1BQ8A

Rubredoxin (methionine mutant) from pyrococcus furiosus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RUBREDOXIN)
publication title Crystal Structure of Rubredoxin from Pyrococcus Furiosus at 0.95 Angstroms Resolution, and the structures of N-terminal methionine and formylmethionine variants of Pf Rd. Contributions of N-terminal interactions to thermostability
pubmed rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1bq8A00
4AR6A 4TPUA 2GMGA 1R0IA 5AI2A 1YUXA 2RDVA 1BQ9A 4ME3A 1T9QA 1LKPA 1R0JA 3SS2A 6RXNA 1FHHA 4YWMA 4K9FA 1C09A 2HR5A 5IY0A 1R0GA 3QVDA 1S30A 1RDGA 1RDVA 1YK5A 1YK4A 5AI3A 1SMWA 2LCQA 1IU5A 1LKOA 1BE7A 3KYWA 2KN9A 1RWDA 1IROA 1SMMA 1CADA 1RB9A 3PWFA 1E8JA 2V3BB 2MS3A 1BRFA 1DX8A 1ZRPA 1DVBA 2PYAA 1SMUA 1VCXA 1B71A 1B13A 1QCVA 2DSXA 1BQ8A 4AR3A 1T9OA 1T9PA 1YV1A 1R0HA 2PVEA 3MPSA 4AR4A 1S2ZA 3KYYA 4RXNA 1BFYA 1LKMA 1B2OA 1LTLA 3RZTA 3A44A 2K2DA 4POFA 2QL0A 1H7VA 3KYXA 1IRNA 1YUZA 3RYGA 1CAAA 1FHMA 7RXNA 4YWLA 3RZ6A 5RXNA 1R0FA 2VL6A 2M4YA 2PVXA 1RYTA 3PZAA 8RXNA 1JYBA 1QYBA 3KYVA 4AR5A 2KKDA 1NNQA 1S24A 1B2JA 3KYUA 1IU6A 4POGA
chains in the Genus database with same CATH superfamily
3S1RL 3H3VM 2EY4E 1R0IA 3K7AL 4AI3A 4JAEA 1TWHL 2R7ZL 1PFYA 2NVXL 1I6HL 3S1QL 4YWMA 4B8CD 3QQCE 3HJYB 3QVDA 2RFKB 4C3JL 4G6BA 3S14L 1YK4A 4A3GL 1P7PA 5AI3A 1Y1VL 3S1NL 1IU5A 1RWDA 1I50L 1RB9A 2WB1P 2V3BB 2MS3A 3HOZL 5MLC3 5H1Sc 4TVMA 2NYDA 1R9TL 5GADc 1B13A 4C3HL 3HOVL 1QCVA 2DSXA 5MF6A 1RYQA 3S16L 5C4JL 2CKAA 3HJWB 5IP7L 1YV1A 1R0HA 2PVEA 5GAEc 3CQZL 2JI3A 2V0FA 1IW7D 5JVH1 1LKMA 4BXXL 1ODHA 1QQTA 2K2DA 4E6YA 4POFA 1TWCL 1IRNA 1OWCA 1VZHA 1YUZA 4AYBP 1CAAA 2XJPA 2PVXA 5JVG1 8RXNA 3H99A 1JYBA 3M4OL 5MGNA 2KKDA 3S17L 4A3EL 4WFN1 4POGA 3S1ML 4TPUA 5C4XL 2GMGA 2A69D 1TWGL 1PZXA 2Z3RB 4ME3A 1T9QA 3I4ML 4A3FL 5DM71 4XXBB 1FHHA 4AI0A 5IYCL 5C3EL 5K2ME 2JA5L 5IY0A 3JR7A 2R93L 5M5WL 1S30A 4BY1L 1RDVA 2BE5D 5GAGc 3ZG6A 5MFPA 1BE7A 1CADA 3IU3I 3HOXL 2JI1A 2A6HD 1BRFA 1PFUA 3B08B 4UY81 1DX8A 3RZDL 2XJUA 2XJQA 3J7Z1 2JA7L 1DVBA 1SMUA 1VCXA 1B71A 4BBSL 5M3FL 3HOYL 2O5JD 2Z3QB 2ERSA 1BQ8A 2J9UB 2PMZP 1T9PA 4ZN1B 4QIWP 3S2HL 4AR4A 1BFYA 5FJ8L 4JAGA 5M5XL 2CR8A 3S15L 2NVQL 1LTLA 3A44A 2XJVA 2V0EA 5IYDL 3GTPL 1FHMA 1OWBA 2A68D 3GTML 4A3JL 2VL6A 3B0AB 1RYTA 3LWPB 2VUML 3RZOL 4AR5A 3LWQB 1WJVA 1NNQA 1S24A 4AI1A 1B2JA 3KYUA 5DM61 3P8BA 2C6AA 3LWRB 5AI2A 1YUXA 3LWOB 2A6ED 4JAFA 1F4LA 4JADA 5M3ML 3WWLA 4LHLA 1LKPA 6RXNA 1VZIA 2E2JL 2WAQP 1R0GA 1PFWA 1PFVA 2AYJA 4AHYA 3MSUA 3H9BA 5IYBL 1VZGA 2ERJA 3J7Y1 3LPEB 3GTLL 3PKJA 3HOUL 1LKOA 4A3DL 3KYWA 3GTQL 2KN9A 4Y52L 4C3IL 3WWNB 5MFZA 4A3IL 5EINC 2JA8L 4BBRL 2PSMC 3H97A 4A3LL 2YU9L 1T9OA 3HKZP 1WCML 1S2ZA 4A3CL 4RXNA 3H0GL 2JI2A 1I3QL 4C2M1 1B2OA 2QL0A 1H7VA 3KYXA 3I4NL 1TWAL 2NVYL 7RXNA 3P2AA 3HAXC 1R0FA 5M5YL 2M4YA 3PZAA 2PPTA 4XGHA 1Z92B 1NXEA 2ZIXA 2E2HL 3K35A 3PIP1 4A3BL 2C6BA 3PO2L 4A3KL 1IU6A 5EIOC 4AR6A 3VPBE 2B63L 3FKIL 2RDVA 4AHZA 1BQ9A 2Y0SP 3PKIA 2M6OA 1K83L 1R0JA 3SS2A 4K9FA 1C09A 5FLML 4GS7D 3FDJA 2HVYC 3M3YL 2M4VA 2HR5A 5IP9L 3GTOL 1RDGA 4AHWA 1YK5A 2NVTL 3PL5A 4A93L 1SMWA 2LCQA 2B5ID 1IROA 1SMMA 3PWFA 1SFOL 1E8JA 1TWFL 3LNLA 4BY7L 4Y7NL 3H9CA 1ZRPA 4V196 3PIO1 3S2DL 1NXGA 2E2IL 4AHXA 2PYAA 5GAHc 2JA6L 4AR3A 2R92L 3MPSA 3GTGL 2APOB 4A3ML 2XJSA 3KYYA 3PO3L 1Y1WL 2XJTA 3RZTA 2M6PA 2AUSB 3HOWL 3GTKL 4U671 2H12A 3LWVB 5C44L 2CKCA 2L0ZA 3RYGA 3NFPI 4YWLA 3RZ6A 5RXNA 2XJRA 4ZN3B 4AI2A 1QYBA 3KYVA 4LHNA 4X6AL 3MQKB 3GTJL 5AN9H 2AQCA
chains in the Genus database with same CATH topology
4AR6A 4TPUA 3VPBE 2GMGA 2A69D 1R0IA 5AI2A 4AI3A 1YUXA 2RDVA 2A6ED 2Z3RB 4JAEA 4AHZA 1BQ9A 4ME3A 4JAFA 4JADA 1T9QA 5DM71 3PKIA 2M6OA 4XXBB 3WWLA 4LHLA 1LKPA 1R0JA 3SS2A 6RXNA 1FHHA 4YWMA 1VZIA 4K9FA 4AI0A 1C09A 4GS7D 2M4VA 5K2ME 4B8CD 3QQCE 2HR5A 5IY0A 1R0GA 3QVDA 2AYJA 4AHYA 1S30A 1RDGA 3MSUA 4G6BA 1RDVA 1YK5A 4AHWA 1VZGA 2BE5D 2ERJA 1YK4A 3J7Y1 3LPEB 5AI3A 1SMWA 2LCQA 5GAGc 3ZG6A 1IU5A 3PKJA 5MFPA 1LKOA 1BE7A 3KYWA 2KN9A 1RWDA 2B5ID 1IROA 1SMMA 1CADA 1RB9A 3PWFA 3IU3I 1E8JA 2JI1A 2A6HD 2V3BB 2MS3A 1BRFA 3LNLA 5MLC3 3B08B 4UY81 3WWNB 5H1Sc 1DX8A 1ZRPA 5MFZA 4V196 2XJUA 2XJQA 3PIO1 3J7Z1 5EINC 4TVMA 1DVBA 1NXGA 2NYDA 4AHXA 2PYAA 1SMUA 1VCXA 5GADc 1B71A 1B13A 2PSMC 2O5JD 1QCVA 2Z3QB 2DSXA 5MF6A 2ERSA 5GAHc 1RYQA 1BQ8A 2J9UB 4AR3A 2CKAA 1T9OA 1T9PA 1YV1A 1R0HA 4ZN1B 2PVEA 5GAEc 3MPSA 2JI3A 2V0FA 4AR4A 1S2ZA 2XJSA 1IW7D 3KYYA 4RXNA 5JVH1 1BFYA 1LKMA 2JI2A 1ODHA 4JAGA 2XJTA 2CR8A 1B2OA 1LTLA 3RZTA 3A44A 2K2DA 2M6PA 4E6YA 4POFA 2QL0A 1H7VA 3KYXA 1IRNA 1OWCA 2H12A 4U671 1VZHA 2XJVA 1YUZA 2V0EA 2CKCA 2L0ZA 3RYGA 3NFPI 1CAAA 1FHMA 7RXNA 1OWBA 3P2AA 4YWLA 2A68D 3RZ6A 5RXNA 2XJRA 1R0FA 2XJPA 4ZN3B 2VL6A 2M4YA 4AI2A 2PVXA 3B0AB 1RYTA 5JVG1 3PZAA 8RXNA 1JYBA 1QYBA 2PPTA 4XGHA 1Z92B 1NXEA 3KYVA 2ZIXA 4AR5A 4LHNA 5MGNA 3K35A 2KKDA 3PIP1 1WJVA 1NNQA 1S24A 4AI1A 2C6BA 1B2JA 4WFN1 3KYUA 1IU6A 5DM61 3P8BA 5EIOC 2C6AA 5AN9H 4POGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AR6 A;  4TPU A;  2GMG A;  1R0I A;  5AI2 A;  1YUX A;  2RDV A;  1BQ9 A;  4ME3 A;  1T9Q A;  1LKP A;  1R0J A;  3SS2 A;  6RXN A;  1FHH A;  4YWM A;  4K9F A;  1C09 A;  2HR5 A;  5IY0 A;  1R0G A;  3QVD A;  1S30 A;  1RDG A;  1RDV A;  1YK5 A;  1YK4 A;  5AI3 A;  1SMW A;  2LCQ A;  1IU5 A;  1LKO A;  1BE7 A;  3KYW A;  2KN9 A;  1RWD A;  1IRO A;  1SMM A;  1CAD A;  1RB9 A;  3PWF A;  1E8J A;  2V3B B;  2MS3 A;  1BRF A;  1DX8 A;  1ZRP A;  1DVB A;  2PYA A;  1SMU A;  1VCX A;  1B71 A;  1B13 A;  1QCV A;  2DSX A;  1BQ8 A;  4AR3 A;  1T9O A;  1T9P A;  1YV1 A;  1R0H A;  2PVE A;  3MPS A;  4AR4 A;  1S2Z A;  3KYY A;  4RXN A;  1BFY A;  1LKM A;  1B2O A;  1LTL A;  3RZT A;  3A44 A;  2K2D A;  4POF A;  2QL0 A;  1H7V A;  3KYX A;  1IRN A;  1YUZ A;  3RYG A;  1CAA A;  1FHM A;  7RXN A;  4YWL A;  3RZ6 A;  5RXN A;  1R0F A;  2VL6 A;  2M4Y A;  2PVX A;  1RYT A;  3PZA A;  8RXN A;  1JYB A;  1QYB A;  3KYV A;  4AR5 A;  2KKD A;  1NNQ A;  1S24 A;  1B2J A;  3KYU A;  1IU6 A;  4POG A; 
#chains in the Genus database with same CATH topology
 3S1R L;  3H3V M;  2EY4 E;  1R0I A;  3K7A L;  4AI3 A;  4JAE A;  1TWH L;  2R7Z L;  1PFY A;  2NVX L;  1I6H L;  3S1Q L;  4YWM A;  4B8C D;  3QQC E;  3HJY B;  3QVD A;  2RFK B;  4C3J L;  4G6B A;  3S14 L;  1YK4 A;  4A3G L;  1P7P A;  5AI3 A;  1Y1V L;  3S1N L;  1IU5 A;  1RWD A;  1I50 L;  1RB9 A;  2WB1 P;  2V3B B;  2MS3 A;  3HOZ L;  5MLC 3;  5H1S c;  4TVM A;  2NYD A;  1R9T L;  5GAD c;  1B13 A;  4C3H L;  3HOV L;  1QCV A;  2DSX A;  5MF6 A;  1RYQ A;  3S16 L;  5C4J L;  2CKA A;  3HJW B;  5IP7 L;  1YV1 A;  1R0H A;  2PVE A;  5GAE c;  3CQZ L;  2JI3 A;  2V0F A;  1IW7 D;  5JVH 1;  1LKM A;  4BXX L;  1ODH A;  1QQT A;  2K2D A;  4E6Y A;  4POF A;  1TWC L;  1IRN A;  1OWC A;  1VZH A;  1YUZ A;  4AYB P;  1CAA A;  2XJP A;  2PVX A;  5JVG 1;  8RXN A;  3H99 A;  1JYB A;  3M4O L;  5MGN A;  2KKD A;  3S17 L;  4A3E L;  4WFN 1;  4POG A;  3S1M L;  4TPU A;  5C4X L;  2GMG A;  2A69 D;  1TWG L;  1PZX A;  2Z3R B;  4ME3 A;  1T9Q A;  3I4M L;  4A3F L;  5DM7 1;  4XXB B;  1FHH A;  4AI0 A;  5IYC L;  5C3E L;  5K2M E;  2JA5 L;  5IY0 A;  3JR7 A;  2R93 L;  5M5W L;  1S30 A;  4BY1 L;  1RDV A;  2BE5 D;  5GAG c;  3ZG6 A;  5MFP A;  1BE7 A;  1CAD A;  3IU3 I;  3HOX L;  2JI1 A;  2A6H D;  1BRF A;  1PFU A;  3B08 B;  4UY8 1;  1DX8 A;  3RZD L;  2XJU A;  2XJQ A;  3J7Z 1;  2JA7 L;  1DVB A;  1SMU A;  1VCX A;  1B71 A;  4BBS L;  5M3F L;  3HOY L;  2O5J D;  2Z3Q B;  2ERS A;  1BQ8 A;  2J9U B;  2PMZ P;  1T9P A;  4ZN1 B;  4QIW P;  3S2H L;  4AR4 A;  1BFY A;  5FJ8 L;  4JAG A;  5M5X L;  2CR8 A;  3S15 L;  2NVQ L;  1LTL A;  3A44 A;  2XJV A;  2V0E A;  5IYD L;  3GTP L;  1FHM A;  1OWB A;  2A68 D;  3GTM L;  4A3J L;  2VL6 A;  3B0A B;  1RYT A;  3LWP B;  2VUM L;  3RZO L;  4AR5 A;  3LWQ B;  1WJV A;  1NNQ A;  1S24 A;  4AI1 A;  1B2J A;  3KYU A;  5DM6 1;  3P8B A;  2C6A A;  3LWR B;  5AI2 A;  1YUX A;  3LWO B;  2A6E D;  4JAF A;  1F4L A;  4JAD A;  5M3M L;  3WWL A;  4LHL A;  1LKP A;  6RXN A;  1VZI A;  2E2J L;  2WAQ P;  1R0G A;  1PFW A;  1PFV A;  2AYJ A;  4AHY A;  3MSU A;  3H9B A;  5IYB L;  1VZG A;  2ERJ A;  3J7Y 1;  3LPE B;  3GTL L;  3PKJ A;  3HOU L;  1LKO A;  4A3D L;  3KYW A;  3GTQ L;  2KN9 A;  4Y52 L;  4C3I L;  3WWN B;  5MFZ A;  4A3I L;  5EIN C;  2JA8 L;  4BBR L;  2PSM C;  3H97 A;  4A3L L;  2YU9 L;  1T9O A;  3HKZ P;  1WCM L;  1S2Z A;  4A3C L;  4RXN A;  3H0G L;  2JI2 A;  1I3Q L;  4C2M 1;  1B2O A;  2QL0 A;  1H7V A;  3KYX A;  3I4N L;  1TWA L;  2NVY L;  7RXN A;  3P2A A;  3HAX C;  1R0F A;  5M5Y L;  2M4Y A;  3PZA A;  2PPT A;  4XGH A;  1Z92 B;  1NXE A;  2ZIX A;  2E2H L;  3K35 A;  3PIP 1;  4A3B L;  2C6B A;  3PO2 L;  4A3K L;  1IU6 A;  5EIO C;  4AR6 A;  3VPB E;  2B63 L;  3FKI L;  2RDV A;  4AHZ A;  1BQ9 A;  2Y0S P;  3PKI A;  2M6O A;  1K83 L;  1R0J A;  3SS2 A;  4K9F A;  1C09 A;  5FLM L;  4GS7 D;  3FDJ A;  2HVY C;  3M3Y L;  2M4V A;  2HR5 A;  5IP9 L;  3GTO L;  1RDG A;  4AHW A;  1YK5 A;  2NVT L;  3PL5 A;  4A93 L;  1SMW A;  2LCQ A;  2B5I D;  1IRO A;  1SMM A;  3PWF A;  1SFO L;  1E8J A;  1TWF L;  3LNL A;  4BY7 L;  4Y7N L;  3H9C A;  1ZRP A;  4V19 6;  3PIO 1;  3S2D L;  1NXG A;  2E2I L;  4AHX A;  2PYA A;  5GAH c;  2JA6 L;  4AR3 A;  2R92 L;  3MPS A;  3GTG L;  2APO B;  4A3M L;  2XJS A;  3KYY A;  3PO3 L;  1Y1W L;  2XJT A;  3RZT A;  2M6P A;  2AUS B;  3HOW L;  3GTK L;  4U67 1;  2H12 A;  3LWV B;  5C44 L;  2CKC A;  2L0Z A;  3RYG A;  3NFP I;  4YWL A;  3RZ6 A;  5RXN A;  2XJR A;  4ZN3 B;  4AI2 A;  1QYB A;  3KYV A;  4LHN A;  4X6A L;  3MQK B;  3GTJ L;  5AN9 H;  2AQC A; 
#chains in the Genus database with same CATH homology
 4AR6 A;  4TPU A;  3VPB E;  2GMG A;  2A69 D;  1R0I A;  5AI2 A;  4AI3 A;  1YUX A;  2RDV A;  2A6E D;  2Z3R B;  4JAE A;  4AHZ A;  1BQ9 A;  4ME3 A;  4JAF A;  4JAD A;  1T9Q A;  5DM7 1;  3PKI A;  2M6O A;  4XXB B;  3WWL A;  4LHL A;  1LKP A;  1R0J A;  3SS2 A;  6RXN A;  1FHH A;  4YWM A;  1VZI A;  4K9F A;  4AI0 A;  1C09 A;  4GS7 D;  2M4V A;  5K2M E;  4B8C D;  3QQC E;  2HR5 A;  5IY0 A;  1R0G A;  3QVD A;  2AYJ A;  4AHY A;  1S30 A;  1RDG A;  3MSU A;  4G6B A;  1RDV A;  1YK5 A;  4AHW A;  1VZG A;  2BE5 D;  2ERJ A;  1YK4 A;  3J7Y 1;  3LPE B;  5AI3 A;  1SMW A;  2LCQ A;  5GAG c;  3ZG6 A;  1IU5 A;  3PKJ A;  5MFP A;  1LKO A;  1BE7 A;  3KYW A;  2KN9 A;  1RWD A;  2B5I D;  1IRO A;  1SMM A;  1CAD A;  1RB9 A;  3PWF A;  3IU3 I;  1E8J A;  2JI1 A;  2A6H D;  2V3B B;  2MS3 A;  1BRF A;  3LNL A;  5MLC 3;  3B08 B;  4UY8 1;  3WWN B;  5H1S c;  1DX8 A;  1ZRP A;  5MFZ A;  4V19 6;  2XJU A;  2XJQ A;  3PIO 1;  3J7Z 1;  5EIN C;  4TVM A;  1DVB A;  1NXG A;  2NYD A;  4AHX A;  2PYA A;  1SMU A;  1VCX A;  5GAD c;  1B71 A;  1B13 A;  2PSM C;  2O5J D;  1QCV A;  2Z3Q B;  2DSX A;  5MF6 A;  2ERS A;  5GAH c;  1RYQ A;  1BQ8 A;  2J9U B;  4AR3 A;  2CKA A;  1T9O A;  1T9P A;  1YV1 A;  1R0H A;  4ZN1 B;  2PVE A;  5GAE c;  3MPS A;  2JI3 A;  2V0F A;  4AR4 A;  1S2Z A;  2XJS A;  1IW7 D;  3KYY A;  4RXN A;  5JVH 1;  1BFY A;  1LKM A;  2JI2 A;  1ODH A;  4JAG A;  2XJT A;  2CR8 A;  1B2O A;  1LTL A;  3RZT A;  3A44 A;  2K2D A;  2M6P A;  4E6Y A;  4POF A;  2QL0 A;  1H7V A;  3KYX A;  1IRN A;  1OWC A;  2H12 A;  4U67 1;  1VZH A;  2XJV A;  1YUZ A;  2V0E A;  2CKC A;  2L0Z A;  3RYG A;  3NFP I;  1CAA A;  1FHM A;  7RXN A;  1OWB A;  3P2A A;  4YWL A;  2A68 D;  3RZ6 A;  5RXN A;  2XJR A;  1R0F A;  2XJP A;  4ZN3 B;  2VL6 A;  2M4Y A;  4AI2 A;  2PVX A;  3B0A B;  1RYT A;  5JVG 1;  3PZA A;  8RXN A;  1JYB A;  1QYB A;  2PPT A;  4XGH A;  1Z92 B;  1NXE A;  3KYV A;  2ZIX A;  4AR5 A;  4LHN A;  5MGN A;  3K35 A;  2KKD A;  3PIP 1;  1WJV A;  1NNQ A;  1S24 A;  4AI1 A;  2C6B A;  1B2J A;  4WFN 1;  3KYU A;  1IU6 A;  5DM6 1;  3P8B A;  5EIO C;  2C6A A;  5AN9 H;  4POG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...