA 1XNRL 4DV0Q 2ASBA 2JA7H 4DR1L 5C0XJ 1QVCA 4BBRH 3PO3H 1CUKA 1X3FA 2K75A 5M3FG 3RN2A 4A3FG 5JEAG 5BR8L 2JQOA 3T1HL 1H95A 1Y1WG 3G6EA 3UDIA 1V1QA 4PZ7A 3GTJH 4IPGA 1SROA 2ZJRA 1FHMA 3PZAA 1YHBA 4DKAC 3CXCA 3EBEA 5C44G 4DV7Q 2CKZB 4AR3A 1FVIA 1X3EA 2YTXA 3KDFA 3DLLA 4A76A 3VDYA 2HHHL 4B3ML 3WWVA 3PO3G 4QY7A 1NTGA 1VQOA 3E9IA 2YYZA 3CAMA 3ICEA 3S1MH 5M3MH 4GLVB 1Y1WH 2VNUD 4YY3L 2WFWA 1EUJA 2WAQE 2KHJA 4JG2A 4HJ9A 1N36L 1BBWA 2E2HH 3HFZB 4DR5Q 1SMMA 3AFPA 2D0OA 1YJWA 4UP9A 3CQZH 2ZTDA 4LF6L 1AE2A 5AJ3L 5LMUQ 5IYDH 1MIUA 3TQYA 2B29A 2VQFQ 1P16A 4B3TL 1BRFA 3FKIG 1H7VA 1TWCH 1FHHA 3KYXA 3KF6B 5M3MG 1CKMA 2VQEL 1LUZA 4RG1A 2JA6G 2N49A 4IPCA 3RLOA 1N33L 1N33Q 2MS3A 1VQ7A 3M85A 3J80c 2I5LX 1QZHA 1X6OA 1CAAA 4A3GH 1I94L 3TREA 2WAQG 4AQYL 1I3QH 2VZAA 4LW1A 2JA8H 2R93G 4YHHL 1K83H 3S17H 3HOXH 1WOCA 4DV6L 1HNXL 3J7A5 2Q2HA 3K0XA 1XPRA 4GKKQ 1RWDA 3PF5A 2BH2A 1VQKA 4GOPA 3TS0A 4P74A 1B71A 1G6PA 1TWGH 4ALPA 4A3GG 3K7AH 4A3KG 1CSQA 1NY4A 1DGSA 4DUZQ 4WJ3M 3Q8DA 4QL5A 4PMWA 1GD7A 2WB1E 1G291 2I5HA 5FJ8H 4AR5A 1VCIA 1BVSA 2UUCL 2NVTH 2Y0SG 4LF5Q 3W1GA 1QVFA 2D0PA 4C3IH 1ASYA 3S1NH 3GD7A 1R9TH 4DAMA 2CWPA 1TWHH 1UE7A 4LF9L 4LF9Q 3CCJA 1WJJA 4DR1Q 3I4MH 1IBKQ 3AFQA 3ULLA 1YZ6A 2A19A 2RHSB 4A3MH 4NXML 1W2BA 4JI8Q 3A5ZB 4LWCA 1DVBA 2FXQA 3I7FA 2LSSA 1GO3E 4AH6A 1SFOH 2R92G 4JI4L 3RLFA 4LF6Q 4C3JH 1GVPA 4DV4Q 4JCVE 1LKMA 2NN6G 5GADC 1PH7A 1C7YA 2JA5H 2QEXA 1NNQA 4DNIA 5GAGC 1JJGA 3H15A 4GKJL 1I50H 1K8AC 1VQJA 2HIXA 2B63G 4GS3A 1KD1C 1A62A 1NMGA 2ZTEA 3PUXA 4IPDA 4DK6C 5IE8A 4A75A 1Q7YC 5LMNW 3OYYA 4IOCA 5JEAJ 4WJ4A 4GNXB 2Z6KC 2V3BB 1V43A 1QUQA 4JI0L 4JYAQ 1E7ZA 2H5XA 1QUQB 2A8VA 2PVXA 1SN8A 1QVGA 4JI0Q 4JYAL 1BQ8A 2CCZA 3CCVA 1V9PA 3E0EA 2JA8G 1IBML 4JBMA 3J80i 1U0LA 3PIOA 3T1YQ 4JI6L 1RDVA 1SR3A 4P71A 3J7ZC 1K3RA 2GVBA 2PYAA
chains in the Genus database with same CATH superfamily
3E3XA 4WJWA 1D2BA 2KJXA 1IKMA 1JR0D 1VQDA 2NB0A 4JBWA 4PG3A 1SMXA 1Z92B 1FL0A 2HCCA 4DR4L 3PIO1 4AYBB 2JYOA 4NMZA 2AQCA 1G91A 2RDVA 5DNFA 2RQXA 1YITA 4KY6A 3U50C 4LF8Q 5C4XB 2DUDA 2NVYB 3Q22A 4IO9A 5M5WB 4OWWB 3GTPH 3VPBE 4KD3A 5JPMC 2K50A 2AMCB 2X6LA 4DV2L 1Q1BA 1NR4A 1S72A 5EPLA 1L0WA 4G7ZC 1R0FA 5I6YA 3SVMA 3I73A 4B8CD 4IUVA 1CKNA 3PUYA 2ZM6L 2EXZA 1EY8A 4B3TQ 4OO1H 1B44D 2QF7A 2VQFL 1BCPB 4MIUA 1JYBA 2B3GA 4P73A 4YIJA 5D3DA 4RFBA 4EQPA 5KNDA 1Y69U 3U4VA 2JA7G 4GLXA 3S2HH 3X3MA 1U4LA 2CR8A 5JEAH 5JJZA 2PMZE 1B8AA 3SEBA 3T56B 5M9OA 4AHYA 4BBSB 1SYDA 5JJKA 3IU3I 3M4PA 2C6AA 5AI2A 3M4YA 3BG3A 4DNTB 3CCUA 2D62A 2HHHQ 3TRZA 4A93H 4LFAQ 3K5LA 1VZIA 1Y1WB 3D3RA 4A4IA 2GN5A 4IUNA 4C2M1 5I2YA 3D8GA 2R6GA 4DXFA 3IKJA 1EFWA 2O2LD 5MF6A 3QIAA 3K0YA 1TWFL 1DCZA 4ZKCB 3MXNA 3DEPA 4OWTB 1QG7A 1VQMA 1STBA 1NJIC 1JJ2A 4GNXA 1STAA 1VQPA 1KABA 4L6TB 1SYCA 1S24A 3UDXA 1B4OA 4U68A 3OTOQ 4LUVA 2RSOA 1IW7D 3D4RA 3BDCA 2MQHA 3J7YW 4AHXA 1HPCA 4ID6A 2E2IB 5C5LA 3HOYH 1UWVA 2ES2A 4HTHA 1BUVT 3S9WA 4FF2A 1M90C 3ZG6A 3BU2A 4JV5L 4JOIC 2OWOA 4K5XA 5DLQE 4L63B 1SAPA 2N3SA 1TWGL 4A3GB 1TY0A 3CMEA 1DJRD 1R0HA 4S3SA 1T9QA 3QG1A 4E6YA 1OO9B 3KF8A 2K6AA 4JOIA 3A8IE 2R92H 3LWOB 2F0LA 5EGTA 2F0UA 1PZJD 1EYGA 4GOPC 1IBMQ 1S5DD 3G4SA 3J7Z1 2NVYL 5M5WL 5C4JH 3S1MB 3LNLA 1WJVA 4N8FA 2VS1A 4ZK9B 1O80A 2L55A 3W1BA 2QEJC 5IP7G 5CBAE 4B3RQ 4RMFA 4XT3B 2Z8LA 4X3UA 4LF4Q 1Q46A 1EOVA 3GTLL 1QJOA 3ERSX 3L0OA 2EJFC 2JE6I 3J81j 1C09A 3CQZL 3KLWA 2F0EA 3CW2C 5A2QL 4FNFA 4DV2Q 3C1EA 2LXJA 4OHJA 2KEEA 1B2OA 5IYCL 1Q1EA 3E5SA 2F0GA 1P7PA 4V196 4DR2Q 3GTLH 1TKWB 2XRQD 1X54A 3I4OA 3PO2L 4Q0FA 1YI2A 2VUMB 2WB1G 2VQEQ 3G7LA 3V05A 1IROA 5ELDA 1Y1WL 3L7ZC 4H02A 1WTXA 2EY6A 4JAFA 3OSOA 1S5FD 3U4ZA 2DGYA 2Q8RE 2RSNA 3OMGA 1EY0A 1II3A 4IALA 4JC0A 3UDFA 3JAML 4LUZA 1HXYD 1DZ1A 3GTQL 2L4NA 1ZYRD 1EEID 1E3PA 4DR7Q 1TWHL 4UP8A 1JB7A 1GHKA 4C3IL 3SK5A 5C0XG 4LHLA 4QIWE 2IW3A 2RCFA 5C4XH 1TS3A 4YWMA 1QILA 2O5JD 4A3KL 2F0IA 2XWJB 3PKIA 4DV0L 1PRTC 2R7DA 2XTIA 4R8IA 4AI0A 3CHBD 5FO8B 4YWKA 4RGOS 1Q82C 1HZ9A 1ET6A 2E2IH 3HKSA 4Y7NB 4Z9CB 4DV4L 1T9OA 1SYEA 3RNUA 5DM73 5FO9B 4OXPA 5LMNQ 1SMYC 1XTDA 1A3VA 4YY3Q 3RR5A 4APVA 4OX9L 3GTJB 1TWGB 2IX1A 3EN2A 2G9HD 4KTAA 3K59A 1SJHD 1F9RA 1IL2A 3JAMi 4LUOA 3M3YH 1EOTA 1TIID 4XYOA 5J1ZA 1QCVA 3C3LA 1YUZA 1V8QA 3TS2A 1CZWA 1UE1A 1WI5A 3S1ML 1EFID 3HRZC 1S4ZA 1PZXA 3VR5A 3LWPB 4XIGS 3PIO3 1A63A 1YJNA 3L9AX 3PKJA 1ENAA 1VF5C 5I9OA 3VR2A 3A5UA 1IBLL 3MFYA 4MZ9A 1XNQL 5IWAL 1IU6A 2BH8A 5AJ3Q 1YV1A 4ZLTF 1IYVA 1DONA 1QNKA 2N55A 3K7UC 1L2FA 5GAEC 1LYLA 4QIWB 1G2TA 4XGHA 5LHY1 3NBIA 2F0FA 5LL6S 1GUTA 3HOYB 3I55A 1I4QA 4C2MB 2OQKA 3S1QL 3T13A 1N8RC 3MXNB 3M3YL 4HJAA 1XNQQ 4ZYSA 2L11A 3RN5A 4MTNA 1E22A 3ZJYC 1VMCA 2AHOB 3VA7A 3MVVA 4DXGA 4L8JA 4KN7C 1LTID 4FF1A 2PW5A 5K5PA 2UXBQ 4NXNQ 1HJPA 2OF1A 4GN5A 5E4WC 3HKZE 6RXNA 1DXMA 2RDHA 1VQ5A 1PTOC 4H7BA 5F2DA 1MD2D 1F2MA 3MHBA 1YIJA 3PO3B 4JI2Q 1HFGA 3GTKB 1UE5A 2KCTA 4HMJA 4AHZA 1MGSA 5EQ0A 3TSSA 1KDAA 2VB2X 4BA2I 4L5SA 2F4VQ 3CP0A 3URYA 4IUPA 4TVAB 3AMUA 1DOLA 1EY4A 1A8VA 4A3EH 3W5OA 2EXDA 1T9PA 5CGKA 3S14H 4BY1B 1I6VC 2A68C 1SJED 2AUSB 5EAYA 5FLML 1YK5A 5GQOA 2K4KA 2NBFA 4V0BA 2F4VL 5ELEA 8RXNA 3I4ML 3T16A 1SRUA 2NVQH 3MEHA 2JA5L 4HIMA 1JE4A 1AH9A 3HOUG 3X3NA 1ET9A 1LTSD 4QJFA 2B2VA 4AR6A 3PO3H 3OPOA 2A6HD 1AFPA 2K75A 1TS4A 4OIJA 4IQZA 3DM1A 3JR7A 3I91A 3TDQA 5C0XH 1FVIA 2MP1A 3KDFA 4A76A 5D65A 3P2AA 4N9PA 4NKLA 4A3EB 2NZ1D 1JC7A 3VA5A 2BDOA 3ICEA 2WINB 1Y1WH 1Z6HA 2E2HH 1JORA 1ENFA 1BBWA 2AQ2B 5KIXA 4ZKBB 2ZTDA 4F88A 4CKBA 1RCVD 2DY7A 5IYDL 3TQYA 2SOBA 3MAQA 2B63B 1TWCH 1H9KA 2VQEL 1CKMA 3RLOA 4IPCA 3S1RB 1KNAA 3PL5A 5JOBA 2E2HL 4N9TA 5C4JL 2KVMA 1DOMA 3GTML 5IP9L 3I90A 4DF7A 2K5DA 5COYA 1CAAA 5CV4A 3SK4A 1I3QH 4DV6L 3K7AB 5M5XB 1RWDA 3Q24A 3PF5A 1VQKA 2WACA 3R2IA 5BN3A 4GOPA 1GUOA 2F0DA 1B71A 1TWGH 1CSQA 3KBGA 4A3BL 4FYDA 1Q8IA 3DWPA 1Q90A 2F0OA 2I5HA 1K0SA 2J4XA 1VCIA 1BVSA 4LF5Q 3D4DA 1T5EA 3TN2A 1UEAB 4IFDJ 3MTSA 4DAMA 2B8FA 1TWHH 2CWPA 1A2UA 4LF9L 3NXWA 1IBKQ 2A19A 4XQJA 1Z7TA 4NXML 4H13C 3DHQA 1W2BA 1DVBA 5CMDA 2FXQA 2R92G 4FF3A 1SFOH 3KLSA 4LF6Q 5DEHA 3NHHA 1LKMA 2Z3QB 2NN6G 2XSCA 1NNQA 2K04A 1NNXA 3CQZB 4DFAA 3MQKB 2QDBA 2F0KA 1CTMA 1K3BC 1VQJA 2HIXA 3A56A 4IN3A 1KD1C 2B63G 1NMGA 5CV7A 5LMNW 4IOCA 3TP5A 5JEAJ 4WJ4A 4G6BA 5C4HA 2NWGA 2M2LA 4XQNA 4JI0L 1E7ZA 2H5XA 2A8VA 2JA8L 1AN8A 1HQMC 4JI0Q 1I3QL 2YU9L 1KDCA 1QVGA 2CCZA 2MGSA 1V9PA 3CCVA 1CHQD 3J80i 2F0WA 1RDVA 1K3RA 4K6DA 3GTGL 1STYA 1KAWA 5MLC3 1R0IA 1HNWL 2B2TA 3HKZP 2A6EC 3I4LA 2FHTA 4JPBW 1PFMA 3FRPB 4L5RC 4N8X1 1KLGD 4G7HC 4O0AA 3H9BA 4A3CL 2F0QA 4JW0A 5M3FH 2UXCL 1HTPA 4X3KA 4CDFC 4A3JL 4KHPL 3UDGA 2UXBL 2F0SA 3OIPA 1AZPA 3S2HL 2UXDQ 2AUKA 3S15B 4DR3Q 4TSSA 3LGJA 4OELB 2KENA 5A2QE 3H3VM 4C56C 1FR3A 2QGQA 2F0NA 2EIFA 4AI1A 1NXGA 2Y0SE 4RA8A 1EEFD 4HN7A 3EIVA 2SNMA 4OO1G 4LFAL 1OXVA 3H91A 3B6YA 3RZDB 3F8TA 2B2TC 4CJ2C 5IIFA 3S1RL 1FNUA 1TWCB 2XJVA 3P75A 5IYDG 4C3HL 4A3DB 1SNQA 5HGQA 1I6HB 3K80C 4HMIA 1JOOA 5JVH3 1D5ZC 2CH4W 1GUWA 3BYTB 2NVQB 4AR4A 4P72A 3IFDA 1PH4A 1LKOA 3J7ZC 1PTOD 5M5XL 2EZVA 1IU5A 1OXUA 3M4QA 1YJ9A 2L1BA 2HIVA 2J0TD 3A8JE 1Q8KA 3HOXL 3FPPA 4UPAA 2WP8J 1E2WA 1RJTA 3NK9A 4B3MQ 1VQEA 2QCPX 3GP7A 2ERJA 1S2ZA 1O7ZA 3HGBA 4TQUS 4A3BB 3IRBA 1B13A 5ELBA 1DOKA 4LAAA 2C6BA 1C48A 3HP3A 1EQRA 2XNAC 3W2DA 3M7NA 4LF8L 2XJRA 4LFCL 2JI2A 2M4YA 1JE5A 4KHVA 4YCWA 4F8MA 3TZUA 4KN4C 4A3LG 3IL8A 1SDFA 4GKKL 1BFYA 3T53B 4DR4Q 3CF5A 1I4PA 4JI3Q 4A3IG 3PO2G 2V0FA 2NVYH 5M5WH 3OW2A 3DWAA 4BS9A 2KCCA 4ZN1B 4JI8L 4RGTA 1HR0Q 2M9VA 2OTJA 3FDJA 2A1AA 1GOZA 3FKIB 3GTLB 3HJYB 2JA6B 3I56A 5I2XA 1SFOL 3KOJA 1KLUD 3HOWB 2PW7A 2WIIB 2E5LQ 1I3QB 4BY1H 4Y52H 3UE0A 5GAHc 1JB3A 1Q12A 2HT1A 4MHEA 2F0HA 1IRNA 2QL0A 3U58A 3CCQA 1VQ4A 1G8ZD 4DUYL 2VUMG 5C4XL 4JI1Q 4DV1L 4ZUJA 1C8CA 4JK1C 4JBKA 3CPFA 1B9NA 3NQIA 2M6PA 4GNXC 4RXNA 4Y52L 3PUZA 1PH1A 2KBNA 5CV6A 1QB5D 3TP7A 1VQCA 2RDFA 4C3JB 2AWNA 1EIFA 4DK3C 1CZGA 4IUUA 4M8AA 5C3EL 4K5WA 1CKNB 4PZ6A 3MXPA 4JVZA 2PNHA 3VYTA 2DJFC 3QOLA 4BA1I 1E1OA 1PZID 2NVTB 5CV8A 4JADA 3PO2H 1Y14B 1V1PA 2N78A 3LWQB 1SYFA 2B2WA 3D0FA 2UUAL 4FVMA 3C2PA 4RH6A 1HA5A 2KA7A 5ELOA 1TS5A 2LKVA 2K33A 1Z47A 5G3LD 2ZXOA 2PZTA 2E2JL 3S14B 4NDXA 1C0AA 1TQOA 5CV9A 3P8BA 5IT9E 3I4NG 5KYIA 3HOZG 2Z4IA 4IFDG 1S5BD 3OTOL 5M3ML 3RMHA 2FMCA 2JP1A 3MXUA 3S2DL 2PI2A 1RODA 5H1SE 3K8AA 5C3WA 4WFN1 1W6JA 7RXNA 2MO0A 4A3FH 1OTCA 1HRJA 2L0ZA 3NFPI 1G51A 2JEBI 1TWFB 1ZXTA 5KEEA 1NE3A 1SNOA 4BBRL 1I94Q 3NWTA 1YVCA 3MPSA 3CCMA 1D5XC 2BA0A 2MNAA 4A3LH 3PV0A 2QDLA 3NELA 5BN4A 4A3DH 2PQAA 3DWQA 2BCOA 1IKLA 1O78A 1SFOB 5JJIA 5FK9C 4GKJQ 4C1NK 4POFA 3E6ZX 4DR2L 4HR7B 4HJ5A 2H1EA 1PH2A 1VF7A 3KF8B 2R7ZL 1G2SA 1NR2A 3CMAA 4DV5L 5J3BA 4EQ5A 1KXLA 1BCPF 3H94A 4PMCA 1PTOB 1B7YB 1UEBA 4ODGA 3M3YB 4DK1A 3A54A 4BBSG 1VQLA 1CK1A 4G7OC 3HOXG 3H97A 1B53A 4KKUA 1QZGA 4J8QA 4DAPA 4R8NA 2E2IL 5E3FA 3JAMc 2F3WA 3CPWA 1XNRQ 2G5DA 2Y0SB 3PQIA 5M5XH 1BF4A 5I6WA 3FP9A 4OGQC 2NVXB 4ME5A 3KLRA 2HQEA 1FJGQ 1LT6D 2BE5D 1N34L 3KFUA 4IUTA 2EYJA 1HR0L 5E7NA 4AQYQ 2APOB 3KBXA 2R92B 2UXCQ 1P8LA 5ELNA 2ALYB 2QKIC 1Q81C 1LTBD 3NTIA 1J5EL 3D31A 4JI5L 3A7LA 3A55A 5K36G 4X3TA 4BY7H 1WYDA 4RKBA 1OWCA 4IURA 4R4CA 1WTQA 1YNND 5LMUL 1VQ8A 2B2UA 1VQBA 3S17B 2ZTCA 3S24A 1HNZQ 5KRUA 2GMGA 2UUBL 5EBCA 5EKKA 1X65A 3PSIA 2XN9C 1X32A 2VXWA 1K9MC 5BR8Q 1PFBA 4J1MA 3K5OA 2NUCA 1HHVA 2NYDA 3HOVG 3NENA 4DR6L 5EBDA 1JOQA 4BBSH 1CQFA 2EYOA 3S2DB 5DM63 4QUCA 2PNRC 2KOLA 2CFMA 2EY5A 5IGBA 2GVAA 3S15L 1SEBD 4AYBP 3FVQA 1MBYA 4RHSA 3RZ6A 1EWIA 2NTTA 3N6RA 3K57A 3QWNA 3S16H 1HZAA 2EYLA 2AKWB 5EIOC 4MNOA 1ESFA 2DY8A 5C3EG 4BY7B 2EJMA 1JT8A 1F2LA 4DV3L 4X62L 3TP8A 1N32L 1PHJA 2JI3A 3L2PA 4KKTA 1N32Q 2I5MX 1EYAA 4KLKA 3H09A 5C3EH 5M5YH 2IT1A 4R9WA 2FMMA 1FGUA 3T4AC 3I70A 4ILWA 1KRSA 4U671 4A3ML 2DNCA 4KHPQ 3I2ZA 3RZDH 1WTOA 2N8NA 1PTOH 1A0IA 1EWHA 4QCLA 3GTOL 1XMQL 4PZ8A 1VQ6A 2OT2A 1KNEA 2MFIA 1KAAA 3CC2A 1XNRL 4DV0Q 2JA7H 2B63L 1JWSD 1CUKA 5EPKA 5BR8L 3T1HL 1Y1WG 3G6EA 1V1QA 3GTJH 2ZJRA 5FOBB 2PMZP 5C44G 4DV7Q 1EIGA 2YTXA 1OWBA 2R61A 3WWVA 1VQOA 4UY81 3K7AL 2VNUD 2CQAA 2WFWA 4HJ9A 3J81L 3HFZB 4DR5Q 2RFKB 5DM71 3AFPA 2RKSA 5HURA 1YJWA 5IT9L 4UP9A 4LF6L 3Q0AA 2JXMB 1MIUA 3FDTA 1NSNS 1TR5A 1BRFA 1H9JA 2CW0D 3KF6B 1FHHA 4H44C 3HOWL 1FYCA 4RG1A 2EYFA 1N33Q 5JVG1 5D3IB 3J80L 1STEA 3LWUA 3U9SA 4A3GH 3TP6A 2XJPA 2WAQG 3CRLC 1U4PA 2JSOA 2ZIXA 1H9SB 2JA8B 4YHHL 1K83H 1AW7A 3HOXH 1WOCA 1XYIA 1HNXL 4RGMA 3S1QB 1LTRD 3EA6A 2EYPA 3SE0A 3KLSX 4P74A 1G6PA 4A3GG 3PMFA 1BBXC 5KNCA 1DM0B 1NY4A 4DUZQ 2B39A 3Q8DA 4QL5A 2WB1E 4C3HG 4AR5A 4C3JG 2UUCL 5C44B 1ASYA 3I3CA 4BY7L 2LFNA 1R9TH 5C6AA 3OHXC 3CCJA 4DR1Q 1STHA 3EROA 2IWHA 4HSPA 4ZCKA 2RHSB 3ULLA 3GTKL 1R9TL 2A69D 4C3JH 3CU7A 4X6AL 1SE4A 3NBHA 4JCVE 5GADC 2L9HA 1PH7A 1C7YA 3H3VC 3HOUL 5JVH1 1JICA 5IGCA 2QEXA 1JJGA 2ZXRA 4PQXA 1I50H 1EIHA 2F3VA 4DK6C 2PPBC 2D2CC 1F9QA 1ZEQX 3EFXD 4BY1L 2KHSA 4IPDA 1Q7YC 4HAEA 1NCVA 1LACA 1I6HL 2K5WA 2V3BB 1V43A 1A3UA 2E2JB 5GAGc 1QUQB 1HUNA 4B08A 3T1YQ 1SR3A 2PCFB 1ODHA 2HCIA 2WB1B 2AUJD 4UDUC 3R2TA 4R4OA 1PH8A 3AU7A 4AYBE 2B5ID 2P5ZX 4PNYA 2YU9H 3NQTA 2ZJPA 3I4NH 1M4VA 3IFTA 5T1GA 2Q2UA 4LF7Q 3HOZH 2JEAI 2VB3X 3S16B 5C0XI 3KYUA 3IAYA 5CV5A 3I4MB 1PH6A 3NUCA 3BVMA 3RD4A 4LJZC 2LCQA 3JC66 1IZ6A 2QA4A 4X66Q 3LNNA 2VY3A 3NP8A 2KCNA 1F77A 2CVRA 2TMPA 1BXTA 5IP7L 1VZGA 3CD6A 2KQ3A 4JAGA 1C4QA 2AQ1B 3KYHC 3VDYA 3CCRA 2UU9L 2YTYA 1SMWA 4R4QA 1O7IA 1NXEA 1X3QA 1BR9A 4P75A 1Y8PB 3OOCA 2K5NA 4I65A 1FNWA 1K8MA 5EKIA 2JA6L 3H9CA 4IUQA 1K73C 2HR5A 2I46A 2Z6KA 4HCEA 5LMNL 3GTOH 1QQTA 1PRTD 2KEDA 4OWXB 1LABA 1S5CD 2R7ZB 1EQTA 3S1RH 2H4OA 3VYSA 1WTRA 1K8GA 1BOSA 1D1IA 2F03A 1FJGL 2VUMH 2M4VA 3HOZL 2F0JA 3AYHB 1LTTD 3U9OA 5GADc 3GTPL 1ONLA 3GV6A 4JI1L 4DV1Q 3R8BA 1WD1A 2KN9A 3QJYA 2VL6A 3P20A 1CM9A 1N36Q 2RF4A 1RHPA 5CR3A 2B8GA 1U4MA 2V4DA 1K28A 3F2UA 2F0MA 2V1CC 1WCMG 1DX8A 5I9PA 3OIQA 1QCBD 3E9HA 4J15A 4ZUIA 2ZJQA 2DSXA 1W6KA 4NPSA 3D6WA 5CBEE 1QYBA 5C4XG 3KYVA 3FEWX 3FKIH 5RXNA 1BQQT 1LTAD 1Z9FA 4JI3L 2NN6I 5JPNC 1PV4A 1RF2D 1PYWD 5K2ME 1C9OA 3HEJA 1EY9A 2R7ZH 4NB3A 4CGYB 5GAHC 2SDFA 2A6HC 4DN4M 4K2KA 4A3JG 2F0PA 4X64Q 2MO1A 1NBWA 4LFBL 2HUGA 2R93H 1YEZA 4Y7NH 3G48A 1A2TA 1X3GA 3AB9A 3FMCA 4E6IA 4JI7Q 1RD9D 3M4OL 4G57A 3J81c 2R7ZG 5EINC 4ZN3B 3PO3L 1HZCA 2CHBD 2E76C 4IPHA 3LWEA 2YU9B 2M00A 4K0KL 1AP0A 4RHRA 4A3KH 3J81E 4X6AH 4A3LL 3I4NB 2C5CA 1VMPA 2HD3A 3GO5A 3GTKH 1VCXA 1E0BA 2NZHA 2D5DA 3UI2A 1LT5D 3F1ZA 1HZBA 4K9FA 4JBJA 5FLMH 4C3HB 1YNNC 3F2BA 2PPTA 5IP7H 2IJ0A 1Y1VH 1IHZA 2ZM6Q 1VQ9A 3J80E 2KHIA 1TY2A 4RCNA 3S14L 4TKOB 5FLXc 1EIYB 3MEFA 2PZUA 5ELFA 1TWAB 1D6EC 4YCUA 4RKLA 1A3TA 1EL0A 1KQSA 2ATWA 3CCEA 1JJCB 2F52A 2EQSA 1MI2A 4A3IB 2ZXPA 5M3FL 1I50B 1RYTA 5T1IA 3KF6A 1MJCA 1B50A 3CCLA 2IHFA 4JV5Q 4A3JB 1PLFA 2RHQB 5IGGA 3H0GH 2E2DC 3ZYYX 1K0RA 1PH5A 1KIXA 3VR6A 3HOWH 1R4PB 4LHNA 1EY5A 4K8IA 1CI3M 4X66L 3CKIB 4FO2A 1SYBA 4HIOA 1SMUA 3MXGA 3Q23A 4YCVA 2OCEA 3UE1A 1N34Q 1L0XB 1GKHA 3HOXB 4A3FB 3TMEA 1TWAH 1LTLA 1J6QA 3H3VI 3S1NB 4K8JA 1EZ8A 4QUFA 1L1OC 2E75C 4DUZL 4RWSC 4A3CG 1PA6A 5CC4A 2NVQL 1YHAA 2AQ3B 1RKNA 1SE2A 1LT4D 4JI6Q 3GTMB 1WCML 3PF4A 3WOEA 3O13A 4O1NA 1VQFA 2DNEA 4KV6A 4GN4B 4K0KQ 2K14A 3NBHB 4YHHQ 3A8KE 2HDMA 1RB9A 5M5YL 1I4GA 1ILPA 1XPOA 2MJ8A 4JI7L 1ZYRC 2JA9A 2V0EA 3DXJC 3D6CA 1IBKL 3CRKC 3FKIL 1BBUA 2XJUA 2Q8IB 1XX8A 3KYWA 3PGZA 4JI4Q 3S17L 2Z6BA 2WAQB 3STBC 4HEDA 4G4KA 4HSVA 4XT1B 3HOYG 1E24A 5KNBA 1VQIA 3SK6A 4C2MH 4NW2A 1LKPA 4EGVA 4KY5A 2PSMC 1R4QB 1Q86C 1Y1VB 3PIPA 1MJEA 1I4RA 1LT3D 4HIDA 2UUBQ 5C44L 2E5LL 1I5FA 1HQRD 2XJTA 4CJ1B 1YUXA 5FLMG 1SLJA 3K6OA 5C3EB 2O5IC 4BY7G 1OXSC 5FJ8G 2PQAB 2TSSA 2J7ZA 3K58A 4Q5VA 4XXBB 3CC4A 1SYGA 1S3OA 2O4XA 1NMFA 2B2WC 2BA1A 1PFWA 4LNQA 5FKAC 5IT9c 2LY7A 2NYZD 3J7AF 4JAEA 2EYMA 1XXGA 1ICFB 3H0GB 4I7ZC 3PWFA 1TS2A 4FDBA 4DK0A 5IYBG 2UUCQ 2Y0SP 1H9RA 5CYUA 2UU9Q 2QW7A 1YBYA 1Y8NB 5IYCG 2OEOA 4QMGA 3SDZA 5FLXE 3M4OH 1YHQA 3GTOB 2KCMA 2Q8TA 4BBRB 1IYJB 2KECA 1OXTA 2EY4E 3F2CA 2MHVA 4LF4L 4DV6Q 1Y1VG 4NXNL 5G3LF 2Z9HA 1MKHA 1V1OA 1XMOQ 3QO2A 5IP9H 3GTMH 2F0TA 1W3SA 1X3PA 4A3MB 1S40A 1D8LA 4CDEC 1E8JA 4KHZA 3AEVA 4A3CH 4A3EG 1XMQQ 2A6ED 1GUNA 3KYYA 3NPPA 1I6HH 2CKCA 1HR0W 5M5YB 4OO1I 4M1UB 1EU3A 1WD0A 2PI2E 4GLAC 2E8GA 3FPUB 2GA4B 4EQNA 3MA2B 1A15A 4OEMB 5TSSA 2Z1CA 3RZOB 4LFBQ 3ER0A 1WFQA 2CWAA 5GAEc 2PZWA 1FD7D 4DNRB 2K01A 4JI5Q 2ZT9C 3J7Y1 1QNUA 2JA7B 4PMBA 2R93B 5IY0A 3VYUA 2L5TA 2HVYC 3PUVA 2K28A 1YNJD 2G9DA 5FJ8L 2A69C 3QQCE 3F2DA 2WB1P 1BE7A 5JVG3 4LF5L 3KUPA 3SXHA 4DR1L 1QVCA 5IGFA 3RN2A 4A3FG 2EPBA 5JEAG 1ML0D 1B3AA 4IPGA 2EVBA 4J6HA 5D14A 2X69A 4DKAC 3CXCA 1K83L 3EBEA 2CKZB 1X3EA 4B3ML 2K1BA 4KD4A 2XVSA 3E9IA 2YYZA 3CAMA 3N52A 3S1MH 4GLVB 5NUCA 4JG2A 1EUJA 2KHJA 5EJWA 1SMMA 2WKDA 1AE2A 3OWEB 2J9UB 5LMUQ 3ND8A 2CW0C 2B29A 1SSOA 1E2ZA 1J9OA 3FKIG 5C5MA 2OXPA 1LUZA 2XIWA 2JA6G 2N49A 1N33L 3HZXA 1B9MA 2MS3A 1VQ7A 1LTGD 3M4OB 4RCOA 2I5LX 1QZHA 1PDQA 4KK7A 1I94L 4AQYL 2VZAA 2C9OA 4KKSA 2JA8H 2R92L 1UAPA 3ONAB 3S17H 2LMCB 1EY6A 2DN8A 3J7A5 2Q2HA 3DEOA 1CT1D 4XXEA 3DUZA 2EY2A 2B2VC 5L37A 3HOUB 4DAYA 4F87A 2BH2A 4QB4A 1SMYD 3K5MA 1DYQA 1I4XA 1AZQA 3B0AB 4WJ3M 1GD7A 1G291 4TVMA 1NUCA 2NVTH 4MTKA 2Y0SG 2RVLA 1QVFA 2D0PA 4DAVA 4OIKA 3S1NH 3GD7A 1UE7A 3W3AA 1LV9A 4HCSA 3AFQA 1YZ6A 2WV6D 4JI8Q 4LWCA 5EPJA 3ITPA 4AH6A 4JI4L 1F2YA 3HKZB 1XTCD 1TU2B 2JA5H 5BN5A 4QF4A 4DNIA 4DA2A 5GAGC 3H15A 4GKJL 4CDDC 1K8AC 5C3XA 5M3MB 1A62A 3PUXA 5IE8A 4V190 2XRSD 3TZDA 2Z6KC 4GNXB 4OL7A 2BOSA 3LWVB 4JYAQ 3BVZA 4JYAL 3E0EA 2JA8G 1SBBB 1IBML 4JBMA 3PIOA 4JI6L 3K35A 4X3SA 4RAUC 1H7VA 2GVBA 2PYAA 4DR3L 1HFNA 1R0GA 1IXRA 2IL8A 3E0JA 3HOZB 4OX9Q 4IFDI 1GJXA 5ELCA 4A93L 1WTPA 2WAQP 1D1KA 3CCSA 2R7FA 1MHWC 1QOHA 1S5ED 4GZYC 1CKOA 1LLRD 4UAIA 3LX0A 2K5VA 1BO0A 1GHJA 1XMOL 4EQOA 1F2ZA 2YV5A 4IZ8A 1WCMB 4B9XA 2NVXH 5IOCA 4L5QA 3ERQA 3PCOB 4K14A 1L1OA 4KI0A 1SXTA 1UUPA 1STGA 4BXXG 3M7GA 1SE8A 4AI3A 4DR6Q 3SR1A 1N9WA 4DUYQ 1EYDA 3VR4A 4GS7D 2A68D 3PO2B 5LL6X 1PZKD 2VUML 3FHWA 3BVGA 3G6JB 5MFZA 1H9MA 2B63H 4TPUA 3OMCA 3A74A 4XQQA 4X64L 1KC8C 3HOWG 1LO5D 5GROA 2JA6H 2M6OA 2IHEA 1PFVA 2L12A 4DPGA 3NWSA 3D4WA 3PUWA 5IGDA 1J5EQ 2NVXL 1AEXA 2BE5C 1A6XA 3BZKA 4DR5L 3RYGA 2ENBA 1PFUA 1JOKA 2IY5B 3ND9A 4CKCA 2ICIA 3G71A 2L15A 3M9BA 3MSUA 1HA6A 4POGA 1IYUA 4K6LA 1GM5A 2YTVA 4FXKC 1JQYD 2RA4A 2AWOA 1TWHB 1F4LA 4C3IG 1U5KA 3A7AB 3STBD 2JA5B 3MC0B 3WWNB 4LF7L 1ENCA 1R9TB 2WKCA 2IPKD 4L5TA 4ZQ3A 1SNPA 3BJUA 3NE5B 4A3IL 3C1FA 3I8ZA 1NAPA 4GN3B 3TEHB 3SK8A 2CQOA 4XDXA 5IGEA 1HUMA 2IX0A 5IYBL 3V2TA 1OXXK 3H0GG 3ULJA 4C1NI 1XPUA 4MN3A 4R4IA 4IJLA 3AQQA 1LM0A 4LMQD 4DAYB 4RGNA 1AE3A 4DR7L 3CC7A 2O5JC 5JJLA 3DMUA 1EZ6A 4A3BH 3HOVL 2I07B 2PMZB 4C3HH 1GUSA 1X9NA 3OWFA 3A44A 1MSGA 4A93G 3T1HQ 4ULLA 1KHIA 3S1NL 4Y7NL 4O2DA 4A3MG 1HNWQ 1EYCA 5IODA 1F9PA 1V1PB 3RZTA 1SNDA 2H12A 1D7QA 1ESRA 3K81C 3MZ5A 3NEMA 4ABNA 3OW7A 5IP9G 4FF4A 4CJ0B 2JA5G 2K32A 4BXXL 1M8AA 4KY7A 2K5QA 1X56A 3HKZG 3R93A 1RTNA 5K36H 2HQLA 5I4DA 2K2DA 4LK1C 5HY6A 3V96A 1HNZL 1XWEA 2KKDA 3S16L 4A3GL 1FNVA 1PFNA 1L1OB 2K52A 4DV5Q 3H6MA 1EY7A 3PIP3 5MFPA 3GDEA 1VQHA 5H1Sc 1CADA 1F9SA 2ID0A 1CFMA 1YNXA 1PFYA 1I4HA 1VQAA 5AFWA 3RZOH 2I0QA 1U4RA 4U673 1D5MC 1BNZA 3S1QH 5J39A 2UXDL 1PYBA 1QWYA 1PFSA 3VR3A 5FO7B 3SGIA 2SNSA 1S30A 4QGUA 2K7VA 5HGTA 2VW9A 1UE6A 3HOUH 5EKLA 5FLXL 1CQVA 2E74C 1K8OA 2F1MA 1BQ9A 3T1YL 3HOYL 1WCMH 2RCNA 1YK4A 4ME3A 2XWBB 3RLNA 3RUZA 2A5HA 2K05A 3QB3A 3NTKA 1RDGA 4B9WA 4B3RL 4IJHA 1O7LA 1PVOA 1HH2P 4A3IH 3LPEB 1JWUD 3HJWB 4UP7A 1IBLQ 1SNMA 1KRTA 3QR8A 3R3OA 1TXYA 1PRTB 3KJPA 4A3JH 2OTLA 2F3IA 2ERSA 2XGTA 4B3SQ 1M1KC 1Y8OB 2E2JH 4B3SL 3WWLA 3GTQB 4A3EL 1VDZA 1R0JA 1PH3A 1ASZA 3HOVB 4DU9A 4BBRG 2XJQA 3B08B 1J8IA 1PTOF 4AIMA 1TWCL 1RYQA 3J81i 3SHLA 4A3BG 4IFDH 4DV7L 4BBSL 4A3KB 1UNSA 1VQGA 2FJ2A 3HAXC 1U9RA 4XTCS 3ULPA 5E4XA 3NTHA 2C35B 4X62Q 4DV3Q 4R4TA 4QIWP 1FGBD 3S15H 4FXDA 2A74C 4O42A 4CDCC 3KDFB 3MWYW 4C3IB 1VZHA 3LWRB 2KUMA 1IL8A 4EX5A 2Q2IA 2Q2TA 3C46A 2F0VA 2PVEA 1RIPA 2Z0SA 3T51B 1EU4A 1QE6A 3TBIB 3GTJL 2CH4A 1CHPD 1B2JA 3DM3A 1VQNA 3P1HA 2OQ0A 4NXMQ 4BY1G 4QQBX 1GXDC 2NZOA 4A3FL 3SS2A 3BZCA 1JMCA 3HOVH 2NN6H 4ZRZA 4EVOA 4WFN3 5A35A 3KK7A 2UUAQ 1ZKOA 4R1JA 1TWAL 1JWMD 1B2TA 1ICWA 2PO4A 2IX3A 1RL2A 3BZDB 5MGNA 1ILQA 2MPMA 1GUGA 2B2YA 1X55A 2K5HA 2JJQA 3A0JA 1STNA 4X65Q 3NSWA 1BKBA 5IYBH 3I72A 2EY1A 4WRDA 3EQLC 2BDNA 1XJVA 2B2YC 2MUYA 5IYCH 3GQBA 4UY8C 1EQVA 3GTGH 2LXKA 4AYBG 2NTSA 1O7YA 1EQQA 5AI3A 4HIKA 3I4MG 1JCKB 3EJIA 5C44H 1T9HA 4X65L 2PYKA 1HTLD 3H3VH 2JK8A 3BS1A 4LFCQ 3JC62 4OONA 1TWFH 4NP5A 3VYRA 4HJ8A 1WTWA 4FXGC 4KJOA 4GOPB 4WORA 1KL9A 3P7JA 5CORA 5KYLA 4HJ7A 4BXXH 5DM61 3GTPB 1E1TA 5DAUA 2CKAA 3BYYB 5IWAQ 3JAME 1G6ZA 3H99A 2EJGC 4KMUC 1Y1VL 4C3JL 1PYSB 4A3DG 4CBVA 1PRTF 1B70B 1HNXQ 1B1ZA 4KJNA 3QVDA 1CSPA 1WTVA 1CA5A 3BDOA 2JI1A 3S2HB 3JC63 3GTQH 5AN9H 1VS0A 3KJOA 3HG9A 4CHTB 4H0LC 3GTGB 1HCZA 1BCPD 2NVTL 4JI2L 1SE3A 4YWLA 1ZRPA 3EVQA 1PMRA 3S2DH 1L0YB 4IOAA 1EWCA 2ASBA 1BDOA 5KGUA 5C0XJ 4BBRH 2EYHA 1X3FA 2QILA 2F4IA 2RBMA 5M3FG 1IW7C 1Q3LA 2SEBD 3RZDL 2JQOA 1H95A 3UDIA 3HS0C 4PZ7A 4XYQA 1T5XD 4BWGB 1SROA 1FHMA 3PZAA 1YHBA 4UHVA 2L0CA 2RDGA 4AR3A 1PXUA 3DLLA 2HHHL 2A73B 3PO3G 2FFKB 4QY7A 1NTGA 1MSHA 2EDGA 2Z3RB 5E1FA 1RDPD 3K5NA 5M3MH 2D9UA 3WDNA 4YY3L 2WAQE 2FINB 1N36L 4DGZA 1SNCA 2D0OA 3CQZH 2PQEA 4F7XA 3I4NL 5AJ3L 3Q6SA 5IYDH 2VQFQ 1P16A 4B3TL 1PH9A 5C4ZA 3KYXA 5M3MG 2K03A 2XJSA 3M85A 2DJGC 3J80c 3H0GL 2EOTA 3GV3A 4AI2A 2B2UC 4AHWA 1CA6A 1X6OA 1TT2A 3TREA 1H9SA 4LW1A 2R93G 4ZAIA 5ISRA 2Z4HA 3K0XA 1XPRA 4FP5D 1WVLA 4GKKQ 4TRDA 3WOFA 2AYJA 5JAVA 1E2VA 1TVXA 4K2LA 3TS0A 1B3QA 4ALPA 4CKEA 1I50L 5M3FB 3K7AH 4A3DL 4A3KG 4A93B 5J22A 2ICEC 1DGSA 1DD2A 3BDLA 4PMWA 5FJ8H 2JN4A 3PIP1 3W1GA 3J7AV 1YNJC 4C3IH 1KTKA 3L3OC 4LF9Q 5C4JB 1WJJA 3I4MH 2EE1A 4A3MH 3A5ZB 2JA7L 2R93L 2LSSA 1GO3E 3I7FA 1KDBA 3RLFA 3QOJA 1BCPC 1GVPA 4PV1C 4DV4Q 4I7AA 1RTOA 2HDLA 4P2CB 4K5VA 3MFGA 4GS3A 2X6GA 2ZTEA 4A75A 2E2HB 3OYYA 3RZOL 1QUQA 1K83B 2PVXA 1SN8A 2N88A 2R3ZA 1BQ8A 2LS01 1U0LA 4P71A 1WTHA
chains in the Genus database with same CATH topology
1R0GA 1KAWA 1IXRA 4R4OA 5MLC3 1R0IA 1PH8A 4OX9Q 4IFDI 1HNWL 4AYBE 2B5ID 1VQDA 2YU9H 3CCSA 2R7FA 4L5RC 4JBWA 4PG3A 2ZJPA 1SMXA 1CKOA 1Z92B 4O0AA 1FL0A 5M3FH 2Q2UA 4LF7Q 3I4NH 4DR4L 3HOZH 3PIO1 2JEAI 2UXCL 2K5VA 3UDGA 1XMOL 5C0XI 3KYUA 4KHPL 2UXBL 2UXDQ 2RDVA 2YV5A 1PH6A 4DR3Q 2NVXH 4L5QA 3PCOB 2LCQA 1L1OA 1IZ6A 3JC66 3LGJA 4KI0A 2QA4A 2KENA 1SE8A 3U50C 4AI3A 4X66Q 4LF8Q 2VY3A 4DR6Q 1N9WA 4DUYQ 2DUDA 2QGQA 2EIFA 1VZGA 4AI1A 1NXGA 4GS7D 2Y0SE 4IO9A 4OWWB 4JAGA 3VPBE 3CD6A 3GTPH 3EIVA 2A68D 4OO1G 4LFAL 3FHWA 2K50A 3KYHC 3CCRA 1OXVA 2AMCB 2YTYA 1SMWA 3B6YA 3F8TA 4R4QA 4DV2L 2UU9L 1O7IA 1Q1BA 1NXEA 5MFZA 2XJVA 4P75A 2B63H 1S72A 5IYDG 4TPUA 1L0WA 3A74A 2K5NA 5HGQA 1R0FA 3K80C 4X64L 4B8CD 1KC8C 1CKNA 3PUYA 2ZM6L 3HOWG 5GROA 1K73C 2HR5A 2JA6H 4B3TQ 2M6OA 2Z6KA 5LMNL 2IHEA 2VQFL 4DPGA 3GTOH 1JYBA 2B3GA 4AR4A 3PUWA 4P73A 4OWXB 4P72A 1J5EQ 1PH4A 1LKOA 3S1RH 2JA7G 3U4VA 4GLXA 3S2HH 3BZKA 1K8GA 4DR5L 3RYGA 1IU5A 2CR8A 1OXUA 3M4QA 1FJGL 1YJ9A 2M4VA 2HIVA 2PMZE 3AYHB 2VUMH 2IY5B 5GADc 1B8AA 1Q8KA 4UPAA 4JI1L 4DV1Q 4AHYA 2WP8J 3G71A 5JJKA 2L15A 3IU3I 3M9BA 3M4PA 2C6AA 5AI2A 2HHHQ 1VQEA 3MSUA 3CCUA 2ERJA 1S2ZA 2KN9A 4POGA 2D62A 4TQUS 4LFAQ 4A93H 3IRBA 1VZIA 1B13A 4A4IA 2GN5A 2VL6A 2C6BA 1N36Q 1EQRA 2RF4A 1GM5A 2YTVA 2R6GA 1EFWA 3M7NA 2V1CC 4LF8L 5MF6A 2XJRA 1DX8A 1WCMG 2AWOA 4LFCL 2JI2A 2M4YA 1JE5A 3E9HA 4J15A 4YCWA 1U5KA 3STBD 2DSXA 4OWTB 1VQMA 1NJIC 1JJ2A 2ZJQA 4GNXA 4NPSA 1VQPA 4A3LG 1QYBA 4GKKL 5C4XG 1S24A 3WWNB 1BFYA 3UDXA 4LF7L 3KYVA 3FKIH 4DR4Q 5RXNA 3CF5A 4L5TA 1Z9FA 4JI3L 2NN6I 4A3IG 1PV4A 2V0FA 4JI3Q 3PO2G 5K2ME 1C9OA 2NVYH 5M5WH 4LUVA 3OTOQ 3OW2A 3BJUA 1IW7D 2R7ZH 4NB3A 5GAHC 4JI8L 4ZN1B 4GN3B 3TEHB 1HR0Q 2OTJA 2A1AA 4A3JG 4DR3L 2CQOA 4X64Q 2IX0A 2MO1A 1NBWA 3I56A 4LFBL 1OXXK 2MQHA 3H0GG 3KOJA 4AHXA 3ULJA 4B3MQ 1YEZA 1XPUA 2R93H 4R4IA 4Y7NH 3G48A 4IJLA 1X3GA 3AQQA 2E5LQ 4JI7Q 1LM0A 4BY1H 4Y52H 3UE0A 4DAYB 5GAHc 3HOYH 3J81c 1UWVA 1AE3A 2R7ZG 2ES2A 1Q12A 5EINC 4ZN3B 1HZCA 4IPHA 3ZG6A 3CC7A 1M90C 3BU2A 2HT1A 4DR7L 1IRNA 4K0KL 2QL0A 3U58A 3CCQA 4A3KH 5JJLA 1VQ4A 4DUYL 2VUMG 4X6AH 4JI1Q 4DV1L 4JV5L 4JOIC 2OWOA 4A3BH 5DLQE 2N3SA 3GO5A 4C3HH 3CPFA 4JBKA 1X9NA 3GTKH 1VCXA 2NZHA 2M6PA 4GNXC 3A44A 4RXNA 4A93G 3CMEA 3T1HQ 1R0HA 3PUZA 1PH1A 2KBNA 3F1ZA 1HZBA 1KHIA 1VQCA 1T9QA 4O2DA 4K9FA 4E6YA 4JBJA 5FLMH 4A3MG 1HNWQ 3F2BA 2AWNA 2PPTA 4JOIA 1EIFA 4DK3C 3RZTA 1Y1VH 5IP7H 2ZM6Q 2H12A 1VQ9A 2R92H 1D7QA 2KHIA 3K81C 1CKNB 3NEMA 5FLXc 4PZ6A 1EYGA 5IP9G 4GOPC 1EIYB 3MEFA 2PNHA 1IBMQ 2JA5G 3G4SA 3J7Z1 4YCUA 5C4JH 3LNLA 1WJVA 2VS1A 1KQSA 2ATWA 3CCEA 4BA1I 1E1OA 1JJCB 2F52A 2EQSA 1X56A 3HKZG 3W1BA 4JADA 5IP7G 4B3RQ 3PO2H 4RMFA 2HQLA 1RYTA 4LF4Q 1Q46A 1EOVA 1Y14B 3ERSX 2K2DA 2N78A 3KF6A 2UUAL 1MJCA 3D0FA 3L0OA 5HY6A 3CCLA 1HNZL 2IHFA 4JV5Q 2JE6I 3J81j 1C09A 2KKDA 3KLWA 1L1OB 2RHQB 3CW2C 5ELOA 4DV2Q 2K52A 4DV5Q 3H0GH 2LXJA 1B2OA 5MFPA 1K0RA 3GDEA 1VQHA 5H1Sc 1Z47A 1PH5A 1CADA 1KIXA 1Q1EA 3HOWH 2ID0A 4LHNA 4V196 4DR2Q 1YNXA 4X66L 3GTLH 1VQAA 1C0AA 4HIOA 1X54A 1SMUA 3I4OA 3RZOH 1YI2A 4YCVA 3P8BA 2OCEA 2WB1G 2VQEQ 2I0QA 3I4NG 2UXDL 3S1QH 3UE1A 1PYBA 1PFSA 3HOZG 1IROA 3SGIA 1N34Q 1GKHA 4IFDG 1S30A 4QGUA 3L7ZC 4H02A 3OTOL 2VW9A 1TWAH 1LTLA 1J6QA 3H3VI 1UE6A 4JAFA 3U4ZA 3HOUH 2PI2A 1PH9A 1L1OC 2DGYA 5H1SE 4DUZL 3K8AA 4A3CG 1PA6A 4WFN1 3UDFA 1YHAA 4JC0A 7RXNA 2MO0A 4A3FH 1OTCA 4LUZA 4B3ML 2L0ZA 3NFPI 1BQ9A 3T1YL 4JI6Q 3PF4A 1G51A 1E3PA 1WCMH 1YK4A 2JEBI 4ME3A 2RCNA 3RLNA 4DR7Q 1NE3A 4UP8A 1JB7A 1I94Q 1VQFA 5C0XG 1RDGA 4LHLA 4QIWE 4GN4B 1YVCA 2K14A 3MPSA 4K0KQ 3NBHB 4YHHQ 3CCMA 2BA0A 4IJHA 5C4XH 4YWMA 2MNAA 1RB9A 4B3RL 2O5JD 4A3LH 3PV0A 1XPOA 3NELA 1PVOA 4BXXG 1HH2P 3PKIA 4A3IH 4DV0L 4A3DH 3LPEB 4JI7L 2PQAA 2JA9A 4UP7A 2V0EA 1IBLQ 4GKJQ 1KRTA 1IBKL 5JJIA 1TXYA 2R7DA 2XTIA 3KJPA 4AI0A 1BBUA 4YWKA 2XJUA 4POFA 4A3JH 1Q82C 1HZ9A 2OTLA 2E2IH 3HKSA 2F3IA 2ERSA 4DV4L 4DR2L 3PGZA 3KYWA 1T9OA 2XGTA 3RNUA 4B3SQ 4JI4Q 1M1KC 4HJ5A 2E2JH 4OXPA 4B3SL 3WWLA 3STBC 1PH2A 5LMNQ 3KF8B 3HOYG 1E24A 3CMAA 1XTDA 4DV5L 1VQIA 1R0JA 5J3BA 1PH3A 1ASZA 4EQ5A 1KXLA 4YY3Q 3RR5A 4APVA 4BBRG 2XJQA 4OX9L 4C2MH 1LKPA 3B08B 2IX1A 1UEBA 1B7YB 3EN2A 4BBSG 4AIMA 1VQLA 2PSMC 1RYQA 3J81i 3HOXG 1Q86C 4A3BG 3PIPA 4DV7L 1MJEA 1VQGA 1IL2A 3JAMi 4XTCS 3ULPA 1QZGA 4LUOA 2C35B 3M3YH 4X62Q 4DV3Q 4HIDA 3JAMc 3CPWA 2UUBQ 4R4TA 2E5LL 1I5FA 1XNRQ 1QCVA 5M5XH 1YUZA 2XJTA 3S15H 3TS2A 1UE1A 3FP9A 1YUXA 1WI5A 5FLMG 1FJGQ 2BE5D 1N34L 3KFUA 1SLJA 3KDFB 1VZHA 4BY7G 1OXSC 5FJ8G 1HR0L 2PQAB 5E7NA 4AQYQ 3TRZA 4EX5A 2Q2IA 2Q2TA 4XXBB 2UXCQ 1P8LA 4XIGS 5ELNA 3CC4A 2PVEA 1RIPA 2ALYB 2Z0SA 1Q81C 1S3OA 1YJNA 1A63A 1NMFA 3PKJA 2BA1A 1J5EL 3D31A 4JI5L 4LNQA 3A5UA 1B2JA 3DM3A 1VQNA 1IBLL 5K36G 2OQ0A 5IT9c 4BY1G 4NXMQ 4BY7H 4QQBX 1WYDA 4JAEA 4MZ9A 1OWCA 2NZOA 1XNQL 3SS2A 3BZCA 4R4CA 1IU6A 2BH8A 5IWAL 1JMCA 5AJ3Q 5LMUL 1VQ8A 1YV1A 3PWFA 3HOVH 1VQBA 4FDBA 2ZTCA 3S24A 5IYBG 3K7UC 1HNZQ 1L2FA 5GAEC 2UUCQ 4IFDJ 2UUAQ 2GMGA 2UUBL 1LYLA 4R1JA 4XGHA 1X65A 2UU9Q 1YBYA 3PSIA 5IYCG 1RL2A 1K9MC 5MGNA 5BR8Q 3I55A 3M4OH 1YHQA 2OQKA 1X55A 2K5HA 1N8RC 2JJQA 3MXNB 2NYDA 3A0JA 3HOVG 3NENA 4X65Q 2KCMA 4HJAA 1XNQQ 1IYJB 3RN5A 1OXTA 4DR6L 1BKBA 1E22A 4MTNA 3ZJYC 5IYBH 3F2CA 2AHOB 4BBSH 4LF4L 1XJVA 4DV6Q 1Y1VG 4NXNL 5IYCH 1MKHA 1XMOQ 2CFMA 4NXNQ 4UY8C 5IP9H 3GTMH 2UXBQ 1HJPA 2GVAA 3GTGH 1W3SA 2LXKA 4GN5A 4AYBG 1S40A 3HKZE 1D8LA 5AI3A 1EQQA 6RXNA 4HIKA 3RZ6A 1EWIA 5C44H 1VQ5A 3I4MG 1T9HA 1E8JA 4X65L 3S16H 1HZAA 4KHZA 1YIJA 3AEVA 3H3VH 4A3CH 2JK8A 4A3EG 2AKWB 5EIOC 4MNOA 4JI2Q 1XMQQ 2A6ED 4LFCQ 1UE5A 2KCTA 5C3EG 3JC62 4OONA 4AHZA 1TWFH 3KYYA 1JT8A 1I6HH 2CKCA 4DV3L 4X62L 4HJ8A 4BA2I 4GOPB 1HR0W 4L5SA 2F4VQ 3CP0A 4OO1I 1KL9A 1PHJA 2JI3A 1N32L 2PI2E 4TVAB 3L2PA 4HJ7A 4BXXH 1N32Q 5DM61 2I5MX 1E1TA 4KLKA 2CKAA 1A8VA 2E8GA 4GLAC 5IWAQ 4A3EH 3W5OA 2EXDA 1T9PA 3S14H 5C3EH 5M5YH 2IT1A 1PYSB 4A3DG 1FGUA 4LFBQ 1B70B 1HNXQ 5EAYA 3ER0A 1WFQA 1YK5A 1KRSA 5GQOA 2CWAA 2K4KA 5GAEc 4U671 1YITA 3QVDA 1CSPA 4KHPQ 2F4VL 2JI1A 3I2ZA 3RZDH 8RXNA 4JI5Q 3J7Y1 2N8NA 3JC63 3GTQH 1SRUA 5AN9H 1A0IA 5IY0A 1VS0A 3KJOA 2NVQH 3PUVA 1XMQL 4JI2L 4PZ8A 4HIMA 3QQCE 4YWLA 3F2DA 1VQ6A 1AH9A 3HOUG 1ZRPA 1BE7A 2MFIA 3S2DH 4QJFA 4LF5L 3CC2A 4AR6A 4IOAA 1XNRL 4DV0Q 2ASBA 2JA7H 4DR1L 5C0XJ 1QVCA 4BBRH 3PO3H 2A6HD 1CUKA 1X3FA 2K75A 5M3FG 3RN2A 4A3FG 5JEAG 5BR8L 2JQOA 3T1HL 1H95A 1Y1WG 3G6EA 3UDIA 1V1QA 4PZ7A 3GTJH 4IPGA 1SROA 2ZJRA 1FHMA 3PZAA 1YHBA 4DKAC 3CXCA 3EBEA 5C44G 4DV7Q 2CKZB 4AR3A 1FVIA 1X3EA 1OWBA 2YTXA 3KDFA 3DLLA 4A76A 3P2AA 3VDYA 3WWVA 2HHHL 4QY7A 3PO3G 1NTGA 4UY81 3E9IA 1VQOA 2Z3RB 2YYZA 3CAMA 3ICEA 3S1MH 5M3MH 4GLVB 1Y1WH 2VNUD 4YY3L 2WFWA 1EUJA 2WAQE 2KHJA 4JG2A 4HJ9A 1N36L 1BBWA 2E2HH 3HFZB 4DR5Q 1SMMA 5DM71 2D0OA 3AFPA 1YJWA 4UP9A 3CQZH 2ZTDA 4LF6L 1AE2A 2J9UB 5AJ3L 5LMUQ 5IYDH 1MIUA 3TQYA 2B29A 2VQFQ 1P16A 4B3TL 1BRFA 3FKIG 1H7VA 1TWCH 1FHHA 3KYXA 3KF6B 5M3MG 1CKMA 2VQEL 1LUZA 4RG1A 2JA6G 2N49A 4IPCA 3RLOA 1N33L 1N33Q 2MS3A 1VQ7A 2XJSA 3M85A 5JVG1 3J80c 2I5LX 1QZHA 4AI2A 4AHWA 1X6OA 1CAAA 4A3GH 1I94L 2XJPA 2WAQG 3TREA 4AQYL 1I3QH 2VZAA 4LW1A 2JA8H 2ZIXA 2R93G 4YHHL 1K83H 3S17H 3HOXH 1WOCA 4DV6L 1HNXL 3J7A5 2Q2HA 3K0XA 1XPRA 4GKKQ 1RWDA 3PF5A 2AYJA 2BH2A 1VQKA 4GOPA 3TS0A 4P74A 1B71A 1G6PA 1TWGH 4ALPA 4A3GG 3K7AH 4A3KG 1CSQA 1NY4A 3B0AB 1DGSA 4DUZQ 4WJ3M 3Q8DA 4QL5A 4PMWA 1GD7A 2WB1E 1G291 4TVMA 2I5HA 5FJ8H 4AR5A 3PIP1 1BVSA 1VCIA 2UUCL 2Y0SG 4LF5Q 3W1GA 1QVFA 2NVTH 2D0PA 4C3IH 1ASYA 3S1NH 3GD7A 1R9TH 4DAMA 2CWPA 1TWHH 1UE7A 4LF9L 4LF9Q 3CCJA 1WJJA 4DR1Q 3I4MH 1IBKQ 3AFQA 3ULLA 1YZ6A 2A19A 2RHSB 4A3MH 4NXML 1W2BA 4JI8Q 3A5ZB 4LWCA 1DVBA 2FXQA 3I7FA 2LSSA 1GO3E 4AH6A 1SFOH 2R92G 4JI4L 2A69D 3RLFA 4LF6Q 4C3JH 1GVPA 4DV4Q 4JCVE 1LKMA 2Z3QB 2NN6G 5GADC 1PH7A 1C7YA 2JA5H 5JVH1 2QEXA 1NNQA 4DNIA 5GAGC 1JJGA 3H15A 4GKJL 1I50H 1K8AC 1VQJA 2HIXA 2B63G 4GS3A 1KD1C 1A62A 1NMGA 2ZTEA 3PUXA 4IPDA 4DK6C 5IE8A 4A75A 1Q7YC 5LMNW 3OYYA 4IOCA 5JEAJ 4WJ4A 4GNXB 2Z6KC 4G6BA 2V3BB 1V43A 1QUQA 4JI0L 4JYAQ 1E7ZA 2H5XA 5GAGc 1QUQB 2A8VA 2PVXA 1SN8A 1QVGA 4JI0Q 4JYAL 1BQ8A 2CCZA 3CCVA 1V9PA 3E0EA 2JA8G 1IBML 4JBMA 3J80i 1U0LA 3PIOA 3T1YQ 4JI6L 1RDVA 3K35A 1SR3A 1ODHA 4P71A 3J7ZC 1K3RA 2GVBA 2PYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0G A;  1KAW A;  1IXR A;  4R4O A;  1PH8 A;  1R0I A;  4OX9 Q;  4IFD I;  1HNW L;  4AYB E;  1VQD A;  2YU9 H;  3CCS A;  2R7F A;  4L5R C;  4JBW A;  4PG3 A;  2ZJP A;  1SMX A;  1CKO A;  4O0A A;  2Q2U A;  1FL0 A;  5M3F H;  4LF7 Q;  3I4N H;  4DR4 L;  2UXC L;  3HOZ H;  2JEA I;  2K5V A;  3UDG A;  1XMO L;  5C0X I;  3KYU A;  4KHP L;  2UXB L;  2UXD Q;  2RDV A;  2YV5 A;  1PH6 A;  4DR3 Q;  2NVX H;  4L5Q A;  3PCO B;  2LCQ A;  1L1O A;  1IZ6 A;  3JC6 6;  3LGJ A;  4KI0 A;  2QA4 A;  2KEN A;  1SE8 A;  3U50 C;  1YIT A;  4X66 Q;  4LF8 Q;  2VY3 A;  4DR6 Q;  1N9W A;  4DUY Q;  2DUD A;  2QGQ A;  2EIF A;  4IO9 A;  4OWW B;  3CD6 A;  2Y0S E;  3GTP H;  4OO1 G;  3EIV A;  4LFA L;  3FHW A;  2K50 A;  3KYH C;  3CCR A;  1OXV A;  2AMC B;  2YTY A;  1SMW A;  3B6Y A;  3F8T A;  4R4Q A;  4DV2 L;  2UU9 L;  1O7I A;  1Q1B A;  4P75 A;  2B63 H;  1S72 A;  5IYD G;  4TPU A;  1L0W A;  3A74 A;  2K5N A;  5HGQ A;  1R0F A;  3K80 C;  4X64 L;  1KC8 C;  1CKN A;  3PUY A;  2ZM6 L;  3HOW G;  5GRO A;  1K73 C;  2HR5 A;  2JA6 H;  4B3T Q;  2Z6K A;  5LMN L;  2IHE A;  2VQF L;  4DPG A;  3GTO H;  1JYB A;  2B3G A;  4AR4 A;  3PUW A;  4P73 A;  4OWX B;  4P72 A;  1J5E Q;  1PH4 A;  1LKO A;  3S1R H;  2JA7 G;  3U4V A;  4GLX A;  3S2H H;  3BZK A;  1K8G A;  4DR5 L;  3RYG A;  1IU5 A;  1OXU A;  3M4Q A;  1FJG L;  1YJ9 A;  3AYH B;  2HIV A;  2PMZ E;  2VUM H;  2IY5 B;  1B8A A;  1Q8K A;  4UPA A;  4JI1 L;  4DV1 Q;  2WP8 J;  3G71 A;  5JJK A;  2L15 A;  3M9B A;  3M4P A;  5AI2 A;  2HHH Q;  4B3M Q;  1VQE A;  3TRZ A;  3CCU A;  2D62 A;  1S2Z A;  2KN9 A;  4POG A;  4TQU S;  4LFA Q;  4A93 H;  3IRB A;  1B13 A;  4A4I A;  2GN5 A;  2VL6 A;  1N36 Q;  1EQR A;  2RF4 A;  1GM5 A;  2YTV A;  2R6G A;  1EFW A;  3M7N A;  2V1C C;  4LF8 L;  1WCM G;  1DX8 A;  4LFC L;  2AWO A;  2M4Y A;  1JE5 A;  3E9H A;  4J15 A;  4YCW A;  1U5K A;  3STB D;  2DSX A;  4OWT B;  1VQM A;  1NJI C;  1JJ2 A;  2ZJQ A;  4GNX A;  4NPS A;  1VQP A;  4A3L G;  1QYB A;  4GKK L;  5C4X G;  1S24 A;  1BFY A;  3UDX A;  4LF7 L;  3KYV A;  3FKI H;  4DR4 Q;  5RXN A;  3CF5 A;  4L5T A;  1Z9F A;  4JI3 L;  2NN6 I;  4A3I G;  1PV4 A;  4JI3 Q;  3PO2 G;  1C9O A;  2NVY H;  5M5W H;  3OTO Q;  4LUV A;  3OW2 A;  3BJU A;  2R7Z H;  4NB3 A;  5GAH C;  4JI8 L;  4GN3 B;  3TEH B;  1HR0 Q;  2OTJ A;  2A1A A;  4A3J G;  4DR3 L;  2CQO A;  4X64 Q;  2IX0 A;  2MO1 A;  1NBW A;  3I56 A;  4LFB L;  1OXX K;  2MQH A;  3H0G G;  3KOJ A;  3ULJ A;  2R93 H;  1XPU A;  1YEZ A;  4R4I A;  4Y7N H;  3G48 A;  4IJL A;  1X3G A;  3AQQ A;  2E5L Q;  4JI7 Q;  1LM0 A;  4BY1 H;  4Y52 H;  3UE0 A;  4DAY B;  3HOY H;  3J81 c;  1UWV A;  1AE3 A;  2R7Z G;  2ES2 A;  1Q12 A;  1HZC A;  4IPH A;  3CC7 A;  1M90 C;  2HT1 A;  3BU2 A;  4DR7 L;  1IRN A;  4K0K L;  2QL0 A;  3U58 A;  3CCQ A;  4A3K H;  5JJL A;  1VQ4 A;  4DUY L;  2VUM G;  4X6A H;  4JI1 Q;  4DV1 L;  4JV5 L;  4JOI C;  2OWO A;  4A3B H;  5DLQ E;  2N3S A;  3GO5 A;  4C3H H;  3CPF A;  4JBK A;  1X9N A;  3GTK H;  1VCX A;  2NZH A;  4GNX C;  3A44 A;  4RXN A;  4A93 G;  3CME A;  3T1H Q;  1R0H A;  3PUZ A;  1PH1 A;  2KBN A;  3F1Z A;  1HZB A;  1KHI A;  1VQC A;  1T9Q A;  4O2D A;  4K9F A;  4JBJ A;  5FLM H;  4A3M G;  1HNW Q;  3F2B A;  2AWN A;  5IP7 H;  4JOI A;  1EIF A;  4DK3 C;  3RZT A;  1Y1V H;  1VQ9 A;  2ZM6 Q;  2R92 H;  1D7Q A;  2KHI A;  3K81 C;  1CKN B;  3NEM A;  5FLX c;  4PZ6 A;  1EYG A;  5IP9 G;  4GOP C;  1EIY B;  3MEF A;  2PNH A;  1IBM Q;  2JA5 G;  3G4S A;  4YCU A;  5C4J H;  2VS1 A;  1KQS A;  2ATW A;  3CCE A;  4BA1 I;  1E1O A;  1JJC B;  2F52 A;  2EQS A;  1X56 A;  3HKZ G;  3W1B A;  5IP7 G;  4B3R Q;  3PO2 H;  4RMF A;  2HQL A;  1RYT A;  4LF4 Q;  1Q46 A;  1EOV A;  1Y14 B;  3ERS X;  2K2D A;  2N78 A;  3KF6 A;  2UUA L;  1MJC A;  3D0F A;  3L0O A;  5HY6 A;  3CCL A;  1HNZ L;  2IHF A;  4JV5 Q;  2JE6 I;  3J81 j;  1C09 A;  2KKD A;  3KLW A;  1L1O B;  2RHQ B;  3CW2 C;  5ELO A;  4DV2 Q;  2K52 A;  4DV5 Q;  3H0G H;  2LXJ A;  1B2O A;  1K0R A;  1PH5 A;  3GDE A;  1VQH A;  1KIX A;  1Z47 A;  1CAD A;  1Q1E A;  3HOW H;  2ID0 A;  4DR2 Q;  1YNX A;  4X66 L;  3GTL H;  1VQA A;  1C0A A;  4HIO A;  1X54 A;  1SMU A;  3I4O A;  3RZO H;  1YI2 A;  4YCV A;  2WB1 G;  2OCE A;  2VQE Q;  2I0Q A;  3I4N G;  2UXD L;  3S1Q H;  3UE1 A;  1PYB A;  1PFS A;  3HOZ G;  1IRO A;  3SGI A;  1N34 Q;  1GKH A;  4IFD G;  1S30 A;  4QGU A;  3L7Z C;  4H02 A;  3OTO L;  2VW9 A;  1TWA H;  1LTL A;  1J6Q A;  3H3V I;  1UE6 A;  3U4Z A;  3HOU H;  2PI2 A;  1PH9 A;  1L1O C;  2DGY A;  5H1S E;  4DUZ L;  3K8A A;  4A3C G;  1PA6 A;  3UDF A;  1YHA A;  4JC0 A;  7RXN A;  2MO0 A;  4A3F H;  1OTC A;  4LUZ A;  1BQ9 A;  3T1Y L;  4JI6 Q;  3PF4 A;  1G51 A;  1E3P A;  2JEB I;  1YK4 A;  1WCM H;  4ME3 A;  2RCN A;  3RLN A;  4DR7 Q;  1NE3 A;  4UP8 A;  1JB7 A;  1I94 Q;  1VQF A;  5C0X G;  1RDG A;  4QIW E;  4GN4 B;  1YVC A;  2K14 A;  3MPS A;  4K0K Q;  3NBH B;  4YHH Q;  3CCM A;  2BA0 A;  4IJH A;  5C4X H;  4YWM A;  2MNA A;  1RB9 A;  4B3R L;  4A3L H;  3PV0 A;  1XPO A;  3NEL A;  1PVO A;  4BXX G;  1HH2 P;  4A3I H;  4DV0 L;  4A3D H;  4JI7 L;  2PQA A;  2JA9 A;  4UP7 A;  1IBL Q;  4GKJ Q;  1KRT A;  1IBK L;  5JJI A;  1TXY A;  2R7D A;  2XTI A;  3KJP A;  1BBU A;  4YWK A;  4POF A;  4A3J H;  1Q82 C;  1HZ9 A;  2OTL A;  2E2I H;  3HKS A;  2F3I A;  4DV4 L;  4DR2 L;  3PGZ A;  3KYW A;  1T9O A;  2XGT A;  3RNU A;  4B3S Q;  4JI4 Q;  1M1K C;  4HJ5 A;  2E2J H;  4OXP A;  4B3S L;  3STB C;  1PH2 A;  5LMN Q;  3KF8 B;  3HOY G;  1E24 A;  3CMA A;  1XTD A;  4DV5 L;  1VQI A;  1R0J A;  5J3B A;  1PH3 A;  1ASZ A;  4EQ5 A;  1KXL A;  4YY3 Q;  3RR5 A;  4APV A;  4BBR G;  4OX9 L;  4C2M H;  1LKP A;  2IX1 A;  1UEB A;  1B7Y B;  3EN2 A;  4BBS G;  4AIM A;  1VQL A;  3J81 i;  3HOX G;  4A3B G;  1Q86 C;  3PIP A;  4DV7 L;  1MJE A;  1VQG A;  1IL2 A;  3JAM i;  4XTC S;  3ULP A;  1QZG A;  4LUO A;  2C35 B;  3M3Y H;  4X62 Q;  4DV3 Q;  4HID A;  3JAM c;  3CPW A;  2UUB Q;  4R4T A;  2E5L L;  1I5F A;  1XNR Q;  1QCV A;  5M5X H;  1YUZ A;  3S15 H;  3TS2 A;  1UE1 A;  3FP9 A;  1YUX A;  1WI5 A;  5FLM G;  1FJG Q;  1N34 L;  3KFU A;  1SLJ A;  3KDF B;  4BY7 G;  1OXS C;  5FJ8 G;  1HR0 L;  2PQA B;  5E7N A;  4AQY Q;  4EX5 A;  2Q2I A;  2Q2T A;  2UXC Q;  1P8L A;  4XIG S;  5ELN A;  3CC4 A;  2PVE A;  1RIP A;  2ALY B;  2Z0S A;  1Q81 C;  1S3O A;  1YJN A;  1A63 A;  1NMF A;  1J5E L;  2BA1 A;  3D31 A;  4JI5 L;  4LNQ A;  3A5U A;  1B2J A;  3DM3 A;  1VQN A;  1IBL L;  5K36 G;  2OQ0 A;  5IT9 c;  4BY1 G;  4NXM Q;  4BY7 H;  4QQB X;  1WYD A;  4MZ9 A;  2NZO A;  1XNQ L;  3SS2 A;  3BZC A;  4R4C A;  1IU6 A;  2BH8 A;  5IWA L;  1JMC A;  5AJ3 Q;  5LMU L;  1VQ8 A;  1YV1 A;  3PWF A;  3HOV H;  1VQB A;  4FDB A;  2ZTC A;  3S24 A;  5IYB G;  3K7U C;  1HNZ Q;  1L2F A;  5GAE C;  2UUC Q;  4IFD J;  2UUA Q;  2GMG A;  2UUB L;  1LYL A;  4R1J A;  1X65 A;  2UU9 Q;  1YBY A;  3PSI A;  5IYC G;  1RL2 A;  1K9M C;  5BR8 Q;  3I55 A;  3M4O H;  1YHQ A;  2OQK A;  1X55 A;  2K5H A;  1N8R C;  2JJQ A;  3MXN B;  3A0J A;  3HOV G;  3NEN A;  4X65 Q;  2KCM A;  4HJA A;  1XNQ Q;  1IYJ B;  3RN5 A;  1OXT A;  4DR6 L;  1BKB A;  1E22 A;  4MTN A;  3ZJY C;  5IYB H;  3F2C A;  2AHO B;  4BBS H;  4LF4 L;  1XJV A;  4DV6 Q;  1Y1V G;  4NXN L;  5IYC H;  1MKH A;  1XMO Q;  2CFM A;  4NXN Q;  4UY8 C;  5IP9 H;  3GTM H;  2UXB Q;  1HJP A;  2GVA A;  3GTG H;  1W3S A;  2LXK A;  4GN5 A;  4AYB G;  1S40 A;  3HKZ E;  1D8L A;  5AI3 A;  1EQQ A;  6RXN A;  4HIK A;  3RZ6 A;  1EWI A;  5C44 H;  1VQ5 A;  3I4M G;  1T9H A;  1E8J A;  4X65 L;  3S16 H;  1HZA A;  4KHZ A;  1YIJ A;  3AEV A;  3H3V H;  4A3C H;  2JK8 A;  4A3E G;  2AKW B;  4MNO A;  4JI2 Q;  1XMQ Q;  4LFC Q;  3JC6 2;  2KCT A;  1UE5 A;  5C3E G;  4OON A;  1TWF H;  3KYY A;  1JT8 A;  1I6H H;  4DV3 L;  4X62 L;  4HJ8 A;  4BA2 I;  4GOP B;  1HR0 W;  4L5S A;  2F4V Q;  3CP0 A;  4OO1 I;  1KL9 A;  1PHJ A;  1N32 L;  2PI2 E;  4TVA B;  3L2P A;  4HJ7 A;  4BXX H;  1N32 Q;  2I5M X;  1E1T A;  4KLK A;  4GLA C;  1A8V A;  2E8G A;  5IWA Q;  4A3E H;  3W5O A;  2EXD A;  1T9P A;  3S14 H;  5C3E H;  5M5Y H;  2IT1 A;  1PYS B;  4A3D G;  1FGU A;  4LFB Q;  1B70 B;  1HNX Q;  5EAY A;  3ER0 A;  1WFQ A;  1YK5 A;  1KRS A;  5GQO A;  2CWA A;  2K4K A;  3QVD A;  1CSP A;  4KHP Q;  2F4V L;  3I2Z A;  3RZD H;  8RXN A;  4JI5 Q;  2N8N A;  3JC6 3;  3GTQ H;  1SRU A;  1A0I A;  1VS0 A;  5IY0 A;  3KJO A;  2NVQ H;  3PUV A;  1XMQ L;  4JI2 L;  4PZ8 A;  4HIM A;  3F2D A;  4YWL A;  1VQ6 A;  1AH9 A;  3HOU G;  1ZRP A;  1BE7 A;  2MFI A;  3S2D H;  4QJF A;  4LF5 L;  3CC2 A;  4AR6 A;  4IOA A;  1XNR L;  4DV0 Q;  2ASB A;  2JA7 H;  4DR1 L;  5C0X J;  1QVC A;  4BBR H;  3PO3 H;  1CUK A;  1X3F A;  2K75 A;  5M3F G;  3RN2 A;  4A3F G;  5JEA G;  5BR8 L;  2JQO A;  3T1H L;  1H95 A;  1Y1W G;  3G6E A;  3UDI A;  1V1Q A;  4PZ7 A;  3GTJ H;  4IPG A;  1SRO A;  2ZJR A;  1FHM A;  3PZA A;  1YHB A;  4DKA C;  3CXC A;  3EBE A;  5C44 G;  4DV7 Q;  2CKZ B;  4AR3 A;  1FVI A;  1X3E A;  2YTX A;  3KDF A;  3DLL A;  4A76 A;  3VDY A;  2HHH L;  4B3M L;  3WWV A;  3PO3 G;  4QY7 A;  1NTG A;  1VQO A;  3E9I A;  2YYZ A;  3CAM A;  3ICE A;  3S1M H;  5M3M H;  4GLV B;  1Y1W H;  2VNU D;  4YY3 L;  2WFW A;  1EUJ A;  2WAQ E;  2KHJ A;  4JG2 A;  4HJ9 A;  1N36 L;  1BBW A;  2E2H H;  3HFZ B;  4DR5 Q;  1SMM A;  3AFP A;  2D0O A;  1YJW A;  4UP9 A;  3CQZ H;  2ZTD A;  4LF6 L;  1AE2 A;  5AJ3 L;  5LMU Q;  5IYD H;  1MIU A;  3TQY A;  2B29 A;  2VQF Q;  1P16 A;  4B3T L;  1BRF A;  3FKI G;  1H7V A;  1TWC H;  1FHH A;  3KYX A;  3KF6 B;  5M3M G;  1CKM A;  2VQE L;  1LUZ A;  4RG1 A;  2JA6 G;  2N49 A;  4IPC A;  3RLO A;  1N33 L;  1N33 Q;  2MS3 A;  1VQ7 A;  3M85 A;  3J80 c;  2I5L X;  1QZH A;  1X6O A;  1CAA A;  4A3G H;  1I94 L;  3TRE A;  2WAQ G;  4AQY L;  1I3Q H;  2VZA A;  4LW1 A;  2JA8 H;  2R93 G;  4YHH L;  1K83 H;  3S17 H;  3HOX H;  1WOC A;  4DV6 L;  1HNX L;  3J7A 5;  2Q2H A;  3K0X A;  1XPR A;  4GKK Q;  1RWD A;  3PF5 A;  2BH2 A;  1VQK A;  4GOP A;  3TS0 A;  4P74 A;  1B71 A;  1G6P A;  1TWG H;  4ALP A;  4A3G G;  3K7A H;  4A3K G;  1CSQ A;  1NY4 A;  1DGS A;  4DUZ Q;  4WJ3 M;  3Q8D A;  4QL5 A;  4PMW A;  1GD7 A;  2WB1 E;  1G29 1;  2I5H A;  5FJ8 H;  4AR5 A;  1VCI A;  1BVS A;  2UUC L;  2NVT H;  2Y0S G;  4LF5 Q;  3W1G A;  1QVF A;  2D0P A;  4C3I H;  1ASY A;  3S1N H;  3GD7 A;  1R9T H;  4DAM A;  2CWP A;  1TWH H;  1UE7 A;  4LF9 L;  4LF9 Q;  3CCJ A;  1WJJ A;  4DR1 Q;  3I4M H;  1IBK Q;  3AFQ A;  3ULL A;  1YZ6 A;  2A19 A;  2RHS B;  4A3M H;  4NXM L;  1W2B A;  4JI8 Q;  3A5Z B;  4LWC A;  1DVB A;  2FXQ A;  3I7F A;  2LSS A;  1GO3 E;  4AH6 A;  1SFO H;  2R92 G;  4JI4 L;  3RLF A;  4LF6 Q;  4C3J H;  1GVP A;  4DV4 Q;  4JCV E;  1LKM A;  2NN6 G;  5GAD C;  1PH7 A;  1C7Y A;  2JA5 H;  2QEX A;  1NNQ A;  4DNI A;  5GAG C;  1JJG A;  3H15 A;  4GKJ L;  1I50 H;  1K8A C;  1VQJ A;  2HIX A;  2B63 G;  4GS3 A;  1KD1 C;  1A62 A;  1NMG A;  2ZTE A;  3PUX A;  4IPD A;  4DK6 C;  5IE8 A;  4A75 A;  1Q7Y C;  5LMN W;  3OYY A;  4IOC A;  5JEA J;  4WJ4 A;  4GNX B;  2Z6K C;  2V3B B;  1V43 A;  1QUQ A;  4JI0 L;  4JYA Q;  1E7Z A;  2H5X A;  1QUQ B;  2A8V A;  2PVX A;  1SN8 A;  1QVG A;  4JI0 Q;  4JYA L;  1BQ8 A;  2CCZ A;  3CCV A;  1V9P A;  3E0E A;  2JA8 G;  1IBM L;  4JBM A;  3J80 i;  1U0L A;  3PIO A;  3T1Y Q;  4JI6 L;  1RDV A;  1SR3 A;  4P71 A;  3J7Z C;  1K3R A;  2GVB A;  2PYA A; 
#chains in the Genus database with same CATH topology
 3E3X A;  4WJW A;  1D2B A;  2KJX A;  1IKM A;  1JR0 D;  1VQD A;  2NB0 A;  4JBW A;  4PG3 A;  1SMX A;  1Z92 B;  1FL0 A;  2HCC A;  4DR4 L;  3PIO 1;  4AYB B;  2JYO A;  4NMZ A;  2AQC A;  1G91 A;  2RDV A;  5DNF A;  2RQX A;  1YIT A;  4KY6 A;  3U50 C;  4LF8 Q;  5C4X B;  2DUD A;  2NVY B;  3Q22 A;  4IO9 A;  5M5W B;  4OWW B;  3GTP H;  3VPB E;  4KD3 A;  5JPM C;  2K50 A;  2AMC B;  2X6L A;  4DV2 L;  1Q1B A;  1NR4 A;  1S72 A;  5EPL A;  1L0W A;  4G7Z C;  1R0F A;  5I6Y A;  3SVM A;  3I73 A;  4B8C D;  4IUV A;  1CKN A;  3PUY A;  2ZM6 L;  2EXZ A;  1EY8 A;  4B3T Q;  4OO1 H;  1B44 D;  2QF7 A;  2VQF L;  1BCP B;  4MIU A;  1JYB A;  2B3G A;  4P73 A;  4YIJ A;  5D3D A;  4RFB A;  4EQP A;  5KND A;  1Y69 U;  3U4V A;  2JA7 G;  4GLX A;  3S2H H;  3X3M A;  1U4L A;  2CR8 A;  5JEA H;  5JJZ A;  2PMZ E;  1B8A A;  3SEB A;  3T56 B;  5M9O A;  4AHY A;  4BBS B;  1SYD A;  5JJK A;  3IU3 I;  3M4P A;  2C6A A;  5AI2 A;  3M4Y A;  3BG3 A;  4DNT B;  3CCU A;  2D62 A;  2HHH Q;  3TRZ A;  4A93 H;  4LFA Q;  3K5L A;  1VZI A;  1Y1W B;  3D3R A;  4A4I A;  2GN5 A;  4IUN A;  4C2M 1;  5I2Y A;  3D8G A;  2R6G A;  4DXF A;  3IKJ A;  1EFW A;  2O2L D;  5MF6 A;  3QIA A;  3K0Y A;  1TWF L;  1DCZ A;  4ZKC B;  3MXN A;  3DEP A;  4OWT B;  1QG7 A;  1VQM A;  1STB A;  1NJI C;  1JJ2 A;  4GNX A;  1STA A;  1VQP A;  1KAB A;  4L6T B;  1SYC A;  1S24 A;  3UDX A;  1B4O A;  4U68 A;  3OTO Q;  4LUV A;  2RSO A;  1IW7 D;  3D4R A;  3BDC A;  2MQH A;  3J7Y W;  4AHX A;  1HPC A;  4ID6 A;  2E2I B;  5C5L A;  3HOY H;  1UWV A;  2ES2 A;  4HTH A;  1BUV T;  3S9W A;  4FF2 A;  1M90 C;  3ZG6 A;  3BU2 A;  4JV5 L;  4JOI C;  2OWO A;  4K5X A;  5DLQ E;  4L63 B;  1SAP A;  2N3S A;  1TWG L;  4A3G B;  1TY0 A;  3CME A;  1DJR D;  1R0H A;  4S3S A;  1T9Q A;  3QG1 A;  4E6Y A;  1OO9 B;  3KF8 A;  2K6A A;  4JOI A;  3A8I E;  2R92 H;  3LWO B;  2F0L A;  5EGT A;  2F0U A;  1PZJ D;  1EYG A;  4GOP C;  1IBM Q;  1S5D D;  3G4S A;  3J7Z 1;  2NVY L;  5M5W L;  5C4J H;  3S1M B;  3LNL A;  1WJV A;  4N8F A;  2VS1 A;  4ZK9 B;  1O80 A;  2L55 A;  3W1B A;  2QEJ C;  5IP7 G;  5CBA E;  4B3R Q;  4RMF A;  4XT3 B;  2Z8L A;  4X3U A;  4LF4 Q;  1Q46 A;  1EOV A;  3GTL L;  1QJO A;  3ERS X;  3L0O A;  2EJF C;  2JE6 I;  3J81 j;  1C09 A;  3CQZ L;  3KLW A;  2F0E A;  3CW2 C;  5A2Q L;  4FNF A;  4DV2 Q;  3C1E A;  2LXJ A;  4OHJ A;  2KEE A;  1B2O A;  5IYC L;  1Q1E A;  3E5S A;  2F0G A;  1P7P A;  4V19 6;  4DR2 Q;  3GTL H;  1TKW B;  2XRQ D;  1X54 A;  3I4O A;  3PO2 L;  4Q0F A;  1YI2 A;  2VUM B;  2WB1 G;  2VQE Q;  3G7L A;  3V05 A;  1IRO A;  5ELD A;  1Y1W L;  3L7Z C;  4H02 A;  1WTX A;  2EY6 A;  4JAF A;  3OSO A;  1S5F D;  3U4Z A;  2DGY A;  2Q8R E;  2RSN A;  3OMG A;  1EY0 A;  1II3 A;  4IAL A;  4JC0 A;  3UDF A;  3JAM L;  4LUZ A;  1HXY D;  1DZ1 A;  3GTQ L;  2L4N A;  1ZYR D;  1EEI D;  1E3P A;  4DR7 Q;  1TWH L;  4UP8 A;  1JB7 A;  1GHK A;  4C3I L;  3SK5 A;  5C0X G;  4LHL A;  4QIW E;  2IW3 A;  2RCF A;  5C4X H;  1TS3 A;  4YWM A;  1QIL A;  2O5J D;  4A3K L;  2F0I A;  2XWJ B;  3PKI A;  4DV0 L;  1PRT C;  2R7D A;  2XTI A;  4R8I A;  4AI0 A;  3CHB D;  5FO8 B;  4YWK A;  4RGO S;  1Q82 C;  1HZ9 A;  1ET6 A;  2E2I H;  3HKS A;  4Y7N B;  4Z9C B;  4DV4 L;  1T9O A;  1SYE A;  3RNU A;  5DM7 3;  5FO9 B;  4OXP A;  5LMN Q;  1SMY C;  1XTD A;  1A3V A;  4YY3 Q;  3RR5 A;  4APV A;  4OX9 L;  3GTJ B;  1TWG B;  2IX1 A;  3EN2 A;  2G9H D;  4KTA A;  3K59 A;  1SJH D;  1F9R A;  1IL2 A;  3JAM i;  4LUO A;  3M3Y H;  1EOT A;  1TII D;  4XYO A;  5J1Z A;  1QCV A;  3C3L A;  1YUZ A;  1V8Q A;  3TS2 A;  1CZW A;  1UE1 A;  1WI5 A;  3S1M L;  1EFI D;  3HRZ C;  1S4Z A;  1PZX A;  3VR5 A;  3LWP B;  4XIG S;  3PIO 3;  1A63 A;  1YJN A;  3L9A X;  3PKJ A;  1ENA A;  1VF5 C;  5I9O A;  3VR2 A;  3A5U A;  1IBL L;  3MFY A;  4MZ9 A;  1XNQ L;  5IWA L;  1IU6 A;  2BH8 A;  5AJ3 Q;  1YV1 A;  4ZLT F;  1IYV A;  1DON A;  1QNK A;  2N55 A;  3K7U C;  1L2F A;  5GAE C;  1LYL A;  4QIW B;  1G2T A;  4XGH A;  5LHY 1;  3NBI A;  2F0F A;  5LL6 S;  1GUT A;  3HOY B;  3I55 A;  1I4Q A;  4C2M B;  2OQK A;  3S1Q L;  3T13 A;  1N8R C;  3MXN B;  3M3Y L;  4HJA A;  1XNQ Q;  4ZYS A;  2L11 A;  3RN5 A;  4MTN A;  1E22 A;  3ZJY C;  1VMC A;  2AHO B;  3VA7 A;  3MVV A;  4DXG A;  4L8J A;  4KN7 C;  1LTI D;  4FF1 A;  2PW5 A;  5K5P A;  2UXB Q;  4NXN Q;  1HJP A;  2OF1 A;  4GN5 A;  5E4W C;  3HKZ E;  6RXN A;  1DXM A;  2RDH A;  1VQ5 A;  1PTO C;  4H7B A;  5F2D A;  1MD2 D;  1F2M A;  3MHB A;  1YIJ A;  3PO3 B;  4JI2 Q;  1HFG A;  3GTK B;  1UE5 A;  2KCT A;  4HMJ A;  4AHZ A;  1MGS A;  5EQ0 A;  3TSS A;  1KDA A;  2VB2 X;  4BA2 I;  4L5S A;  2F4V Q;  3CP0 A;  3URY A;  4IUP A;  4TVA B;  3AMU A;  1DOL A;  1EY4 A;  1A8V A;  4A3E H;  3W5O A;  2EXD A;  1T9P A;  5CGK A;  3S14 H;  4BY1 B;  1I6V C;  2A68 C;  1SJE D;  2AUS B;  5EAY A;  5FLM L;  1YK5 A;  5GQO A;  2K4K A;  2NBF A;  4V0B A;  2F4V L;  5ELE A;  8RXN A;  3I4M L;  3T16 A;  1SRU A;  2NVQ H;  3MEH A;  2JA5 L;  4HIM A;  1JE4 A;  1AH9 A;  3HOU G;  3X3N A;  1ET9 A;  1LTS D;  4QJF A;  2B2V A;  4AR6 A;  3PO3 H;  3OPO A;  2A6H D;  1AFP A;  2K75 A;  1TS4 A;  4OIJ A;  4IQZ A;  3DM1 A;  3JR7 A;  3I91 A;  3TDQ A;  5C0X H;  1FVI A;  2MP1 A;  3KDF A;  4A76 A;  5D65 A;  3P2A A;  4N9P A;  4NKL A;  4A3E B;  2NZ1 D;  1JC7 A;  3VA5 A;  2BDO A;  3ICE A;  2WIN B;  1Y1W H;  1Z6H A;  2E2H H;  1JOR A;  1ENF A;  1BBW A;  2AQ2 B;  5KIX A;  4ZKB B;  2ZTD A;  4F88 A;  4CKB A;  1RCV D;  2DY7 A;  5IYD L;  3TQY A;  2SOB A;  3MAQ A;  2B63 B;  1TWC H;  1H9K A;  2VQE L;  1CKM A;  3RLO A;  4IPC A;  3S1R B;  1KNA A;  3PL5 A;  5JOB A;  2E2H L;  4N9T A;  5C4J L;  2KVM A;  1DOM A;  3GTM L;  5IP9 L;  3I90 A;  4DF7 A;  2K5D A;  5COY A;  1CAA A;  5CV4 A;  3SK4 A;  1I3Q H;  4DV6 L;  3K7A B;  5M5X B;  1RWD A;  3Q24 A;  3PF5 A;  1VQK A;  2WAC A;  3R2I A;  5BN3 A;  4GOP A;  1GUO A;  2F0D A;  1B71 A;  1TWG H;  1CSQ A;  3KBG A;  4A3B L;  4FYD A;  1Q8I A;  3DWP A;  1Q90 A;  2F0O A;  2I5H A;  1K0S A;  2J4X A;  1VCI A;  1BVS A;  4LF5 Q;  3D4D A;  1T5E A;  3TN2 A;  1UEA B;  4IFD J;  3MTS A;  4DAM A;  2B8F A;  1TWH H;  2CWP A;  1A2U A;  4LF9 L;  3NXW A;  1IBK Q;  2A19 A;  4XQJ A;  1Z7T A;  4NXM L;  4H13 C;  3DHQ A;  1W2B A;  1DVB A;  5CMD A;  2FXQ A;  2R92 G;  4FF3 A;  1SFO H;  3KLS A;  4LF6 Q;  5DEH A;  3NHH A;  1LKM A;  2Z3Q B;  2NN6 G;  2XSC A;  1NNQ A;  2K04 A;  1NNX A;  3CQZ B;  4DFA A;  3MQK B;  2QDB A;  2F0K A;  1CTM A;  1K3B C;  1VQJ A;  2HIX A;  3A56 A;  4IN3 A;  1KD1 C;  2B63 G;  1NMG A;  5CV7 A;  5LMN W;  4IOC A;  3TP5 A;  5JEA J;  4WJ4 A;  4G6B A;  5C4H A;  2NWG A;  2M2L A;  4XQN A;  4JI0 L;  1E7Z A;  2H5X A;  2A8V A;  2JA8 L;  1AN8 A;  1HQM C;  4JI0 Q;  1I3Q L;  2YU9 L;  1KDC A;  1QVG A;  2CCZ A;  2MGS A;  1V9P A;  3CCV A;  1CHQ D;  3J80 i;  2F0W A;  1RDV A;  1K3R A;  4K6D A;  3GTG L;  1STY A;  1KAW A;  5MLC 3;  1R0I A;  1HNW L;  2B2T A;  3HKZ P;  2A6E C;  3I4L A;  2FHT A;  4JPB W;  1PFM A;  3FRP B;  4L5R C;  4N8X 1;  1KLG D;  4G7H C;  4O0A A;  3H9B A;  4A3C L;  2F0Q A;  4JW0 A;  5M3F H;  2UXC L;  1HTP A;  4X3K A;  4CDF C;  4A3J L;  4KHP L;  3UDG A;  2UXB L;  2F0S A;  3OIP A;  1AZP A;  3S2H L;  2UXD Q;  2AUK A;  3S15 B;  4DR3 Q;  4TSS A;  3LGJ A;  4OEL B;  2KEN A;  5A2Q E;  3H3V M;  4C56 C;  1FR3 A;  2QGQ A;  2F0N A;  2EIF A;  4AI1 A;  1NXG A;  2Y0S E;  4RA8 A;  1EEF D;  4HN7 A;  3EIV A;  2SNM A;  4OO1 G;  4LFA L;  1OXV A;  3H91 A;  3B6Y A;  3RZD B;  3F8T A;  2B2T C;  4CJ2 C;  5IIF A;  3S1R L;  1FNU A;  1TWC B;  2XJV A;  3P75 A;  5IYD G;  4C3H L;  4A3D B;  1SNQ A;  5HGQ A;  1I6H B;  3K80 C;  4HMI A;  1JOO A;  5JVH 3;  1D5Z C;  2CH4 W;  1GUW A;  3BYT B;  2NVQ B;  4AR4 A;  4P72 A;  3IFD A;  1PH4 A;  1LKO A;  3J7Z C;  1PTO D;  5M5X L;  2EZV A;  1IU5 A;  1OXU A;  3M4Q A;  1YJ9 A;  2L1B A;  2HIV A;  2J0T D;  3A8J E;  1Q8K A;  3HOX L;  3FPP A;  4UPA A;  2WP8 J;  1E2W A;  1RJT A;  3NK9 A;  4B3M Q;  1VQE A;  2QCP X;  3GP7 A;  2ERJ A;  1S2Z A;  1O7Z A;  3HGB A;  4TQU S;  4A3B B;  3IRB A;  1B13 A;  5ELB A;  1DOK A;  4LAA A;  2C6B A;  1C48 A;  3HP3 A;  1EQR A;  2XNA C;  3W2D A;  3M7N A;  4LF8 L;  2XJR A;  4LFC L;  2JI2 A;  2M4Y A;  1JE5 A;  4KHV A;  4YCW A;  4F8M A;  3TZU A;  4KN4 C;  4A3L G;  3IL8 A;  1SDF A;  4GKK L;  1BFY A;  3T53 B;  4DR4 Q;  3CF5 A;  1I4P A;  4JI3 Q;  4A3I G;  3PO2 G;  2V0F A;  2NVY H;  5M5W H;  3OW2 A;  3DWA A;  4BS9 A;  2KCC A;  4ZN1 B;  4JI8 L;  4RGT A;  1HR0 Q;  2M9V A;  2OTJ A;  3FDJ A;  2A1A A;  1GOZ A;  3FKI B;  3GTL B;  3HJY B;  2JA6 B;  3I56 A;  5I2X A;  1SFO L;  3KOJ A;  1KLU D;  3HOW B;  2PW7 A;  2WII B;  2E5L Q;  1I3Q B;  4BY1 H;  4Y52 H;  3UE0 A;  5GAH c;  1JB3 A;  1Q12 A;  2HT1 A;  4MHE A;  2F0H A;  1IRN A;  2QL0 A;  3U58 A;  3CCQ A;  1VQ4 A;  1G8Z D;  4DUY L;  2VUM G;  5C4X L;  4JI1 Q;  4DV1 L;  4ZUJ A;  1C8C A;  4JK1 C;  4JBK A;  3CPF A;  1B9N A;  3NQI A;  2M6P A;  4GNX C;  4RXN A;  4Y52 L;  3PUZ A;  1PH1 A;  2KBN A;  5CV6 A;  1QB5 D;  3TP7 A;  1VQC A;  2RDF A;  4C3J B;  2AWN A;  1EIF A;  4DK3 C;  1CZG A;  4IUU A;  4M8A A;  5C3E L;  4K5W A;  1CKN B;  4PZ6 A;  3MXP A;  4JVZ A;  2PNH A;  3VYT A;  2DJF C;  3QOL A;  4BA1 I;  1E1O A;  1PZI D;  2NVT B;  5CV8 A;  4JAD A;  3PO2 H;  1Y14 B;  1V1P A;  2N78 A;  3LWQ B;  1SYF A;  2B2W A;  3D0F A;  2UUA L;  4FVM A;  3C2P A;  4RH6 A;  1HA5 A;  2KA7 A;  5ELO A;  1TS5 A;  2LKV A;  2K33 A;  1Z47 A;  5G3L D;  2ZXO A;  2PZT A;  2E2J L;  3S14 B;  4NDX A;  1C0A A;  1TQO A;  5CV9 A;  3P8B A;  5IT9 E;  3I4N G;  5KYI A;  3HOZ G;  2Z4I A;  4IFD G;  1S5B D;  3OTO L;  5M3M L;  3RMH A;  2FMC A;  2JP1 A;  3MXU A;  3S2D L;  2PI2 A;  1ROD A;  5H1S E;  3K8A A;  5C3W A;  4WFN 1;  1W6J A;  7RXN A;  2MO0 A;  4A3F H;  1OTC A;  1HRJ A;  2L0Z A;  3NFP I;  1G51 A;  2JEB I;  1TWF B;  1ZXT A;  5KEE A;  1NE3 A;  1SNO A;  4BBR L;  1I94 Q;  3NWT A;  1YVC A;  3MPS A;  3CCM A;  1D5X C;  2BA0 A;  2MNA A;  4A3L H;  3PV0 A;  2QDL A;  3NEL A;  5BN4 A;  4A3D H;  2PQA A;  3DWQ A;  2BCO A;  1IKL A;  1O78 A;  1SFO B;  5JJI A;  5FK9 C;  4GKJ Q;  4C1N K;  4POF A;  3E6Z X;  4DR2 L;  4HR7 B;  4HJ5 A;  2H1E A;  1PH2 A;  1VF7 A;  3KF8 B;  2R7Z L;  1G2S A;  1NR2 A;  3CMA A;  4DV5 L;  5J3B A;  4EQ5 A;  1KXL A;  1BCP F;  3H94 A;  4PMC A;  1PTO B;  1B7Y B;  1UEB A;  4ODG A;  3M3Y B;  4DK1 A;  3A54 A;  4BBS G;  1VQL A;  1CK1 A;  4G7O C;  3HOX G;  3H97 A;  1B53 A;  4KKU A;  1QZG A;  4J8Q A;  4DAP A;  4R8N A;  2E2I L;  5E3F A;  3JAM c;  2F3W A;  3CPW A;  1XNR Q;  2G5D A;  2Y0S B;  3PQI A;  5M5X H;  1BF4 A;  5I6W A;  3FP9 A;  4OGQ C;  2NVX B;  4ME5 A;  3KLR A;  2HQE A;  1FJG Q;  1LT6 D;  2BE5 D;  1N34 L;  3KFU A;  4IUT A;  2EYJ A;  1HR0 L;  5E7N A;  4AQY Q;  2APO B;  3KBX A;  2R92 B;  2UXC Q;  1P8L A;  5ELN A;  2ALY B;  2QKI C;  1Q81 C;  1LTB D;  3NTI A;  1J5E L;  3D31 A;  4JI5 L;  3A7L A;  3A55 A;  5K36 G;  4X3T A;  4BY7 H;  1WYD A;  4RKB A;  1OWC A;  4IUR A;  4R4C A;  1WTQ A;  1YNN D;  5LMU L;  1VQ8 A;  2B2U A;  1VQB A;  3S17 B;  2ZTC A;  3S24 A;  1HNZ Q;  5KRU A;  2GMG A;  2UUB L;  5EBC A;  5EKK A;  1X65 A;  3PSI A;  2XN9 C;  1X32 A;  2VXW A;  1K9M C;  5BR8 Q;  1PFB A;  4J1M A;  3K5O A;  2NUC A;  1HHV A;  2NYD A;  3HOV G;  3NEN A;  4DR6 L;  5EBD A;  1JOQ A;  4BBS H;  1CQF A;  2EYO A;  3S2D B;  5DM6 3;  4QUC A;  2PNR C;  2KOL A;  2CFM A;  2EY5 A;  5IGB A;  2GVA A;  3S15 L;  1SEB D;  4AYB P;  3FVQ A;  1MBY A;  4RHS A;  3RZ6 A;  1EWI A;  2NTT A;  3N6R A;  3K57 A;  3QWN A;  3S16 H;  1HZA A;  2EYL A;  2AKW B;  5EIO C;  4MNO A;  1ESF A;  2DY8 A;  5C3E G;  4BY7 B;  2EJM A;  1JT8 A;  1F2L A;  4DV3 L;  4X62 L;  3TP8 A;  1N32 L;  1PHJ A;  2JI3 A;  3L2P A;  4KKT A;  1N32 Q;  2I5M X;  1EYA A;  4KLK A;  3H09 A;  5C3E H;  5M5Y H;  2IT1 A;  4R9W A;  2FMM A;  1FGU A;  3T4A C;  3I70 A;  4ILW A;  1KRS A;  4U67 1;  4A3M L;  2DNC A;  4KHP Q;  3I2Z A;  3RZD H;  1WTO A;  2N8N A;  1PTO H;  1A0I A;  1EWH A;  4QCL A;  3GTO L;  1XMQ L;  4PZ8 A;  1VQ6 A;  2OT2 A;  1KNE A;  2MFI A;  1KAA A;  3CC2 A;  1XNR L;  4DV0 Q;  2JA7 H;  2B63 L;  1JWS D;  1CUK A;  5EPK A;  5BR8 L;  3T1H L;  1Y1W G;  3G6E A;  1V1Q A;  3GTJ H;  2ZJR A;  5FOB B;  2PMZ P;  5C44 G;  4DV7 Q;  1EIG A;  2YTX A;  1OWB A;  2R61 A;  3WWV A;  1VQO A;  4UY8 1;  3K7A L;  2VNU D;  2CQA A;  2WFW A;  4HJ9 A;  3J81 L;  3HFZ B;  4DR5 Q;  2RFK B;  5DM7 1;  3AFP A;  2RKS A;  5HUR A;  1YJW A;  5IT9 L;  4UP9 A;  4LF6 L;  3Q0A A;  2JXM B;  1MIU A;  3FDT A;  1NSN S;  1TR5 A;  1BRF A;  1H9J A;  2CW0 D;  3KF6 B;  1FHH A;  4H44 C;  3HOW L;  1FYC A;  4RG1 A;  2EYF A;  1N33 Q;  5JVG 1;  5D3I B;  3J80 L;  1STE A;  3LWU A;  3U9S A;  4A3G H;  3TP6 A;  2XJP A;  2WAQ G;  3CRL C;  1U4P A;  2JSO A;  2ZIX A;  1H9S B;  2JA8 B;  4YHH L;  1K83 H;  1AW7 A;  3HOX H;  1WOC A;  1XYI A;  1HNX L;  4RGM A;  3S1Q B;  1LTR D;  3EA6 A;  2EYP A;  3SE0 A;  3KLS X;  4P74 A;  1G6P A;  4A3G G;  3PMF A;  1BBX C;  5KNC A;  1DM0 B;  1NY4 A;  4DUZ Q;  2B39 A;  3Q8D A;  4QL5 A;  2WB1 E;  4C3H G;  4AR5 A;  4C3J G;  2UUC L;  5C44 B;  1ASY A;  3I3C A;  4BY7 L;  2LFN A;  1R9T H;  5C6A A;  3OHX C;  3CCJ A;  4DR1 Q;  1STH A;  3ERO A;  2IWH A;  4HSP A;  4ZCK A;  2RHS B;  3ULL A;  3GTK L;  1R9T L;  2A69 D;  4C3J H;  3CU7 A;  4X6A L;  1SE4 A;  3NBH A;  4JCV E;  5GAD C;  2L9H A;  1PH7 A;  1C7Y A;  3H3V C;  3HOU L;  5JVH 1;  1JIC A;  5IGC A;  2QEX A;  1JJG A;  2ZXR A;  4PQX A;  1I50 H;  1EIH A;  2F3V A;  4DK6 C;  2PPB C;  2D2C C;  1F9Q A;  1ZEQ X;  3EFX D;  4BY1 L;  2KHS A;  4IPD A;  1Q7Y C;  4HAE A;  1NCV A;  1LAC A;  1I6H L;  2K5W A;  2V3B B;  1V43 A;  1A3U A;  2E2J B;  5GAG c;  1QUQ B;  1HUN A;  4B08 A;  3T1Y Q;  1SR3 A;  2PCF B;  1ODH A;  2HCI A;  2WB1 B;  2AUJ D;  4UDU C;  3R2T A;  4R4O A;  1PH8 A;  3AU7 A;  4AYB E;  2B5I D;  2P5Z X;  4PNY A;  2YU9 H;  3NQT A;  2ZJP A;  3I4N H;  1M4V A;  3IFT A;  5T1G A;  2Q2U A;  4LF7 Q;  3HOZ H;  2JEA I;  2VB3 X;  3S16 B;  5C0X I;  3KYU A;  3IAY A;  5CV5 A;  3I4M B;  1PH6 A;  3NUC A;  3BVM A;  3RD4 A;  4LJZ C;  2LCQ A;  3JC6 6;  1IZ6 A;  2QA4 A;  4X66 Q;  3LNN A;  2VY3 A;  3NP8 A;  2KCN A;  1F77 A;  2CVR A;  2TMP A;  1BXT A;  5IP7 L;  1VZG A;  3CD6 A;  2KQ3 A;  4JAG A;  1C4Q A;  2AQ1 B;  3KYH C;  3VDY A;  3CCR A;  2UU9 L;  2YTY A;  1SMW A;  4R4Q A;  1O7I A;  1NXE A;  1X3Q A;  1BR9 A;  4P75 A;  1Y8P B;  3OOC A;  2K5N A;  4I65 A;  1FNW A;  1K8M A;  5EKI A;  2JA6 L;  3H9C A;  4IUQ A;  1K73 C;  2HR5 A;  2I46 A;  2Z6K A;  4HCE A;  5LMN L;  3GTO H;  1QQT A;  1PRT D;  2KED A;  4OWX B;  1LAB A;  1S5C D;  2R7Z B;  1EQT A;  3S1R H;  2H4O A;  3VYS A;  1WTR A;  1K8G A;  1BOS A;  1D1I A;  2F03 A;  1FJG L;  2VUM H;  2M4V A;  3HOZ L;  2F0J A;  3AYH B;  1LTT D;  3U9O A;  5GAD c;  3GTP L;  1ONL A;  3GV6 A;  4JI1 L;  4DV1 Q;  3R8B A;  1WD1 A;  2KN9 A;  3QJY A;  2VL6 A;  3P20 A;  1CM9 A;  1N36 Q;  2RF4 A;  1RHP A;  5CR3 A;  2B8G A;  1U4M A;  2V4D A;  1K28 A;  3F2U A;  2F0M A;  2V1C C;  1WCM G;  1DX8 A;  5I9P A;  3OIQ A;  1QCB D;  3E9H A;  4J15 A;  4ZUI A;  2ZJQ A;  2DSX A;  1W6K A;  4NPS A;  3D6W A;  5CBE E;  1QYB A;  5C4X G;  3KYV A;  3FEW X;  3FKI H;  5RXN A;  1BQQ T;  1LTA D;  1Z9F A;  4JI3 L;  2NN6 I;  5JPN C;  1PV4 A;  1RF2 D;  1PYW D;  5K2M E;  1C9O A;  3HEJ A;  1EY9 A;  2R7Z H;  4NB3 A;  4CGY B;  5GAH C;  2SDF A;  2A6H C;  4DN4 M;  4K2K A;  4A3J G;  2F0P A;  4X64 Q;  2MO1 A;  1NBW A;  4LFB L;  2HUG A;  2R93 H;  1YEZ A;  4Y7N H;  3G48 A;  1A2T A;  1X3G A;  3AB9 A;  3FMC A;  4E6I A;  4JI7 Q;  1RD9 D;  3M4O L;  4G57 A;  3J81 c;  2R7Z G;  5EIN C;  4ZN3 B;  3PO3 L;  1HZC A;  2CHB D;  2E76 C;  4IPH A;  3LWE A;  2YU9 B;  2M00 A;  4K0K L;  1AP0 A;  4RHR A;  4A3K H;  3J81 E;  4X6A H;  4A3L L;  3I4N B;  2C5C A;  1VMP A;  2HD3 A;  3GO5 A;  3GTK H;  1VCX A;  1E0B A;  2NZH A;  2D5D A;  3UI2 A;  1LT5 D;  3F1Z A;  1HZB A;  4K9F A;  4JBJ A;  5FLM H;  4C3H B;  1YNN C;  3F2B A;  2PPT A;  5IP7 H;  2IJ0 A;  1Y1V H;  1IHZ A;  2ZM6 Q;  1VQ9 A;  3J80 E;  2KHI A;  1TY2 A;  4RCN A;  3S14 L;  4TKO B;  5FLX c;  1EIY B;  3MEF A;  2PZU A;  5ELF A;  1TWA B;  1D6E C;  4YCU A;  4RKL A;  1A3T A;  1EL0 A;  1KQS A;  2ATW A;  3CCE A;  1JJC B;  2F52 A;  2EQS A;  1MI2 A;  4A3I B;  2ZXP A;  5M3F L;  1I50 B;  1RYT A;  5T1I A;  3KF6 A;  1MJC A;  1B50 A;  3CCL A;  2IHF A;  4JV5 Q;  4A3J B;  1PLF A;  2RHQ B;  5IGG A;  3H0G H;  2E2D C;  3ZYY X;  1K0R A;  1PH5 A;  1KIX A;  3VR6 A;  3HOW H;  1R4P B;  4LHN A;  1EY5 A;  4K8I A;  1CI3 M;  4X66 L;  3CKI B;  4FO2 A;  1SYB A;  4HIO A;  1SMU A;  3MXG A;  3Q23 A;  4YCV A;  2OCE A;  3UE1 A;  1N34 Q;  1L0X B;  1GKH A;  3HOX B;  4A3F B;  3TME A;  1TWA H;  1LTL A;  1J6Q A;  3H3V I;  3S1N B;  4K8J A;  1EZ8 A;  4QUF A;  1L1O C;  2E75 C;  4DUZ L;  4RWS C;  4A3C G;  1PA6 A;  5CC4 A;  2NVQ L;  1YHA A;  2AQ3 B;  1RKN A;  1SE2 A;  1LT4 D;  4JI6 Q;  3GTM B;  1WCM L;  3PF4 A;  3WOE A;  3O13 A;  4O1N A;  1VQF A;  2DNE A;  4KV6 A;  4GN4 B;  4K0K Q;  2K14 A;  3NBH B;  4YHH Q;  3A8K E;  2HDM A;  1RB9 A;  5M5Y L;  1I4G A;  1ILP A;  1XPO A;  2MJ8 A;  4JI7 L;  1ZYR C;  2JA9 A;  2V0E A;  3DXJ C;  3D6C A;  1IBK L;  3CRK C;  3FKI L;  1BBU A;  2XJU A;  2Q8I B;  1XX8 A;  3KYW A;  3PGZ A;  4JI4 Q;  3S17 L;  2Z6B A;  2WAQ B;  3STB C;  4HED A;  4G4K A;  4HSV A;  4XT1 B;  3HOY G;  1E24 A;  5KNB A;  1VQI A;  3SK6 A;  4C2M H;  4NW2 A;  1LKP A;  4EGV A;  4KY5 A;  2PSM C;  1R4Q B;  1Q86 C;  1Y1V B;  3PIP A;  1MJE A;  1I4R A;  1LT3 D;  4HID A;  2UUB Q;  5C44 L;  2E5L L;  1I5F A;  1HQR D;  2XJT A;  4CJ1 B;  1YUX A;  5FLM G;  1SLJ A;  3K6O A;  5C3E B;  2O5I C;  4BY7 G;  1OXS C;  5FJ8 G;  2PQA B;  2TSS A;  2J7Z A;  3K58 A;  4Q5V A;  4XXB B;  3CC4 A;  1SYG A;  1S3O A;  2O4X A;  1NMF A;  2B2W C;  2BA1 A;  1PFW A;  4LNQ A;  5FKA C;  5IT9 c;  2LY7 A;  2NYZ D;  3J7A F;  4JAE A;  2EYM A;  1XXG A;  1ICF B;  3H0G B;  4I7Z C;  3PWF A;  1TS2 A;  4FDB A;  4DK0 A;  5IYB G;  2UUC Q;  2Y0S P;  1H9R A;  5CYU A;  2UU9 Q;  2QW7 A;  1YBY A;  1Y8N B;  5IYC G;  2OEO A;  4QMG A;  3SDZ A;  5FLX E;  3M4O H;  1YHQ A;  3GTO B;  2KCM A;  2Q8T A;  4BBR B;  1IYJ B;  2KEC A;  1OXT A;  2EY4 E;  3F2C A;  2MHV A;  4LF4 L;  4DV6 Q;  1Y1V G;  4NXN L;  5G3L F;  2Z9H A;  1MKH A;  1V1O A;  1XMO Q;  3QO2 A;  5IP9 H;  3GTM H;  2F0T A;  1W3S A;  1X3P A;  4A3M B;  1S40 A;  1D8L A;  4CDE C;  1E8J A;  4KHZ A;  3AEV A;  4A3C H;  4A3E G;  1XMQ Q;  2A6E D;  1GUN A;  3KYY A;  3NPP A;  1I6H H;  2CKC A;  1HR0 W;  5M5Y B;  4OO1 I;  4M1U B;  1EU3 A;  1WD0 A;  2PI2 E;  4GLA C;  2E8G A;  3FPU B;  2GA4 B;  4EQN A;  3MA2 B;  1A15 A;  4OEM B;  5TSS A;  2Z1C A;  3RZO B;  4LFB Q;  3ER0 A;  1WFQ A;  2CWA A;  5GAE c;  2PZW A;  1FD7 D;  4DNR B;  2K01 A;  4JI5 Q;  2ZT9 C;  3J7Y 1;  1QNU A;  2JA7 B;  4PMB A;  2R93 B;  5IY0 A;  3VYU A;  2L5T A;  2HVY C;  3PUV A;  2K28 A;  1YNJ D;  2G9D A;  5FJ8 L;  2A69 C;  3QQC E;  3F2D A;  2WB1 P;  1BE7 A;  5JVG 3;  4LF5 L;  3KUP A;  3SXH A;  4DR1 L;  1QVC A;  5IGF A;  3RN2 A;  4A3F G;  2EPB A;  5JEA G;  1ML0 D;  1B3A A;  4IPG A;  2EVB A;  4J6H A;  5D14 A;  2X69 A;  4DKA C;  3CXC A;  1K83 L;  3EBE A;  2CKZ B;  1X3E A;  4B3M L;  2K1B A;  4KD4 A;  2XVS A;  3E9I A;  2YYZ A;  3CAM A;  3N52 A;  3S1M H;  4GLV B;  5NUC A;  4JG2 A;  1EUJ A;  2KHJ A;  5EJW A;  1SMM A;  2WKD A;  1AE2 A;  3OWE B;  2J9U B;  5LMU Q;  3ND8 A;  2CW0 C;  2B29 A;  1SSO A;  1E2Z A;  1J9O A;  3FKI G;  5C5M A;  2OXP A;  1LUZ A;  2XIW A;  2JA6 G;  2N49 A;  1N33 L;  3HZX A;  1B9M A;  2MS3 A;  1VQ7 A;  1LTG D;  3M4O B;  4RCO A;  2I5L X;  1QZH A;  1PDQ A;  4KK7 A;  1I94 L;  4AQY L;  2VZA A;  2C9O A;  4KKS A;  2JA8 H;  2R92 L;  1UAP A;  3ONA B;  3S17 H;  2LMC B;  1EY6 A;  2DN8 A;  3J7A 5;  2Q2H A;  3DEO A;  1CT1 D;  4XXE A;  3DUZ A;  2EY2 A;  2B2V C;  5L37 A;  3HOU B;  4DAY A;  4F87 A;  2BH2 A;  4QB4 A;  1SMY D;  3K5M A;  1DYQ A;  1I4X A;  1AZQ A;  3B0A B;  4WJ3 M;  1GD7 A;  1G29 1;  4TVM A;  1NUC A;  2NVT H;  4MTK A;  2Y0S G;  2RVL A;  1QVF A;  2D0P A;  4DAV A;  4OIK A;  3S1N H;  3GD7 A;  1UE7 A;  3W3A A;  1LV9 A;  4HCS A;  3AFQ A;  1YZ6 A;  2WV6 D;  4JI8 Q;  4LWC A;  5EPJ A;  3ITP A;  4AH6 A;  4JI4 L;  1F2Y A;  3HKZ B;  1XTC D;  1TU2 B;  2JA5 H;  5BN5 A;  4QF4 A;  4DNI A;  4DA2 A;  5GAG C;  3H15 A;  4GKJ L;  4CDD C;  1K8A C;  5C3X A;  5M3M B;  1A62 A;  3PUX A;  5IE8 A;  4V19 0;  2XRS D;  3TZD A;  2Z6K C;  4GNX B;  4OL7 A;  2BOS A;  3LWV B;  4JYA Q;  3BVZ A;  4JYA L;  3E0E A;  2JA8 G;  1SBB B;  1IBM L;  4JBM A;  3PIO A;  4JI6 L;  3K35 A;  4X3S A;  4RAU C;  1H7V A;  2GVB A;  2PYA A;  4DR3 L;  1HFN A;  1R0G A;  1IXR A;  2IL8 A;  3E0J A;  3HOZ B;  4OX9 Q;  4IFD I;  1GJX A;  5ELC A;  4A93 L;  1WTP A;  2WAQ P;  1D1K A;  3CCS A;  2R7F A;  1MHW C;  1QOH A;  1S5E D;  4GZY C;  1CKO A;  1LLR D;  4UAI A;  3LX0 A;  2K5V A;  1BO0 A;  1GHJ A;  1XMO L;  4EQO A;  1F2Z A;  2YV5 A;  4IZ8 A;  1WCM B;  4B9X A;  2NVX H;  5IOC A;  4L5Q A;  3ERQ A;  3PCO B;  4K14 A;  1L1O A;  4KI0 A;  1SXT A;  1UUP A;  1STG A;  4BXX G;  3M7G A;  1SE8 A;  4AI3 A;  4DR6 Q;  3SR1 A;  1N9W A;  4DUY Q;  1EYD A;  3VR4 A;  4GS7 D;  2A68 D;  3PO2 B;  5LL6 X;  1PZK D;  2VUM L;  3FHW A;  3BVG A;  3G6J B;  5MFZ A;  1H9M A;  2B63 H;  4TPU A;  3OMC A;  3A74 A;  4XQQ A;  4X64 L;  1KC8 C;  3HOW G;  1LO5 D;  5GRO A;  2JA6 H;  2M6O A;  2IHE A;  1PFV A;  2L12 A;  4DPG A;  3NWS A;  3D4W A;  3PUW A;  5IGD A;  1J5E Q;  2NVX L;  1AEX A;  2BE5 C;  1A6X A;  3BZK A;  4DR5 L;  3RYG A;  2ENB A;  1PFU A;  1JOK A;  2IY5 B;  3ND9 A;  4CKC A;  2ICI A;  3G71 A;  2L15 A;  3M9B A;  3MSU A;  1HA6 A;  4POG A;  1IYU A;  4K6L A;  1GM5 A;  2YTV A;  4FXK C;  1JQY D;  2RA4 A;  2AWO A;  1TWH B;  1F4L A;  4C3I G;  1U5K A;  3A7A B;  3STB D;  2JA5 B;  3MC0 B;  3WWN B;  4LF7 L;  1ENC A;  1R9T B;  2WKC A;  2IPK D;  4L5T A;  4ZQ3 A;  1SNP A;  3BJU A;  3NE5 B;  4A3I L;  3C1F A;  3I8Z A;  1NAP A;  4GN3 B;  3TEH B;  3SK8 A;  2CQO A;  4XDX A;  5IGE A;  1HUM A;  2IX0 A;  5IYB L;  3V2T A;  1OXX K;  3H0G G;  3ULJ A;  4C1N I;  1XPU A;  4MN3 A;  4R4I A;  4IJL A;  3AQQ A;  1LM0 A;  4LMQ D;  4DAY B;  4RGN A;  1AE3 A;  4DR7 L;  3CC7 A;  2O5J C;  5JJL A;  3DMU A;  1EZ6 A;  4A3B H;  3HOV L;  2I07 B;  2PMZ B;  4C3H H;  1GUS A;  1X9N A;  3OWF A;  3A44 A;  1MSG A;  4A93 G;  3T1H Q;  4ULL A;  1KHI A;  3S1N L;  4Y7N L;  4O2D A;  4A3M G;  1HNW Q;  1EYC A;  5IOD A;  1F9P A;  1V1P B;  3RZT A;  1SND A;  2H12 A;  1D7Q A;  1ESR A;  3K81 C;  3MZ5 A;  3NEM A;  4ABN A;  3OW7 A;  5IP9 G;  4FF4 A;  4CJ0 B;  2JA5 G;  2K32 A;  4BXX L;  1M8A A;  4KY7 A;  2K5Q A;  1X56 A;  3HKZ G;  3R93 A;  1RTN A;  5K36 H;  2HQL A;  5I4D A;  2K2D A;  4LK1 C;  5HY6 A;  3V96 A;  1HNZ L;  1XWE A;  2KKD A;  3S16 L;  4A3G L;  1FNV A;  1PFN A;  1L1O B;  2K52 A;  4DV5 Q;  3H6M A;  1EY7 A;  3PIP 3;  5MFP A;  3GDE A;  1VQH A;  5H1S c;  1CAD A;  1F9S A;  2ID0 A;  1CFM A;  1YNX A;  1PFY A;  1I4H A;  1VQA A;  5AFW A;  3RZO H;  2I0Q A;  1U4R A;  4U67 3;  1D5M C;  1BNZ A;  3S1Q H;  5J39 A;  2UXD L;  1PYB A;  1QWY A;  1PFS A;  3VR3 A;  5FO7 B;  3SGI A;  2SNS A;  1S30 A;  4QGU A;  2K7V A;  5HGT A;  2VW9 A;  1UE6 A;  3HOU H;  5EKL A;  5FLX L;  1CQV A;  2E74 C;  1K8O A;  2F1M A;  1BQ9 A;  3T1Y L;  3HOY L;  1WCM H;  2RCN A;  1YK4 A;  4ME3 A;  2XWB B;  3RLN A;  3RUZ A;  2A5H A;  2K05 A;  3QB3 A;  3NTK A;  1RDG A;  4B9W A;  4B3R L;  4IJH A;  1O7L A;  1PVO A;  1HH2 P;  4A3I H;  3LPE B;  1JWU D;  3HJW B;  4UP7 A;  1IBL Q;  1SNM A;  1KRT A;  3QR8 A;  3R3O A;  1TXY A;  1PRT B;  3KJP A;  4A3J H;  2OTL A;  2F3I A;  2ERS A;  2XGT A;  4B3S Q;  1M1K C;  1Y8O B;  2E2J H;  4B3S L;  3WWL A;  3GTQ B;  4A3E L;  1VDZ A;  1R0J A;  1PH3 A;  1ASZ A;  3HOV B;  4DU9 A;  4BBR G;  2XJQ A;  3B08 B;  1J8I A;  1PTO F;  4AIM A;  1TWC L;  1RYQ A;  3J81 i;  3SHL A;  4A3B G;  4IFD H;  4DV7 L;  4BBS L;  4A3K B;  1UNS A;  1VQG A;  2FJ2 A;  3HAX C;  1U9R A;  4XTC S;  3ULP A;  5E4X A;  3NTH A;  2C35 B;  4X62 Q;  4DV3 Q;  4R4T A;  4QIW P;  1FGB D;  3S15 H;  4FXD A;  2A74 C;  4O42 A;  4CDC C;  3KDF B;  3MWY W;  4C3I B;  1VZH A;  3LWR B;  2KUM A;  1IL8 A;  4EX5 A;  2Q2I A;  2Q2T A;  3C46 A;  2F0V A;  2PVE A;  1RIP A;  2Z0S A;  3T51 B;  1EU4 A;  1QE6 A;  3TBI B;  3GTJ L;  2CH4 A;  1CHP D;  1B2J A;  3DM3 A;  1VQN A;  3P1H A;  2OQ0 A;  4NXM Q;  4BY1 G;  4QQB X;  1GXD C;  2NZO A;  4A3F L;  3SS2 A;  3BZC A;  1JMC A;  3HOV H;  2NN6 H;  4ZRZ A;  4EVO A;  4WFN 3;  5A35 A;  3KK7 A;  2UUA Q;  1ZKO A;  4R1J A;  1TWA L;  1JWM D;  1B2T A;  1ICW A;  2PO4 A;  2IX3 A;  1RL2 A;  3BZD B;  5MGN A;  1ILQ A;  2MPM A;  1GUG A;  2B2Y A;  1X55 A;  2K5H A;  2JJQ A;  3A0J A;  1STN A;  4X65 Q;  3NSW A;  1BKB A;  5IYB H;  3I72 A;  2EY1 A;  4WRD A;  3EQL C;  2BDN A;  1XJV A;  2B2Y C;  2MUY A;  5IYC H;  3GQB A;  4UY8 C;  1EQV A;  3GTG H;  2LXK A;  4AYB G;  2NTS A;  1O7Y A;  1EQQ A;  5AI3 A;  4HIK A;  3I4M G;  1JCK B;  3EJI A;  5C44 H;  1T9H A;  4X65 L;  2PYK A;  1HTL D;  3H3V H;  2JK8 A;  3BS1 A;  4LFC Q;  3JC6 2;  4OON A;  1TWF H;  4NP5 A;  3VYR A;  4HJ8 A;  1WTW A;  4FXG C;  4KJO A;  4GOP B;  4WOR A;  1KL9 A;  3P7J A;  5COR A;  5KYL A;  4HJ7 A;  4BXX H;  5DM6 1;  3GTP B;  1E1T A;  5DAU A;  2CKA A;  3BYY B;  5IWA Q;  3JAM E;  1G6Z A;  3H99 A;  2EJG C;  4KMU C;  1Y1V L;  4C3J L;  1PYS B;  4A3D G;  4CBV A;  1PRT F;  1B70 B;  1HNX Q;  1B1Z A;  4KJN A;  3QVD A;  1CSP A;  1WTV A;  1CA5 A;  3BDO A;  2JI1 A;  3S2H B;  3JC6 3;  3GTQ H;  5AN9 H;  1VS0 A;  3KJO A;  3HG9 A;  4CHT B;  4H0L C;  3GTG B;  1HCZ A;  1BCP D;  2NVT L;  4JI2 L;  1SE3 A;  4YWL A;  1ZRP A;  3EVQ A;  1PMR A;  3S2D H;  1L0Y B;  4IOA A;  1EWC A;  2ASB A;  1BDO A;  5KGU A;  5C0X J;  4BBR H;  2EYH A;  1X3F A;  2QIL A;  2F4I A;  2RBM A;  5M3F G;  1IW7 C;  1Q3L A;  2SEB D;  3RZD L;  2JQO A;  1H95 A;  3UDI A;  3HS0 C;  4PZ7 A;  4XYQ A;  1T5X D;  4BWG B;  1SRO A;  1FHM A;  3PZA A;  1YHB A;  4UHV A;  2L0C A;  2RDG A;  4AR3 A;  1PXU A;  3DLL A;  2HHH L;  2A73 B;  3PO3 G;  2FFK B;  4QY7 A;  1NTG A;  1MSH A;  2EDG A;  2Z3R B;  5E1F A;  1RDP D;  3K5N A;  5M3M H;  2D9U A;  3WDN A;  4YY3 L;  2WAQ E;  2FIN B;  1N36 L;  4DGZ A;  1SNC A;  2D0O A;  3CQZ H;  2PQE A;  4F7X A;  3I4N L;  5AJ3 L;  3Q6S A;  5IYD H;  2VQF Q;  1P16 A;  4B3T L;  1PH9 A;  5C4Z A;  3KYX A;  5M3M G;  2K03 A;  2XJS A;  3M85 A;  2DJG C;  3J80 c;  3H0G L;  2EOT A;  3GV3 A;  4AI2 A;  2B2U C;  4AHW A;  1CA6 A;  1X6O A;  1TT2 A;  3TRE A;  1H9S A;  4LW1 A;  2R93 G;  4ZAI A;  5ISR A;  2Z4H A;  3K0X A;  1XPR A;  4FP5 D;  1WVL A;  4GKK Q;  4TRD A;  3WOF A;  2AYJ A;  5JAV A;  1E2V A;  1TVX A;  4K2L A;  3TS0 A;  1B3Q A;  4ALP A;  4CKE A;  1I50 L;  5M3F B;  3K7A H;  4A3D L;  4A3K G;  4A93 B;  5J22 A;  2ICE C;  1DGS A;  1DD2 A;  3BDL A;  4PMW A;  5FJ8 H;  2JN4 A;  3PIP 1;  3W1G A;  3J7A V;  1YNJ C;  4C3I H;  1KTK A;  3L3O C;  4LF9 Q;  5C4J B;  1WJJ A;  3I4M H;  2EE1 A;  4A3M H;  3A5Z B;  2JA7 L;  2R93 L;  2LSS A;  1GO3 E;  3I7F A;  1KDB A;  3RLF A;  3QOJ A;  1BCP C;  1GVP A;  4PV1 C;  4DV4 Q;  4I7A A;  1RTO A;  2HDL A;  4P2C B;  4K5V A;  3MFG A;  4GS3 A;  2X6G A;  2ZTE A;  4A75 A;  2E2H B;  3OYY A;  3RZO L;  1QUQ A;  1K83 B;  2PVX A;  1SN8 A;  2N88 A;  2R3Z A;  1BQ8 A;  2LS0 1;  1U0L A;  4P71 A;  1WTH A; 
#chains in the Genus database with same CATH homology
 1R0G A;  1KAW A;  1IXR A;  4R4O A;  5MLC 3;  1R0I A;  1PH8 A;  4OX9 Q;  4IFD I;  1HNW L;  4AYB E;  2B5I D;  1VQD A;  2YU9 H;  3CCS A;  2R7F A;  4L5R C;  4JBW A;  4PG3 A;  2ZJP A;  1SMX A;  1CKO A;  1Z92 B;  4O0A A;  1FL0 A;  5M3F H;  2Q2U A;  4LF7 Q;  3I4N H;  4DR4 L;  3HOZ H;  3PIO 1;  2JEA I;  2UXC L;  2K5V A;  3UDG A;  1XMO L;  5C0X I;  3KYU A;  4KHP L;  2UXB L;  2UXD Q;  2RDV A;  2YV5 A;  1PH6 A;  4DR3 Q;  2NVX H;  4L5Q A;  3PCO B;  2LCQ A;  1L1O A;  1IZ6 A;  3JC6 6;  3LGJ A;  4KI0 A;  2QA4 A;  2KEN A;  1SE8 A;  3U50 C;  4AI3 A;  4X66 Q;  4LF8 Q;  2VY3 A;  4DR6 Q;  1N9W A;  4DUY Q;  2DUD A;  2QGQ A;  2EIF A;  1VZG A;  4AI1 A;  1NXG A;  4GS7 D;  2Y0S E;  4IO9 A;  4OWW B;  4JAG A;  3VPB E;  3CD6 A;  3GTP H;  3EIV A;  2A68 D;  4OO1 G;  4LFA L;  3FHW A;  2K50 A;  3KYH C;  3CCR A;  1OXV A;  2AMC B;  2YTY A;  1SMW A;  3B6Y A;  3F8T A;  4R4Q A;  4DV2 L;  2UU9 L;  1O7I A;  1Q1B A;  1NXE A;  5MFZ A;  2XJV A;  4P75 A;  2B63 H;  1S72 A;  5IYD G;  4TPU A;  1L0W A;  3A74 A;  2K5N A;  5HGQ A;  1R0F A;  3K80 C;  4X64 L;  4B8C D;  1KC8 C;  1CKN A;  3PUY A;  2ZM6 L;  3HOW G;  5GRO A;  1K73 C;  2HR5 A;  2JA6 H;  4B3T Q;  2M6O A;  2Z6K A;  5LMN L;  2IHE A;  2VQF L;  4DPG A;  3GTO H;  1JYB A;  2B3G A;  4AR4 A;  3PUW A;  4P73 A;  4OWX B;  4P72 A;  1J5E Q;  1PH4 A;  1LKO A;  3S1R H;  2JA7 G;  3U4V A;  4GLX A;  3S2H H;  3BZK A;  1K8G A;  4DR5 L;  3RYG A;  1IU5 A;  2CR8 A;  1OXU A;  3M4Q A;  1FJG L;  1YJ9 A;  2M4V A;  2HIV A;  2PMZ E;  3AYH B;  2VUM H;  2IY5 B;  5GAD c;  1B8A A;  1Q8K A;  4UPA A;  4JI1 L;  4DV1 Q;  4AHY A;  2WP8 J;  3G71 A;  5JJK A;  2L15 A;  3IU3 I;  3M9B A;  3M4P A;  2C6A A;  5AI2 A;  2HHH Q;  1VQE A;  3MSU A;  3CCU A;  2ERJ A;  1S2Z A;  2KN9 A;  4POG A;  2D62 A;  4TQU S;  4LFA Q;  4A93 H;  3IRB A;  1VZI A;  1B13 A;  4A4I A;  2GN5 A;  2VL6 A;  2C6B A;  1N36 Q;  1EQR A;  2RF4 A;  1GM5 A;  2YTV A;  2R6G A;  1EFW A;  3M7N A;  2V1C C;  4LF8 L;  5MF6 A;  2XJR A;  1DX8 A;  1WCM G;  2AWO A;  4LFC L;  2JI2 A;  2M4Y A;  1JE5 A;  3E9H A;  4J15 A;  4YCW A;  1U5K A;  3STB D;  2DSX A;  4OWT B;  1VQM A;  1NJI C;  1JJ2 A;  2ZJQ A;  4GNX A;  4NPS A;  1VQP A;  4A3L G;  1QYB A;  4GKK L;  5C4X G;  1S24 A;  3WWN B;  1BFY A;  3UDX A;  4LF7 L;  3KYV A;  3FKI H;  4DR4 Q;  5RXN A;  3CF5 A;  4L5T A;  1Z9F A;  4JI3 L;  2NN6 I;  4A3I G;  1PV4 A;  2V0F A;  4JI3 Q;  3PO2 G;  5K2M E;  1C9O A;  2NVY H;  5M5W H;  4LUV A;  3OTO Q;  3OW2 A;  3BJU A;  1IW7 D;  2R7Z H;  4NB3 A;  5GAH C;  4JI8 L;  4ZN1 B;  4GN3 B;  3TEH B;  1HR0 Q;  2OTJ A;  2A1A A;  4A3J G;  4DR3 L;  2CQO A;  4X64 Q;  2IX0 A;  2MO1 A;  1NBW A;  3I56 A;  4LFB L;  1OXX K;  2MQH A;  3H0G G;  3KOJ A;  4AHX A;  3ULJ A;  4B3M Q;  1YEZ A;  1XPU A;  2R93 H;  4R4I A;  4Y7N H;  3G48 A;  4IJL A;  1X3G A;  3AQQ A;  2E5L Q;  4JI7 Q;  1LM0 A;  4BY1 H;  4Y52 H;  3UE0 A;  4DAY B;  5GAH c;  3HOY H;  3J81 c;  1UWV A;  1AE3 A;  2R7Z G;  2ES2 A;  1Q12 A;  5EIN C;  4ZN3 B;  1HZC A;  4IPH A;  3ZG6 A;  3CC7 A;  1M90 C;  3BU2 A;  2HT1 A;  4DR7 L;  1IRN A;  4K0K L;  2QL0 A;  3U58 A;  3CCQ A;  4A3K H;  5JJL A;  1VQ4 A;  4DUY L;  2VUM G;  4X6A H;  4JI1 Q;  4DV1 L;  4JV5 L;  4JOI C;  2OWO A;  4A3B H;  5DLQ E;  2N3S A;  3GO5 A;  4C3H H;  3CPF A;  4JBK A;  1X9N A;  3GTK H;  1VCX A;  2NZH A;  2M6P A;  4GNX C;  3A44 A;  4RXN A;  4A93 G;  3CME A;  3T1H Q;  1R0H A;  3PUZ A;  1PH1 A;  2KBN A;  3F1Z A;  1HZB A;  1KHI A;  1VQC A;  1T9Q A;  4O2D A;  4K9F A;  4E6Y A;  4JBJ A;  5FLM H;  4A3M G;  1HNW Q;  3F2B A;  2AWN A;  2PPT A;  4JOI A;  1EIF A;  4DK3 C;  3RZT A;  1Y1V H;  5IP7 H;  2ZM6 Q;  2H12 A;  1VQ9 A;  2R92 H;  1D7Q A;  2KHI A;  3K81 C;  1CKN B;  3NEM A;  5FLX c;  4PZ6 A;  1EYG A;  5IP9 G;  4GOP C;  1EIY B;  3MEF A;  2PNH A;  1IBM Q;  2JA5 G;  3G4S A;  3J7Z 1;  4YCU A;  5C4J H;  3LNL A;  1WJV A;  2VS1 A;  1KQS A;  2ATW A;  3CCE A;  4BA1 I;  1E1O A;  1JJC B;  2F52 A;  2EQS A;  1X56 A;  3HKZ G;  3W1B A;  4JAD A;  5IP7 G;  4B3R Q;  3PO2 H;  4RMF A;  2HQL A;  1RYT A;  4LF4 Q;  1Q46 A;  1EOV A;  1Y14 B;  3ERS X;  2K2D A;  2N78 A;  3KF6 A;  2UUA L;  1MJC A;  3D0F A;  3L0O A;  5HY6 A;  3CCL A;  1HNZ L;  2IHF A;  4JV5 Q;  2JE6 I;  3J81 j;  1C09 A;  2KKD A;  3KLW A;  1L1O B;  2RHQ B;  3CW2 C;  5ELO A;  4DV2 Q;  2K52 A;  4DV5 Q;  3H0G H;  2LXJ A;  1B2O A;  5MFP A;  1K0R A;  3GDE A;  1VQH A;  5H1S c;  1Z47 A;  1PH5 A;  1CAD A;  1KIX A;  1Q1E A;  3HOW H;  2ID0 A;  4LHN A;  4V19 6;  4DR2 Q;  1YNX A;  4X66 L;  3GTL H;  1VQA A;  1C0A A;  4HIO A;  1X54 A;  1SMU A;  3I4O A;  3RZO H;  1YI2 A;  4YCV A;  3P8B A;  2OCE A;  2WB1 G;  2VQE Q;  2I0Q A;  3I4N G;  2UXD L;  3S1Q H;  3UE1 A;  1PYB A;  1PFS A;  3HOZ G;  1IRO A;  3SGI A;  1N34 Q;  1GKH A;  4IFD G;  1S30 A;  4QGU A;  3L7Z C;  4H02 A;  3OTO L;  2VW9 A;  1TWA H;  1LTL A;  1J6Q A;  3H3V I;  1UE6 A;  4JAF A;  3U4Z A;  3HOU H;  2PI2 A;  1PH9 A;  1L1O C;  2DGY A;  5H1S E;  4DUZ L;  3K8A A;  4A3C G;  1PA6 A;  4WFN 1;  3UDF A;  1YHA A;  4JC0 A;  7RXN A;  2MO0 A;  4A3F H;  1OTC A;  4LUZ A;  4B3M L;  2L0Z A;  3NFP I;  1BQ9 A;  3T1Y L;  4JI6 Q;  3PF4 A;  1G51 A;  1E3P A;  1WCM H;  1YK4 A;  2JEB I;  4ME3 A;  2RCN A;  3RLN A;  4DR7 Q;  1NE3 A;  4UP8 A;  1JB7 A;  1I94 Q;  1VQF A;  5C0X G;  1RDG A;  4LHL A;  4QIW E;  4GN4 B;  1YVC A;  2K14 A;  3MPS A;  4K0K Q;  3NBH B;  4YHH Q;  3CCM A;  2BA0 A;  4IJH A;  5C4X H;  4YWM A;  2MNA A;  1RB9 A;  4B3R L;  2O5J D;  4A3L H;  3PV0 A;  1XPO A;  3NEL A;  1PVO A;  4BXX G;  1HH2 P;  3PKI A;  4A3I H;  4DV0 L;  4A3D H;  3LPE B;  4JI7 L;  2PQA A;  2JA9 A;  4UP7 A;  2V0E A;  1IBL Q;  4GKJ Q;  1KRT A;  1IBK L;  5JJI A;  1TXY A;  2R7D A;  2XTI A;  3KJP A;  4AI0 A;  1BBU A;  4YWK A;  2XJU A;  4POF A;  4A3J H;  1Q82 C;  1HZ9 A;  2OTL A;  2E2I H;  3HKS A;  2F3I A;  2ERS A;  4DV4 L;  4DR2 L;  3PGZ A;  3KYW A;  1T9O A;  2XGT A;  3RNU A;  4B3S Q;  4JI4 Q;  1M1K C;  4HJ5 A;  2E2J H;  4OXP A;  4B3S L;  3WWL A;  3STB C;  1PH2 A;  5LMN Q;  3KF8 B;  3HOY G;  1E24 A;  3CMA A;  1XTD A;  4DV5 L;  1VQI A;  1R0J A;  5J3B A;  1PH3 A;  1ASZ A;  4EQ5 A;  1KXL A;  4YY3 Q;  3RR5 A;  4APV A;  4BBR G;  2XJQ A;  4OX9 L;  4C2M H;  1LKP A;  3B08 B;  2IX1 A;  1UEB A;  1B7Y B;  3EN2 A;  4BBS G;  4AIM A;  1VQL A;  2PSM C;  1RYQ A;  3J81 i;  3HOX G;  1Q86 C;  4A3B G;  3PIP A;  4DV7 L;  1MJE A;  1VQG A;  1IL2 A;  3JAM i;  4XTC S;  3ULP A;  1QZG A;  4LUO A;  2C35 B;  3M3Y H;  4X62 Q;  4DV3 Q;  4HID A;  3JAM c;  3CPW A;  2UUB Q;  4R4T A;  2E5L L;  1I5F A;  1XNR Q;  1QCV A;  5M5X H;  1YUZ A;  2XJT A;  3S15 H;  3TS2 A;  1UE1 A;  3FP9 A;  1YUX A;  1WI5 A;  5FLM G;  1FJG Q;  2BE5 D;  1N34 L;  3KFU A;  1SLJ A;  3KDF B;  1VZH A;  4BY7 G;  1OXS C;  5FJ8 G;  1HR0 L;  2PQA B;  5E7N A;  4AQY Q;  3TRZ A;  4EX5 A;  2Q2I A;  2Q2T A;  4XXB B;  2UXC Q;  1P8L A;  4XIG S;  5ELN A;  3CC4 A;  2PVE A;  1RIP A;  2ALY B;  2Z0S A;  1Q81 C;  1S3O A;  1YJN A;  1A63 A;  1NMF A;  3PKJ A;  2BA1 A;  1J5E L;  3D31 A;  4JI5 L;  4LNQ A;  3A5U A;  1B2J A;  3DM3 A;  1VQN A;  1IBL L;  5K36 G;  2OQ0 A;  5IT9 c;  4BY1 G;  4NXM Q;  4BY7 H;  4QQB X;  1WYD A;  4JAE A;  4MZ9 A;  1OWC A;  2NZO A;  1XNQ L;  3SS2 A;  3BZC A;  4R4C A;  1IU6 A;  2BH8 A;  5IWA L;  1JMC A;  5AJ3 Q;  5LMU L;  1VQ8 A;  1YV1 A;  3PWF A;  3HOV H;  1VQB A;  4FDB A;  2ZTC A;  3S24 A;  5IYB G;  3K7U C;  1HNZ Q;  1L2F A;  5GAE C;  2UUC Q;  4IFD J;  2UUA Q;  2GMG A;  2UUB L;  1LYL A;  4R1J A;  4XGH A;  1X65 A;  2UU9 Q;  1YBY A;  3PSI A;  5IYC G;  1RL2 A;  1K9M C;  5MGN A;  5BR8 Q;  3I55 A;  3M4O H;  1YHQ A;  2OQK A;  1X55 A;  2K5H A;  1N8R C;  2JJQ A;  3MXN B;  2NYD A;  3A0J A;  3HOV G;  3NEN A;  4X65 Q;  2KCM A;  4HJA A;  1XNQ Q;  1IYJ B;  3RN5 A;  1OXT A;  4DR6 L;  1BKB A;  1E22 A;  4MTN A;  3ZJY C;  5IYB H;  3F2C A;  2AHO B;  4BBS H;  4LF4 L;  1XJV A;  4DV6 Q;  1Y1V G;  4NXN L;  5IYC H;  1MKH A;  1XMO Q;  2CFM A;  4NXN Q;  4UY8 C;  5IP9 H;  3GTM H;  2UXB Q;  1HJP A;  2GVA A;  3GTG H;  1W3S A;  2LXK A;  4GN5 A;  4AYB G;  1S40 A;  3HKZ E;  1D8L A;  5AI3 A;  1EQQ A;  6RXN A;  4HIK A;  3RZ6 A;  1EWI A;  5C44 H;  1VQ5 A;  3I4M G;  1T9H A;  1E8J A;  4X65 L;  3S16 H;  1HZA A;  4KHZ A;  1YIJ A;  3AEV A;  3H3V H;  4A3C H;  2JK8 A;  4A3E G;  2AKW B;  5EIO C;  4MNO A;  4JI2 Q;  1XMQ Q;  2A6E D;  4LFC Q;  1UE5 A;  2KCT A;  5C3E G;  3JC6 2;  4OON A;  4AHZ A;  1TWF H;  3KYY A;  1JT8 A;  1I6H H;  2CKC A;  4DV3 L;  4X62 L;  4HJ8 A;  4BA2 I;  4GOP B;  1HR0 W;  4L5S A;  2F4V Q;  3CP0 A;  4OO1 I;  1KL9 A;  1PHJ A;  2JI3 A;  1N32 L;  2PI2 E;  4TVA B;  3L2P A;  4HJ7 A;  4BXX H;  1N32 Q;  5DM6 1;  2I5M X;  1E1T A;  4KLK A;  2CKA A;  1A8V A;  2E8G A;  4GLA C;  5IWA Q;  4A3E H;  3W5O A;  2EXD A;  1T9P A;  3S14 H;  5C3E H;  5M5Y H;  2IT1 A;  1PYS B;  4A3D G;  1FGU A;  4LFB Q;  1B70 B;  1HNX Q;  5EAY A;  3ER0 A;  1WFQ A;  1YK5 A;  1KRS A;  5GQO A;  2CWA A;  2K4K A;  5GAE c;  4U67 1;  1YIT A;  3QVD A;  1CSP A;  4KHP Q;  2F4V L;  2JI1 A;  3I2Z A;  3RZD H;  8RXN A;  4JI5 Q;  3J7Y 1;  2N8N A;  3JC6 3;  3GTQ H;  1SRU A;  5AN9 H;  1A0I A;  5IY0 A;  1VS0 A;  3KJO A;  2NVQ H;  3PUV A;  1XMQ L;  4JI2 L;  4PZ8 A;  4HIM A;  3QQC E;  4YWL A;  3F2D A;  1VQ6 A;  1AH9 A;  3HOU G;  1ZRP A;  1BE7 A;  2MFI A;  3S2D H;  4QJF A;  4LF5 L;  3CC2 A;  4AR6 A;  4IOA A;  1XNR L;  4DV0 Q;  2ASB A;  2JA7 H;  4DR1 L;  5C0X J;  1QVC A;  4BBR H;  3PO3 H;  2A6H D;  1CUK A;  1X3F A;  2K75 A;  5M3F G;  3RN2 A;  4A3F G;  5JEA G;  5BR8 L;  2JQO A;  3T1H L;  1H95 A;  1Y1W G;  3G6E A;  3UDI A;  1V1Q A;  4PZ7 A;  3GTJ H;  4IPG A;  1SRO A;  2ZJR A;  1FHM A;  3PZA A;  1YHB A;  4DKA C;  3CXC A;  3EBE A;  5C44 G;  4DV7 Q;  2CKZ B;  4AR3 A;  1FVI A;  1X3E A;  1OWB A;  2YTX A;  3KDF A;  3DLL A;  4A76 A;  3P2A A;  3VDY A;  3WWV A;  2HHH L;  4QY7 A;  3PO3 G;  1NTG A;  4UY8 1;  3E9I A;  1VQO A;  2Z3R B;  2YYZ A;  3CAM A;  3ICE A;  3S1M H;  5M3M H;  4GLV B;  1Y1W H;  2VNU D;  4YY3 L;  2WFW A;  1EUJ A;  2WAQ E;  2KHJ A;  4JG2 A;  4HJ9 A;  1N36 L;  1BBW A;  2E2H H;  3HFZ B;  4DR5 Q;  1SMM A;  5DM7 1;  2D0O A;  3AFP A;  1YJW A;  4UP9 A;  3CQZ H;  2ZTD A;  4LF6 L;  1AE2 A;  2J9U B;  5AJ3 L;  5LMU Q;  5IYD H;  1MIU A;  3TQY A;  2B29 A;  2VQF Q;  1P16 A;  4B3T L;  1BRF A;  3FKI G;  1H7V A;  1TWC H;  1FHH A;  3KYX A;  3KF6 B;  5M3M G;  1CKM A;  2VQE L;  1LUZ A;  4RG1 A;  2JA6 G;  2N49 A;  4IPC A;  3RLO A;  1N33 L;  1N33 Q;  2MS3 A;  1VQ7 A;  2XJS A;  3M85 A;  5JVG 1;  3J80 c;  2I5L X;  1QZH A;  4AI2 A;  4AHW A;  1X6O A;  1CAA A;  4A3G H;  1I94 L;  2XJP A;  2WAQ G;  3TRE A;  4AQY L;  1I3Q H;  2VZA A;  4LW1 A;  2JA8 H;  2ZIX A;  2R93 G;  4YHH L;  1K83 H;  3S17 H;  3HOX H;  1WOC A;  4DV6 L;  1HNX L;  3J7A 5;  2Q2H A;  3K0X A;  1XPR A;  4GKK Q;  1RWD A;  3PF5 A;  2AYJ A;  2BH2 A;  1VQK A;  4GOP A;  3TS0 A;  4P74 A;  1B71 A;  1G6P A;  1TWG H;  4ALP A;  4A3G G;  3K7A H;  4A3K G;  1CSQ A;  1NY4 A;  3B0A B;  1DGS A;  4DUZ Q;  4WJ3 M;  3Q8D A;  4QL5 A;  4PMW A;  1GD7 A;  2WB1 E;  1G29 1;  4TVM A;  2I5H A;  5FJ8 H;  4AR5 A;  3PIP 1;  1BVS A;  1VCI A;  2UUC L;  2Y0S G;  4LF5 Q;  3W1G A;  1QVF A;  2NVT H;  2D0P A;  4C3I H;  1ASY A;  3S1N H;  3GD7 A;  1R9T H;  4DAM A;  2CWP A;  1TWH H;  1UE7 A;  4LF9 L;  4LF9 Q;  3CCJ A;  1WJJ A;  4DR1 Q;  3I4M H;  1IBK Q;  3AFQ A;  3ULL A;  1YZ6 A;  2A19 A;  2RHS B;  4A3M H;  4NXM L;  1W2B A;  4JI8 Q;  3A5Z B;  4LWC A;  1DVB A;  2FXQ A;  3I7F A;  2LSS A;  1GO3 E;  4AH6 A;  1SFO H;  2R92 G;  4JI4 L;  2A69 D;  3RLF A;  4LF6 Q;  4C3J H;  1GVP A;  4DV4 Q;  4JCV E;  1LKM A;  2Z3Q B;  2NN6 G;  5GAD C;  1PH7 A;  1C7Y A;  2JA5 H;  5JVH 1;  2QEX A;  1NNQ A;  4DNI A;  5GAG C;  1JJG A;  3H15 A;  4GKJ L;  1I50 H;  1K8A C;  1VQJ A;  2HIX A;  2B63 G;  4GS3 A;  1KD1 C;  1A62 A;  1NMG A;  2ZTE A;  3PUX A;  4IPD A;  4DK6 C;  5IE8 A;  4A75 A;  1Q7Y C;  5LMN W;  3OYY A;  4IOC A;  5JEA J;  4WJ4 A;  4GNX B;  2Z6K C;  4G6B A;  2V3B B;  1V43 A;  1QUQ A;  4JI0 L;  4JYA Q;  1E7Z A;  2H5X A;  5GAG c;  1QUQ B;  2A8V A;  2PVX A;  1SN8 A;  1QVG A;  4JI0 Q;  4JYA L;  1BQ8 A;  2CCZ A;  3CCV A;  1V9P A;  3E0E A;  2JA8 G;  1IBM L;  4JBM A;  3J80 i;  1U0L A;  3PIO A;  3T1Y Q;  4JI6 L;  1RDV A;  3K35 A;  1SR3 A;  1ODH A;  4P71 A;  3J7Z C;  1K3R A;  2GVB A;  2PYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...