4YWLA

Pyrococcus furiosus mcm n-terminal domain f179a point mutant pentameric ring
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSAVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ywlA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywlA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywlA01
1I50H 1Q86C 1SFOH 1Q46A 4BY7H 7RXNA 1R0JA 4X65L 2K5VA 4LF5L 3S17H 3PO3H 3GD7A 2UXDL 4GOPA 1TWFH 1JB7A 4DV1L 1PH5A 4AR3A 1WYDA 3KDFA 4DK6C 1R9TH 2K2DA 5IYBH 3HOVH 3GTPH 1E1TA 2JA5H 2K5HA 1HH2P 4NXML 2N3SA 2OQ0A 1JJGA 2K5NA 5H1SE 1KRSA 1H95A 4GKKL 2WAQG 1VQKA 1BQ8A 2IT1A 4QQBX 2PMZE 2E2JH 2PVEA 3E0EA 1B2OA 4A3EH 1S24A 5M5YH 1E3PA 4A3LG 3MPSA 4DR2Q 4LFAL 4BBSG 2PYAA 3J80c 5AI3A 2RDVA 5GAEC 4PZ6A 1BRFA 4A3FG 2A19A 3CCEA 4TPUA 4X66Q 1PH7A 5JJIA 1C0AA 3K0XA 5ELNA 3J80i 3S15H 2RHSB 4A3JG 1PV4A 4X64Q 2GVBA 4BXXH 4UPAA 4P72A 1IBMQ 2ZJRA 2VNUD 5C3EG 2D0OA 1XMOQ 1K8AC 4JBKA 5FLMG 1SMUA 2JA9A 2HR5A 3KOJA 2DSXA 1U0LA 2Q2UA 2NVYH 3RZTA 3PUWA 3M4PA 1HNXQ 4X62L 5IT9c 4HJ9A 4A3GG 2VZAA 3PCOB 5BR8Q 3RLFA 1IYJB 2Z0SA 1VCIA 4JV5L 2UXBQ 4A3IG 1K9MC 2R93G 3MXNB 4LF7Q 1PH3A 1I94Q 5RXNA 3RNUA 1VQ5A 2R7ZG 5C0XJ 3ER0A 3RR5A 1UE5A 3CMAA 2K75A 3MEFA 3NENA 1VQ4A 1AE3A 5J3BA 2RF4A 1HZAA 4P71A 2VUMG 4IJLA 4A3LH 4LFBL 4BBSH 1V1QA 2Y0SG 3G6EA 3NBHB 1R0IA 3PSIA 4A3MG 4A3KG 4DV5Q 1QVCA 2E2HH 3KYYA 1SN8A 4L5SA 4LFCQ 1B2JA 3AEVA 4LF8L 1PH1A 4YHHQ 4DNIA 4LW1A 1RDVA 5IWAQ 4DV3L 1HNXL 4DR5Q 1IBLL 2E2IH 1KRTA 4JI5L 3CPWA 4A75A 5BR8L 1OXTA 1A63A 3G71A 1G6PA 2PQAB 3UE0A 1W2BA 1GM5A 4DV0Q 4AIMA 1BQ9A 5JEAJ 5C3EH 4BBRG 1KL9A 5IP9G 1OXVA 5FLMH 1I94L 4GN5A 1MJCA 3HOWG 6RXNA 1HR0W 2JK8A 2CQOA 2ZTEA 4LUZA 2Q2TA 4FDBA 4RXNA 1L1OA 4A3GH 1N33L 1IRNA 1VQEA 3BZCA 2UUAL 4JCVE 4JI8Q 3UE1A 2JA6G 4ME3A 2R7DA 8RXNA 2KCMA 2N78A 4A3IH 1KHIA 2CCZA 2R93H 4KHZA 4K9FA 2LXKA 4LFCL 1J5EQ 1SMXA 3T1HL 1CSQA 3GTGH 1N9WA 5JEAG 2OQKA 3IRBA 4L5QA 4DR5L 5FJ8G 1QZHA 3AQQA 1PA6A 4DR3Q 4A4IA 4C2MH 2BA1A 1EWIA 1EOVA 4HJAA 1I6HH 4DUZL 4KI0A 3F2DA 4JI4L 1OXXK 2ZJPA 4DV0L 4DV2L 4A3KH 1IZ6A 1D8LA 3CC4A 1B71A 1U5KA 1V43A 2A1AA 1A0IA 3CC2A 2LCQA 1VQAA 3OTOQ 1D7QA 1RDGA 1LKPA 1SE8A 3J81j 1Q8KA 4JI8L 5IYBG 3T1YQ 1YJWA 3RLOA 3JC66 2PVXA 4TQUS 1YNXA 2YTVA 1IU6A 4P74A 4BBRH 2KCTA 5C4JH 3H15A 3I4MG 3HOWH 4UP9A 3HOYG 4POFA 4DR4L 3CQZH 1KIXA 1T9QA 4JI2Q 4DV4Q 1J6QA 4JI3L 2JA6H 3ERSX 3KYXA 2JE6I 2ZM6Q 4A3EG 4JYAQ 4B3RQ 1CKOA 3CCJA 1JYBA 4HJ7A 1FHHA 4DR1Q 3EBEA 5LMNQ 3TS2A 1X55A 1FJGQ 4YWKA 4IFDJ 5FJ8H 1X6OA 3AYHB 3M85A 1CKNB 3KLWA 2UUCL 3HKZG 3T1YL 1LKMA 2DGYA 1HNZL 4BXXG 1R0GA 3FKIG 2IHEA 2CWAA 2E5LL 4P75A 2UXCQ 3PZAA 2NVTH 3KYUA 4HIKA 3A44A 3BU2A 1NMGA 4DPGA 4JI2L 3D0FA 4DV4L 4O2DA 2YTXA 3M4OH 3NEMA 2JEBI 3DM3A 1QUQA 4OX9Q 3RZDH 4IFDG 2ZTCA 2ZM6L 4KLKA 3L2PA 2DUDA 3CPFA 4YCUA 4B3RL 3I4MH 3KF6B 4YWMA 5LMNL 3HOYH 4GKJQ 3ULJA 1XMQQ 1BBUA 3PWFA 3S2HH 1E8JA 4RG1A 4XTCS 3U4ZA 4LUOA 3RZ6A 3TQYA 4B3TQ 4A3CG 2PI2A 2JQOA 2F4VQ 3CCLA 1Q1EA 4B3SQ 4R1JA 4JOIA 1OTCA 4OWXB 1PH8A 2K14A 4AR4A 3H3VH 1JT8A 2WP8J 2MO0A 5LMUQ 2Q2HA 1CKNA 3W1BA 2UU9Q 1PYSB 3I2ZA 3K7UC 3JC63 4P73A 1UE6A 4XIGS 3F2CA 2R6GA 1XPRA 3KYWA 4JBMA 5FLXc 3S1NH 2IX0A 3FKIH 1PH6A 1ASYA 3M7NA 2HIXA 1CAAA 4AR5A 2YYZA 4GKJL 2LSSA 1EIFA 1JJCB 1XMQL 1Q12A 2WAQE 1IBKQ 4JI6Q 1ZRPA 2K4KA 4C3HH 4DAYB 2Z6KA 5IY0A 1L1OC 5E7NA 1YUXA 1K8GA 3GTKH 1EIYB 1SR3A 4X6AH 3B6YA 2WB1E 2AKWB 1YBYA 3L7ZC 3CCVA 1NY4A 1WOCA 2QA4A 4IOCA 4AQYQ 4JI7Q 1XNRQ 1M1KC 4DR2L 2F4VL 2V3BB 2NN6G 2PNHA 4GS3A 2R92G 3EN2A 3CCQA 2A8VA 3AFPA 4R4CA 4IO9A 1N34Q 1DVBA 1RYTA 2ID0A 3STBD 1NMFA 4X66L 2VQFQ 5LMUL 2VQEQ 4L5TA 1SMMA 1WFQA 4QGUA 4NXNQ 2JA7G 4IPCA 4X64L 3AFQA 1I3QH 3UDFA 4A3CH 1Y1WG 1XNQQ 3UDGA 1BFYA 1G291 4RMFA 1GO3E 1HZCA 4EX5A 1YITA 1VQGA 1VS0A 1P16A 1IBML 1XPUA 1B7YB 3M9BA 4TVAB 1XMOL 2N8NA 4LF6Q 3GTLH 4K0KQ 1TWHH 3JC62 5EAYA 3W5OA 1NJIC 4JI6L 2WFWA 1S72A 5GAHC 4C3JH 1JE5A 2KKDA 1Q1BA 1HR0Q 1Z47A 4AQYL 4YCWA 2YTYA 5C0XG 3CCRA 3PGZA 4JI7L 2UXBL 3NELA 4DUYQ 4LF7L 2E8GA 4OXPA 4HIDA 5IE8A 1WCMH 1VQLA 4AYBE 3RN2A 2IHFA 3CD6A 2EXDA 4J15A 1L0WA 3TREA 1UE7A 1VQJA 5AJ3Q 2KN9A 2XTIA 4WJ3M 1KAWA 3CXCA 3CW2C 3HFZB 1XNQL 4LF9Q 1T9OA 3I55A 4AR6A 2PI2E 4JI1Q 3HOXH 1LYLA 1YHBA 2R92H 4DV5L 1Q7YC 2ZTDA 4PG3A 4LF6L 4DV6Q 2VW9A 4YHHL 1VCXA 5IWAL 1RB9A 2JA7H 4MNOA 1E7ZA 1MKHA 4OO1G 1UWVA 1YZ6A 3TEHB 1Y1WH 1M90C 1IU5A 1DGSA 2RHQB 2ASBA 1I5FA 4IPHA 1K83H 2IY5B 1NE3A 1BBWA 3K7AH 3L0OA 4NB3A 3S14H 1EUJA 1B70B 5AJ3L 2I5MX 4GOPC 2GMGA 1TWAH 5HY6A 1OXUA 2D62A 2CFMA 2PQAA 3K81C 3W1GA 3KF8B 4DR7Q 3KYVA 3U4VA 2GVAA 5GROA 3S16H 2B29A 4R4QA 3A74A 1B13A 4JBJA 2MS3A 3HOUG 4PMWA 1J5EL 4QIWE 4JG2A 3RYGA 1VQOA 3I56A 3PF5A 4Y52H 3CCSA 3QVDA 1CSPA 4WJ4A 4DR3L 5DLQE 3S2DH 2D0PA 2JJQA 2MNAA 2I0QA 2KBNA 1N8RC 5IYCG 5C44G 1X56A 4A93H 3FHWA 1T9PA 4JOIC 3ULPA 4BA1I 4A76A 2N49A 3OTOL 1YJ9A 1H7VA 2Q2IA 1E1OA 1C7YA 4IJHA 3KDFB 1K73C 4LNQA 3SGIA 2CKZB 1PVOA 2UUBQ 1XTDA 3EIVA 4O0AA 1BE7A 3H3VI 1R0FA 1LKOA 1A8VA 1V9PA 3ZJYC 3FP9A 3GTOH 3PV0A 4DKAC 3PIOA 4GNXB 2FXQA 3G4SA 3E9HA 3F2BA 1X9NA 1YVCA 2UXDQ 4UP8A 1NTGA 4IPGA 1EYGA 4DV1Q 4KHPQ 2Z6KC 5JJLA 2C35B 1BVSA 4H02A 1IL2A 2AWOA 4OWWB 4JYAL 3A5ZB 3KJPA 3CAMA 1BKBA 4GLVB 4DR1L 3LGJA 1EFWA 3HOUH 3I4NH 1P8LA 3J7ZC 3JAMc 4IFDI 1VQ9A 1IROA 3ULLA 4GKKQ 1FVIA 2AMCB 3HKSA 5LMNW 1YUZA 1QVGA 2MFIA 4GLXA 3CF5A 1C9OA 3JAMi 1VQ7A 2UUBL 4LFAQ 1O7IA 5IYCH 1MIUA 1OXSC 1T9HA 3KYHC 5C44H 1CKMA 5IP7H 4A3DH 1X54A 1VQIA 2UXCL 1X3EA 1RIPA 3K8AA 3J81c 2YU9H 4ALPA 5M5WH 2EIFA 1IXRA 2B63H 3S1QH 4KHPL 2BH2A 2YV5A 1VQ6A 4C3IH 4YWLA 3J81i 1YJNA 4OX9L 2F52A 1E22A 1K0RA 3M4QA 1NBWA 1R0HA 2RCNA 4LWCA 1LTLA 2NVQH 4APVA 4GNXA 1G51A 3G48A 2JA8H 4GN3B 4R4OA 4BY1H 2AHOB 3HOZH 1WCMG 3S24A 2HT1A 1S3OA 3KFUA 3CMEA 1PH9A 4EQ5A 2IX1A 4HJ5A 1VQPA 4LF4Q 4X62Q 1VQFA 2KHJA 2R7FA 1UE1A 5GQOA 3ICEA 1PH4A 4B3TL 1JJ2A 2WB1G 4R4IA 4JV5Q 4POGA 4PZ8A 3RN5A 3TS0A 1HNWQ 3KF6A 1GKHA 3HOXG 2I5LX 4B3SL 3GTMH 5GADC 4A3BG 1N32Q 3PUXA 2MQHA 1PHJA 1YK4A 4L5RC 2ALYB 1TXYA 2UU9L 1SMWA 2QEXA 2NN6I 2NZHA 4MZ9A 1SLJA 2K50A 1AE2A 2K52A 1YIJA 2ATWA 4LFBQ 2V1CC 3S1MH 2HHHQ 1HZ9A 1QVFA 5ELOA 5M3FG 4QL5A 4PZ7A 3Q8DA 3GDEA 3I4OA 1HJPA 1VQBA 4DR6Q 3CC7A 4R4TA 4LF8Q 1Q81C 1N36Q 1IBKL 1FGUA 1IBLQ 2OTLA 4DV3Q 4B3MQ 4LF5Q 1KQSA 1VQHA 4JI5Q 4LF4L 4DV7Q 1EQRA 1L1OB 2OTJA 3OYYA 2HIVA 3BJUA 1SROA 1XPOA 1HNWL 2QGQA 1DX8A 4OWTB 1XNRL 1S30A 1VQMA 4BA2I 1N32L 3DLLA 2I5HA 1YHAA 4AYBG 3U58A 1QYBA 1N34L 1MJEA 2AWNA 3J7A5 2VQFL 3PUYA 5C0XI 2MO1A 2VQEL 1N33Q 1CUKA 1GVPA 2CWPA 4GN4B 4NXNL 4DAMA 4HJ8A 2UUAQ 1C09A 3K80C 2NZOA 2Y0SE 1FJGL 2HHHL 3I7FA 1Y14B 1HZBA 3H0GG 4A3BH 4AH6A 4A3FH 4DR6L 4K0KL 4A93G 3T1HQ 5C4XG 1N36L 4UP7A 1FL0A 3STBC 1LUZA 1PYBA 2HQLA 3F1ZA 4GLAC 4OONA 4A3JH 4B3ML 3CCMA 2F3IA 4DV7L 4JI0Q 5IYDG 1KC8C 1YK5A 4DUZQ 2GN5A 3PUVA 1HR0L 1FHMA 4JI4Q 3BZKA 2JEAI 4DV2Q 2VL6A 2ES2A 1X3FA 3RLNA 5M3FH 2EQSA 1ASZA 4DUYL 5K36G 5M5XH 3RZOH 1PFSA 3GO5A 4OO1I 1GD7A 2M4YA 2XGTA 4YY3Q 1AH9A 3GTQH 1S40A 1YV1A 1Y1VG 2OWOA 3PO2G 1S2ZA 3M3YH 1K3RA 4DK3C 4YCVA 4LF9L 1VQCA 3PUZA 4JI1L 1Z9FA 2LXJA 4HIOA 1EQQA 1QZGA 1UEBA 5M3MG 2L15A 1JMCA 2VY3A 3D31A 4DR4Q 3I4NG 2R7ZH 2BH8A 4DV6L 4QJFA 4QY7A 4JC0A 5GAGC 2ZJQA 4JI3Q 1XJVA 4JI0L 2BA0A 3PIPA 1PH2A 3VDYA 2VUMH 3PF4A 2H5XA 3KJOA 4A3MH 3H0GH 1TWCH 4BY7G 3E9IA 1L2FA 4IPDA 4A3DG 3GTJH 5C4XH 5IP7G 1RL2A 4LUVA 3PO3G 4YY3L 2OCEA 1KXLA 1YHQA 3U50C 2B63G 4GOPB 5IYDH 3SS2A 1CADA 2UUCQ 1VQNA 3HOVG 1QUQB 2KHIA 1HNZQ 1VQ8A 4DR7L 1YEZA 2JA5G 3CP0A 3UDXA 1TWGH 3WWVA 5IP9H 1YI2A 1A62A 1X3GA 4GNXC 3OW2A 2E5LQ 4UY8C 2JA8G 1LM0A 4X65Q 4BY1G 3HOZG 1WJJA 4NPSA 1WI5A 1Y1VH 5HGQA 3PO2H 4IOAA 3A5UA 3S1RH 5JJKA 1E24A 1W3SA 3UDIA 3CCUA 3TRZA 4MTNA 1X65A 2VS1A 5M3MH 3F8TA 4NXMQ 4JBWA 1B8AA 4Y7NH 1Q82C 1SRUA 1NNQA 2KENA 2QL0A 5AI2A 2B3GA 4HIMA 3A0JA 3HKZE 1RWDA 1QCVA 2NVXH 1VQDA 1KD1C
chains in the Genus database with same CATH superfamily
1QQTA 4KD3A 3UI2A 2C5CA 7RXNA 4OIJA 2A6HD 1R0JA 1LT4D 3BDCA 3GD7A 2UXDL 2JP1A 5LHY1 1JB7A 3KDFA 2JYOA 1E1TA 2JA5H 4AYBP 1JJGA 1QCBD 1H95A 4Y7NB 2B2YC 5FK9C 2EPBA 4RAUC 2E2JH 3E0EA 3QJYA 1B2OA 1K3BC 1S24A 1PDQA 5M5YH 4BBSG 4LFAL 3MA2B 2PYAA 5TSSA 2RDVA 4DAVA 1BRFA 2X6LA 2A19A 3CCEA 3PO3B 4X66Q 5JJIA 1SE3A 1C0AA 3K0XA 5ELNA 2B63B 3S15H 2RHSB 2EY5A 3P8BA 4FO2A 4ZLTF 3ZYYX 2GVBA 2ICEC 2EY1A 5C3EG 2HCIA 4B8CD 1EQVA 2Z4HA 2NVYH 1HNXQ 4X62L 5IT9c 4HJ9A 3P75A 2KOLA 2F0QA 2Z0SA 2F3WA 2R93G 3EA6A 4LF7Q 5DNFA 3RNUA 1CT1D 1C48A 4ZKBB 2QW7A 3QB3A 2K75A 3NTIA 4DXFA 5GAHc 1HZAA 4BBSH 1X32A 2Y0SG 3G6EA 3PSIA 1R0IA 3K5MA 4A3MG 1JC7A 4DV5Q 4LFCQ 3AEVA 1PH1A 1VQKA 5IWAQ 1HNXL 2Z8LA 4DR5Q 4L63B 2JXMB 3J7YW 1G6PA 1H9KA 4A3GL 1W2BA 2LMCB 1BQ9A 5C3EH 1XTCD 5C5MA 1OXVA 1SYCA 4GN5A 3HOWG 1UUPA 4KD4A 2ZTEA 2CQOA 2EYHA 1B1ZA 2KUMA 4FDBA 4RXNA 1CQFA 3HGBA 4CKEA 2K5QA 4IZ8A 2Z3RB 2XRSD 1NNXA 1H9SB 2R93H 4NKLA 1MD2D 4KHZA 4OL7A 4A3KL 1XXGA 4M8AA 4LFCL 2E2HB 4RKLA 2CVRA 1CSQA 2L4NA 1N9WA 2A6ED 5DAUA 1A3VA 2DJFC 4DR5L 1PA6A 5D3IB 4DR3Q 4A4IA 4HJAA 1I6HH 3A7AB 5G3LF 2PZTA 1BXTA 3CC4A 1B71A 1V43A 4BBRL 1A0IA 4EVOA 3G6JB 2F0VA 3OTOQ 1QOHA 1DOKA 4JAEA 1SE8A 5MGNA 5IYBG 5C0XH 4CKCA 5EBCA 3RLOA 4A3IB 5C4JH 1SJED 4P74A 3S1RL 2K03A 3HOWH 4DV4Q 1J6QA 4JI3L 2WINB 3CKIB 4C2MB 2JE6I 1CKOA 1BNZA 1JYBA 1FHHA 1CM9A 2NVXL 3EBEA 1WTPA 4YWKA 4IFDJ 2GA4B 5JVG1 5CBEE 3D6WA 2DGYA 4BXXG 1B3QA 1R0GA 1DONA 2CWAA 2E5LL 4P75A 2JA5L 3I4ML 3LWPB 3KYUA 4HIKA 1A2TA 4EGVA 3VYUA 4DA2A 4DV4L 4K5XA 2FMMA 3E3XA 2JEBI 1KDBA 1STNA 3RZDH 2ZTCA 2E2JL 3T13A 3CPFA 3L2PA 1D5ZC 5M5YL 3QWNA 5IT9E 2L11A 3S2HH 3ND8A 4LUOA 3RZ6A 4B3TQ 2IPKD 4A3CG 5KIXA 2QILA 4JOIA 1OTCA 2NVTB 2K14A 1I4PA 2RDGA 5LMUQ 2Q2HA 1CKNA 2CH4A 3M4OB 3JC63 2NVYL 3F2CA 1BCPC 5FLXc 1HFNA 2K04A 3WDNA 3E0JA 1LT3D 3ONAB 3MXUA 4JI6Q 1K8GA 2A74C 3GTKH 1SR3A 3EVQA 4X6AH 2QA4A 2AKWB 4A3EB 1NY4A 4JI7Q 4JAGA 1TIID 1XNRQ 1M1KC 4BBSL 4IOAA 1GUGA 1RYTA 1NMFA 5LMUL 4QGUA 1WFQA 4L8JA 3HKZB 4A3CH 2IL8A 3S1NB 1YITA 1FJGQ 3JR7A 4TVAB 1XMOL 4K0KQ 5C3EL 1NJIC 3W5OA 4JI6L 3J7AV 4C3HB 2WFWA 4WRDA 1Q1BA 2KKDA 4QUFA 1HR0Q 1Z47A 1GUSA 4YCWA 4JI7L 3PGZA 1B9MA 4X3TA 1D1IA 4DUYQ 4J6HA 2R93L 3BG3A 1RCVD 1CQVA 2EXDA 3TREA 1VQJA 2F0PA 2QEJC 2KECA 4WJ3M 3KBXA 2PMZB 1SYBA 1L0YB 1PFNA 1Y1WL 1I6HL 1YHBA 3P20A 3HKZP 3K35A 3H99A 2F0JA 5BN3A 1LTID 1E7ZA 4OO1G 1YZ6A 4C3JB 2CHBD 2O5JD 1UAPA 4IPHA 3A8KE 5C4JL 1WCMB 2RSOA 1BBWA 2XNAC 3HOWL 1GJXA 3T16A 1B2TA 1MHWC 5HY6A 2RA4A 1DOLA 1I4RA 2PCFB 3A74A 5CGKA 4R8NA 4XGHA 1WTXA 1J5EL 5JAVA 1Z92B 1UEAB 4K8IA 3I56A 5EQ0A 4JADA 4UY81 3FDTA 1PFYA 5E4XA 4WJ4A 1EU4A 2KBNA 5CV8A 1B3AA 3ULPA 1ML0D 4RGTA 4BA1I 4A76A 2N49A 2A6EC 3HRZC 1LT5D 4K8JA 4OO1H 4LNQA 4H0LC 1K73C 3GP7A 1NR2A 2BDNA 3RZDL 1LKOA 2AQ1B 1V9PA 3FP9A 3GTOH 3PV0A 1S5ED 2FXQA 2KEEA 4MIUA 1EYGA 1HA5A 1QB5D 2EOTA 5FLXE 1BVSA 2AWOA 4JYAL 2EVBA 5DM73 2XSCA 4GLVB 1D5MC 5IYCL 3BVZA 4N8X1 2AMCB 4WJWA 5LMNW 4XXBB 1QVGA 1SDFA 4XDXA 5KRUA 2O5IC 1OXSC 1T9HA 2E2DC 1CKMA 1G91A 1X54A 2I07B 1FGBD 1X3EA 2YU9H 2UXCL 4R9WA 2M6OA 3S1QH 1VQ6A 1SYDA 5AFWA 4C3JG 3GTKL 1NBWA 3MFGA 1NR4A 3TZDA 3A8IE 4GN3B 3I4NB 4LHNA 1SEBD 4QIWB 4ZQ3A 5GAEc 1WCMG 3S24A 2HT1A 3KFUA 2IX1A 1ESFA 4LF4Q 1VQFA 2KHJA 3ICEA 5IT9L 4PZ8A 1SE4A 3S9WA 4A3CL 4L6TB 4K2LA 3QR8A 2M4VA 2ALYB 2F0KA 4HCEA 2QEXA 2NN6I 2NZHA 1BCPB 2K50A 1AE2A 1OO9B 2HHHQ 4CKBA 5ELOA 4QL5A 2JI2A 1JICA 2LKVA 2EY2A 4LF8Q 1D2BA 1Q81C 1N36Q 2OTLA 1FGUA 4JK1C 4LF4L 1VQHA 3KLRA 3RUZA 2OTJA 4QIWP 1SROA 1XPOA 5DM61 1J9OA 4BA2I 3DLLA 1YHAA 3U58A 1CFMA 4KTAA 1N33Q 4NXNL 4DAMA 4K5VA 3VR6A 4JVZA 1PTOH 2HHHL 2PYKA 3HJYB 1Y14B 4AH6A 4A3FH 4PMBA 1N36L 2HQLA 2EXZA 3C1EA 3CCMA 2F3IA 4JI0Q 1KC8C 3GTQL 4DUZQ 4JI4Q 4F88A 1FHMA 3BZKA 3LPEB 3RLNA 1CHPD 3RZOH 1HUMA 1PFSA 3L9AX 2WAQB 1AH9A 3MWYW 4K2KA 2EZVA 2DJGC 3X3MA 1K3RA 4TVMA 2WB1B 4JI1L 3HOXB 4AI1A 2XJVA 4DR4Q 3I4NG 1NSNS 2R7ZH 2BH8A 5C4XL 3A56A 3T53B 2ZJQA 4JI0L 3VDYA 3G7LA 2VUMH 1VMCA 1EZ8A 5EKIA 4BY7G 2D9UA 2NB0A 5F2DA 1RL2A 3GTOL 2OCEA 1VZGA 2K05A 2NBFA 1PZKD 3SS2A 2K7VA 3HOVG 1Y1VL 3PO2L 1QUQB 3BVMA 3OWEB 2HDLA 3WOEA 2WAQP 1SYEA 2O5JC 4GNXC 4UY8C 1SBBB 3CHBD 5HGQA 3HG9A 1PFBA 3UDIA 4ZKCB 1AZQA 2RVLA 4JBWA 4K14A 4Z9CB 1SRUA 2YU9L 2B39A 2KENA 2QL0A 1LTSD 5AI2A 1S4ZA 4OEMB 3S1QL 1R9TL 2DY8A 1KD1C 1EY7A 2BE5C 1SFOH 4BY7H 1F9PA 2VB2X 3S17H 4X3KA 1VDZA 4AR3A 4DK6C 3HOVH 2CR8A 2J9UB 3GTPH 1B4OA 3S1RB 1FNUA 2K5HA 2PZWA 4NP5A 1ZKOA 2F0GA 1IYVA 2OQ0A 1PFUA 1K8MA 2K5NA 4GKKL 5FOBB 2XJRA 2WAQG 2EJGC 1SNQA 4J8QA 3K58A 5ELCA 3DWAA 1E3PA 2NVXB 4DR2Q 3MVVA 3J80c 4PZ6A 4TPUA 2XJUA 3K5NA 1EEFD 3J80i 1Y8PB 4UPAA 1W6KA 2KCNA 2JA5B 2ZJRA 2VNUD 4RHSA 2D0OA 1W6JA 1K8AC 4JBKA 1TU2B 1A3UA 2JA9A 4BY1B 3HOZB 1QG7A 2HDMA 3NPPA 4JPBW 4A3GG 1PTOD 2NTSA 3RLFA 5BR8Q 5ELDA 5M5YB 1TY0A 1KDCA 4A3LL 2FFKB 1EY6A 3P7JA 1I94Q 2F0WA 1RF2D 4A3FL 3ER0A 3RR5A 3CMAA 5NUCA 4XT3B 3S15B 2TSSA 2WKDA 3CRKC 5I9OA 4OIKA 3VR5A 3IFDA 1RJTA 1V1QA 4A3KG 1SN8A 5FLML 4YHHQ 4DNIA 2P5ZX 1RDVA 4LW1A 4DV3L 1HTPA 1IBLL 1Y8NB 2E2IH 3CPWA 5AN9H 4AHZA 5BR8L 1OXTA 1A63A 3G71A 2PQAB 1HFGA 4AIMA 4BBRG 2CQAA 4DAPA 1KL9A 1V1PB 1I94L 1MJCA 2JSOA 6RXNA 1HR0W 4LUZA 3SK8A 2Q2TA 1AP0A 2ZT9C 1U4RA 2R7ZL 4A3GH 1VQEA 4JCVE 3UE1A 4ME3A 2R7DA 8RXNA 4C1NI 4XQNA 2VUML 1KHIA 4BBSB 4K9FA 4AI0A 1I6VC 4KY7A 3H97A 1SMXA 3T1HL 3V05A 3GTGH 1EY4A 1S5DD 3AQQA 3NP8A 2BA1A 1EWIA 2HQEA 1GHJA 2IJ0A 1OXXK 2ZJPA 4DV2L 4A3KH 1IZ6A 5C3EB 4H7BA 5HGTA 5EKKA 3OHXC 2CH4W 5JPMC 3R2TA 5M9OA 2K5DA 4FF1A 2QDLA 3CQZL 2DN8A 3OMCA 1YJWA 2JA6L 2PVXA 1EYDA 4BBRH 1YNXA 2R93B 3I4MG 2KCTA 3H15A 4POFA 3E5SA 2OEOA 2KJXA 1JWSD 4EQPA 3QQCE 5FJ8L 1I6HB 4B3RQ 2Y0SB 3I73A 3CCJA 4HJ7A 1EY8A 5LMNQ 2F0LA 2X69A 1X55A 1SFOL 3EROA 3A54A 4BY7L 4RHRA 3SEBA 2F0NA 3OIQA 1X6OA 3AYHB 4WORA 1CKNB 2UUCL 1BCPD 1HNZL 1HXYD 4X3UA 3J80E 3FKIG 3GTPL 5EGTA 2L55A 5C4JB 1D5XC 1Q3LA 1AEXA 1TWGB 3HOWB 3A44A 1NMGA 4DPGA 4FF2A 1LABA 1QUQA 4IFDG 4G7HC 2K32A 4B3RL 2DUDA 4YCUA 4HN7A 4ZN3B 3I4MH 5LMNL 2EJMA 4GKJQ 3ULJA 1XMQQ 4ULLA 2Y0SP 4DGZA 2PI2A 5I4DA 2JQOA 3I4LA 3I90A 3CCLA 2FMCA 1I50B 3PKJA 5EPJA 2NYDA 1PFMA 4AR4A 2WP8J 3RMHA 4CJ0B 2MO0A 2UU9Q 1PYSB 3I2ZA 4CJ1B 1SNMA 1QJOA 1UE6A 4XIGS 4JBMA 4TRDA 3KYWA 3FKIH 4KKUA 3M7NA 2A73B 2HIXA 5MFZA 4GKJL 1JJCB 1X3PA 1XMQL 5GADc 1Q12A 1VMPA 5HURA 3BVGA 1ZRPA 2K4KA 3S2HB 1YUXA 4IFDH 3AU7A 3CCVA 3L7ZC 4AQYQ 1WOCA 2PNRC 3TP8A 4FF3A 2V3BB 1SNOA 3EN2A 3CCQA 5I2YA 5JVG3 2A8VA 4IO9A 1N34Q 1DVBA 2ID0A 4X66L 1EYAA 3H94A 2VQEQ 4IPCA 3UDFA 2E2IL 1Y1WG 3UDGA 1HZCA 1VQGA 3SK4A 2IWHA 5FKAC 1B7YB 4LF6Q 3GTLH 1HUNA 3OPOA 4KHVA 1RTNA 4ZK9B 3GTKB 1JE5A 2XJPA 4AQYL 5C0XG 1CK1A 3CCRA 1F4LA 4KN7C 2B5ID 4LF7L 2E8GA 4OXPA 3Q24A 4HIDA 2R92L 1EZ6A 4AYBE 1SYGA 3I3CA 5CV5A 3CD6A 1SYFA 1UE7A 2ZIXA 1U4LA 5KGUA 3GTGL 3PIO1 2Z3QB 1KAWA 1TVXA 2MUYA 3CW2C 1PTOC 2JA7L 4LF9Q 1T9OA 2KQ3A 2MP1A 3BZDB 2V0EA 2QF7A 5IGEA 4IUNA 4DV5L 4LF6L 4PG3A 1BDOA 4KJNA 1VCXA 1GOZA 5IWAL 1RB9A 4MNOA 1MKHA 1UWVA 3LNNA 1Y1WH 1QE6A 1M90C 5FO7B 1XWEA 1DGSA 1I5FA 1RHPA 1ICFB 1NE3A 1F9SA 3K7AH 3L0OA 4NB3A 3S14H 1SE2A 1TWAH 2D62A 2CFMA 2PQAA 2XWJB 3NFPI 3KYVA 2K33A 3PL5A 3U4VA 3S16H 4MN3A 3S2DL 1CZGA 4R4QA 1B13A 1V1PA 3MXGA 4ZRZA 4JG2A 3RYGA 1KLUD 3PF5A 1ICWA 4PQXA 3CCSA 1CSPA 4DR3L 3I8ZA 4DNRB 5BN4A 2MNAA 4KK7A 3T51B 3F2UA 5IYCG 3LWEA 1U4MA 1MGSA 1T9PA 3KLSX 1YJ9A 2KA7A 3OTOL 1C7YA 2M2LA 4C3IG 3SGIA 5I2XA 1XTDA 5KYIA 3FEWX 3URYA 2L1BA 3ZJYC 2APOB 3QO2A 1X9NA 3LWRB 4DV1Q 5E4WC 3KF8A 1CZWA 2Z6KC 2C35B 1BQQT 1IL2A 3K0YA 1E2WA 3EFXD 1CHQD 2XJSA 3KJPA 3CAMA 4WFN1 1EFWA 1P8LA 2J7ZA 1J8IA 3JAMc 4U671 3NSWA 2HVYC 3HKSA 5M5WL 3QOJA 1YUZA 5C6AA 4GLXA 2SOBA 1C9OA 3JAMi 4ME5A 1WTWA 4MTKA 1II3A 1ILQA 1O7IA 5IYCH 1MIUA 1TKWB 3WOFA 4IUQA 5IP7H 3FKIL 3GTOB 3T56B 2XJQA 1LTTD 3J81c 4ALPA 1IW7D 2B63H 2AUKA 2BH2A 4C3IH 4YWLA 3J81i 1WTOA 3M4QA 1JE4A 5MLC3 4CDFC 4GNXA 2JA8H 1TT2A 1CI3M 4OHJA 1KABA 3C3LA 1FR3A 1DJRD 1H9MA 4ODGA 5ELEA 5GQOA 1PH4A 3TBIB 4B3TL 1RDPD 2V0FA 4R4IA 4CDEC 4JV5Q 4KN4C 1E2ZA 4FYDA 1GKHA 1EIHA 1RKNA 2I5LX 3S1ML 4QCLA 1N32Q 1HRJA 2PW7A 3MEHA 2YU9B 1PHJA 2F0FA 5CYUA 5JVH3 3GTLL 2ENBA 3A55A 3C46A 2L0ZA 4PV1C 4E6IA 1SLJA 3D4DA 2ATWA 4LFBQ 1YIJA 2ICIA 1EEID 3PIP1 5M3FG 5D65A 1JOKA 5D3DA 3GDEA 3I4OA 2B2VC 5T1GA 3SHLA 1XYIA 3CC7A 1ONLA 4R4TA 2F0TA 4LF5Q 5H1Sc 3ZG6A 4JI5Q 2OF1A 5EJWA 4DV7Q 3OYYA 1MSGA 5JPNC 1UNSA 2OT2A 1DD2A 2QGQA 3W2DA 4K6DA 1XNRL 1M8AA 4EQNA 1VQMA 1N32L 1QYBA 2MO1A 3T4AC 1CUKA 5IGDA 2XVSA 2UUAQ 1C09A 2XWBB 1FJGL 1PFWA 1QILA 1HZBA 3VR3A 4K0KL 5C4XG 2RFKB 1FL0A 3F1ZA 4A3JH 3K7AL 3S14L 1EYCA 4DV7L 5ELFA 1YK5A 2ERJA 2GN5A 1HR0L 1TWAL 4DXGA 3NK9A 2H1EA 2VL6A 3K5LA 1ZXTA 2EQSA 5M3FH 3S16L 4DUYL 5M5XH 1ASZA 3AMUA 5K36G 4OO1I 2F0HA 1GUWA 2XGTA 4G4KA 4KV6A 3GTQH 1S40A 1Y1VG 3PO2G 1K28A 3M3YH 2G9HD 1PTOB 4DK3C 1OWCA 2LXJA 4HIOA 4ZYSA 1QZGA 5M3MG 3FPPA 4A3FB 2VY3A 3H0GL 3DWPA 4QJFA 5GAGC 3I72A 1XJVA 3PF4A 5IYDL 2N88A 3H6MA 1B44D 3KBGA 2BE5D 1TS4A 1TWCH 2SDFA 3E9IA 3RZOB 5C4XH 1EFID 1U4PA 5DM63 2MJ8A 2L9HA 4M1UB 1T5EA 3VYSA 2KHIA 3H3VM 4YIJA 2Q8RE 5JVH1 5EKLA 2FINB 5I6YA 5IP9H 1YI2A 3J81E 1A62A 1X3GA 4ILWA 2R61A 3OW2A 5K36H 1SNCA 2R7ZB 1WJJA 4F87A 1V1OA 2KVMA 5A35A 1S5FD 1Y1VH 3VR4A 3PO2H 3A5UA 2VUMB 4X3SA 5JJKA 1W3SA 4FXDA 1PRTD 3CCUA 5COYA 5M3MH 1X65A 1O7YA 1RTOA 2IX3A 2L12A 5IP7L 2X6GA 2B3GA 2B63L 4HIMA 3HKZE 2AQCA 5I6WA 1QCVA 4C3IL 4B9WA 1BCPF 2HUGA 2JA8L 3SK5A 1PZXA 4GOPA 1TWFH 1WYDA 1R9TH 5CC4A 2EJFC 1STEA 2B2WC 2N55A 2N3SA 3DUZA 5H1SE 1PLFA 2O2LD 1BQ8A 2IT1A 2K28A 2PMZE 4A3EH 1SXTA 4A3LG 3MPSA 1SFOB 3HS0C 3SK6A 4BY7B 4A3FG 3S17B 1PH7A 4BS9A 1VZHA 1F2LA 4X64Q 3HOVB 3GTPB 4P72A 4XT1B 1IBMQ 5FLMG 1U0LA 2Q2UA 1IW7C 3PUWA 3M4PA 4HMIA 1GHKA 3PCOB 1VCIA 3OWFA 3A8JE 1IL8A 5RXNA 2CKAA 1STHA 1VQ5A 4IN3A 2R7ZG 3PKIA 1TY2A 5CMDA 4HSPA 3MEFA 1VQ4A 4A3JL 1AE3A 2RF4A 4P71A 2VUMG 2NUCA 3QIAA 4IJLA 4A3LH 3NBHB 4ABNA 2AYJA 1QVCA 4L5SA 1EOTA 3PMFA 3I91A 5M3FL 5M5XL 2RQXA 4LF8L 1ENAA 1KRTA 4A75A 1RODA 2D5DA 3UE0A 4DV0Q 3M3YL 2A68D 5JEAJ 5EINC 5I9PA 4XQJA 5FLMH 1G2SA 2E75C 2TMPA 2JK8A 3J7Y1 3H09A 3IAYA 1VF5C 4ZAIA 3U9OA 1N33L 1IRNA 3BZCA 4H13C 2JA6G 4AI3A 3FRPB 3WWNB 2NN6H 4I65A 2LXKA 3Q23A 4RCOA 2NYZD 1TWCL 5EBDA 3EJIA 3B08B 5G3LD 2L5TA 1WTHA 2E2IB 5FJ8G 1QZHA 3N6RA 4KI0A 3F2DA 4DUZL 4JI4L 4DV0L 4IALA 1U5KA 2A1AA 5IP9L 2LCQA 5A2QE 1VQAA 3FMCA 3K6OA 3VYTA 1RD9D 1D7QA 3D8GA 1LLRD 4A3GB 1KAAA 3T1YQ 3JC66 4TQUS 3HOYG 4UP9A 4DR4L 5M3ML 1LTAD 3GTGB 3CQZH 2I46A 4S3SA 1T9QA 4JI2Q 1KIXA 2JA6H 2Q8TA 5EPLA 3KYXA 4A3KB 4DR1Q 3AB9A 3TS2A 2NVTL 5FJ8H 4IUVA 3M85A 1TWFL 3T1YL 1LKMA 4RGMA 1KTKA 4BBRB 1SMYD 3E6ZX 5FO9B 1EU3A 2J0TD 3J7AF 1IKMA 4JI2L 1FNWA 4OX9Q 1HHVA 3M7GA 1BOSA 1M4VA 1Q90A 4EQOA 3V96A 5FLXL 4A3EL 2XIWA 3KF6B 3HOYH 2B8GA 1ZYRD 1STAA 1BBUA 3PWFA 1E8JA 4RG1A 4XTCS 3U4ZA 2EYLA 3TQYA 3OOCA 2WV6D 1NUCA 2F4VQ 1PRTC 3S1NL 1JORA 4B3SQ 4R1JA 1CA5A 1EL0A 3NWTA 4OWXB 1NCVA 3DWQA 3H3VH 1JT8A 4HR7B 1F77A 2R6GA 2IX0A 1MSHA 1FD7D 3I4MB 1CAAA 2YYZA 2LSSA 2MHVA 2DNCA 2WAQE 1IBKQ 1ILPA 3R3OA 3D6CA 4RFBA 2Z6KA 5IY0A 1L1OC 1SAPA 3H91A 4RWSC 3Q6SA 2E2JB 2V4DA 4HMJA 3B6YA 2WB1E 2QCPX 2F4VL 2G9DA 3D3RA 5KNCA 4DR2L 2PNHA 4GS3A 2R92G 3AFPA 3KLSA 2VQFQ 4L5TA 1SMMA 2SNMA 2JA7G 3AFQA 1I3QH 2ZXRA 1XNQQ 1H9JA 1G291 4RMFA 3VA5A 3FKIB 1P16A 4CJ2C 4CHTB 3NUCA 1XPUA 2WACA 1DM0B 3GV3A 1TWHH 3JC62 4QUCA 1YNJD 5EAYA 2NVYB 2XRQD 1S72A 5GAHC 5C5LA 4XYQA 5IIFA 1EIGA 2F3VA 3P2AA 5IGBA 2YTYA 3NELA 2K1BA 1AZPA 5KNBA 2D2CC 5IE8A 1EY9A 2O4XA 3RD4A 1VQLA 2IHFA 4DAYA 1BO0A 4J15A 1L0WA 5AJ3Q 2ZXPA 2XTIA 4IQZA 3FVQA 3CXCA 3HFZB 4LJZC 1B9NA 1XNQL 3I55A 2PI2E 1JOQA 3HOXH 4DFAA 2R92H 2LFNA 1TS5A 1YNND 1AW7A 1Q7YC 3GTLB 4DV6Q 1STYA 2CKCA 2B2TC 4YHHL 2JA7H 3TEHB 1H9RA 3NBHA 1G2TA 2BDOA 1K83H 2B2VA 3QOLA 4B9XA 1EUJA 1B70B 5AJ3L 1D6EC 2I5MX 4GOPC 2B8FA 1OXUA 3W1GA 1PZJD 3KF8B 4DR7Q 1S5CD 1O80A 2GVAA 3MSUA 5GROA 2C6AA 2A68C 3MFYA 4FNFA 4JBJA 2MS3A 3HOUG 4LK1C 1VQOA 3QVDA 1CTMA 2FHTA 1DZ1A 5DLQE 1Y1WB 3S2DH 4RKBA 2I0QA 3KK7A 1KLGD 3HZXA 1N8RC 3NE5B 5C44G 4A93H 2SNSA 3K7AB 3S14B 5D14A 1TWAB 2Q2IA 2BOSA 2CKZB 4KKTA 3S16B 2KHSA 3EIVA 4O0AA 1BE7A 5FO8B 1A8VA 2PQEA 3PIO3 3PIOA 4GNXB 3G4SA 3HOYL 3F2BA 2UXDQ 4UP8A 1NTGA 1I4QA 4KHPQ 2MGSA 4H02A 4AI2A 4XXEA 4KY5A 1G6ZA 4RCNA 2C9OA 3HOUH 4IFDI 1VQ9A 1IROA 1NXGA 2JI1A 1FVIA 5LL6S 2EE1A 2MFIA 5C3WA 1A6XA 4LFAQ 4A3DH 3KYHC 5C44H 1VQIA 3K8AA 1RIPA 3I70A 1DXMA 5M5WH 2WIIB 4KHPL 2YV5A 4QF4A 3SVMA 1E22A 2F52A 3RZDB 3DEPA 1WVLA 1R0HA 2RCNA 4LWCA 2NVQH 3G48A 3W3AA 1JB3A 5BN5A 4BY1H 2AHOB 3HOZH 1SMYC 4EQ5A 3ND9A 3B0AB 2AQ2B 4DN4M 4HJ5A 1VQPA 4X62Q 5CORA 1EWCA 3TS0A 3RN5A 1I3QL 3KF6A 1PRTB 3GTMH 4A3BG 3PUXA 2B2UC 3DXJC 1VF7A 1X3QA 2MQHA 2PZUA 1YK4A 4LHLA 3VPBE 1ZYRC 3SE0A 2UU9L 3TMEA 1HTLD 1TWHL 4C3IB 4MZ9A 1O78A 1E2VA 4FXKC 3OIPA 5CV9A 3S1MH 5ISRA 2H4OA 4PZ7A 3Q8DA 2JA8B 4DR6Q 1HJPA 1VQBA 1TS3A 4IURA 3TSSA 4B3MQ 1SSOA 4FP5D 1L1OB 4WFN3 1Z7TA 2Z9HA 1F2YA 2HIVA 4U673 3BJUA 1LTGD 2B2WA 4OWTB 2H12A 3HOXL 3DHQA 4G6BA 2I5HA 2Z6BA 3C2PA 4AYBG 4BWGB 1N34L 1MJEA 5L37A 2AWNA 3J7A5 3PUYA 5C0XI 5DEHA 1XX8A 2VQEL 2Y0SE 1GUTA 4KY6A 3H0GG 4A3BH 4DR6L 1K83L 4UP7A 4B3ML 1LUZA 1PYBA 4GLAC 4OONA 5IYDG 2JEAI 3PUVA 4FF4A 2QKIC 1I4XA 3OMGA 4H44C 1R4PB 1X3FA 3OSOA 4LMQD 3GO5A 1ENFA 1SNPA 4YY3Q 1YNJC 4XQQA 1YV1A 4RGNA 2OWOA 1S2ZA 5E1FA 4YCVA 4LF9L 1VQCA 1Z9FA 3D31A 3N52A 1I4GA 4A93L 3NQIA 4JW0A 4N9TA 3TN2A 4QY7A 4JC0A 3PIP3 4A3JB 4JI3Q 3PIPA 1PH2A 2DY7A 3KJOA 5J22A 1F2ZA 4A3MH 4RA8A 3H0GH 2E74C 4I7AA 5M3FB 1YNNC 5M5XB 3GTJH 5IP7G 4LUVA 3PO3G 4YY3L 1YHQA 2B63G 4GOPB 4KKSA 3GTQB 5IYDH 3M3YB 1VQ8A 1U9RA 2E5LQ 1TWGH 4FVMA 3MHBA 5IODA 2JA8G 3IU3I 1LM0A 4IUTA 4X65Q 3HOUL 2K01A 2XN9C 4NPSA 3MXPA 1WI5A 2JN4A 3VR2A 1KDAA 4RH6A 3GQBA 3TRZA 2KCCA 2PO4A 1L0XB 2VS1A 1TWCB 4KJOA 3F8TA 4NXMQ 1F9QA 3DEOA 4A3DL 5C4XB 5C44L 4Y7NH 1Q82C 2DNEA 4CDCC 4DK1A 1B53A 4K5WA 2F0DA 1RWDA 1VQDA 3IFTA 1I50H 4J1MA 1Q86C 2HD3A 3K5OA 1Q46A 3J80L 2AUSB 4R8IA 4X65L 2NVQL 2K5VA 3PO3H 3MQKB 1BUVT 1B50A 4BY1L 3HOZL 3VA7A 3DMUA 4DV1L 1PH5A 1Y1VB 3PO2B 2K2DA 5IYBH 2IW3A 3NXWA 1CA6A 4ZCKA 1HH2P 3KUPA 4C1NK 5M3MB 4N8FA 4NXML 1KRSA 3GTML 2F0SA 4QQBX 2PVEA 3S15L 1ENCA 2J4XA 1EQTA 4N9PA 1DOMA 5MFPA 5AI3A 4LAAA 1PXUA 5GAEC 3H9CA 3H3VC 2R3ZA 1TWFB 1LTRD 4IUPA 4A3JG 3S1QB 3BDLA 1PV4A 1S5BD 1R9TB 4BXXH 3LWVB 1XMOQ 2A6HC 1SMUA 2HR5A 3KOJA 2DSXA 3RZTA 2VZAA 5CV6A 1IYJB 4JV5L 4A3IG 1K9MC 4RGOS 3MXNB 2Z4IA 1PH3A 1PTOF 1LTBD 4DNTB 4A3BL 3D4WA 5C0XJ 1UE5A 2QDBA 3NENA 5J3BA 4LFBL 1WTRA 2E2HH 4U68A 3KYYA 1B2JA 3ERQA 4LF5L 4JI5L 2C6BA 3MZ5A 3TDQA 1GM5A 3MC0B 4UDUC 5IP9G 4KMUC 1JR0D 5J1ZA 5C4ZA 4ZN1B 4TSSA 1KNEA 1I4HA 1L1OA 3MAQA 2UUAL 4JI8Q 2VXWA 2CCZA 2N78A 2KCMA 5JOBA 4A3IH 3IKJA 4A3ML 1VZIA 3TZUA 1JOOA 1J5EQ 5JEAG 2OQKA 3GTJL 3IRBA 4L5QA 4CGYB 3R8BA 1EY5A 4C2MH 1EOVA 1GUNA 5K5PA 1D8LA 1WTQA 1IKLA 3R93A 3CC2A 4QB4A 4MHEA 3JAME 1TWGL 4AHXA 4E6YA 1RDGA 4HSVA 4CBVA 2ZXOA 3NQTA 1LKPA 3J81j 3LX0A 4NDXA 1Q8KA 4JI8L 3LWQB 2WKCA 1F2MA 2YTVA 1IU6A 2RDHA 2F0MA 3Q0AA 2PMZP 4FXGC 2K6AA 2FJ2A 4NMZA 1TS2A 1STGA 4Y7NL 4GZYC 1H9SA 3ERSX 2ZM6Q 4A3EG 4JYAQ 4UHVA 1G8ZD 2F0EA 1I50L 5JEAH 3DM1A 3LWUA 2B2TA 4UAIA 3PO3L 3J7Z1 3BDOA 2EYFA 1R4QB 3KLWA 3HKZG 3IL8A 5IYBL 2IHEA 2UXCQ 3O13A 3PZAA 4GS7D 1Y8OB 2NVTH 3BU2A 3HP3A 3CQZB 1HQRD 3D0FA 5CV7A 5C4HA 4C3HG 4O2DA 2YTXA 3M4OH 3NEMA 3DM3A 4P2CB 3S2HL 4HCSA 3BYTB 2JA6B 2ZM6L 3L3OC 4KLKA 1DCZA 4YWMA 3M4YA 4PNYA 2RKSA 1OWBA 2VB3X 3TP7A 1MBYA 2A69D 4BXXL 1Q1EA 3NTKA 2PPBC 1PH8A 1FYCA 1RYQA 2PPTA 1HA6A 3W1BA 1GXDC 2RBMA 3K7UC 4P73A 1XPRA 1LO5D 4V0BA 3S1NH 4X6AL 1PH6A 1ASYA 4AR5A 3HOYB 1EIFA 1ET9A 4AHWA 4DAYB 4C3HH 5E7NA 1WD0A 1AN8A 1EIYB 4ZUIA 4IOCA 1YBYA 5CR3A 2UXBQ 3MTSA 3SDZA 4G57A 2NN6G 1QNKA 1JQYD 3CRLC 1DYQA 4R4CA 2E2HL 3STBD 4NXNQ 4X64L 5E3FA 1BFYA 1IBML 1GO3E 4EX5A 5IGFA 1VS0A 2LY7A 3Q22A 3M9BA 2N8NA 2Q8IB 2PSMC 1IYUA 2G5DA 4DU9A 4ZUJA 4C3JH 2UXBL 1Q8IA 4Q0FA 4TKOB 4A3IL 3HAXC 1WCMH 2B2YA 3V2TA 5T1IA 3RN2A 3BS1A 4HTHA 5IOCA 2E76C 3X3NA 2KN9A 1I3QB 1KNAA 4AR6A 4JI1Q 3MXNA 1LYLA 3K59A 1PYWD 2ZTDA 1GUOA 2B2UA 3U9SA 2EYOA 2VW9A 1TWHB 5KNDA 5DM71 1E0BA 1IU5A 2RHQB 2ASBA 4C2M1 1WD1A 2EYMA 1BF4A 2IY5B 3OW7A 3K57A 2CW0D 3WWLA 2GMGA 1BR9A 1HQMC 1IHZA 3NWSA 5GAGc 4NW2A 3K81C 5IGCA 2B29A 3FPUB 3R2IA 5LL6X 2R92B 4PMWA 4QIWE 1EWHA 2AQ3B 3QG1A 4Y52H 3SR1A 2JA7B 4OGQC 2D0PA 2JJQA 1X56A 1K83B 1JWUD 3FHWA 4IUUA 4JOIC 1ODHA 3JAML 5K2ME 1H7VA 4DK0A 1JWMD 3GV6A 1E1OA 4IJHA 3KDFB 1ET6A 3M4OL 1PVOA 2UUBQ 5KYLA 3H3VI 1R0FA 1QNUA 3NHHA 4DKAC 3J81L 3E9HA 5J39A 2WB1P 1YVCA 1PMRA 5CV4A 3H9BA 4IPGA 3HEJA 4QMGA 5JJLA 1Z6HA 3P1HA 1HCZA 2HCCA 4OWWB 3S2DB 4CDDC 3A5ZB 1BKBA 4DR1L 3LGJA 3I4NH 4A93B 2M9VA 1D1KA 1HPCA 2L0CA 3J7ZC 4GKKQ 3ULLA 1A2UA 4O42A 3CF5A 2EYJA 4XYOA 1VQ7A 2UUBL 1F9RA 1TR5A 2EIFA 5KEEA 1IXRA 1SNDA 1P7PA 4F7XA 4OELB 1YJNA 4OX9L 4C3HL 1K0RA 4F8MA 1K8OA 5EPKA 1LTLA 4APVA 1G51A 2M6PA 4R4OA 3HOUB 1S3OA 3CMEA 1PH9A 2K5WA 1A3TA 2R7FA 1BBXC 1UE1A 1MI2A 1TQOA 5MF6A 1JJ2A 2WB1G 4POGA 4PMCA 1HNWQ 2RCFA 3HOXG 5C44B 4G7ZC 4B3SL 4A3DB 5GADC 4L5RC 5M5WB 4HEDA 1TXYA 1SMWA 2OXPA 2A69C 4O1NA 2F4IA 2K52A 2RSNA 2V1CC 4C3JL 3LWOB 1HZ9A 1QVFA 2NVQB 2EYPA 1ESRA 2F0UA 1IBKL 1IBLQ 4K6LA 1WCML 4DV3Q 1C8CA 1KQSA 1EQRA 2PW5A 4C56C 1HNWL 2EDGA 2XJTA 1DX8A 1S30A 3TP6A 3GTMB 2MPMA 3BYYB 2Z1CA 2VQFL 2AUJD 1GVPA 2CWPA 4GN4B 4HJ8A 2NTTA 1K0SA 4Q5VA 3K80C 2NZOA 4V190 3S1MB 3I7FA 3NTHA 4A93G 1FNVA 1A15A 3T1HQ 3RZOL 3ITPA 3STBC 3C1FA 3LNLA 5JJZA 3NBIA 1WTVA 2BCOA 4DV2Q 2ES2A 1LT6D 3D4RA 2NZ1D 3A7LA 3CU7A 1GD7A 2M00A 2EY4E 2M4YA 4B08A 4HAEA 4Y52L 1STBA 3SXHA 2F1MA 1NAPA 3TP5A 3PUZA 1EQQA 4G7OC 2LS01 1JMCA 1QWYA 1UEBA 2F0OA 2L15A 4A3BB 5EIOC 4DV6L 1V8QA 4V196 3PQIA 1PFVA 2BA0A 2H5XA 4DF7A 1C4QA 5C3XA 1EY0A 4A3DG 1L2FA 2KEDA 4IPDA 5A2QL 1KXLA 3U50C 1CADA 2NWGA 2UUCQ 1VQNA 3FDJA 1HNZQ 1ZEQX 4DR7L 5ELBA 1YEZA 2JA5G 3CP0A 3UDXA 3WWVA 1JCKB 1PZID 2RDFA 1WJVA 4BY1G 4AYBB 3HOZG 1LACA 2A5HA 3I4NL 1T5XD 2CW0C 3HJWB 2F03A 4AHYA 1LV9A 2SEBD 5IGGA 5CBAE 3S1RH 4I7ZC 1E24A 2F0IA 4A3MB 1AFPA 2JI3A 3EQLC 4MTNA 3H0GB 4ID6A 3GTJB 2ERSA 1B8AA 1Y69U 1PRTF 2EY6A 3S17L 3VYRA 1NNQA 1O7ZA 4JAFA 1NXEA 1O7LA 3A0JA 3HOVL 2NVXH 1SJHD
chains in the Genus database with same CATH topology
7RXNA 2A6HD 1R0JA 3GD7A 2UXDL 1JB7A 3KDFA 1E1TA 2JA5H 1JJGA 1H95A 2E2JH 3E0EA 1B2OA 1S24A 5M5YH 4BBSG 4LFAL 2PYAA 2RDVA 1BRFA 2A19A 3CCEA 4X66Q 5JJIA 1C0AA 3K0XA 5ELNA 3S15H 2RHSB 3P8BA 2GVBA 5C3EG 4B8CD 2NVYH 1HNXQ 4X62L 5IT9c 4HJ9A 2Z0SA 2R93G 4LF7Q 3RNUA 2K75A 5GAHc 1HZAA 4BBSH 2Y0SG 3G6EA 3PSIA 1R0IA 4A3MG 4DV5Q 4LFCQ 3AEVA 1PH1A 1VQKA 5IWAQ 1HNXL 4DR5Q 1G6PA 1W2BA 1BQ9A 5C3EH 1OXVA 4GN5A 3HOWG 2ZTEA 2CQOA 4FDBA 4RXNA 2Z3RB 2R93H 4KHZA 4LFCL 1CSQA 1N9WA 2A6ED 4DR5L 1PA6A 4DR3Q 4A4IA 4HJAA 1I6HH 3CC4A 1B71A 1V43A 1A0IA 3OTOQ 4JAEA 1SE8A 5MGNA 5IYBG 3RLOA 5C4JH 4P74A 3HOWH 4DV4Q 1J6QA 4JI3L 2JE6I 1CKOA 1JYBA 1FHHA 3EBEA 4YWKA 4IFDJ 5JVG1 2DGYA 4BXXG 1R0GA 2CWAA 2E5LL 4P75A 3KYUA 4HIKA 4DV4L 2JEBI 3RZDH 2ZTCA 3L2PA 3CPFA 3S2HH 4LUOA 3RZ6A 4B3TQ 4A3CG 4JOIA 1OTCA 2K14A 5LMUQ 2Q2HA 1CKNA 3JC63 3F2CA 5FLXc 4JI6Q 1K8GA 3GTKH 1SR3A 4X6AH 2QA4A 2AKWB 1NY4A 4JI7Q 4JAGA 1XNRQ 1M1KC 4IOAA 1RYTA 1NMFA 5LMUL 4QGUA 1WFQA 4A3CH 1YITA 1FJGQ 4TVAB 1XMOL 4K0KQ 1NJIC 3W5OA 4JI6L 2WFWA 1Q1BA 2KKDA 1HR0Q 1Z47A 4YCWA 4JI7L 3PGZA 4DUYQ 2EXDA 3TREA 1VQJA 4WJ3M 1YHBA 3K35A 1E7ZA 4OO1G 1YZ6A 2O5JD 4IPHA 1BBWA 5HY6A 3A74A 4XGHA 1J5EL 1Z92B 3I56A 4JADA 4UY81 4WJ4A 2KBNA 3ULPA 4BA1I 4A76A 2N49A 4LNQA 1K73C 1LKOA 1V9PA 3FP9A 3GTOH 3PV0A 2FXQA 1EYGA 1BVSA 2AWOA 4JYAL 4GLVB 2AMCB 5LMNW 4XXBB 1QVGA 1OXSC 1T9HA 1CKMA 1X54A 2UXCL 1X3EA 2YU9H 2M6OA 3S1QH 1VQ6A 1NBWA 4GN3B 4LHNA 5GAEc 1WCMG 3S24A 2HT1A 3KFUA 2IX1A 4LF4Q 1VQFA 2KHJA 3ICEA 4PZ8A 2M4VA 2ALYB 2QEXA 2NN6I 2NZHA 2K50A 1AE2A 2HHHQ 5ELOA 4QL5A 2JI2A 4LF8Q 1Q81C 1N36Q 2OTLA 1FGUA 4LF4L 1VQHA 2OTJA 1SROA 1XPOA 5DM61 4BA2I 3DLLA 1YHAA 3U58A 1N33Q 4NXNL 4DAMA 2HHHL 1Y14B 4AH6A 4A3FH 1N36L 2HQLA 3CCMA 2F3IA 4JI0Q 1KC8C 4DUZQ 4JI4Q 1FHMA 3BZKA 3LPEB 3RLNA 3RZOH 1PFSA 1AH9A 1K3RA 4TVMA 4JI1L 4AI1A 2XJVA 4DR4Q 3I4NG 2R7ZH 2BH8A 2ZJQA 4JI0L 3VDYA 2VUMH 4BY7G 1RL2A 2OCEA 1VZGA 3SS2A 3HOVG 1QUQB 4GNXC 4UY8C 5HGQA 3UDIA 4JBWA 1SRUA 2KENA 2QL0A 5AI2A 1KD1C 1SFOH 4BY7H 3S17H 4AR3A 4DK6C 3HOVH 2CR8A 2J9UB 3GTPH 2K5HA 2OQ0A 2K5NA 4GKKL 2XJRA 2WAQG 1E3PA 4DR2Q 3J80c 4PZ6A 4TPUA 2XJUA 3J80i 4UPAA 2ZJRA 2VNUD 2D0OA 1K8AC 4JBKA 2JA9A 4A3GG 5BR8Q 3RLFA 1I94Q 3ER0A 3RR5A 3CMAA 1V1QA 4A3KG 1SN8A 4YHHQ 4DNIA 4LW1A 1RDVA 1IBLL 4DV3L 2E2IH 3CPWA 5AN9H 4AHZA 5BR8L 1OXTA 1A63A 3G71A 2PQAB 4AIMA 4BBRG 1KL9A 1I94L 1MJCA 6RXNA 1HR0W 4LUZA 2Q2TA 4A3GH 1VQEA 4JCVE 3UE1A 4ME3A 2R7DA 8RXNA 1KHIA 4K9FA 4AI0A 1SMXA 3T1HL 3GTGH 3AQQA 2BA1A 1EWIA 1OXXK 2ZJPA 4DV2L 4A3KH 1IZ6A 1YJWA 2PVXA 4BBRH 1YNXA 3I4MG 2KCTA 3H15A 4POFA 3QQCE 4B3RQ 3CCJA 4HJ7A 5LMNQ 1X55A 1X6OA 3AYHB 1CKNB 2UUCL 1HNZL 3FKIG 3A44A 1NMGA 4DPGA 1QUQA 4IFDG 4B3RL 2DUDA 4YCUA 4ZN3B 3I4MH 5LMNL 4GKJQ 3ULJA 1XMQQ 2PI2A 2JQOA 3CCLA 3PKJA 2NYDA 4AR4A 2WP8J 2MO0A 2UU9Q 1PYSB 3I2ZA 4XIGS 1UE6A 4JBMA 3KYWA 3FKIH 3M7NA 2HIXA 5MFZA 4GKJL 1JJCB 1XMQL 5GADc 1Q12A 1ZRPA 2K4KA 1YUXA 3CCVA 3L7ZC 4AQYQ 1WOCA 2V3BB 3EN2A 3CCQA 2A8VA 4IO9A 1N34Q 1DVBA 2ID0A 4X66L 2VQEQ 4IPCA 3UDFA 1Y1WG 3UDGA 1HZCA 1VQGA 1B7YB 4LF6Q 3GTLH 1JE5A 2XJPA 4AQYL 5C0XG 3CCRA 2B5ID 4LF7L 2E8GA 4OXPA 4HIDA 4AYBE 3CD6A 1UE7A 2ZIXA 3PIO1 2Z3QB 1KAWA 3CW2C 4LF9Q 1T9OA 2V0EA 4DV5L 4LF6L 4PG3A 1VCXA 5IWAL 1RB9A 4MNOA 1MKHA 1UWVA 1Y1WH 1M90C 1DGSA 1I5FA 1NE3A 3K7AH 3L0OA 4NB3A 3S14H 1TWAH 2D62A 2CFMA 2PQAA 3NFPI 3KYVA 3U4VA 3S16H 4R4QA 1B13A 4JG2A 3RYGA 3PF5A 3CCSA 1CSPA 4DR3L 2MNAA 5IYCG 1T9PA 1YJ9A 3OTOL 1C7YA 3SGIA 1XTDA 3ZJYC 1X9NA 4DV1Q 2Z6KC 2C35B 1IL2A 2XJSA 3KJPA 3CAMA 4WFN1 1EFWA 1P8LA 3JAMc 4U671 3HKSA 1YUZA 4GLXA 1C9OA 3JAMi 1O7IA 5IYCH 1MIUA 5IP7H 2XJQA 3J81c 4ALPA 1IW7D 2B63H 2BH2A 4C3IH 4YWLA 3J81i 3M4QA 5MLC3 4GNXA 2JA8H 5GQOA 1PH4A 4B3TL 2V0FA 4R4IA 4JV5Q 1GKHA 2I5LX 1N32Q 1PHJA 2L0ZA 1SLJA 2ATWA 4LFBQ 1YIJA 3PIP1 5M3FG 3GDEA 3I4OA 3CC7A 4R4TA 4LF5Q 5H1Sc 3ZG6A 4JI5Q 4DV7Q 3OYYA 2QGQA 1XNRL 1VQMA 1N32L 1QYBA 2MO1A 1CUKA 2UUAQ 1C09A 1FJGL 1HZBA 4K0KL 5C4XG 1FL0A 3F1ZA 4A3JH 4DV7L 1YK5A 2ERJA 2GN5A 1HR0L 2VL6A 5M3FH 2EQSA 1ASZA 4DUYL 5K36G 5M5XH 4OO1I 2XGTA 3GTQH 1S40A 1Y1VG 3PO2G 3M3YH 4DK3C 1OWCA 2LXJA 4HIOA 1QZGA 5M3MG 2VY3A 4QJFA 5GAGC 1XJVA 3PF4A 2BE5D 1TWCH 3E9IA 5C4XH 2KHIA 5JVH1 5IP9H 1YI2A 1A62A 1X3GA 3OW2A 1WJJA 1Y1VH 3PO2H 3A5UA 5JJKA 1W3SA 3CCUA 5M3MH 1X65A 2B3GA 4HIMA 3HKZE 1QCVA 4GOPA 1TWFH 1WYDA 1R9TH 2N3SA 5H1SE 1BQ8A 2IT1A 2PMZE 4A3EH 4A3LG 3MPSA 4A3FG 1PH7A 1VZHA 4X64Q 4P72A 1IBMQ 5FLMG 1U0LA 2Q2UA 3PUWA 3M4PA 3PCOB 1VCIA 5RXNA 2CKAA 1VQ5A 2R7ZG 3PKIA 3MEFA 1VQ4A 1AE3A 2RF4A 4P71A 2VUMG 4IJLA 4A3LH 3NBHB 2AYJA 1QVCA 4L5SA 4LF8L 1KRTA 4A75A 3UE0A 4DV0Q 2A68D 5JEAJ 5EINC 5FLMH 2JK8A 3J7Y1 1N33L 1IRNA 3BZCA 2JA6G 4AI3A 3WWNB 2LXKA 3B08B 5FJ8G 1QZHA 4DUZL 4KI0A 3F2DA 4JI4L 4DV0L 1U5KA 2A1AA 2LCQA 1VQAA 1D7QA 3T1YQ 3JC66 4TQUS 3HOYG 4UP9A 4DR4L 3CQZH 1KIXA 1T9QA 4JI2Q 2JA6H 3KYXA 4DR1Q 3TS2A 5FJ8H 3M85A 3T1YL 1LKMA 4JI2L 4OX9Q 3KF6B 3HOYH 1BBUA 3PWFA 1E8JA 4RG1A 4XTCS 3U4ZA 3TQYA 2F4VQ 4B3SQ 4R1JA 4OWXB 3H3VH 1JT8A 2R6GA 2IX0A 1CAAA 2YYZA 2LSSA 2WAQE 1IBKQ 2Z6KA 5IY0A 1L1OC 3B6YA 2WB1E 2F4VL 4DR2L 2PNHA 4GS3A 2R92G 3AFPA 2VQFQ 4L5TA 1SMMA 2JA7G 3AFQA 1I3QH 1XNQQ 1G291 4RMFA 1P16A 1XPUA 1TWHH 3JC62 5EAYA 1S72A 5GAHC 3P2AA 2YTYA 3NELA 5IE8A 1VQLA 2IHFA 4J15A 1L0WA 5AJ3Q 2XTIA 3CXCA 3HFZB 1XNQL 3I55A 2PI2E 3HOXH 2R92H 1Q7YC 4DV6Q 2CKCA 4YHHL 2JA7H 3TEHB 1K83H 1EUJA 1B70B 5AJ3L 2I5MX 4GOPC 1OXUA 3W1GA 3KF8B 4DR7Q 2GVAA 3MSUA 5GROA 2C6AA 4JBJA 2MS3A 3HOUG 1VQOA 3QVDA 5DLQE 3S2DH 2I0QA 1N8RC 5C44G 4A93H 2Q2IA 2CKZB 3EIVA 4O0AA 1BE7A 1A8VA 3PIOA 4GNXB 3G4SA 3F2BA 2UXDQ 4UP8A 1NTGA 4KHPQ 4H02A 4AI2A 3HOUH 4IFDI 1VQ9A 1IROA 1NXGA 2JI1A 1FVIA 2MFIA 4LFAQ 4A3DH 3KYHC 5C44H 1VQIA 3K8AA 1RIPA 5M5WH 4KHPL 2YV5A 1E22A 2F52A 1R0HA 2RCNA 4LWCA 2NVQH 3G48A 4BY1H 2AHOB 3HOZH 4EQ5A 3B0AB 4HJ5A 1VQPA 4X62Q 3TS0A 3RN5A 3KF6A 3GTMH 4A3BG 3PUXA 2MQHA 1YK4A 4LHLA 3VPBE 2UU9L 4MZ9A 3S1MH 4PZ7A 3Q8DA 4DR6Q 1HJPA 1VQBA 4B3MQ 1L1OB 2HIVA 3BJUA 4OWTB 2H12A 4G6BA 2I5HA 4AYBG 1N34L 3J7A5 1MJEA 2AWNA 3PUYA 5C0XI 2VQEL 2Y0SE 3H0GG 4A3BH 4DR6L 4UP7A 4B3ML 1LUZA 1PYBA 4GLAC 4OONA 5IYDG 2JEAI 3PUVA 1X3FA 3GO5A 4YY3Q 1YV1A 2OWOA 1S2ZA 4YCVA 4LF9L 1VQCA 1Z9FA 3D31A 4QY7A 4JC0A 4JI3Q 3PIPA 1PH2A 3KJOA 4A3MH 3H0GH 3GTJH 5IP7G 4LUVA 3PO3G 4YY3L 1YHQA 2B63G 4GOPB 5IYDH 1VQ8A 2E5LQ 1TWGH 2JA8G 3IU3I 1LM0A 4X65Q 4NPSA 1WI5A 3TRZA 2VS1A 3F8TA 4NXMQ 4Y7NH 1Q82C 1RWDA 1VQDA 1I50H 1Q86C 1Q46A 4X65L 2K5VA 3PO3H 4DV1L 1PH5A 2K2DA 5IYBH 1HH2P 4NXML 1KRSA 4QQBX 2PVEA 5MFPA 5AI3A 5GAEC 4A3JG 1PV4A 4BXXH 1XMOQ 1SMUA 2HR5A 3KOJA 2DSXA 3RZTA 2VZAA 1IYJB 4JV5L 4A3IG 1K9MC 3MXNB 1PH3A 5C0XJ 1UE5A 3NENA 5J3BA 4LFBL 2E2HH 3KYYA 1B2JA 4LF5L 4JI5L 2C6BA 1GM5A 5IP9G 4ZN1B 1L1OA 2UUAL 4JI8Q 2CCZA 2N78A 2KCMA 4A3IH 1VZIA 1J5EQ 5JEAG 2OQKA 3IRBA 4L5QA 4C2MH 1EOVA 1D8LA 3CC2A 4AHXA 4E6YA 1RDGA 1LKPA 3J81j 1Q8KA 4JI8L 2YTVA 1IU6A 3ERSX 2ZM6Q 4A3EG 4JYAQ 3J7Z1 3KLWA 3HKZG 2IHEA 2UXCQ 3PZAA 4GS7D 2NVTH 3BU2A 3D0FA 4O2DA 2YTXA 3M4OH 3NEMA 3DM3A 2ZM6L 4KLKA 4YWMA 1OWBA 2A69D 1Q1EA 1PH8A 1RYQA 2PPTA 3W1BA 3K7UC 4P73A 1XPRA 3S1NH 1ASYA 1PH6A 4AR5A 1EIFA 4AHWA 4DAYB 4C3HH 5E7NA 1EIYB 4IOCA 1YBYA 2UXBQ 2NN6G 4R4CA 3STBD 4NXNQ 4X64L 1BFYA 1IBML 1GO3E 4EX5A 1VS0A 3M9BA 2N8NA 2PSMC 4C3JH 2UXBL 1WCMH 3RN2A 2KN9A 4AR6A 4JI1Q 1LYLA 2ZTDA 2VW9A 5DM71 1IU5A 2RHQB 2ASBA 2IY5B 3WWLA 2GMGA 5GAGc 3K81C 2B29A 4PMWA 4QIWE 4Y52H 2D0PA 2JJQA 1X56A 3FHWA 4JOIC 1ODHA 5K2ME 1H7VA 1E1OA 4IJHA 3KDFB 1PVOA 2UUBQ 3H3VI 1R0FA 4DKAC 3E9HA 1YVCA 4IPGA 5JJLA 4OWWB 3A5ZB 1BKBA 4DR1L 3LGJA 3I4NH 3J7ZC 4GKKQ 3ULLA 3CF5A 1VQ7A 2UUBL 2EIFA 1IXRA 1YJNA 4OX9L 1K0RA 1LTLA 4APVA 1G51A 2M6PA 4R4OA 1S3OA 3CMEA 1PH9A 2R7FA 1UE1A 1JJ2A 5MF6A 2WB1G 4POGA 1HNWQ 3HOXG 4B3SL 5GADC 4L5RC 1TXYA 1SMWA 2K52A 2V1CC 1HZ9A 1QVFA 1IBKL 1IBLQ 4DV3Q 1KQSA 1EQRA 1HNWL 2XJTA 1DX8A 1S30A 2VQFL 1GVPA 2CWPA 4GN4B 4HJ8A 3K80C 2NZOA 3I7FA 4A93G 3T1HQ 3STBC 3LNLA 4DV2Q 2ES2A 1GD7A 2M4YA 3PUZA 1EQQA 1JMCA 1UEBA 2L15A 5EIOC 4DV6L 4V196 2BA0A 2H5XA 4A3DG 1L2FA 4IPDA 1KXLA 3U50C 1CADA 2UUCQ 1VQNA 1HNZQ 4DR7L 1YEZA 2JA5G 3CP0A 3UDXA 3WWVA 1WJVA 4BY1G 3HOZG 4AHYA 3S1RH 1E24A 2JI3A 4MTNA 2ERSA 1B8AA 1NNQA 4JAFA 1NXEA 3A0JA 2NVXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 H;  1Q86 C;  1SFO H;  1Q46 A;  4BY7 H;  7RXN A;  1R0J A;  4X65 L;  2K5V A;  4LF5 L;  3S17 H;  3PO3 H;  3GD7 A;  2UXD L;  4GOP A;  1TWF H;  1JB7 A;  4DV1 L;  1PH5 A;  4AR3 A;  1WYD A;  3KDF A;  4DK6 C;  1R9T H;  2K2D A;  5IYB H;  3HOV H;  3GTP H;  1E1T A;  2JA5 H;  2K5H A;  1HH2 P;  4NXM L;  2N3S A;  2OQ0 A;  1JJG A;  2K5N A;  5H1S E;  1KRS A;  1H95 A;  4GKK L;  2WAQ G;  1VQK A;  1BQ8 A;  2IT1 A;  4QQB X;  2PMZ E;  2E2J H;  2PVE A;  3E0E A;  1B2O A;  4A3E H;  1S24 A;  5M5Y H;  1E3P A;  4A3L G;  3MPS A;  4DR2 Q;  4LFA L;  4BBS G;  2PYA A;  3J80 c;  5AI3 A;  2RDV A;  5GAE C;  4PZ6 A;  1BRF A;  4A3F G;  2A19 A;  3CCE A;  4TPU A;  4X66 Q;  1PH7 A;  5JJI A;  1C0A A;  3K0X A;  5ELN A;  3J80 i;  3S15 H;  2RHS B;  4A3J G;  1PV4 A;  4X64 Q;  2GVB A;  4BXX H;  4UPA A;  4P72 A;  1IBM Q;  2ZJR A;  2VNU D;  5C3E G;  2D0O A;  1XMO Q;  1K8A C;  4JBK A;  5FLM G;  1SMU A;  2JA9 A;  2HR5 A;  3KOJ A;  2DSX A;  1U0L A;  2Q2U A;  2NVY H;  3RZT A;  3PUW A;  3M4P A;  1HNX Q;  4X62 L;  5IT9 c;  4HJ9 A;  4A3G G;  2VZA A;  3PCO B;  5BR8 Q;  3RLF A;  1IYJ B;  2Z0S A;  1VCI A;  4JV5 L;  2UXB Q;  4A3I G;  1K9M C;  2R93 G;  3MXN B;  4LF7 Q;  1PH3 A;  1I94 Q;  5RXN A;  3RNU A;  1VQ5 A;  2R7Z G;  5C0X J;  3ER0 A;  3RR5 A;  1UE5 A;  3CMA A;  2K75 A;  3MEF A;  3NEN A;  1VQ4 A;  1AE3 A;  5J3B A;  2RF4 A;  1HZA A;  4P71 A;  2VUM G;  4IJL A;  4A3L H;  4LFB L;  4BBS H;  1V1Q A;  2Y0S G;  3G6E A;  3NBH B;  1R0I A;  3PSI A;  4A3M G;  4A3K G;  4DV5 Q;  1QVC A;  2E2H H;  3KYY A;  1SN8 A;  4L5S A;  4LFC Q;  1B2J A;  3AEV A;  4LF8 L;  1PH1 A;  4YHH Q;  4DNI A;  4LW1 A;  1RDV A;  5IWA Q;  4DV3 L;  1HNX L;  4DR5 Q;  1IBL L;  2E2I H;  1KRT A;  4JI5 L;  3CPW A;  4A75 A;  5BR8 L;  1OXT A;  1A63 A;  3G71 A;  1G6P A;  2PQA B;  3UE0 A;  1W2B A;  1GM5 A;  4DV0 Q;  4AIM A;  1BQ9 A;  5JEA J;  5C3E H;  4BBR G;  1KL9 A;  5IP9 G;  1OXV A;  5FLM H;  1I94 L;  4GN5 A;  1MJC A;  3HOW G;  6RXN A;  1HR0 W;  2JK8 A;  2CQO A;  2ZTE A;  4LUZ A;  2Q2T A;  4FDB A;  4RXN A;  1L1O A;  4A3G H;  1N33 L;  1IRN A;  1VQE A;  3BZC A;  2UUA L;  4JCV E;  4JI8 Q;  3UE1 A;  2JA6 G;  4ME3 A;  2R7D A;  8RXN A;  2KCM A;  2N78 A;  4A3I H;  1KHI A;  2CCZ A;  2R93 H;  4KHZ A;  4K9F A;  2LXK A;  4LFC L;  1J5E Q;  1SMX A;  3T1H L;  1CSQ A;  3GTG H;  1N9W A;  5JEA G;  2OQK A;  3IRB A;  4L5Q A;  4DR5 L;  5FJ8 G;  1QZH A;  3AQQ A;  1PA6 A;  4DR3 Q;  4A4I A;  4C2M H;  2BA1 A;  1EWI A;  1EOV A;  4HJA A;  1I6H H;  4DUZ L;  4KI0 A;  3F2D A;  4JI4 L;  1OXX K;  2ZJP A;  4DV0 L;  4DV2 L;  4A3K H;  1IZ6 A;  1D8L A;  3CC4 A;  1B71 A;  1U5K A;  1V43 A;  2A1A A;  1A0I A;  3CC2 A;  2LCQ A;  1VQA A;  3OTO Q;  1D7Q A;  1RDG A;  1LKP A;  1SE8 A;  3J81 j;  1Q8K A;  4JI8 L;  5IYB G;  3T1Y Q;  1YJW A;  3RLO A;  3JC6 6;  2PVX A;  4TQU S;  1YNX A;  2YTV A;  1IU6 A;  4P74 A;  4BBR H;  2KCT A;  5C4J H;  3H15 A;  3I4M G;  3HOW H;  4UP9 A;  3HOY G;  4POF A;  4DR4 L;  3CQZ H;  1KIX A;  1T9Q A;  4JI2 Q;  4DV4 Q;  1J6Q A;  4JI3 L;  2JA6 H;  3ERS X;  3KYX A;  2JE6 I;  2ZM6 Q;  4A3E G;  4JYA Q;  4B3R Q;  1CKO A;  3CCJ A;  1JYB A;  4HJ7 A;  1FHH A;  4DR1 Q;  3EBE A;  5LMN Q;  3TS2 A;  1X55 A;  1FJG Q;  4YWK A;  4IFD J;  5FJ8 H;  1X6O A;  3AYH B;  3M85 A;  1CKN B;  3KLW A;  2UUC L;  3HKZ G;  3T1Y L;  1LKM A;  2DGY A;  1HNZ L;  4BXX G;  1R0G A;  3FKI G;  2IHE A;  2CWA A;  2E5L L;  4P75 A;  2UXC Q;  3PZA A;  2NVT H;  3KYU A;  4HIK A;  3A44 A;  3BU2 A;  1NMG A;  4DPG A;  4JI2 L;  3D0F A;  4DV4 L;  4O2D A;  2YTX A;  3M4O H;  3NEM A;  2JEB I;  3DM3 A;  1QUQ A;  4OX9 Q;  3RZD H;  4IFD G;  2ZTC A;  2ZM6 L;  4KLK A;  3L2P A;  2DUD A;  3CPF A;  4YCU A;  4B3R L;  3I4M H;  3KF6 B;  4YWM A;  5LMN L;  3HOY H;  4GKJ Q;  3ULJ A;  1XMQ Q;  1BBU A;  3PWF A;  3S2H H;  1E8J A;  4RG1 A;  4XTC S;  3U4Z A;  4LUO A;  3RZ6 A;  3TQY A;  4B3T Q;  4A3C G;  2PI2 A;  2JQO A;  2F4V Q;  3CCL A;  1Q1E A;  4B3S Q;  4R1J A;  4JOI A;  1OTC A;  4OWX B;  1PH8 A;  2K14 A;  4AR4 A;  3H3V H;  1JT8 A;  2WP8 J;  2MO0 A;  5LMU Q;  2Q2H A;  1CKN A;  3W1B A;  2UU9 Q;  1PYS B;  3I2Z A;  3K7U C;  3JC6 3;  4P73 A;  1UE6 A;  4XIG S;  3F2C A;  2R6G A;  1XPR A;  3KYW A;  4JBM A;  5FLX c;  3S1N H;  2IX0 A;  3FKI H;  1PH6 A;  1ASY A;  3M7N A;  2HIX A;  1CAA A;  4AR5 A;  2YYZ A;  4GKJ L;  2LSS A;  1EIF A;  1JJC B;  1XMQ L;  1Q12 A;  2WAQ E;  1IBK Q;  4JI6 Q;  1ZRP A;  2K4K A;  4C3H H;  4DAY B;  2Z6K A;  5IY0 A;  1L1O C;  5E7N A;  1YUX A;  1K8G A;  3GTK H;  1EIY B;  1SR3 A;  4X6A H;  3B6Y A;  2WB1 E;  2AKW B;  1YBY A;  3L7Z C;  3CCV A;  1NY4 A;  1WOC A;  2QA4 A;  4IOC A;  4AQY Q;  4JI7 Q;  1XNR Q;  1M1K C;  4DR2 L;  2F4V L;  2V3B B;  2NN6 G;  2PNH A;  4GS3 A;  2R92 G;  3EN2 A;  3CCQ A;  2A8V A;  3AFP A;  4R4C A;  4IO9 A;  1N34 Q;  1DVB A;  1RYT A;  2ID0 A;  3STB D;  1NMF A;  4X66 L;  2VQF Q;  5LMU L;  2VQE Q;  4L5T A;  1SMM A;  1WFQ A;  4QGU A;  4NXN Q;  2JA7 G;  4IPC A;  4X64 L;  3AFQ A;  1I3Q H;  3UDF A;  4A3C H;  1Y1W G;  1XNQ Q;  3UDG A;  1BFY A;  1G29 1;  4RMF A;  1GO3 E;  1HZC A;  4EX5 A;  1YIT A;  1VQG A;  1VS0 A;  1P16 A;  1IBM L;  1XPU A;  1B7Y B;  3M9B A;  4TVA B;  1XMO L;  2N8N A;  4LF6 Q;  3GTL H;  4K0K Q;  1TWH H;  3JC6 2;  5EAY A;  3W5O A;  1NJI C;  4JI6 L;  2WFW A;  1S72 A;  5GAH C;  4C3J H;  1JE5 A;  2KKD A;  1Q1B A;  1HR0 Q;  1Z47 A;  4AQY L;  4YCW A;  2YTY A;  5C0X G;  3CCR A;  3PGZ A;  4JI7 L;  2UXB L;  3NEL A;  4DUY Q;  4LF7 L;  2E8G A;  4OXP A;  4HID A;  5IE8 A;  1WCM H;  1VQL A;  4AYB E;  3RN2 A;  2IHF A;  3CD6 A;  2EXD A;  4J15 A;  1L0W A;  3TRE A;  1UE7 A;  1VQJ A;  5AJ3 Q;  2KN9 A;  2XTI A;  4WJ3 M;  1KAW A;  3CXC A;  3CW2 C;  3HFZ B;  1XNQ L;  4LF9 Q;  1T9O A;  3I55 A;  4AR6 A;  2PI2 E;  4JI1 Q;  3HOX H;  1LYL A;  1YHB A;  2R92 H;  4DV5 L;  1Q7Y C;  2ZTD A;  4PG3 A;  4LF6 L;  4DV6 Q;  2VW9 A;  4YHH L;  1VCX A;  5IWA L;  1RB9 A;  2JA7 H;  4MNO A;  1E7Z A;  1MKH A;  4OO1 G;  1UWV A;  1YZ6 A;  3TEH B;  1Y1W H;  1M90 C;  1IU5 A;  1DGS A;  2RHQ B;  2ASB A;  1I5F A;  4IPH A;  1K83 H;  2IY5 B;  1NE3 A;  1BBW A;  3K7A H;  3L0O A;  4NB3 A;  3S14 H;  1EUJ A;  1B70 B;  5AJ3 L;  2I5M X;  4GOP C;  2GMG A;  1TWA H;  5HY6 A;  1OXU A;  2D62 A;  2CFM A;  2PQA A;  3K81 C;  3W1G A;  3KF8 B;  4DR7 Q;  3KYV A;  3U4V A;  2GVA A;  5GRO A;  3S16 H;  2B29 A;  4R4Q A;  3A74 A;  1B13 A;  4JBJ A;  2MS3 A;  3HOU G;  4PMW A;  1J5E L;  4QIW E;  4JG2 A;  3RYG A;  1VQO A;  3I56 A;  3PF5 A;  4Y52 H;  3CCS A;  3QVD A;  1CSP A;  4WJ4 A;  4DR3 L;  5DLQ E;  3S2D H;  2D0P A;  2JJQ A;  2MNA A;  2I0Q A;  2KBN A;  1N8R C;  5IYC G;  5C44 G;  1X56 A;  4A93 H;  3FHW A;  1T9P A;  4JOI C;  3ULP A;  4BA1 I;  4A76 A;  2N49 A;  3OTO L;  1YJ9 A;  1H7V A;  2Q2I A;  1E1O A;  1C7Y A;  4IJH A;  3KDF B;  1K73 C;  4LNQ A;  3SGI A;  2CKZ B;  1PVO A;  2UUB Q;  1XTD A;  3EIV A;  4O0A A;  1BE7 A;  3H3V I;  1R0F A;  1LKO A;  1A8V A;  1V9P A;  3ZJY C;  3FP9 A;  3GTO H;  3PV0 A;  4DKA C;  3PIO A;  4GNX B;  2FXQ A;  3G4S A;  3E9H A;  3F2B A;  1X9N A;  1YVC A;  2UXD Q;  4UP8 A;  1NTG A;  4IPG A;  1EYG A;  4DV1 Q;  4KHP Q;  2Z6K C;  5JJL A;  2C35 B;  1BVS A;  4H02 A;  1IL2 A;  2AWO A;  4OWW B;  4JYA L;  3A5Z B;  3KJP A;  3CAM A;  1BKB A;  4GLV B;  4DR1 L;  3LGJ A;  1EFW A;  3HOU H;  3I4N H;  1P8L A;  3J7Z C;  3JAM c;  4IFD I;  1VQ9 A;  1IRO A;  3ULL A;  4GKK Q;  1FVI A;  2AMC B;  3HKS A;  5LMN W;  1YUZ A;  1QVG A;  2MFI A;  4GLX A;  3CF5 A;  1C9O A;  3JAM i;  1VQ7 A;  2UUB L;  4LFA Q;  1O7I A;  5IYC H;  1MIU A;  1OXS C;  1T9H A;  3KYH C;  5C44 H;  1CKM A;  5IP7 H;  4A3D H;  1X54 A;  1VQI A;  2UXC L;  1X3E A;  1RIP A;  3K8A A;  3J81 c;  2YU9 H;  4ALP A;  5M5W H;  2EIF A;  1IXR A;  2B63 H;  3S1Q H;  4KHP L;  2BH2 A;  2YV5 A;  1VQ6 A;  4C3I H;  4YWL A;  3J81 i;  1YJN A;  4OX9 L;  2F52 A;  1E22 A;  1K0R A;  3M4Q A;  1NBW A;  1R0H A;  2RCN A;  4LWC A;  1LTL A;  2NVQ H;  4APV A;  4GNX A;  1G51 A;  3G48 A;  2JA8 H;  4GN3 B;  4R4O A;  4BY1 H;  2AHO B;  3HOZ H;  1WCM G;  3S24 A;  2HT1 A;  1S3O A;  3KFU A;  3CME A;  1PH9 A;  4EQ5 A;  2IX1 A;  4HJ5 A;  1VQP A;  4LF4 Q;  4X62 Q;  1VQF A;  2KHJ A;  2R7F A;  1UE1 A;  5GQO A;  3ICE A;  1PH4 A;  4B3T L;  1JJ2 A;  2WB1 G;  4R4I A;  4JV5 Q;  4POG A;  4PZ8 A;  3RN5 A;  3TS0 A;  1HNW Q;  3KF6 A;  1GKH A;  3HOX G;  2I5L X;  4B3S L;  3GTM H;  5GAD C;  4A3B G;  1N32 Q;  3PUX A;  2MQH A;  1PHJ A;  1YK4 A;  4L5R C;  2ALY B;  1TXY A;  2UU9 L;  1SMW A;  2QEX A;  2NN6 I;  2NZH A;  4MZ9 A;  1SLJ A;  2K50 A;  1AE2 A;  2K52 A;  1YIJ A;  2ATW A;  4LFB Q;  2V1C C;  3S1M H;  2HHH Q;  1HZ9 A;  1QVF A;  5ELO A;  5M3F G;  4QL5 A;  4PZ7 A;  3Q8D A;  3GDE A;  3I4O A;  1HJP A;  1VQB A;  4DR6 Q;  3CC7 A;  4R4T A;  4LF8 Q;  1Q81 C;  1N36 Q;  1IBK L;  1FGU A;  1IBL Q;  2OTL A;  4DV3 Q;  4B3M Q;  4LF5 Q;  1KQS A;  1VQH A;  4JI5 Q;  4LF4 L;  4DV7 Q;  1EQR A;  1L1O B;  2OTJ A;  3OYY A;  2HIV A;  3BJU A;  1SRO A;  1XPO A;  1HNW L;  2QGQ A;  1DX8 A;  4OWT B;  1XNR L;  1S30 A;  1VQM A;  4BA2 I;  1N32 L;  3DLL A;  2I5H A;  1YHA A;  4AYB G;  3U58 A;  1QYB A;  1N34 L;  1MJE A;  2AWN A;  3J7A 5;  2VQF L;  3PUY A;  5C0X I;  2MO1 A;  2VQE L;  1N33 Q;  1CUK A;  1GVP A;  2CWP A;  4GN4 B;  4NXN L;  4DAM A;  4HJ8 A;  2UUA Q;  1C09 A;  3K80 C;  2NZO A;  2Y0S E;  1FJG L;  2HHH L;  3I7F A;  1Y14 B;  1HZB A;  3H0G G;  4A3B H;  4AH6 A;  4A3F H;  4DR6 L;  4K0K L;  4A93 G;  3T1H Q;  5C4X G;  1N36 L;  4UP7 A;  1FL0 A;  3STB C;  1LUZ A;  1PYB A;  2HQL A;  3F1Z A;  4GLA C;  4OON A;  4A3J H;  4B3M L;  3CCM A;  2F3I A;  4DV7 L;  4JI0 Q;  5IYD G;  1KC8 C;  1YK5 A;  4DUZ Q;  2GN5 A;  3PUV A;  1HR0 L;  1FHM A;  4JI4 Q;  3BZK A;  2JEA I;  4DV2 Q;  2VL6 A;  2ES2 A;  1X3F A;  3RLN A;  5M3F H;  2EQS A;  1ASZ A;  4DUY L;  5K36 G;  5M5X H;  3RZO H;  1PFS A;  3GO5 A;  4OO1 I;  1GD7 A;  2M4Y A;  2XGT A;  4YY3 Q;  1AH9 A;  3GTQ H;  1S40 A;  1YV1 A;  1Y1V G;  2OWO A;  3PO2 G;  1S2Z A;  3M3Y H;  1K3R A;  4DK3 C;  4YCV A;  4LF9 L;  1VQC A;  3PUZ A;  4JI1 L;  1Z9F A;  2LXJ A;  4HIO A;  1EQQ A;  1QZG A;  1UEB A;  5M3M G;  2L15 A;  1JMC A;  2VY3 A;  3D31 A;  4DR4 Q;  3I4N G;  2R7Z H;  2BH8 A;  4DV6 L;  4QJF A;  4QY7 A;  4JC0 A;  5GAG C;  2ZJQ A;  4JI3 Q;  1XJV A;  4JI0 L;  2BA0 A;  3PIP A;  1PH2 A;  3VDY A;  2VUM H;  3PF4 A;  2H5X A;  3KJO A;  4A3M H;  3H0G H;  1TWC H;  4BY7 G;  3E9I A;  1L2F A;  4IPD A;  4A3D G;  3GTJ H;  5C4X H;  5IP7 G;  1RL2 A;  4LUV A;  3PO3 G;  4YY3 L;  2OCE A;  1KXL A;  1YHQ A;  3U50 C;  2B63 G;  4GOP B;  5IYD H;  3SS2 A;  1CAD A;  2UUC Q;  1VQN A;  3HOV G;  1QUQ B;  2KHI A;  1HNZ Q;  1VQ8 A;  4DR7 L;  1YEZ A;  2JA5 G;  3CP0 A;  3UDX A;  1TWG H;  3WWV A;  5IP9 H;  1YI2 A;  1A62 A;  1X3G A;  4GNX C;  3OW2 A;  2E5L Q;  4UY8 C;  2JA8 G;  1LM0 A;  4X65 Q;  4BY1 G;  3HOZ G;  1WJJ A;  4NPS A;  1WI5 A;  1Y1V H;  5HGQ A;  3PO2 H;  4IOA A;  3A5U A;  3S1R H;  5JJK A;  1E24 A;  1W3S A;  3UDI A;  3CCU A;  3TRZ A;  4MTN A;  1X65 A;  2VS1 A;  5M3M H;  3F8T A;  4NXM Q;  4JBW A;  1B8A A;  4Y7N H;  1Q82 C;  1SRU A;  1NNQ A;  2KEN A;  2QL0 A;  5AI2 A;  2B3G A;  4HIM A;  3A0J A;  3HKZ E;  1RWD A;  1QCV A;  2NVX H;  1VQD A;  1KD1 C; 
#chains in the Genus database with same CATH topology
 1QQT A;  4KD3 A;  3UI2 A;  2C5C A;  7RXN A;  4OIJ A;  2A6H D;  1R0J A;  1LT4 D;  3BDC A;  3GD7 A;  2UXD L;  2JP1 A;  5LHY 1;  1JB7 A;  3KDF A;  2JYO A;  1E1T A;  2JA5 H;  4AYB P;  1JJG A;  1QCB D;  1H95 A;  4Y7N B;  2B2Y C;  5FK9 C;  2EPB A;  4RAU C;  2E2J H;  3E0E A;  3QJY A;  1B2O A;  1K3B C;  1S24 A;  1PDQ A;  5M5Y H;  4BBS G;  4LFA L;  3MA2 B;  2PYA A;  5TSS A;  2RDV A;  4DAV A;  1BRF A;  2X6L A;  2A19 A;  3CCE A;  3PO3 B;  4X66 Q;  5JJI A;  1SE3 A;  1C0A A;  3K0X A;  5ELN A;  2B63 B;  3S15 H;  2RHS B;  2EY5 A;  3P8B A;  4FO2 A;  4ZLT F;  3ZYY X;  2GVB A;  2ICE C;  2EY1 A;  5C3E G;  2HCI A;  4B8C D;  1EQV A;  2Z4H A;  2NVY H;  1HNX Q;  4X62 L;  5IT9 c;  4HJ9 A;  3P75 A;  2KOL A;  2F0Q A;  2Z0S A;  2F3W A;  2R93 G;  3EA6 A;  4LF7 Q;  5DNF A;  3RNU A;  1CT1 D;  1C48 A;  4ZKB B;  2QW7 A;  3QB3 A;  2K75 A;  3NTI A;  4DXF A;  5GAH c;  1HZA A;  4BBS H;  1X32 A;  2Y0S G;  3G6E A;  3PSI A;  1R0I A;  3K5M A;  4A3M G;  1JC7 A;  4DV5 Q;  4LFC Q;  3AEV A;  1PH1 A;  1VQK A;  5IWA Q;  1HNX L;  2Z8L A;  4DR5 Q;  4L63 B;  2JXM B;  3J7Y W;  1G6P A;  1H9K A;  4A3G L;  1W2B A;  2LMC B;  1BQ9 A;  5C3E H;  1XTC D;  5C5M A;  1OXV A;  1SYC A;  4GN5 A;  3HOW G;  1UUP A;  4KD4 A;  2ZTE A;  2CQO A;  2EYH A;  1B1Z A;  2KUM A;  4FDB A;  4RXN A;  1CQF A;  3HGB A;  4CKE A;  2K5Q A;  4IZ8 A;  2Z3R B;  2XRS D;  1NNX A;  1H9S B;  2R93 H;  4NKL A;  1MD2 D;  4KHZ A;  4OL7 A;  4A3K L;  1XXG A;  4M8A A;  4LFC L;  2E2H B;  4RKL A;  2CVR A;  1CSQ A;  2L4N A;  1N9W A;  2A6E D;  5DAU A;  1A3V A;  2DJF C;  4DR5 L;  1PA6 A;  5D3I B;  4DR3 Q;  4A4I A;  4HJA A;  1I6H H;  3A7A B;  5G3L F;  2PZT A;  1BXT A;  3CC4 A;  1B71 A;  1V43 A;  4BBR L;  1A0I A;  4EVO A;  3G6J B;  2F0V A;  3OTO Q;  1QOH A;  1DOK A;  4JAE A;  1SE8 A;  5MGN A;  5IYB G;  5C0X H;  4CKC A;  5EBC A;  3RLO A;  4A3I B;  5C4J H;  1SJE D;  4P74 A;  3S1R L;  2K03 A;  3HOW H;  4DV4 Q;  1J6Q A;  4JI3 L;  2WIN B;  3CKI B;  4C2M B;  2JE6 I;  1CKO A;  1BNZ A;  1JYB A;  1FHH A;  1CM9 A;  2NVX L;  3EBE A;  1WTP A;  4YWK A;  4IFD J;  2GA4 B;  5JVG 1;  5CBE E;  3D6W A;  2DGY A;  4BXX G;  1B3Q A;  1R0G A;  1DON A;  2CWA A;  2E5L L;  4P75 A;  2JA5 L;  3I4M L;  3LWP B;  3KYU A;  4HIK A;  1A2T A;  4EGV A;  3VYU A;  4DA2 A;  4DV4 L;  4K5X A;  2FMM A;  3E3X A;  2JEB I;  1KDB A;  1STN A;  3RZD H;  2ZTC A;  2E2J L;  3T13 A;  3CPF A;  3L2P A;  1D5Z C;  5M5Y L;  3QWN A;  5IT9 E;  2L11 A;  3S2H H;  3ND8 A;  4LUO A;  3RZ6 A;  4B3T Q;  2IPK D;  4A3C G;  5KIX A;  2QIL A;  4JOI A;  1OTC A;  2NVT B;  2K14 A;  1I4P A;  2RDG A;  5LMU Q;  2Q2H A;  1CKN A;  2CH4 A;  3M4O B;  3JC6 3;  2NVY L;  3F2C A;  1BCP C;  5FLX c;  1HFN A;  2K04 A;  3WDN A;  3E0J A;  1LT3 D;  3ONA B;  3MXU A;  4JI6 Q;  1K8G A;  2A74 C;  3GTK H;  1SR3 A;  3EVQ A;  4X6A H;  2QA4 A;  2AKW B;  4A3E B;  1NY4 A;  4JI7 Q;  4JAG A;  1TII D;  1XNR Q;  1M1K C;  4BBS L;  4IOA A;  1GUG A;  1RYT A;  1NMF A;  5LMU L;  4QGU A;  1WFQ A;  4L8J A;  3HKZ B;  4A3C H;  2IL8 A;  3S1N B;  1YIT A;  1FJG Q;  3JR7 A;  4TVA B;  1XMO L;  4K0K Q;  5C3E L;  1NJI C;  3W5O A;  4JI6 L;  3J7A V;  4C3H B;  2WFW A;  4WRD A;  1Q1B A;  2KKD A;  4QUF A;  1HR0 Q;  1Z47 A;  1GUS A;  4YCW A;  4JI7 L;  3PGZ A;  1B9M A;  4X3T A;  1D1I A;  4DUY Q;  4J6H A;  2R93 L;  3BG3 A;  1RCV D;  1CQV A;  2EXD A;  3TRE A;  1VQJ A;  2F0P A;  2QEJ C;  2KEC A;  4WJ3 M;  3KBX A;  2PMZ B;  1SYB A;  1L0Y B;  1PFN A;  1Y1W L;  1I6H L;  1YHB A;  3P20 A;  3HKZ P;  3K35 A;  3H99 A;  2F0J A;  5BN3 A;  1LTI D;  1E7Z A;  4OO1 G;  1YZ6 A;  4C3J B;  2CHB D;  2O5J D;  1UAP A;  4IPH A;  3A8K E;  5C4J L;  1WCM B;  2RSO A;  1BBW A;  2XNA C;  3HOW L;  1GJX A;  3T16 A;  1B2T A;  1MHW C;  5HY6 A;  2RA4 A;  1DOL A;  1I4R A;  2PCF B;  3A74 A;  5CGK A;  4R8N A;  4XGH A;  1WTX A;  1J5E L;  5JAV A;  1Z92 B;  1UEA B;  4K8I A;  3I56 A;  5EQ0 A;  4JAD A;  4UY8 1;  3FDT A;  1PFY A;  5E4X A;  4WJ4 A;  1EU4 A;  2KBN A;  5CV8 A;  1B3A A;  3ULP A;  1ML0 D;  4RGT A;  4BA1 I;  4A76 A;  2N49 A;  2A6E C;  3HRZ C;  1LT5 D;  4K8J A;  4OO1 H;  4LNQ A;  4H0L C;  1K73 C;  3GP7 A;  1NR2 A;  2BDN A;  3RZD L;  1LKO A;  2AQ1 B;  1V9P A;  3FP9 A;  3GTO H;  3PV0 A;  1S5E D;  2FXQ A;  2KEE A;  4MIU A;  1EYG A;  1HA5 A;  1QB5 D;  2EOT A;  5FLX E;  1BVS A;  2AWO A;  4JYA L;  2EVB A;  5DM7 3;  2XSC A;  4GLV B;  1D5M C;  5IYC L;  3BVZ A;  4N8X 1;  2AMC B;  4WJW A;  5LMN W;  4XXB B;  1QVG A;  1SDF A;  4XDX A;  5KRU A;  2O5I C;  1OXS C;  1T9H A;  2E2D C;  1CKM A;  1G91 A;  1X54 A;  2I07 B;  1FGB D;  1X3E A;  2YU9 H;  2UXC L;  4R9W A;  2M6O A;  3S1Q H;  1VQ6 A;  1SYD A;  5AFW A;  4C3J G;  3GTK L;  1NBW A;  3MFG A;  1NR4 A;  3TZD A;  3A8I E;  4GN3 B;  3I4N B;  4LHN A;  1SEB D;  4QIW B;  4ZQ3 A;  5GAE c;  1WCM G;  3S24 A;  2HT1 A;  3KFU A;  2IX1 A;  1ESF A;  4LF4 Q;  1VQF A;  2KHJ A;  3ICE A;  5IT9 L;  4PZ8 A;  1SE4 A;  3S9W A;  4A3C L;  4L6T B;  4K2L A;  3QR8 A;  2M4V A;  2ALY B;  2F0K A;  4HCE A;  2QEX A;  2NN6 I;  2NZH A;  1BCP B;  2K50 A;  1AE2 A;  1OO9 B;  2HHH Q;  4CKB A;  5ELO A;  4QL5 A;  2JI2 A;  1JIC A;  2LKV A;  2EY2 A;  4LF8 Q;  1D2B A;  1Q81 C;  1N36 Q;  2OTL A;  1FGU A;  4JK1 C;  4LF4 L;  1VQH A;  3KLR A;  3RUZ A;  2OTJ A;  4QIW P;  1SRO A;  1XPO A;  5DM6 1;  1J9O A;  4BA2 I;  3DLL A;  1YHA A;  3U58 A;  1CFM A;  4KTA A;  1N33 Q;  4NXN L;  4DAM A;  4K5V A;  3VR6 A;  4JVZ A;  1PTO H;  2HHH L;  2PYK A;  3HJY B;  1Y14 B;  4AH6 A;  4A3F H;  4PMB A;  1N36 L;  2HQL A;  2EXZ A;  3C1E A;  3CCM A;  2F3I A;  4JI0 Q;  1KC8 C;  3GTQ L;  4DUZ Q;  4JI4 Q;  4F88 A;  1FHM A;  3BZK A;  3LPE B;  3RLN A;  1CHP D;  3RZO H;  1HUM A;  1PFS A;  3L9A X;  2WAQ B;  1AH9 A;  3MWY W;  4K2K A;  2EZV A;  2DJG C;  3X3M A;  1K3R A;  4TVM A;  2WB1 B;  4JI1 L;  3HOX B;  4AI1 A;  2XJV A;  4DR4 Q;  3I4N G;  1NSN S;  2R7Z H;  2BH8 A;  5C4X L;  3A56 A;  3T53 B;  2ZJQ A;  4JI0 L;  3VDY A;  3G7L A;  2VUM H;  1VMC A;  1EZ8 A;  5EKI A;  4BY7 G;  2D9U A;  2NB0 A;  5F2D A;  1RL2 A;  3GTO L;  2OCE A;  1VZG A;  2K05 A;  2NBF A;  1PZK D;  3SS2 A;  2K7V A;  3HOV G;  1Y1V L;  3PO2 L;  1QUQ B;  3BVM A;  3OWE B;  2HDL A;  3WOE A;  2WAQ P;  1SYE A;  2O5J C;  4GNX C;  4UY8 C;  1SBB B;  3CHB D;  5HGQ A;  3HG9 A;  1PFB A;  3UDI A;  4ZKC B;  1AZQ A;  2RVL A;  4JBW A;  4K14 A;  4Z9C B;  1SRU A;  2YU9 L;  2B39 A;  2KEN A;  2QL0 A;  1LTS D;  5AI2 A;  1S4Z A;  4OEM B;  3S1Q L;  1R9T L;  2DY8 A;  1KD1 C;  1EY7 A;  2BE5 C;  1SFO H;  4BY7 H;  1F9P A;  2VB2 X;  3S17 H;  4X3K A;  1VDZ A;  4AR3 A;  4DK6 C;  3HOV H;  2CR8 A;  2J9U B;  3GTP H;  1B4O A;  3S1R B;  1FNU A;  2K5H A;  2PZW A;  4NP5 A;  1ZKO A;  2F0G A;  1IYV A;  2OQ0 A;  1PFU A;  1K8M A;  2K5N A;  4GKK L;  5FOB B;  2XJR A;  2WAQ G;  2EJG C;  1SNQ A;  4J8Q A;  3K58 A;  5ELC A;  3DWA A;  1E3P A;  2NVX B;  4DR2 Q;  3MVV A;  3J80 c;  4PZ6 A;  4TPU A;  2XJU A;  3K5N A;  1EEF D;  3J80 i;  1Y8P B;  4UPA A;  1W6K A;  2KCN A;  2JA5 B;  2ZJR A;  2VNU D;  4RHS A;  2D0O A;  1W6J A;  1K8A C;  4JBK A;  1TU2 B;  1A3U A;  2JA9 A;  4BY1 B;  3HOZ B;  1QG7 A;  2HDM A;  3NPP A;  4JPB W;  4A3G G;  1PTO D;  2NTS A;  3RLF A;  5BR8 Q;  5ELD A;  5M5Y B;  1TY0 A;  1KDC A;  4A3L L;  2FFK B;  1EY6 A;  3P7J A;  1I94 Q;  2F0W A;  1RF2 D;  4A3F L;  3ER0 A;  3RR5 A;  3CMA A;  5NUC A;  4XT3 B;  3S15 B;  2TSS A;  2WKD A;  3CRK C;  5I9O A;  4OIK A;  3VR5 A;  3IFD A;  1RJT A;  1V1Q A;  4A3K G;  1SN8 A;  5FLM L;  4YHH Q;  4DNI A;  2P5Z X;  1RDV A;  4LW1 A;  4DV3 L;  1HTP A;  1IBL L;  1Y8N B;  2E2I H;  3CPW A;  5AN9 H;  4AHZ A;  5BR8 L;  1OXT A;  1A63 A;  3G71 A;  2PQA B;  1HFG A;  4AIM A;  4BBR G;  2CQA A;  4DAP A;  1KL9 A;  1V1P B;  1I94 L;  1MJC A;  2JSO A;  6RXN A;  1HR0 W;  4LUZ A;  3SK8 A;  2Q2T A;  1AP0 A;  2ZT9 C;  1U4R A;  2R7Z L;  4A3G H;  1VQE A;  4JCV E;  3UE1 A;  4ME3 A;  2R7D A;  8RXN A;  4C1N I;  4XQN A;  2VUM L;  1KHI A;  4BBS B;  4K9F A;  4AI0 A;  1I6V C;  4KY7 A;  3H97 A;  1SMX A;  3T1H L;  3V05 A;  3GTG H;  1EY4 A;  1S5D D;  3AQQ A;  3NP8 A;  2BA1 A;  1EWI A;  2HQE A;  1GHJ A;  2IJ0 A;  1OXX K;  2ZJP A;  4DV2 L;  4A3K H;  1IZ6 A;  5C3E B;  4H7B A;  5HGT A;  5EKK A;  3OHX C;  2CH4 W;  5JPM C;  3R2T A;  5M9O A;  2K5D A;  4FF1 A;  2QDL A;  3CQZ L;  2DN8 A;  3OMC A;  1YJW A;  2JA6 L;  2PVX A;  1EYD A;  4BBR H;  1YNX A;  2R93 B;  3I4M G;  2KCT A;  3H15 A;  4POF A;  3E5S A;  2OEO A;  2KJX A;  1JWS D;  4EQP A;  3QQC E;  5FJ8 L;  1I6H B;  4B3R Q;  2Y0S B;  3I73 A;  3CCJ A;  4HJ7 A;  1EY8 A;  5LMN Q;  2F0L A;  2X69 A;  1X55 A;  1SFO L;  3ERO A;  3A54 A;  4BY7 L;  4RHR A;  3SEB A;  2F0N A;  3OIQ A;  1X6O A;  3AYH B;  4WOR A;  1CKN B;  2UUC L;  1BCP D;  1HNZ L;  1HXY D;  4X3U A;  3J80 E;  3FKI G;  3GTP L;  5EGT A;  2L55 A;  5C4J B;  1D5X C;  1Q3L A;  1AEX A;  1TWG B;  3HOW B;  3A44 A;  1NMG A;  4DPG A;  4FF2 A;  1LAB A;  1QUQ A;  4IFD G;  4G7H C;  2K32 A;  4B3R L;  2DUD A;  4YCU A;  4HN7 A;  4ZN3 B;  3I4M H;  5LMN L;  2EJM A;  4GKJ Q;  3ULJ A;  1XMQ Q;  4ULL A;  2Y0S P;  4DGZ A;  2PI2 A;  5I4D A;  2JQO A;  3I4L A;  3I90 A;  3CCL A;  2FMC A;  1I50 B;  3PKJ A;  5EPJ A;  2NYD A;  1PFM A;  4AR4 A;  2WP8 J;  3RMH A;  4CJ0 B;  2MO0 A;  2UU9 Q;  1PYS B;  3I2Z A;  4CJ1 B;  1SNM A;  1QJO A;  1UE6 A;  4XIG S;  4JBM A;  4TRD A;  3KYW A;  3FKI H;  4KKU A;  3M7N A;  2A73 B;  2HIX A;  5MFZ A;  4GKJ L;  1JJC B;  1X3P A;  1XMQ L;  5GAD c;  1Q12 A;  1VMP A;  5HUR A;  3BVG A;  1ZRP A;  2K4K A;  3S2H B;  1YUX A;  4IFD H;  3AU7 A;  3CCV A;  3L7Z C;  4AQY Q;  1WOC A;  2PNR C;  3TP8 A;  4FF3 A;  2V3B B;  1SNO A;  3EN2 A;  3CCQ A;  5I2Y A;  5JVG 3;  2A8V A;  4IO9 A;  1N34 Q;  1DVB A;  2ID0 A;  4X66 L;  1EYA A;  3H94 A;  2VQE Q;  4IPC A;  3UDF A;  2E2I L;  1Y1W G;  3UDG A;  1HZC A;  1VQG A;  3SK4 A;  2IWH A;  5FKA C;  1B7Y B;  4LF6 Q;  3GTL H;  1HUN A;  3OPO A;  4KHV A;  1RTN A;  4ZK9 B;  3GTK B;  1JE5 A;  2XJP A;  4AQY L;  5C0X G;  1CK1 A;  3CCR A;  1F4L A;  4KN7 C;  2B5I D;  4LF7 L;  2E8G A;  4OXP A;  3Q24 A;  4HID A;  2R92 L;  1EZ6 A;  4AYB E;  1SYG A;  3I3C A;  5CV5 A;  3CD6 A;  1SYF A;  1UE7 A;  2ZIX A;  1U4L A;  5KGU A;  3GTG L;  3PIO 1;  2Z3Q B;  1KAW A;  1TVX A;  2MUY A;  3CW2 C;  1PTO C;  2JA7 L;  4LF9 Q;  1T9O A;  2KQ3 A;  2MP1 A;  3BZD B;  2V0E A;  2QF7 A;  5IGE A;  4IUN A;  4DV5 L;  4LF6 L;  4PG3 A;  1BDO A;  4KJN A;  1VCX A;  1GOZ A;  5IWA L;  1RB9 A;  4MNO A;  1MKH A;  1UWV A;  3LNN A;  1Y1W H;  1QE6 A;  1M90 C;  5FO7 B;  1XWE A;  1DGS A;  1I5F A;  1RHP A;  1ICF B;  1NE3 A;  1F9S A;  3K7A H;  3L0O A;  4NB3 A;  3S14 H;  1SE2 A;  1TWA H;  2D62 A;  2CFM A;  2PQA A;  2XWJ B;  3NFP I;  3KYV A;  2K33 A;  3PL5 A;  3U4V A;  3S16 H;  4MN3 A;  3S2D L;  1CZG A;  4R4Q A;  1B13 A;  1V1P A;  3MXG A;  4ZRZ A;  4JG2 A;  3RYG A;  1KLU D;  3PF5 A;  1ICW A;  4PQX A;  3CCS A;  1CSP A;  4DR3 L;  3I8Z A;  4DNR B;  5BN4 A;  2MNA A;  4KK7 A;  3T51 B;  3F2U A;  5IYC G;  3LWE A;  1U4M A;  1MGS A;  1T9P A;  3KLS X;  1YJ9 A;  2KA7 A;  3OTO L;  1C7Y A;  2M2L A;  4C3I G;  3SGI A;  5I2X A;  1XTD A;  5KYI A;  3FEW X;  3URY A;  2L1B A;  3ZJY C;  2APO B;  3QO2 A;  1X9N A;  3LWR B;  4DV1 Q;  5E4W C;  3KF8 A;  1CZW A;  2Z6K C;  2C35 B;  1BQQ T;  1IL2 A;  3K0Y A;  1E2W A;  3EFX D;  1CHQ D;  2XJS A;  3KJP A;  3CAM A;  4WFN 1;  1EFW A;  1P8L A;  2J7Z A;  1J8I A;  3JAM c;  4U67 1;  3NSW A;  2HVY C;  3HKS A;  5M5W L;  3QOJ A;  1YUZ A;  5C6A A;  4GLX A;  2SOB A;  1C9O A;  3JAM i;  4ME5 A;  1WTW A;  4MTK A;  1II3 A;  1ILQ A;  1O7I A;  5IYC H;  1MIU A;  1TKW B;  3WOF A;  4IUQ A;  5IP7 H;  3FKI L;  3GTO B;  3T56 B;  2XJQ A;  1LTT D;  3J81 c;  4ALP A;  1IW7 D;  2B63 H;  2AUK A;  2BH2 A;  4C3I H;  4YWL A;  3J81 i;  1WTO A;  3M4Q A;  1JE4 A;  5MLC 3;  4CDF C;  4GNX A;  2JA8 H;  1TT2 A;  1CI3 M;  4OHJ A;  1KAB A;  3C3L A;  1FR3 A;  1DJR D;  1H9M A;  4ODG A;  5ELE A;  5GQO A;  1PH4 A;  3TBI B;  4B3T L;  1RDP D;  2V0F A;  4R4I A;  4CDE C;  4JV5 Q;  4KN4 C;  1E2Z A;  4FYD A;  1GKH A;  1EIH A;  1RKN A;  2I5L X;  3S1M L;  4QCL A;  1N32 Q;  1HRJ A;  2PW7 A;  3MEH A;  2YU9 B;  1PHJ A;  2F0F A;  5CYU A;  5JVH 3;  3GTL L;  2ENB A;  3A55 A;  3C46 A;  2L0Z A;  4PV1 C;  4E6I A;  1SLJ A;  3D4D A;  2ATW A;  4LFB Q;  1YIJ A;  2ICI A;  1EEI D;  3PIP 1;  5M3F G;  5D65 A;  1JOK A;  5D3D A;  3GDE A;  3I4O A;  2B2V C;  5T1G A;  3SHL A;  1XYI A;  3CC7 A;  1ONL A;  4R4T A;  2F0T A;  4LF5 Q;  5H1S c;  3ZG6 A;  4JI5 Q;  2OF1 A;  5EJW A;  4DV7 Q;  3OYY A;  1MSG A;  5JPN C;  1UNS A;  2OT2 A;  1DD2 A;  2QGQ A;  3W2D A;  4K6D A;  1XNR L;  1M8A A;  4EQN A;  1VQM A;  1N32 L;  1QYB A;  2MO1 A;  3T4A C;  1CUK A;  5IGD A;  2XVS A;  2UUA Q;  1C09 A;  2XWB B;  1FJG L;  1PFW A;  1QIL A;  1HZB A;  3VR3 A;  4K0K L;  5C4X G;  2RFK B;  1FL0 A;  3F1Z A;  4A3J H;  3K7A L;  3S14 L;  1EYC A;  4DV7 L;  5ELF A;  1YK5 A;  2ERJ A;  2GN5 A;  1HR0 L;  1TWA L;  4DXG A;  3NK9 A;  2H1E A;  2VL6 A;  3K5L A;  1ZXT A;  2EQS A;  5M3F H;  3S16 L;  4DUY L;  5M5X H;  1ASZ A;  3AMU A;  5K36 G;  4OO1 I;  2F0H A;  1GUW A;  2XGT A;  4G4K A;  4KV6 A;  3GTQ H;  1S40 A;  1Y1V G;  3PO2 G;  1K28 A;  3M3Y H;  2G9H D;  1PTO B;  4DK3 C;  1OWC A;  2LXJ A;  4HIO A;  4ZYS A;  1QZG A;  5M3M G;  3FPP A;  4A3F B;  2VY3 A;  3H0G L;  3DWP A;  4QJF A;  5GAG C;  3I72 A;  1XJV A;  3PF4 A;  5IYD L;  2N88 A;  3H6M A;  1B44 D;  3KBG A;  2BE5 D;  1TS4 A;  1TWC H;  2SDF A;  3E9I A;  3RZO B;  5C4X H;  1EFI D;  1U4P A;  5DM6 3;  2MJ8 A;  2L9H A;  4M1U B;  1T5E A;  3VYS A;  2KHI A;  3H3V M;  4YIJ A;  2Q8R E;  5JVH 1;  5EKL A;  2FIN B;  5I6Y A;  5IP9 H;  1YI2 A;  3J81 E;  1A62 A;  1X3G A;  4ILW A;  2R61 A;  3OW2 A;  5K36 H;  1SNC A;  2R7Z B;  1WJJ A;  4F87 A;  1V1O A;  2KVM A;  5A35 A;  1S5F D;  1Y1V H;  3VR4 A;  3PO2 H;  3A5U A;  2VUM B;  4X3S A;  5JJK A;  1W3S A;  4FXD A;  1PRT D;  3CCU A;  5COY A;  5M3M H;  1X65 A;  1O7Y A;  1RTO A;  2IX3 A;  2L12 A;  5IP7 L;  2X6G A;  2B3G A;  2B63 L;  4HIM A;  3HKZ E;  2AQC A;  5I6W A;  1QCV A;  4C3I L;  4B9W A;  1BCP F;  2HUG A;  2JA8 L;  3SK5 A;  1PZX A;  4GOP A;  1TWF H;  1WYD A;  1R9T H;  5CC4 A;  2EJF C;  1STE A;  2B2W C;  2N55 A;  2N3S A;  3DUZ A;  5H1S E;  1PLF A;  2O2L D;  1BQ8 A;  2IT1 A;  2K28 A;  2PMZ E;  4A3E H;  1SXT A;  4A3L G;  3MPS A;  1SFO B;  3HS0 C;  3SK6 A;  4BY7 B;  4A3F G;  3S17 B;  1PH7 A;  4BS9 A;  1VZH A;  1F2L A;  4X64 Q;  3HOV B;  3GTP B;  4P72 A;  4XT1 B;  1IBM Q;  5FLM G;  1U0L A;  2Q2U A;  1IW7 C;  3PUW A;  3M4P A;  4HMI A;  1GHK A;  3PCO B;  1VCI A;  3OWF A;  3A8J E;  1IL8 A;  5RXN A;  2CKA A;  1STH A;  1VQ5 A;  4IN3 A;  2R7Z G;  3PKI A;  1TY2 A;  5CMD A;  4HSP A;  3MEF A;  1VQ4 A;  4A3J L;  1AE3 A;  2RF4 A;  4P71 A;  2VUM G;  2NUC A;  3QIA A;  4IJL A;  4A3L H;  3NBH B;  4ABN A;  2AYJ A;  1QVC A;  4L5S A;  1EOT A;  3PMF A;  3I91 A;  5M3F L;  5M5X L;  2RQX A;  4LF8 L;  1ENA A;  1KRT A;  4A75 A;  1ROD A;  2D5D A;  3UE0 A;  4DV0 Q;  3M3Y L;  2A68 D;  5JEA J;  5EIN C;  5I9P A;  4XQJ A;  5FLM H;  1G2S A;  2E75 C;  2TMP A;  2JK8 A;  3J7Y 1;  3H09 A;  3IAY A;  1VF5 C;  4ZAI A;  3U9O A;  1N33 L;  1IRN A;  3BZC A;  4H13 C;  2JA6 G;  4AI3 A;  3FRP B;  3WWN B;  2NN6 H;  4I65 A;  2LXK A;  3Q23 A;  4RCO A;  2NYZ D;  1TWC L;  5EBD A;  3EJI A;  3B08 B;  5G3L D;  2L5T A;  1WTH A;  2E2I B;  5FJ8 G;  1QZH A;  3N6R A;  4KI0 A;  3F2D A;  4DUZ L;  4JI4 L;  4DV0 L;  4IAL A;  1U5K A;  2A1A A;  5IP9 L;  2LCQ A;  5A2Q E;  1VQA A;  3FMC A;  3K6O A;  3VYT A;  1RD9 D;  1D7Q A;  3D8G A;  1LLR D;  4A3G B;  1KAA A;  3T1Y Q;  3JC6 6;  4TQU S;  3HOY G;  4UP9 A;  4DR4 L;  5M3M L;  1LTA D;  3GTG B;  3CQZ H;  2I46 A;  4S3S A;  1T9Q A;  4JI2 Q;  1KIX A;  2JA6 H;  2Q8T A;  5EPL A;  3KYX A;  4A3K B;  4DR1 Q;  3AB9 A;  3TS2 A;  2NVT L;  5FJ8 H;  4IUV A;  3M85 A;  1TWF L;  3T1Y L;  1LKM A;  4RGM A;  1KTK A;  4BBR B;  1SMY D;  3E6Z X;  5FO9 B;  1EU3 A;  2J0T D;  3J7A F;  1IKM A;  4JI2 L;  1FNW A;  4OX9 Q;  1HHV A;  3M7G A;  1BOS A;  1M4V A;  1Q90 A;  4EQO A;  3V96 A;  5FLX L;  4A3E L;  2XIW A;  3KF6 B;  3HOY H;  2B8G A;  1ZYR D;  1STA A;  1BBU A;  3PWF A;  1E8J A;  4RG1 A;  4XTC S;  3U4Z A;  2EYL A;  3TQY A;  3OOC A;  2WV6 D;  1NUC A;  2F4V Q;  1PRT C;  3S1N L;  1JOR A;  4B3S Q;  4R1J A;  1CA5 A;  1EL0 A;  3NWT A;  4OWX B;  1NCV A;  3DWQ A;  3H3V H;  1JT8 A;  4HR7 B;  1F77 A;  2R6G A;  2IX0 A;  1MSH A;  1FD7 D;  3I4M B;  1CAA A;  2YYZ A;  2LSS A;  2MHV A;  2DNC A;  2WAQ E;  1IBK Q;  1ILP A;  3R3O A;  3D6C A;  4RFB A;  2Z6K A;  5IY0 A;  1L1O C;  1SAP A;  3H91 A;  4RWS C;  3Q6S A;  2E2J B;  2V4D A;  4HMJ A;  3B6Y A;  2WB1 E;  2QCP X;  2F4V L;  2G9D A;  3D3R A;  5KNC A;  4DR2 L;  2PNH A;  4GS3 A;  2R92 G;  3AFP A;  3KLS A;  2VQF Q;  4L5T A;  1SMM A;  2SNM A;  2JA7 G;  3AFQ A;  1I3Q H;  2ZXR A;  1XNQ Q;  1H9J A;  1G29 1;  4RMF A;  3VA5 A;  3FKI B;  1P16 A;  4CJ2 C;  4CHT B;  3NUC A;  1XPU A;  2WAC A;  1DM0 B;  3GV3 A;  1TWH H;  3JC6 2;  4QUC A;  1YNJ D;  5EAY A;  2NVY B;  2XRQ D;  1S72 A;  5GAH C;  5C5L A;  4XYQ A;  5IIF A;  1EIG A;  2F3V A;  3P2A A;  5IGB A;  2YTY A;  3NEL A;  2K1B A;  1AZP A;  5KNB A;  2D2C C;  5IE8 A;  1EY9 A;  2O4X A;  3RD4 A;  1VQL A;  2IHF A;  4DAY A;  1BO0 A;  4J15 A;  1L0W A;  5AJ3 Q;  2ZXP A;  2XTI A;  4IQZ A;  3FVQ A;  3CXC A;  3HFZ B;  4LJZ C;  1B9N A;  1XNQ L;  3I55 A;  2PI2 E;  1JOQ A;  3HOX H;  4DFA A;  2R92 H;  2LFN A;  1TS5 A;  1YNN D;  1AW7 A;  1Q7Y C;  3GTL B;  4DV6 Q;  1STY A;  2CKC A;  2B2T C;  4YHH L;  2JA7 H;  3TEH B;  1H9R A;  3NBH A;  1G2T A;  2BDO A;  1K83 H;  2B2V A;  3QOL A;  4B9X A;  1EUJ A;  1B70 B;  5AJ3 L;  1D6E C;  2I5M X;  4GOP C;  2B8F A;  1OXU A;  3W1G A;  1PZJ D;  3KF8 B;  4DR7 Q;  1S5C D;  1O80 A;  2GVA A;  3MSU A;  5GRO A;  2C6A A;  2A68 C;  3MFY A;  4FNF A;  4JBJ A;  2MS3 A;  3HOU G;  4LK1 C;  1VQO A;  3QVD A;  1CTM A;  2FHT A;  1DZ1 A;  5DLQ E;  1Y1W B;  3S2D H;  4RKB A;  2I0Q A;  3KK7 A;  1KLG D;  3HZX A;  1N8R C;  3NE5 B;  5C44 G;  4A93 H;  2SNS A;  3K7A B;  3S14 B;  5D14 A;  1TWA B;  2Q2I A;  2BOS A;  2CKZ B;  4KKT A;  3S16 B;  2KHS A;  3EIV A;  4O0A A;  1BE7 A;  5FO8 B;  1A8V A;  2PQE A;  3PIO 3;  3PIO A;  4GNX B;  3G4S A;  3HOY L;  3F2B A;  2UXD Q;  4UP8 A;  1NTG A;  1I4Q A;  4KHP Q;  2MGS A;  4H02 A;  4AI2 A;  4XXE A;  4KY5 A;  1G6Z A;  4RCN A;  2C9O A;  3HOU H;  4IFD I;  1VQ9 A;  1IRO A;  1NXG A;  2JI1 A;  1FVI A;  5LL6 S;  2EE1 A;  2MFI A;  5C3W A;  1A6X A;  4LFA Q;  4A3D H;  3KYH C;  5C44 H;  1VQI A;  3K8A A;  1RIP A;  3I70 A;  1DXM A;  5M5W H;  2WII B;  4KHP L;  2YV5 A;  4QF4 A;  3SVM A;  1E22 A;  2F52 A;  3RZD B;  3DEP A;  1WVL A;  1R0H A;  2RCN A;  4LWC A;  2NVQ H;  3G48 A;  3W3A A;  1JB3 A;  5BN5 A;  4BY1 H;  2AHO B;  3HOZ H;  1SMY C;  4EQ5 A;  3ND9 A;  3B0A B;  2AQ2 B;  4DN4 M;  4HJ5 A;  1VQP A;  4X62 Q;  5COR A;  1EWC A;  3TS0 A;  3RN5 A;  1I3Q L;  3KF6 A;  1PRT B;  3GTM H;  4A3B G;  3PUX A;  2B2U C;  3DXJ C;  1VF7 A;  1X3Q A;  2MQH A;  2PZU A;  1YK4 A;  4LHL A;  3VPB E;  1ZYR C;  3SE0 A;  2UU9 L;  3TME A;  1HTL D;  1TWH L;  4C3I B;  4MZ9 A;  1O78 A;  1E2V A;  4FXK C;  3OIP A;  5CV9 A;  3S1M H;  5ISR A;  2H4O A;  4PZ7 A;  3Q8D A;  2JA8 B;  4DR6 Q;  1HJP A;  1VQB A;  1TS3 A;  4IUR A;  3TSS A;  4B3M Q;  1SSO A;  4FP5 D;  1L1O B;  4WFN 3;  1Z7T A;  2Z9H A;  1F2Y A;  2HIV A;  4U67 3;  3BJU A;  1LTG D;  2B2W A;  4OWT B;  2H12 A;  3HOX L;  3DHQ A;  4G6B A;  2I5H A;  2Z6B A;  3C2P A;  4AYB G;  4BWG B;  1N34 L;  1MJE A;  5L37 A;  2AWN A;  3J7A 5;  3PUY A;  5C0X I;  5DEH A;  1XX8 A;  2VQE L;  2Y0S E;  1GUT A;  4KY6 A;  3H0G G;  4A3B H;  4DR6 L;  1K83 L;  4UP7 A;  4B3M L;  1LUZ A;  1PYB A;  4GLA C;  4OON A;  5IYD G;  2JEA I;  3PUV A;  4FF4 A;  2QKI C;  1I4X A;  3OMG A;  4H44 C;  1R4P B;  1X3F A;  3OSO A;  4LMQ D;  3GO5 A;  1ENF A;  1SNP A;  4YY3 Q;  1YNJ C;  4XQQ A;  1YV1 A;  4RGN A;  2OWO A;  1S2Z A;  5E1F A;  4YCV A;  4LF9 L;  1VQC A;  1Z9F A;  3D31 A;  3N52 A;  1I4G A;  4A93 L;  3NQI A;  4JW0 A;  4N9T A;  3TN2 A;  4QY7 A;  4JC0 A;  3PIP 3;  4A3J B;  4JI3 Q;  3PIP A;  1PH2 A;  2DY7 A;  3KJO A;  5J22 A;  1F2Z A;  4A3M H;  4RA8 A;  3H0G H;  2E74 C;  4I7A A;  5M3F B;  1YNN C;  5M5X B;  3GTJ H;  5IP7 G;  4LUV A;  3PO3 G;  4YY3 L;  1YHQ A;  2B63 G;  4GOP B;  4KKS A;  3GTQ B;  5IYD H;  3M3Y B;  1VQ8 A;  1U9R A;  2E5L Q;  1TWG H;  4FVM A;  3MHB A;  5IOD A;  2JA8 G;  3IU3 I;  1LM0 A;  4IUT A;  4X65 Q;  3HOU L;  2K01 A;  2XN9 C;  4NPS A;  3MXP A;  1WI5 A;  2JN4 A;  3VR2 A;  1KDA A;  4RH6 A;  3GQB A;  3TRZ A;  2KCC A;  2PO4 A;  1L0X B;  2VS1 A;  1TWC B;  4KJO A;  3F8T A;  4NXM Q;  1F9Q A;  3DEO A;  4A3D L;  5C4X B;  5C44 L;  4Y7N H;  1Q82 C;  2DNE A;  4CDC C;  4DK1 A;  1B53 A;  4K5W A;  2F0D A;  1RWD A;  1VQD A;  3IFT A;  1I50 H;  4J1M A;  1Q86 C;  2HD3 A;  3K5O A;  1Q46 A;  3J80 L;  2AUS B;  4R8I A;  4X65 L;  2NVQ L;  2K5V A;  3PO3 H;  3MQK B;  1BUV T;  1B50 A;  4BY1 L;  3HOZ L;  3VA7 A;  3DMU A;  4DV1 L;  1PH5 A;  1Y1V B;  3PO2 B;  2K2D A;  5IYB H;  2IW3 A;  3NXW A;  1CA6 A;  4ZCK A;  1HH2 P;  3KUP A;  4C1N K;  5M3M B;  4N8F A;  4NXM L;  1KRS A;  3GTM L;  2F0S A;  4QQB X;  2PVE A;  3S15 L;  1ENC A;  2J4X A;  1EQT A;  4N9P A;  1DOM A;  5MFP A;  5AI3 A;  4LAA A;  1PXU A;  5GAE C;  3H9C A;  3H3V C;  2R3Z A;  1TWF B;  1LTR D;  4IUP A;  4A3J G;  3S1Q B;  3BDL A;  1PV4 A;  1S5B D;  1R9T B;  4BXX H;  3LWV B;  1XMO Q;  2A6H C;  1SMU A;  2HR5 A;  3KOJ A;  2DSX A;  3RZT A;  2VZA A;  5CV6 A;  1IYJ B;  4JV5 L;  4A3I G;  1K9M C;  4RGO S;  3MXN B;  2Z4I A;  1PH3 A;  1PTO F;  1LTB D;  4DNT B;  4A3B L;  3D4W A;  5C0X J;  1UE5 A;  2QDB A;  3NEN A;  5J3B A;  4LFB L;  1WTR A;  2E2H H;  4U68 A;  3KYY A;  1B2J A;  3ERQ A;  4LF5 L;  4JI5 L;  2C6B A;  3MZ5 A;  3TDQ A;  1GM5 A;  3MC0 B;  4UDU C;  5IP9 G;  4KMU C;  1JR0 D;  5J1Z A;  5C4Z A;  4ZN1 B;  4TSS A;  1KNE A;  1I4H A;  1L1O A;  3MAQ A;  2UUA L;  4JI8 Q;  2VXW A;  2CCZ A;  2N78 A;  2KCM A;  5JOB A;  4A3I H;  3IKJ A;  4A3M L;  1VZI A;  3TZU A;  1JOO A;  1J5E Q;  5JEA G;  2OQK A;  3GTJ L;  3IRB A;  4L5Q A;  4CGY B;  3R8B A;  1EY5 A;  4C2M H;  1EOV A;  1GUN A;  5K5P A;  1D8L A;  1WTQ A;  1IKL A;  3R93 A;  3CC2 A;  4QB4 A;  4MHE A;  3JAM E;  1TWG L;  4AHX A;  4E6Y A;  1RDG A;  4HSV A;  4CBV A;  2ZXO A;  3NQT A;  1LKP A;  3J81 j;  3LX0 A;  4NDX A;  1Q8K A;  4JI8 L;  3LWQ B;  2WKC A;  1F2M A;  2YTV A;  1IU6 A;  2RDH A;  2F0M A;  3Q0A A;  2PMZ P;  4FXG C;  2K6A A;  2FJ2 A;  4NMZ A;  1TS2 A;  1STG A;  4Y7N L;  4GZY C;  1H9S A;  3ERS X;  2ZM6 Q;  4A3E G;  4JYA Q;  4UHV A;  1G8Z D;  2F0E A;  1I50 L;  5JEA H;  3DM1 A;  3LWU A;  2B2T A;  4UAI A;  3PO3 L;  3J7Z 1;  3BDO A;  2EYF A;  1R4Q B;  3KLW A;  3HKZ G;  3IL8 A;  5IYB L;  2IHE A;  2UXC Q;  3O13 A;  3PZA A;  4GS7 D;  1Y8O B;  2NVT H;  3BU2 A;  3HP3 A;  3CQZ B;  1HQR D;  3D0F A;  5CV7 A;  5C4H A;  4C3H G;  4O2D A;  2YTX A;  3M4O H;  3NEM A;  3DM3 A;  4P2C B;  3S2H L;  4HCS A;  3BYT B;  2JA6 B;  2ZM6 L;  3L3O C;  4KLK A;  1DCZ A;  4YWM A;  3M4Y A;  4PNY A;  2RKS A;  1OWB A;  2VB3 X;  3TP7 A;  1MBY A;  2A69 D;  4BXX L;  1Q1E A;  3NTK A;  2PPB C;  1PH8 A;  1FYC A;  1RYQ A;  2PPT A;  1HA6 A;  3W1B A;  1GXD C;  2RBM A;  3K7U C;  4P73 A;  1XPR A;  1LO5 D;  4V0B A;  3S1N H;  4X6A L;  1PH6 A;  1ASY A;  4AR5 A;  3HOY B;  1EIF A;  1ET9 A;  4AHW A;  4DAY B;  4C3H H;  5E7N A;  1WD0 A;  1AN8 A;  1EIY B;  4ZUI A;  4IOC A;  1YBY A;  5CR3 A;  2UXB Q;  3MTS A;  3SDZ A;  4G57 A;  2NN6 G;  1QNK A;  1JQY D;  3CRL C;  1DYQ A;  4R4C A;  2E2H L;  3STB D;  4NXN Q;  4X64 L;  5E3F A;  1BFY A;  1IBM L;  1GO3 E;  4EX5 A;  5IGF A;  1VS0 A;  2LY7 A;  3Q22 A;  3M9B A;  2N8N A;  2Q8I B;  2PSM C;  1IYU A;  2G5D A;  4DU9 A;  4ZUJ A;  4C3J H;  2UXB L;  1Q8I A;  4Q0F A;  4TKO B;  4A3I L;  3HAX C;  1WCM H;  2B2Y A;  3V2T A;  5T1I A;  3RN2 A;  3BS1 A;  4HTH A;  5IOC A;  2E76 C;  3X3N A;  2KN9 A;  1I3Q B;  1KNA A;  4AR6 A;  4JI1 Q;  3MXN A;  1LYL A;  3K59 A;  1PYW D;  2ZTD A;  1GUO A;  2B2U A;  3U9S A;  2EYO A;  2VW9 A;  1TWH B;  5KND A;  5DM7 1;  1E0B A;  1IU5 A;  2RHQ B;  2ASB A;  4C2M 1;  1WD1 A;  2EYM A;  1BF4 A;  2IY5 B;  3OW7 A;  3K57 A;  2CW0 D;  3WWL A;  2GMG A;  1BR9 A;  1HQM C;  1IHZ A;  3NWS A;  5GAG c;  4NW2 A;  3K81 C;  5IGC A;  2B29 A;  3FPU B;  3R2I A;  5LL6 X;  2R92 B;  4PMW A;  4QIW E;  1EWH A;  2AQ3 B;  3QG1 A;  4Y52 H;  3SR1 A;  2JA7 B;  4OGQ C;  2D0P A;  2JJQ A;  1X56 A;  1K83 B;  1JWU D;  3FHW A;  4IUU A;  4JOI C;  1ODH A;  3JAM L;  5K2M E;  1H7V A;  4DK0 A;  1JWM D;  3GV6 A;  1E1O A;  4IJH A;  3KDF B;  1ET6 A;  3M4O L;  1PVO A;  2UUB Q;  5KYL A;  3H3V I;  1R0F A;  1QNU A;  3NHH A;  4DKA C;  3J81 L;  3E9H A;  5J39 A;  2WB1 P;  1YVC A;  1PMR A;  5CV4 A;  3H9B A;  4IPG A;  3HEJ A;  4QMG A;  5JJL A;  1Z6H A;  3P1H A;  1HCZ A;  2HCC A;  4OWW B;  3S2D B;  4CDD C;  3A5Z B;  1BKB A;  4DR1 L;  3LGJ A;  3I4N H;  4A93 B;  2M9V A;  1D1K A;  1HPC A;  2L0C A;  3J7Z C;  4GKK Q;  3ULL A;  1A2U A;  4O42 A;  3CF5 A;  2EYJ A;  4XYO A;  1VQ7 A;  2UUB L;  1F9R A;  1TR5 A;  2EIF A;  5KEE A;  1IXR A;  1SND A;  1P7P A;  4F7X A;  4OEL B;  1YJN A;  4OX9 L;  4C3H L;  1K0R A;  4F8M A;  1K8O A;  5EPK A;  1LTL A;  4APV A;  1G51 A;  2M6P A;  4R4O A;  3HOU B;  1S3O A;  3CME A;  1PH9 A;  2K5W A;  1A3T A;  2R7F A;  1BBX C;  1UE1 A;  1MI2 A;  1TQO A;  5MF6 A;  1JJ2 A;  2WB1 G;  4POG A;  4PMC A;  1HNW Q;  2RCF A;  3HOX G;  5C44 B;  4G7Z C;  4B3S L;  4A3D B;  5GAD C;  4L5R C;  5M5W B;  4HED A;  1TXY A;  1SMW A;  2OXP A;  2A69 C;  4O1N A;  2F4I A;  2K52 A;  2RSN A;  2V1C C;  4C3J L;  3LWO B;  1HZ9 A;  1QVF A;  2NVQ B;  2EYP A;  1ESR A;  2F0U A;  1IBK L;  1IBL Q;  4K6L A;  1WCM L;  4DV3 Q;  1C8C A;  1KQS A;  1EQR A;  2PW5 A;  4C56 C;  1HNW L;  2EDG A;  2XJT A;  1DX8 A;  1S30 A;  3TP6 A;  3GTM B;  2MPM A;  3BYY B;  2Z1C A;  2VQF L;  2AUJ D;  1GVP A;  2CWP A;  4GN4 B;  4HJ8 A;  2NTT A;  1K0S A;  4Q5V A;  3K80 C;  2NZO A;  4V19 0;  3S1M B;  3I7F A;  3NTH A;  4A93 G;  1FNV A;  1A15 A;  3T1H Q;  3RZO L;  3ITP A;  3STB C;  3C1F A;  3LNL A;  5JJZ A;  3NBI A;  1WTV A;  2BCO A;  4DV2 Q;  2ES2 A;  1LT6 D;  3D4R A;  2NZ1 D;  3A7L A;  3CU7 A;  1GD7 A;  2M00 A;  2EY4 E;  2M4Y A;  4B08 A;  4HAE A;  4Y52 L;  1STB A;  3SXH A;  2F1M A;  1NAP A;  3TP5 A;  3PUZ A;  1EQQ A;  4G7O C;  2LS0 1;  1JMC A;  1QWY A;  1UEB A;  2F0O A;  2L15 A;  4A3B B;  5EIO C;  4DV6 L;  1V8Q A;  4V19 6;  3PQI A;  1PFV A;  2BA0 A;  2H5X A;  4DF7 A;  1C4Q A;  5C3X A;  1EY0 A;  4A3D G;  1L2F A;  2KED A;  4IPD A;  5A2Q L;  1KXL A;  3U50 C;  1CAD A;  2NWG A;  2UUC Q;  1VQN A;  3FDJ A;  1HNZ Q;  1ZEQ X;  4DR7 L;  5ELB A;  1YEZ A;  2JA5 G;  3CP0 A;  3UDX A;  3WWV A;  1JCK B;  1PZI D;  2RDF A;  1WJV A;  4BY1 G;  4AYB B;  3HOZ G;  1LAC A;  2A5H A;  3I4N L;  1T5X D;  2CW0 C;  3HJW B;  2F03 A;  4AHY A;  1LV9 A;  2SEB D;  5IGG A;  5CBA E;  3S1R H;  4I7Z C;  1E24 A;  2F0I A;  4A3M B;  1AFP A;  2JI3 A;  3EQL C;  4MTN A;  3H0G B;  4ID6 A;  3GTJ B;  2ERS A;  1B8A A;  1Y69 U;  1PRT F;  2EY6 A;  3S17 L;  3VYR A;  1NNQ A;  1O7Z A;  4JAF A;  1NXE A;  1O7L A;  3A0J A;  3HOV L;  2NVX H;  1SJH D; 
#chains in the Genus database with same CATH homology
 7RXN A;  2A6H D;  1R0J A;  3GD7 A;  2UXD L;  1JB7 A;  3KDF A;  1E1T A;  2JA5 H;  1JJG A;  1H95 A;  2E2J H;  3E0E A;  1B2O A;  1S24 A;  5M5Y H;  4BBS G;  4LFA L;  2PYA A;  2RDV A;  1BRF A;  2A19 A;  3CCE A;  4X66 Q;  5JJI A;  1C0A A;  3K0X A;  5ELN A;  3S15 H;  2RHS B;  3P8B A;  2GVB A;  5C3E G;  4B8C D;  2NVY H;  1HNX Q;  4X62 L;  5IT9 c;  4HJ9 A;  2Z0S A;  2R93 G;  4LF7 Q;  3RNU A;  2K75 A;  5GAH c;  1HZA A;  4BBS H;  2Y0S G;  3G6E A;  3PSI A;  1R0I A;  4A3M G;  4DV5 Q;  4LFC Q;  3AEV A;  1PH1 A;  1VQK A;  5IWA Q;  1HNX L;  4DR5 Q;  1G6P A;  1W2B A;  1BQ9 A;  5C3E H;  1OXV A;  4GN5 A;  3HOW G;  2ZTE A;  2CQO A;  4FDB A;  4RXN A;  2Z3R B;  2R93 H;  4KHZ A;  4LFC L;  1CSQ A;  1N9W A;  2A6E D;  4DR5 L;  1PA6 A;  4DR3 Q;  4A4I A;  4HJA A;  1I6H H;  3CC4 A;  1B71 A;  1V43 A;  1A0I A;  3OTO Q;  4JAE A;  1SE8 A;  5MGN A;  5IYB G;  3RLO A;  5C4J H;  4P74 A;  3HOW H;  4DV4 Q;  1J6Q A;  4JI3 L;  2JE6 I;  1CKO A;  1JYB A;  1FHH A;  3EBE A;  4YWK A;  4IFD J;  5JVG 1;  2DGY A;  4BXX G;  1R0G A;  2CWA A;  2E5L L;  4P75 A;  3KYU A;  4HIK A;  4DV4 L;  2JEB I;  3RZD H;  2ZTC A;  3L2P A;  3CPF A;  3S2H H;  4LUO A;  3RZ6 A;  4B3T Q;  4A3C G;  4JOI A;  1OTC A;  2K14 A;  5LMU Q;  2Q2H A;  1CKN A;  3JC6 3;  3F2C A;  5FLX c;  4JI6 Q;  1K8G A;  3GTK H;  1SR3 A;  4X6A H;  2QA4 A;  2AKW B;  1NY4 A;  4JI7 Q;  4JAG A;  1XNR Q;  1M1K C;  4IOA A;  1RYT A;  1NMF A;  5LMU L;  4QGU A;  1WFQ A;  4A3C H;  1YIT A;  1FJG Q;  4TVA B;  1XMO L;  4K0K Q;  1NJI C;  3W5O A;  4JI6 L;  2WFW A;  1Q1B A;  2KKD A;  1HR0 Q;  1Z47 A;  4YCW A;  4JI7 L;  3PGZ A;  4DUY Q;  2EXD A;  3TRE A;  1VQJ A;  4WJ3 M;  1YHB A;  3K35 A;  1E7Z A;  4OO1 G;  1YZ6 A;  2O5J D;  4IPH A;  1BBW A;  5HY6 A;  3A74 A;  4XGH A;  1J5E L;  1Z92 B;  3I56 A;  4JAD A;  4UY8 1;  4WJ4 A;  2KBN A;  3ULP A;  4BA1 I;  4A76 A;  2N49 A;  4LNQ A;  1K73 C;  1LKO A;  1V9P A;  3FP9 A;  3GTO H;  3PV0 A;  2FXQ A;  1EYG A;  1BVS A;  2AWO A;  4JYA L;  4GLV B;  2AMC B;  5LMN W;  4XXB B;  1QVG A;  1OXS C;  1T9H A;  1CKM A;  1X54 A;  2UXC L;  1X3E A;  2YU9 H;  2M6O A;  3S1Q H;  1VQ6 A;  1NBW A;  4GN3 B;  4LHN A;  5GAE c;  1WCM G;  3S24 A;  2HT1 A;  3KFU A;  2IX1 A;  4LF4 Q;  1VQF A;  2KHJ A;  3ICE A;  4PZ8 A;  2M4V A;  2ALY B;  2QEX A;  2NN6 I;  2NZH A;  2K50 A;  1AE2 A;  2HHH Q;  5ELO A;  4QL5 A;  2JI2 A;  4LF8 Q;  1Q81 C;  1N36 Q;  2OTL A;  1FGU A;  4LF4 L;  1VQH A;  2OTJ A;  1SRO A;  1XPO A;  5DM6 1;  4BA2 I;  3DLL A;  1YHA A;  3U58 A;  1N33 Q;  4NXN L;  4DAM A;  2HHH L;  1Y14 B;  4AH6 A;  4A3F H;  1N36 L;  2HQL A;  3CCM A;  2F3I A;  4JI0 Q;  1KC8 C;  4DUZ Q;  4JI4 Q;  1FHM A;  3BZK A;  3LPE B;  3RLN A;  3RZO H;  1PFS A;  1AH9 A;  1K3R A;  4TVM A;  4JI1 L;  4AI1 A;  2XJV A;  4DR4 Q;  3I4N G;  2R7Z H;  2BH8 A;  2ZJQ A;  4JI0 L;  3VDY A;  2VUM H;  4BY7 G;  1RL2 A;  2OCE A;  1VZG A;  3SS2 A;  3HOV G;  1QUQ B;  4GNX C;  4UY8 C;  5HGQ A;  3UDI A;  4JBW A;  1SRU A;  2KEN A;  2QL0 A;  5AI2 A;  1KD1 C;  1SFO H;  4BY7 H;  3S17 H;  4AR3 A;  4DK6 C;  3HOV H;  2CR8 A;  2J9U B;  3GTP H;  2K5H A;  2OQ0 A;  2K5N A;  4GKK L;  2XJR A;  2WAQ G;  1E3P A;  4DR2 Q;  3J80 c;  4PZ6 A;  4TPU A;  2XJU A;  3J80 i;  4UPA A;  2ZJR A;  2VNU D;  2D0O A;  1K8A C;  4JBK A;  2JA9 A;  4A3G G;  5BR8 Q;  3RLF A;  1I94 Q;  3ER0 A;  3RR5 A;  3CMA A;  1V1Q A;  4A3K G;  1SN8 A;  4YHH Q;  4DNI A;  4LW1 A;  1RDV A;  1IBL L;  4DV3 L;  2E2I H;  3CPW A;  5AN9 H;  4AHZ A;  5BR8 L;  1OXT A;  1A63 A;  3G71 A;  2PQA B;  4AIM A;  4BBR G;  1KL9 A;  1I94 L;  1MJC A;  6RXN A;  1HR0 W;  4LUZ A;  2Q2T A;  4A3G H;  1VQE A;  4JCV E;  3UE1 A;  4ME3 A;  2R7D A;  8RXN A;  1KHI A;  4K9F A;  4AI0 A;  1SMX A;  3T1H L;  3GTG H;  3AQQ A;  2BA1 A;  1EWI A;  1OXX K;  2ZJP A;  4DV2 L;  4A3K H;  1IZ6 A;  1YJW A;  2PVX A;  4BBR H;  1YNX A;  3I4M G;  2KCT A;  3H15 A;  4POF A;  3QQC E;  4B3R Q;  3CCJ A;  4HJ7 A;  5LMN Q;  1X55 A;  1X6O A;  3AYH B;  1CKN B;  2UUC L;  1HNZ L;  3FKI G;  3A44 A;  1NMG A;  4DPG A;  1QUQ A;  4IFD G;  4B3R L;  2DUD A;  4YCU A;  4ZN3 B;  3I4M H;  5LMN L;  4GKJ Q;  3ULJ A;  1XMQ Q;  2PI2 A;  2JQO A;  3CCL A;  3PKJ A;  2NYD A;  4AR4 A;  2WP8 J;  2MO0 A;  2UU9 Q;  1PYS B;  3I2Z A;  4XIG S;  1UE6 A;  4JBM A;  3KYW A;  3FKI H;  3M7N A;  2HIX A;  5MFZ A;  4GKJ L;  1JJC B;  1XMQ L;  5GAD c;  1Q12 A;  1ZRP A;  2K4K A;  1YUX A;  3CCV A;  3L7Z C;  4AQY Q;  1WOC A;  2V3B B;  3EN2 A;  3CCQ A;  2A8V A;  4IO9 A;  1N34 Q;  1DVB A;  2ID0 A;  4X66 L;  2VQE Q;  4IPC A;  3UDF A;  1Y1W G;  3UDG A;  1HZC A;  1VQG A;  1B7Y B;  4LF6 Q;  3GTL H;  1JE5 A;  2XJP A;  4AQY L;  5C0X G;  3CCR A;  2B5I D;  4LF7 L;  2E8G A;  4OXP A;  4HID A;  4AYB E;  3CD6 A;  1UE7 A;  2ZIX A;  3PIO 1;  2Z3Q B;  1KAW A;  3CW2 C;  4LF9 Q;  1T9O A;  2V0E A;  4DV5 L;  4LF6 L;  4PG3 A;  1VCX A;  5IWA L;  1RB9 A;  4MNO A;  1MKH A;  1UWV A;  1Y1W H;  1M90 C;  1DGS A;  1I5F A;  1NE3 A;  3K7A H;  3L0O A;  4NB3 A;  3S14 H;  1TWA H;  2D62 A;  2CFM A;  2PQA A;  3NFP I;  3KYV A;  3U4V A;  3S16 H;  4R4Q A;  1B13 A;  4JG2 A;  3RYG A;  3PF5 A;  3CCS A;  1CSP A;  4DR3 L;  2MNA A;  5IYC G;  1T9P A;  1YJ9 A;  3OTO L;  1C7Y A;  3SGI A;  1XTD A;  3ZJY C;  1X9N A;  4DV1 Q;  2Z6K C;  2C35 B;  1IL2 A;  2XJS A;  3KJP A;  3CAM A;  4WFN 1;  1EFW A;  1P8L A;  3JAM c;  4U67 1;  3HKS A;  1YUZ A;  4GLX A;  1C9O A;  3JAM i;  1O7I A;  5IYC H;  1MIU A;  5IP7 H;  2XJQ A;  3J81 c;  4ALP A;  1IW7 D;  2B63 H;  2BH2 A;  4C3I H;  4YWL A;  3J81 i;  3M4Q A;  5MLC 3;  4GNX A;  2JA8 H;  5GQO A;  1PH4 A;  4B3T L;  2V0F A;  4R4I A;  4JV5 Q;  1GKH A;  2I5L X;  1N32 Q;  1PHJ A;  2L0Z A;  1SLJ A;  2ATW A;  4LFB Q;  1YIJ A;  3PIP 1;  5M3F G;  3GDE A;  3I4O A;  3CC7 A;  4R4T A;  4LF5 Q;  5H1S c;  3ZG6 A;  4JI5 Q;  4DV7 Q;  3OYY A;  2QGQ A;  1XNR L;  1VQM A;  1N32 L;  1QYB A;  2MO1 A;  1CUK A;  2UUA Q;  1C09 A;  1FJG L;  1HZB A;  4K0K L;  5C4X G;  1FL0 A;  3F1Z A;  4A3J H;  4DV7 L;  1YK5 A;  2ERJ A;  2GN5 A;  1HR0 L;  2VL6 A;  5M3F H;  2EQS A;  1ASZ A;  4DUY L;  5K36 G;  5M5X H;  4OO1 I;  2XGT A;  3GTQ H;  1S40 A;  1Y1V G;  3PO2 G;  3M3Y H;  4DK3 C;  1OWC A;  2LXJ A;  4HIO A;  1QZG A;  5M3M G;  2VY3 A;  4QJF A;  5GAG C;  1XJV A;  3PF4 A;  2BE5 D;  1TWC H;  3E9I A;  5C4X H;  2KHI A;  5JVH 1;  5IP9 H;  1YI2 A;  1A62 A;  1X3G A;  3OW2 A;  1WJJ A;  1Y1V H;  3PO2 H;  3A5U A;  5JJK A;  1W3S A;  3CCU A;  5M3M H;  1X65 A;  2B3G A;  4HIM A;  3HKZ E;  1QCV A;  4GOP A;  1TWF H;  1WYD A;  1R9T H;  2N3S A;  5H1S E;  1BQ8 A;  2IT1 A;  2PMZ E;  4A3E H;  4A3L G;  3MPS A;  4A3F G;  1PH7 A;  1VZH A;  4X64 Q;  4P72 A;  1IBM Q;  5FLM G;  1U0L A;  2Q2U A;  3PUW A;  3M4P A;  3PCO B;  1VCI A;  5RXN A;  2CKA A;  1VQ5 A;  2R7Z G;  3PKI A;  3MEF A;  1VQ4 A;  1AE3 A;  2RF4 A;  4P71 A;  2VUM G;  4IJL A;  4A3L H;  3NBH B;  2AYJ A;  1QVC A;  4L5S A;  4LF8 L;  1KRT A;  4A75 A;  3UE0 A;  4DV0 Q;  2A68 D;  5JEA J;  5EIN C;  5FLM H;  2JK8 A;  3J7Y 1;  1N33 L;  1IRN A;  3BZC A;  2JA6 G;  4AI3 A;  3WWN B;  2LXK A;  3B08 B;  5FJ8 G;  1QZH A;  4DUZ L;  4KI0 A;  3F2D A;  4JI4 L;  4DV0 L;  1U5K A;  2A1A A;  2LCQ A;  1VQA A;  1D7Q A;  3T1Y Q;  3JC6 6;  4TQU S;  3HOY G;  4UP9 A;  4DR4 L;  3CQZ H;  1KIX A;  1T9Q A;  4JI2 Q;  2JA6 H;  3KYX A;  4DR1 Q;  3TS2 A;  5FJ8 H;  3M85 A;  3T1Y L;  1LKM A;  4JI2 L;  4OX9 Q;  3KF6 B;  3HOY H;  1BBU A;  3PWF A;  1E8J A;  4RG1 A;  4XTC S;  3U4Z A;  3TQY A;  2F4V Q;  4B3S Q;  4R1J A;  4OWX B;  3H3V H;  1JT8 A;  2R6G A;  2IX0 A;  1CAA A;  2YYZ A;  2LSS A;  2WAQ E;  1IBK Q;  2Z6K A;  5IY0 A;  1L1O C;  3B6Y A;  2WB1 E;  2F4V L;  4DR2 L;  2PNH A;  4GS3 A;  2R92 G;  3AFP A;  2VQF Q;  4L5T A;  1SMM A;  2JA7 G;  3AFQ A;  1I3Q H;  1XNQ Q;  1G29 1;  4RMF A;  1P16 A;  1XPU A;  1TWH H;  3JC6 2;  5EAY A;  1S72 A;  5GAH C;  3P2A A;  2YTY A;  3NEL A;  5IE8 A;  1VQL A;  2IHF A;  4J15 A;  1L0W A;  5AJ3 Q;  2XTI A;  3CXC A;  3HFZ B;  1XNQ L;  3I55 A;  2PI2 E;  3HOX H;  2R92 H;  1Q7Y C;  4DV6 Q;  2CKC A;  4YHH L;  2JA7 H;  3TEH B;  1K83 H;  1EUJ A;  1B70 B;  5AJ3 L;  2I5M X;  4GOP C;  1OXU A;  3W1G A;  3KF8 B;  4DR7 Q;  2GVA A;  3MSU A;  5GRO A;  2C6A A;  4JBJ A;  2MS3 A;  3HOU G;  1VQO A;  3QVD A;  5DLQ E;  3S2D H;  2I0Q A;  1N8R C;  5C44 G;  4A93 H;  2Q2I A;  2CKZ B;  3EIV A;  4O0A A;  1BE7 A;  1A8V A;  3PIO A;  4GNX B;  3G4S A;  3F2B A;  2UXD Q;  4UP8 A;  1NTG A;  4KHP Q;  4H02 A;  4AI2 A;  3HOU H;  4IFD I;  1VQ9 A;  1IRO A;  1NXG A;  2JI1 A;  1FVI A;  2MFI A;  4LFA Q;  4A3D H;  3KYH C;  5C44 H;  1VQI A;  3K8A A;  1RIP A;  5M5W H;  4KHP L;  2YV5 A;  1E22 A;  2F52 A;  1R0H A;  2RCN A;  4LWC A;  2NVQ H;  3G48 A;  4BY1 H;  2AHO B;  3HOZ H;  4EQ5 A;  3B0A B;  4HJ5 A;  1VQP A;  4X62 Q;  3TS0 A;  3RN5 A;  3KF6 A;  3GTM H;  4A3B G;  3PUX A;  2MQH A;  1YK4 A;  4LHL A;  3VPB E;  2UU9 L;  4MZ9 A;  3S1M H;  4PZ7 A;  3Q8D A;  4DR6 Q;  1HJP A;  1VQB A;  4B3M Q;  1L1O B;  2HIV A;  3BJU A;  4OWT B;  2H12 A;  4G6B A;  2I5H A;  4AYB G;  1N34 L;  3J7A 5;  1MJE A;  2AWN A;  3PUY A;  5C0X I;  2VQE L;  2Y0S E;  3H0G G;  4A3B H;  4DR6 L;  4UP7 A;  4B3M L;  1LUZ A;  1PYB A;  4GLA C;  4OON A;  5IYD G;  2JEA I;  3PUV A;  1X3F A;  3GO5 A;  4YY3 Q;  1YV1 A;  2OWO A;  1S2Z A;  4YCV A;  4LF9 L;  1VQC A;  1Z9F A;  3D31 A;  4QY7 A;  4JC0 A;  4JI3 Q;  3PIP A;  1PH2 A;  3KJO A;  4A3M H;  3H0G H;  3GTJ H;  5IP7 G;  4LUV A;  3PO3 G;  4YY3 L;  1YHQ A;  2B63 G;  4GOP B;  5IYD H;  1VQ8 A;  2E5L Q;  1TWG H;  2JA8 G;  3IU3 I;  1LM0 A;  4X65 Q;  4NPS A;  1WI5 A;  3TRZ A;  2VS1 A;  3F8T A;  4NXM Q;  4Y7N H;  1Q82 C;  1RWD A;  1VQD A;  1I50 H;  1Q86 C;  1Q46 A;  4X65 L;  2K5V A;  3PO3 H;  4DV1 L;  1PH5 A;  2K2D A;  5IYB H;  1HH2 P;  4NXM L;  1KRS A;  4QQB X;  2PVE A;  5MFP A;  5AI3 A;  5GAE C;  4A3J G;  1PV4 A;  4BXX H;  1XMO Q;  1SMU A;  2HR5 A;  3KOJ A;  2DSX A;  3RZT A;  2VZA A;  1IYJ B;  4JV5 L;  4A3I G;  1K9M C;  3MXN B;  1PH3 A;  5C0X J;  1UE5 A;  3NEN A;  5J3B A;  4LFB L;  2E2H H;  3KYY A;  1B2J A;  4LF5 L;  4JI5 L;  2C6B A;  1GM5 A;  5IP9 G;  4ZN1 B;  1L1O A;  2UUA L;  4JI8 Q;  2CCZ A;  2N78 A;  2KCM A;  4A3I H;  1VZI A;  1J5E Q;  5JEA G;  2OQK A;  3IRB A;  4L5Q A;  4C2M H;  1EOV A;  1D8L A;  3CC2 A;  4AHX A;  4E6Y A;  1RDG A;  1LKP A;  3J81 j;  1Q8K A;  4JI8 L;  2YTV A;  1IU6 A;  3ERS X;  2ZM6 Q;  4A3E G;  4JYA Q;  3J7Z 1;  3KLW A;  3HKZ G;  2IHE A;  2UXC Q;  3PZA A;  4GS7 D;  2NVT H;  3BU2 A;  3D0F A;  4O2D A;  2YTX A;  3M4O H;  3NEM A;  3DM3 A;  2ZM6 L;  4KLK A;  4YWM A;  1OWB A;  2A69 D;  1Q1E A;  1PH8 A;  1RYQ A;  2PPT A;  3W1B A;  3K7U C;  4P73 A;  1XPR A;  3S1N H;  1ASY A;  1PH6 A;  4AR5 A;  1EIF A;  4AHW A;  4DAY B;  4C3H H;  5E7N A;  1EIY B;  4IOC A;  1YBY A;  2UXB Q;  2NN6 G;  4R4C A;  3STB D;  4NXN Q;  4X64 L;  1BFY A;  1IBM L;  1GO3 E;  4EX5 A;  1VS0 A;  3M9B A;  2N8N A;  2PSM C;  4C3J H;  2UXB L;  1WCM H;  3RN2 A;  2KN9 A;  4AR6 A;  4JI1 Q;  1LYL A;  2ZTD A;  2VW9 A;  5DM7 1;  1IU5 A;  2RHQ B;  2ASB A;  2IY5 B;  3WWL A;  2GMG A;  5GAG c;  3K81 C;  2B29 A;  4PMW A;  4QIW E;  4Y52 H;  2D0P A;  2JJQ A;  1X56 A;  3FHW A;  4JOI C;  1ODH A;  5K2M E;  1H7V A;  1E1O A;  4IJH A;  3KDF B;  1PVO A;  2UUB Q;  3H3V I;  1R0F A;  4DKA C;  3E9H A;  1YVC A;  4IPG A;  5JJL A;  4OWW B;  3A5Z B;  1BKB A;  4DR1 L;  3LGJ A;  3I4N H;  3J7Z C;  4GKK Q;  3ULL A;  3CF5 A;  1VQ7 A;  2UUB L;  2EIF A;  1IXR A;  1YJN A;  4OX9 L;  1K0R A;  1LTL A;  4APV A;  1G51 A;  2M6P A;  4R4O A;  1S3O A;  3CME A;  1PH9 A;  2R7F A;  1UE1 A;  1JJ2 A;  5MF6 A;  2WB1 G;  4POG A;  1HNW Q;  3HOX G;  4B3S L;  5GAD C;  4L5R C;  1TXY A;  1SMW A;  2K52 A;  2V1C C;  1HZ9 A;  1QVF A;  1IBK L;  1IBL Q;  4DV3 Q;  1KQS A;  1EQR A;  1HNW L;  2XJT A;  1DX8 A;  1S30 A;  2VQF L;  1GVP A;  2CWP A;  4GN4 B;  4HJ8 A;  3K80 C;  2NZO A;  3I7F A;  4A93 G;  3T1H Q;  3STB C;  3LNL A;  4DV2 Q;  2ES2 A;  1GD7 A;  2M4Y A;  3PUZ A;  1EQQ A;  1JMC A;  1UEB A;  2L15 A;  5EIO C;  4DV6 L;  4V19 6;  2BA0 A;  2H5X A;  4A3D G;  1L2F A;  4IPD A;  1KXL A;  3U50 C;  1CAD A;  2UUC Q;  1VQN A;  1HNZ Q;  4DR7 L;  1YEZ A;  2JA5 G;  3CP0 A;  3UDX A;  3WWV A;  1WJV A;  4BY1 G;  3HOZ G;  4AHY A;  3S1R H;  1E24 A;  2JI3 A;  4MTN A;  2ERS A;  1B8A A;  1NNQ A;  4JAF A;  1NXE A;  3A0J A;  2NVX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...