5IY0A

Pfmcm n-terminal domain double hexamer
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double hexamer of the Pyrococcus furiosus minichromosome maintenance protein N-terminal domain.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication dna binding protein
molecule keywords Cell division control protein 21
total genus 72
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5iy0A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iy0A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 5iy0A01
1Z47A 1RWDA 4P71A 3TEHB 5HGQA 2PQAA 1HR0Q 3CMEA 4WJ3M 1BQ8A 2RF4A 4LFAL 2DSXA 3I4MH 4A3BH 3CQZH 3HKZE 3OTOL 4DR5Q 4BY7G 4LF7Q 1QVGA 1PA6A 1M90C 1XNQQ 1X54A 1FHMA 1VQAA 4LUVA 4JV5L 1YUZA 4X64L 4DV2L 4DR7Q 2NZHA 1O7IA 1UE1A 5IP9G 4HIKA 3PIPA 4OX9Q 1UE6A 1I50H 1P16A 1XTDA 2ZTCA 3FHWA 2R7DA 4UPAA 3S1RH 2R7FA 3L2PA 2E8GA 4BA2I 1OXVA 2JA7G 4GKKQ 4X62L 5GAGC 3G4SA 2WAQG 1X9NA 2Q2TA 4C2MH 2K14A 5LMUL 4KI0A 1EQRA 4DV2Q 3GDEA 3K80C 3M9BA 1KL9A 3HKSA 1L1OB 2EQSA 3E9IA 1VQGA 4IPCA 2NZOA 3BU2A 1EOVA 2FXQA 5IP7H 5M5XH 3H0GH 2JJQA 1WI5A 2N49A 3J80i 2EIFA 3EBEA 2QEXA 3S16H 4HJ9A 4R4TA 3S1QH 1YEZA 1NMFA 4HIDA 2RHSB 3A5ZB 3STBC 4NXMQ 1HNWL 1HZAA 4A3MG 3I4NH 2KKDA 7RXNA 1YZ6A 2K5HA 5IP7G 4A3KG 1MJEA 1S40A 3KYWA 1YIJA 4LFBL 3UE0A 5GROA 2CKZB 3HFZB 3ER0A 1HNZL 3KDFA 3ULLA 1G291 1VQMA 1N33L 2AMCB 6RXNA 5AI3A 2CWPA 5C4XH 1GM5A 2Q2IA 3L7ZC 4PZ8A 5E7NA 1HNXL 4BBSG 1IBLQ 3KYVA 2PI2E 2HHHL 3CF5A 4DK3C 4YCUA 3S15H 2Z0SA 1HZ9A 2VL6A 2PVEA 1VS0A 3ULPA 1K0RA 1V43A 1FJGL 1PHJA 1DVBA 1MKHA 5IY0A 1XPOA 4POGA 2IX0A 4A3FG 2UU9L 3F2DA 5AI2A 2ZTEA 3Q8DA 1OXUA 2DUDA 4NXNL 2F4VL 4B3TL 3KF6B 3TRZA 1MIUA 1SN8A 4HIMA 4A3BG 2JEBI 1R0GA 1KRTA 3U50C 3RN5A 4OWWB 4IO9A 4C3HH 1JJCB 4AQYL 2K52A 4JV5Q 2WB1E 2QGQA 3T1HQ 2KBNA 1PFSA 2R93H 4B3MQ 3HOZG 5BR8L 3UDFA 2UUCQ 4JI3L 4HJ5A 4L5SA 5J3BA 4DUZQ 4HJ7A 4MNOA 3GO5A 1X55A 2NN6I 5JJKA 2JEAI 3M4OH 4A3CH 4YWLA 1FVIA 2IT1A 4GLAC 4RMFA 1PH9A 3M7NA 1NNQA 1PH8A 1B70B 1VQ5A 1GVPA 1Q1BA 3B6YA 2JK8A 1YUXA 2JQOA 3F2CA 3CCEA 3FKIG 2NN6G 4A3EG 2BH2A 4GKKL 1S30A 1SE8A 5C3EH 5M3MH 5FLMH 2WFWA 2ZM6L 1TXYA 2AKWB 3CXCA 4LFBQ 2HHHQ 5M3MG 5M5YH 1RDVA 1PYSB 4JOIC 5FLMG 3G71A 1VQ8A 1XPUA 4BXXG 1QZGA 4OWXB 3S1NH 4R1JA 1D8LA 3UE1A 4OO1G 4ME3A 2JA5G 1XMQL 4QY7A 1CUKA 1HNWQ 4TQUS 2AWNA 3AFQA 4GOPC 3NELA 1UE7A 4A75A 3CCMA 1QUQB 4A3DH 5JJLA 4JYAQ 2RCNA 1R0FA 4EX5A 1J5EQ 1X3EA 3I56A 2K2DA 1SRUA 2XGTA 5H1SE 1GO3E 3U4ZA 4A3IG 2ZTDA 1MJCA 3I2ZA 2PVXA 2MFIA 2YTVA 5LMNW 3K0XA 4NXNQ 3HOVG 2MO1A 4A3JH 1L1OA 1VQLA 4P73A 4X62Q 1X56A 1NE3A 1CSPA 3HOYG 1TWGH 2ID0A 3TQYA 2D62A 1VQIA 1N32Q 2YTXA 4YWKA 2GVBA 4A3JG 2YV5A 5JJIA 5FLXc 1YK4A 4YCWA 1YITA 3AFPA 4JI5L 1CSQA 3H3VH 4K0KQ 1L1OC 3UDGA 1QUQA 1YBYA 4IOCA 2OTLA 4UP9A 4DV7L 2GMGA 4LW1A 1BFYA 4H02A 3J80c 4DR4Q 1G6PA 1N32L 4BA1I 2CWAA 3AYHB 1IXRA 1T9HA 1KD1C 2I0QA 3QVDA 1Q82C 4YY3L 2R92G 1OXSC 5IE8A 5M5WH 4LF9Q 1WFQA 3RZDH 1P8LA 3A44A 3PUWA 4J15A 1U5KA 1M1KC 3RZ6A 2B29A 4EQ5A 4LF5L 3CC7A 4QIWE 2UUBQ 4A76A 4DPGA 4DAYB 4DV1Q 3KYHC 1J5EL 1W3SA 3S14H 2E5LQ 4PMWA 4HIOA 2E2IH 1PV4A 4A93G 3J7A5 1CADA 4DV7Q 2ASBA 2KN9A 3PSIA 4A3EH 1IZ6A 2OCEA 3S2HH 1YHBA 3S24A 1X65A 3ERSX 1IROA 2CCZA 3NBHB 1E1OA 2UUAQ 1EYGA 4IPGA 4C3JH 4TPUA 2H5XA 1C9OA 4GS3A 2YYZA 1VQPA 1OTCA 4A3CG 2BA1A 3KJOA 1ASZA 4DR2Q 1WOCA 4JI8Q 4UP7A 3PIOA 4POFA 1H7VA 4LF7L 2AWOA 4DUZL 4GNXB 3S2DH 2I5HA 2R7ZG 1AE3A 5GAHC 4P74A 4OONA 1HNZQ 4WJ4A 2PMZE 4DV6Q 3BZCA 4O2DA 1AE2A 1WJJA 1EWIA 4LUZA 4JBWA 4AYBE 4X66L 5IYBG 5C0XJ 3J81i 3T1HL 1NJIC 3A74A 3IRBA 4A4IA 3JC63 4DV4L 1W2BA 1Q8KA 1E22A 4JI6Q 1E1TA 2VW9A 4Y52H 4QJFA 3CC4A 3JAMi 2F52A 4DV0L 3JC62 1SMWA 3MXNB 1VQDA 4JI4Q 4A3FH 2GN5A 1JMCA 4DR4L 2ALYB 5RXNA 2UXCQ 2XTIA 2HIXA 1EIYB 1LKOA 1PYBA 4LF9L 4B3RL 1XMOL 3RZOH 2JA9A 2IY5B 3K7UC 1PH4A 2F4VQ 1R0IA 4Y7NH 2N3SA 4FDBA 5LMNQ 3JC66 1RYTA 4DNIA 4DR7L 4AR3A 3RN2A 1UEBA 1BE7A 1ZRPA 2Y0SE 4XTCS 4JI2Q 1JT8A 3T1YL 2UXDL 2NVYH 2UUCL 3CCLA 4DR6Q 4DR3Q 4QQBX 3I55A 1JJGA 1TWFH 4BBRG 1IBML 1D7QA 3KDFB 2IHFA 3EIVA 1SMXA 1V9PA 4OO1I 4YCVA 3I4NG 3KYXA 1BQ9A 4APVA 1QZHA 2LXJA 3KLWA 2E2JH 4R4OA 3CD6A 1XNQL 3MPSA 4DV3L 2Q2HA 3GTGH 3D0FA 1XNRL 1YV1A 2OQKA 3F1ZA 4BBRH 5IWAL 1WCMG 3H0GG 4R4CA 3J7ZC 2B63H 2VNUD 3K81C 2Q2UA 3CPWA 2PYAA 2M4YA 4AR4A 1TWHH 2DGYA 2VY3A 1JE5A 3PGZA 4JOIA 3MEFA 1Q81C 1RDGA 3S17H 4JC0A 1U0LA 2ES2A 4QGUA 3WWVA 1UWVA 4DV6L 1K73C 3E9HA 1EIFA 1B13A 1YVCA 2JA7H 1I3QH 3K7AH 3CC2A 2VZAA 1SROA 2JE6I 2ZM6Q 2IX1A 4JI5Q 4K9FA 2PI2A 4JI8L 5M3FG 3BJUA 2OWOA 1Z9FA 2Z6KC 2LSSA 3CW2C 5ELNA 2YTYA 5AJ3Q 4JBMA 3AEVA 1H95A 3HOXG 3SGIA 3GD7A 1KXLA 4LF4Q 2F3IA 1IL2A 4UY8C 1C7YA 4GLXA 4JI3Q 3CP0A 1C0AA 3KF8B 4IJHA 1K8AC 1LM0A 3HOVH 1OXTA 3D31A 1UE5A 3CAMA 1DGSA 2C35B 4JI0L 2R7ZH 3A5UA 1Q86C 3GTKH 3PCOB 4X64Q 3GTQH 2R6GA 4X66Q 1VQKA 4PZ7A 1A63A 4IJLA 5IT9c 5BR8Q 5ELOA 1Y1WH 2I5MX 4GOPA 1XNRQ 3GTOH 2MS3A 1K8GA 3GTPH 2QL0A 3KYUA 4A3DG 1XJVA 2BA0A 1Q7YC 4DR2L 1TWCH 3PZAA 1PH6A 3CCRA 4IFDI 2WAQE 4LF8L 4A3LG 1N9WA 3TREA 2JA5H 3T1YQ 2L15A 1FL0A 4LFCQ 2UXDQ 1L2FA 2WB1G 1R9TH 4BXXH 1A62A 3HKZG 1B7YB 4A3LH 8RXNA 1R0JA 5IYDG 4OWTB 3ULJA 3OW2A 1JB7A 2LCQA 1S3OA 2NVXH 1SLJA 4DR5L 2ZJQA 2UXBL 1SMUA 3I7FA 2MQHA 4DV1L 1N36L 2E5LL 1JYBA 2A19A 2VQEL 1PH1A 1NMGA 4GNXC 3RNUA 3CPFA 4AH6A 4JI7Q 1Y1WG 3S1MH 4LF5Q 4DUYL 3TS0A 1K9MC 2VS1A 3HOZH 2R92H 4NPSA 3PUVA 4R4QA 3W1BA 4DV3Q 1VQ7A 4A3GH 2R93G 1VQ4A 1VCXA 1E3PA 4KHZA 1XMQQ 3PF5A 3VDYA 4NXML 2B3GA 1Y1VH 3U4VA 1C09A 4LF6Q 1YJWA 3K8AA 4JI2L 2A1AA 1HR0W 1S72A 2UXBQ 3DM3A 1S2ZA 4JBJA 5M3FH 4BY1G 1IBKL 2JA6H 3F8TA 1T9QA 1HZBA 5DLQE 4AR5A 1N34Q 1VQJA 3M4QA 3OYYA 2K50A 1RL2A 4C3IH 4KHPQ 3A0JA 3KOJA 1NBWA 2CQOA 4GN5A 4BBSH 1NTGA 1KRSA 3RR5A 5FJ8H 1I94Q 2A8VA 1VQNA 3M3YH 4AIMA 4LF6L 4DV4Q 4B3ML 4TVAB 1KQSA 2QA4A 1WCMH 3FP9A 1EQQA 1QVCA 3PO2G 1LKMA 1YK5A 1V1QA 2RHQB 1SR3A 3CCJA 1K83H 1HR0L 4JI0Q 2ZJPA 4A3MH 4JYAL 3OTOQ 3RLFA 1CKOA 1NY4A 1B2JA 1BRFA 2HQLA 2N78A 3JAMc 1RB9A 1FJGQ 2LXKA 1FHHA 5GQOA 2MNAA 3TS2A 4R4IA 1XPRA 5LMNL 2K75A 4GKJL 1FGUA 1HZCA 3NEMA 1CKMA 1IBLL 4JG2A 1I6HH 1JJ2A 4PZ6A 1E8JA 2WP8J 3W5OA 5AJ3L 3HOWH 4DV5Q 1RIPA 1VQHA 3G48A 3RLNA 4YWMA 1T9PA 1IBKQ 4X6AH 1AH9A 3U58A 1WYDA 4XIGS 1VQFA 2D0OA 4MZ9A 5IYCG 2JA8G 4GOPB 5GADC 1XMOQ 1VQ6A 5IP9H 5C4JH 2MO0A 2GVAA 4DR1Q 1VQ9A 4UP8A 3J81c 1J6QA 4JI1Q 4AQYQ 2N8NA 1Y1VG 1LYLA 3STBD 4BY7H 3CCSA 2UUBL 4DUYQ 4JCVE 3H3VI 2RDVA 4KHPL 5IYCH 2AHOB 1IBMQ 1A0IA 2K4KA 2CFMA 1X3FA 2IHEA 5IYBH 1B8AA 4HJAA 2NVQH 1B2OA 2JA8H 1VQBA 3RLOA 3HOWG 4L5RC 2PNHA 1YHQA 1PVOA 4IFDG 4DR6L 4LFCL 3PWFA 1HJPA 3J81j 4X65Q 5C4XG 3NENA 2ZJRA 3KF6A 2PQAB 2ATWA 4PG3A 3PV0A 5JEAJ 3KFUA 3L0OA 3RZTA 5JEAG 5LMUQ 2UUAL 3PUXA 3PO3H 4P75A 1IU5A 4DV5L 4IPHA 4A3KH 4LWCA 1BBWA 1QCVA 5C44G 2VQFQ 5IWAQ 4A93H 4IOAA 1YJ9A 3RYGA 1X3GA 3PUZA 3PO2H 4GN4B 4GKJQ 4IFDJ 4RG1A 4P72A 1OXXK 3W1GA 1G51A 3GTLH 4YY3Q 1X6OA 3G6EA 2K5VA 4DR3L 1A8VA 3I4OA 4B3SQ 2HT1A 1BBUA 2Y0SG 3E0EA 4DKAC 5FJ8G 2KCTA 3CCUA 2UU9Q 4DAMA 4HJ8A 4LF4L 1QVFA 4LFAQ 4YHHQ 1SMMA 3KJPA 1N8RC 2KENA 4B3TQ 4RXNA 1CKNA 3PF4A 1YHAA 2EXDA 2YU9H 1L0WA 2V3BB 3AQQA 1N36Q 1B71A 2I5LX 1GD7A 1LKPA 2V1CC 4L5TA 4O0AA 5C0XI 4BY1H 2NVTH 1I94L 1YJNA 1DX8A 1Y14B 2BH8A 4ALPA 3CMAA 2JA6G 1E7ZA 2HR5A 4QL5A 3HOXH 4MTNA 4B3RQ 4K0KL 4YHHL 4IPDA 2HIVA 1IU6A 3CCVA 3HOYH 3UDXA 1HH2P 3ICEA 2Z6KA 1PH3A 4JBKA 2OQ0A 4B3SL 1PH7A 4A3IH 1KIXA 4A3GG 1R0HA 1BKBA 4LF8Q 1QYBA 1VQCA 3BZKA 1IYJB 4KLKA 4NB3A 1I5FA 3I4MG 3ZJYC 1PH5A 4OX9L 2UXCL 5K36G 5HY6A 4JI6L 1EUJA 1Q46A 1T9OA 2K5NA 3CCQA 4DV0Q 3LGJA 4LNQA 1VCIA 2B63G 1CAAA 3GTMH 3SS2A 3PUYA 4DK6C 3M85A 4GNXA 1KHIA 3HOUH 1CKNB 1YNXA 2E2HH 1Q12A 2VUMG 2KCMA 1N34L 2VQEQ 5IYDH 2VQFL 2D0PA 3EN2A 3F2BA 2OTJA 1IRNA 4JI7L 5EAYA 1EFWA 4L5QA 1SFOH 1TWAH 1ASYA 1K3RA 2KHIA 2KHJA 3DLLA 1VQEA 4AYBG 5C44H 1BVSA 4DR1L 1E24A 4GN3B 4GLVB 3H15A 1YI2A 1PH2A 3UDIA 1GKHA 3PO3G 4X65L 5C3EG 1LTLA 3FKIH 3GTJH 3KYYA 1KC8C 4LUOA 1HNXQ 4AR6A 2VUMH 1Q1EA 1VQOA 3HOUG 3M4PA 4OXPA 1LUZA 5C0XG 4JI4L 1N33Q 4JI1L 1S24A 1KAWA 5GAEC
chains in the Genus database with same CATH superfamily
4JK1C 4XT1B 1Z47A 3IFTA 3PIP1 3TEHB 5HGQA 4C3HB 4RCNA 2E2JB 2DSXA 2G9HD 3H6MA 3BVGA 1M90C 2D9UA 1FNWA 2EYFA 4JV5L 4EQPA 4X64L 2NZHA 1BNZA 3H97A 5IT9L 1UE6A 3S14B 1I50H 3PO3B 4XGHA 2NYDA 4UPAA 4BA2I 4NP5A 1ENCA 3S15B 2Q2TA 4C2MH 4NDXA 3FMCA 3S1MB 1DJRD 2K14A 5LMUL 1I6HB 1PFVA 5M5XL 2EY2A 5C4XB 5HGTA 4H13C 3HKSA 5E4WC 3S1QH 1VQGA 4IPCA 2NZOA 1ZKOA 3VR4A 3J80i 3EBEA 4V196 4HJ9A 4A3GL 2NTTA 4HIDA 3STBC 4NXMQ 1B44D 2CKAA 2KKDA 1PRTF 3S9WA 1MJEA 4DAVA 4H44C 1S5BD 5GROA 1G291 3HOUB 2Q2IA 5IYBL 2BCOA 3L7ZC 4BBSG 3KYVA 2PI2E 1I3QL 2VL6A 2EY4E 4A3EB 1DVBA 3F2DA 2F3VA 1XWEA 2ZTEA 4B3TL 3KF6B 1IW7D 1SN8A 4XT3B 1ILPA 2JEBI 4C3HH 1JJCB 4L8JA 3CQZB 5CV9A 2WB1E 1PZKD 5K2ME 2KBNA 3MXGA 3T1HQ 4CBVA 2R93L 2PPTA 4JI3L 3I90A 5J3BA 4DUZQ 3NPPA 4MNOA 5LL6X 1TIID 3GO5A 1I50L 3MXPA 4A3CH 4YWLA 4GLAC 4RGTA 1BO0A 1V1PB 2DJFC 4KKSA 5DNFA 2WB1P 1J9OA 2BH2A 3FKIG 1Y1VL 4A3DL 1CQVA 5C3EH 5EINC 5FLMH 2WFWA 5EIOC 4X3KA 2ERSA 2ZM6L 4UY81 1STAA 3R93A 1NAPA 2HHHQ 2FJ2A 4OWXB 1ZXTA 4R1JA 1LACA 1AFPA 4A3ML 4ME3A 2JA5G 2EDGA 1STYA 2AWNA 1TWGL 3AFQA 3J80L 2F0EA 3NELA 1UE7A 4A3DH 1JE4A 2RDGA 5CR3A 2NVXL 2RVLA 2K28A 3M3YL 3I56A 2WIIB 4A3CL 2RDFA 3V2TA 3I2ZA 5LMNW 1JOKA 3GTKL 2PW7A 2MO1A 2ZXPA 5M5YB 1L1OA 1EQTA 1SE4A 4KJNA 2IX3A 4P73A 2H4OA 2RBMA 1DYQA 4YWKA 2GVBA 5M3MB 4HSPA 4JI5L 4KY7A 1H9JA 4EVOA 1CSQA 3MFYA 4BY1B 3MA2B 3LWQB 3UDGA 5C4JB 3DUZA 4UP9A 4BWGB 1G6PA 4BA1I 2MP1A 1B3QA 5EQ0A 3AYHB 1T9HA 3SDZA 3QVDA 2B63B 3SEBA 1OXSC 2JA7L 4LF9Q 1WFQA 3RZDH 1P8LA 4C2M1 1RODA 4J15A 4OO1H 2B29A 3EQLC 4LF5L 4XQJA 4DK0A 3SE0A 4A76A 4DV1Q 5FLML 3S14H 2NVTL 2E2IH 5TSSA 3PSIA 4ZK9B 4AHWA 1X65A 3ERSX 1IROA 4L63B 2I46A 4KV6A 4HMJA 5G3LF 2P5ZX 1WTPA 1WJVA 5M5WB 1CZGA 2BA1A 1LTBD 5C5MA 3PIOA 4POFA 2CH4W 4GNXB 2I5HA 3E5SA 4KK7A 1YHQA 3BZCA 5IYBG 4DV2Q 1WJJA 1NJIC 4LUZA 1K8GA 4X66L 2F3WA 3HOVL 1MI2A 4A4IA 5KRUA 4ID6A 4DV4L 1WD0A 4R8IA 4Y52H 4QJFA 4DV0L 3A54A 1D6EC 1SMWA 2PSMC 1JMCA 3U9SA 2ALYB 2XTIA 4X3TA 3WOFA 2HIXA 1DCZA 1H9RA 4IQZA 4LF9L 4IN3A 1XMOL 2IY5B 3GTPL 3K7UC 1R0IA 2VUML 1CHQD 1LLRD 4FDBA 5EPLA 1OWBA 4DR7L 1BE7A 2CH4A 1QNKA 1PZID 5DM73 4C3IL 2B63L 1E2WA 1TQOA 1M8AA 3I4NG 2HD3A 2LXJA 3KLWA 2XN9C 1SXTA 2OF1A 3FPPA 3CD6A 3GQBA 3KF8A 2Y0SP 3S16B 2PZWA 4BBRH 3CPWA 2PYAA 3D4RA 1KAWA 4JOIA 3GTPH 1JE5A 1KTKA 2F1MA 4QGUA 4TSSA 3OPOA 4CKBA 1WTXA 3E9HA 1B13A 4KY5A 1SROA 3M4YA 5LL6S 2ZM6Q 1K83L 4RWSC 2OWOA 3BJUA 1Z9FA 2Z6KC 3FEWX 2LSSA 3CW2C 4ZKBB 4UHVA 5AJ3Q 3DWQA 2KHSA 4AYBB 3GD7A 4LF4Q 2F3IA 1VF5C 2FMMA 1B9NA 1SNMA 4GLXA 1VMCA 1C0AA 2GA4B 1DGSA 1Q86C 3BG3A 3GV3A 4HAEA 2PZTA 4CJ0B 1T5XD 5IT9c 2B2YA 1BQQT 1XNRQ 5MFPA 2WAQB 3KYUA 4A3DG 3E0JA 2JA8B 3HKZP 1AN8A 4CDDC 1C48A 4A3LG 2KUMA 1RJTA 2JA5H 1CFMA 1FL0A 4CDCC 1RHPA 1B7YB 5IYDG 3HOZL 4OWTB 3ULJA 1JB7A 1CZWA 3KBXA 1SLJA 3H0GB 4ZN3B 2E5LL 1JYBA 1VZIA 3HG9A 3SXHA 3RNUA 4IFDH 3LWPB 4LHNA 2F0TA 1WVLA 3DEOA 2NYZD 2R92H 2N88A 3NBIA 1B3AA 4A3GH 1HRJA 3H99A 3PF5A 3HRZC 4LF6Q 1YJWA 3K8AA 2K5WA 4K5XA 3IKJA 1RCVD 4CDFC 1S2ZA 1K83B 4JBJA 1JOQA 4IUNA 4BY1G 3GTGL 3OWFA 1IBKL 2BE5D 3F8TA 1HZBA 2RSOA 3NBHA 3M4QA 4C3IH 2HDLA 4KHPQ 3A0JA 3KOJA 5DM71 2XWJB 4JVZA 2EXZA 1KRSA 4FYDA 3OHXC 4KTAA 1DD2A 4AIMA 2J9UB 2A6HD 2R93B 3SVMA 2QA4A 3A56A 1EQQA 4ZQ3A 2IL8A 3GTLB 3R8BA 1YK5A 1V1QA 3CCJA 2SNMA 2A68D 4N8X1 5A2QL 4JYAL 2KJXA 3RLFA 4UAIA 3A55A 4DF7A 1B2JA 3J7Z1 2HQLA 2LXKA 4G57A 1F2MA 3IU3I 1XPRA 4GKJL 3NEMA 4DNTB 1CKMA 5DAUA 5CYUA 3GTOL 4X6AH 1Y1WL 1WTWA 3U58A 1VQFA 4MZ9A 5EKKA 2EYMA 5FK9C 4UP8A 3J81c 1STGA 2B2VA 4JI1Q 5J39A 3I4NB 4JPBW 4TVMA 4JCVE 3H3VI 5IYCH 2AHOB 1A0IA 2K4KA 4HJAA 5IYBH 1B8AA 1VDZA 1VQBA 2M4VA 4L5RC 1PDQA 1F2ZA 5AN9H 3L3OC 1PVOA 4DR6L 4LFCL 4F8MA 1NR2A 2O4XA 2ZJRA 2XJVA 3VR2A 3KF6A 1QJOA 4PG3A 3PV0A 1HA6A 3L0OA 3RZTA 5LMUQ 3PO3H 2XIWA 5COYA 4P75A 4CKEA 2QDBA 4DV5L 4IPHA 4LWCA 1QCVA 1LTID 5IWAQ 1YJ9A 3RYGA 1X3GA 4IFDJ 2FINB 2F0LA 2DY7A 4P72A 1OXXK 1I4RA 1S5ED 3IL8A 3CRLC 5E3FA 3I4OA 1XYIA 4C1NK 1BBUA 3VYUA 4DKAC 1QVFA 3VYRA 1A2UA 2RKSA 4TRDA 3KJPA 4B3TQ 3EROA 1CKNA 1PFNA 2R92L 1N36Q 1B71A 2I5LX 4L5TA 3GTJB 2JI1A 4RKLA 1SMYC 2M00A 5FOBB 2BH8A 5JVH3 5IT9E 4K0KL 3HP3A 1IU6A 5AFWA 2A6ED 2JP1A 1V8QA 4JBKA 3S2DB 4LF8Q 1VQCA 3Q24A 3HJYB 1I5FA 4IZ8A 5IIFA 2M6OA 1K0SA 4U673 1Q46A 1T9OA 3LGJA 2HCIA 4B9XA 2XWBB 3GTMH 3M85A 4BY7L 5EJWA 3HOUH 2E2HH 2KCMA 1PZJD 1M4VA 4PV1C 2ZXRA 2V0FA 4P2CB 1YNNC 4KMUC 2NUCA 4DR1L 4GN3B 3H15A 1AP0A 3UDIA 3GTML 3KUPA 4RAUC 5C3EG 1STNA 1LTLA 4EQNA 1CQFA 3FKIH 1ESRA 1Q1EA 3MEHA 4RGOS 5C0XG 1N33Q 2O2LD 1HR0Q 3CMEA 1BOSA 1BQ8A 5D3DA 4OHJA 3D4WA 3I4MH 3CQZH 3HKZE 4MN3A 1I4XA 1IYVA 4LUVA 2D2CC 1SYBA 3S2HB 1O7IA 1UE1A 4K5VA 1WTHA 3KK7A 1G2TA 1XTDA 2AUSB 2JN4A 4DA2A 4F7XA 2R7DA 3S1RH 1QNUA 3P1HA 3L2PA 4GKKQ 1PFMA 4X62L 4QCLA 2Q8IB 3G4SA 3J81L 4FO2A 3R2IA 3S2DL 5JOBA 4AHXA 1LTRD 3GDEA 2AQCA 1PFWA 1D5MC 1KL9A 1L1OB 3BU2A 5IP7H 5CORA 1NR4A 2N49A 5I4DA 2EIFA 2QEXA 1BBXC 1QOHA 3I91A 1V1OA 2B2YC 2RHSB 3X3NA 3A5ZB 1HZAA 1LT4D 2K5HA 1TWCB 4LFBL 1SNPA 1E2ZA 3ER0A 3J81E 3KDFA 1VQMA 2AMCB 5C4ZA 5AI3A 2CWPA 4G6BA 4PZ8A 5E7NA 3CF5A 3K7AL 2O5IC 4X3SA 2K32A 5EKIA 2PVEA 3ULPA 1V43A 3G7LA 4XXBB 1PHJA 1MKHA 1SMYD 5KNCA 1XPOA 2UU9L 2IX0A 3NUCA 4A3FG 2K1BA 2L1BA 2NBFA 3Q8DA 1OXUA 4NXNL 2F4VL 1JWMD 4A3BG 5MFZA 1JOOA 4OWWB 4AQYL 1XTCD 1QG7A 4A93L 2KEEA 2QGQA 3RZDB 4KKUA 3C46A 3I4MB 2R93H 5JPNC 1WCMB 1B4OA 5E1FA 4GZYC 4L5SA 4HJ7A 1ODHA 3M4OB 3GTPB 1KLGD 2FMCA 4N9PA 3W2DA 5JJKA 3S17B 3S1NL 1PH8A 1B70B 5D14A 3B6YA 1C8CA 1LT3D 3CCEA 4A3EG 1S30A 2C6BA 1G8ZD 1YNND 2AKWB 4LFBQ 3G71A 1RDVA 3LNNA 4LMQD 4BXXG 5DEHA 4IALA 5DM61 1D8LA 3DM1A 3ND9A 3Q6SA 2EY1A 4QY7A 1HNWQ 3MVVA 1HPCA 3WDNA 4G4KA 2F0WA 1QE6A 2K6AA 1QUQB 3CCMA 4A75A 3HAXC 5GAGc 4BBRL 1R0FA 2G5DA 2IJ0A 1HA5A 3RD4A 2AQ1B 3RZOB 3HJWB 4C3HG 4A3IG 3PKJA 4NXNQ 3E3XA 1JB3A 5LHY1 3T4AC 1N32Q 4S3SA 2YTXA 3ZG6A 1LTSD 5JJIA 5FLXc 1YK4A 1YITA 5IOCA 2F0UA 3DMUA 4BS9A 2OTLA 4LW1A 1BFYA 3J80c 1N32L 5C5LA 5A35A 2CWAA 5CV6A 2SNSA 2I0QA 1Q82C 2VXWA 5IE8A 3D6CA 3A44A 3PUWA 1M1KC 3RZ6A 2XJSA 1I4HA 4J1MA 2UUBQ 1D5XC 4DAYB 5M3ML 1J5EL 2AQ2B 4PMWA 1Y1VB 3SK5A 4RKBA 1CA5A 1PV4A 5EGTA 3J7A5 5IGCA 1Z7TA 1IZ6A 2OCEA 2EVBA 5CV7A 1JCKB 3ERQA 1E1OA 1EYGA 3VR6A 1L0XB 4C3JH 2H5XA 1C9OA 3H0GL 2PMZB 2EYOA 1KLUD 1ASZA 3T53B 3FVQA 2NVXB 1H7VA 1S5DD 5T1GA 1SFOL 4Z9CB 2J0TD 4OONA 4DV6Q 4O2DA 4OIJA 4JBWA 3NQIA 3J81i 1AZPA 3IRBA 3JC63 4JI6Q 5C44B 1E1TA 4O1NA 3TMEA 4ODGA 2YU9B 4RHRA 2KOLA 4DR4L 5RXNA 4Y7NL 1EIYB 2JA9A 4A3BL 1D5ZC 4Y7NH 1AZQA 1UNSA 3JC66 1Q8IA 4K14A 1DOLA 1UEBA 5ELDA 1ZRPA 2Y0SE 3T51B 3CCLA 4DR6Q 1JJGA 1PYWD 4BBRG 1IBML 5NUCA 3KDFB 2IHFA 1D7QA 4YCVA 3KYXA 1BQ9A 1QZHA 1HUNA 4LAAA 1XNQL 3MPSA 1KDBA 2BDOA 2Q2HA 3D0FA 1EQVA 3GTGH 2PCFB 1YV1A 1XNRL 2VNUD 1I6HL 2B63H 2Q2UA 3S17H 1MBYA 3FDTA 3MEFA 4OIKA 3TBIB 2HVYC 1I6VC 4JC0A 4ABNA 1Q81C 2ES2A 3WWVA 5K36H 5M5WL 3EVQA 2VZAA 2JE6I 4JI5Q 4C3JB 1ILQA 3P7JA 4R9WA 4JBMA 1H95A 2PQEA 3A8KE 5A2QE 2WB1B 1SDFA 3A7AB 3SGIA 1D2BA 1SNOA 3F2UA 2AYJA 1TWFB 2J7ZA 1C7YA 3I4NL 5EKLA 1LM0A 1UE5A 1TS4A 3V96A 2C35B 1D1IA 2ERJA 1I3QB 1T5EA 2YU9L 3K57A 4IJLA 2VB2X 5BR8Q 1Y1WH 4MTKA 2I5MX 3GTOH 3VPBE 2QL0A 4A3EL 5I2XA 1XJVA 4G7HC 1Y8OB 1Q7YC 4DR2L 1TWCH 5CV5A 2E2IL 3TP6A 4IFDI 2WAQE 1N9WA 4YIJA 4LFCQ 4FF1A 1BCPB 1PTOB 1R9TH 1A62A 3HOXB 4BXXH 4A3LH 8RXNA 1EWHA 2NN6H 3OW2A 4F88A 4NKLA 3I7FA 4I65A 4DV1L 1X3PA 4GNXC 1RKNA 3S1MH 1Y1WG 3VR3A 4WFN3 4NPSA 3GTQB 2R7ZB 1EZ6A 4R4QA 1VCXA 1Q3LA 2X69A 2K04A 3SK8A 2O5JC 4JI2L 2XJUA 1S72A 1HTPA 3DM3A 4HSVA 3H9CA 5M3FH 2EYHA 1KDAA 1SYCA 3O13A 3BDCA 2J4XA 4FF3A 2L5TA 5ELEA 2I07B 3OYYA 5M9OA 1RL2A 1NNXA 4GN5A 2XRQD 4DXFA 5I9OA 3RR5A 4RH6A 1CA6A 1VQNA 1LTTD 4RHSA 3VR5A 1WCMH 4BY7B 3H3VM 1LKMA 2NZ1D 5JVG3 4JI0Q 1LT6D 2ZJPA 2B2TA 3S15L 3OTOQ 2ZXOA 1NY4A 4A3IL 2B8FA 3I8ZA 1Q90A 1FHHA 5GQOA 3TS2A 4MIUA 3T16A 4DK1A 3GTMB 3NWTA 1IBLL 5K5PA 1I6HH 5CV8A 4PZ6A 1E8JA 2WP8J 5AJ3L 2H1EA 4DV5Q 3G48A 1AH9A 1IBKQ 1T9PA 5JAVA 4TKOB 4X6AL 1WYDA 1JC7A 4XIGS 5IYCG 1ET9A 1XMOQ 1JQYD 2XSCA 1MSHA 2X6GA 5C4JH 1BCPC 1PTOC 2HUGA 2NVYL 5MF6A 1J6QA 3I70A 3QO2A 4AQYQ 2K01A 4QF4A 3CCSA 5EPJA 3PIO1 2JI2A 4DUYQ 3DHQA 2JSOA 2IHEA 2MJ8A 5CBAE 3DWAA 3MZ5A 5KYLA 3KBGA 2PNHA 1VMPA 4O42A 1A3TA 1EY0A 4J8QA 3EJIA 5C4XG 1DZ1A 3NENA 3HOVB 2SDFA 1EIHA 5JEAJ 2SOBA 2B2UA 5JEAG 4HTHA 1EU3A 3S1RB 5ELCA 1BBWA 3PUZA 4GN4B 3PL5A 3MSUA 2E2HB 2CW0C 2PZUA 1SAPA 3GTLH 4KD4A 2DY8A 4B3SQ 1A8VA 4C1NI 2HT1A 2Y0SG 3E0EA 3CCUA 2Z9HA 4LF4L 4K5WA 4XYOA 2B2UC 4YHHQ 2QF7A 3SR1A 1N8RC 3PO2L 4RXNA 1A2TA 1U4LA 1YHAA 5ELFA 4C3IB 3G6JB 2V1CC 1LKPA 5C0XI 5KIXA 2JA6G 4ALPA 2HR5A 4QL5A 4IPDA 1TWGB 3CCVA 2QKIC 1SFOB 3ICEA 2Z6KA 1DONA 4WRDA 1BKBA 5DM63 3S1QB 3BZKA 4KLKA 2CKCA 2Q8RE 2NVYB 4NB3A 1IHZA 4OX9L 1EUJA 2K05A 1ONLA 2MHVA 3UI2A 2Z8LA 3GTKB 2K5NA 2R92B 2B63G 1TWHL 3SS2A 1U4PA 1YNXA 2VUMG 1N34L 1ICWA 1Z6HA 2N55A 2VQFL 3LX0A 3NTIA 1EFWA 4A3FB 1ASYA 2KHIA 4K8IA 2KHJA 1VQEA 4AYBG 1BVSA 4GLVB 2D5DA 2ICIA 3K5LA 4LK1C 4X65L 2JA7B 3KYYA 1CTMA 1HNXQ 2VUMH 2CR8A 1IKMA 1PLFA 3M4PA 4DAYA 4JI1L 2WAQG 2PQAA 3Q0AA 1OWCA 3S1ML 2RF4A 3OTOL 4DR5Q 4BY7G 4LF7Q 1QVGA 3TZUA 1VQAA 2NB0A 3D4DA 2F0KA 2HCCA 5IP9G 4HIKA 1A3UA 4OX9Q 5GAEc 3K6OA 2ZTCA 3FDJA 2R7FA 1NSNS 3K0YA 4QIWP 1JWUD 1X9NA 1GHKA 1TWFL 4HMIA 4KI0A 5GAHc 4XDXA 4K6DA 5CGKA 3E9IA 5M5XH 3WWLA 3H0GH 2JJQA 2Z4IA 4DXGA 3S16H 1CK1A 1S5CD 1SJED 1TT2A 4A3MG 1SEBD 3QQCE 7RXNA 1S40A 1YIJA 4B9WA 3P2AA 5C4XL 2CKZB 3HFZB 2KVMA 3ULLA 2EJMA 5C4XH 4FVMA 4K2KA 2XJRA 1HNXL 2BE5C 1B2TA 4KJOA 4YCUA 4DK3C 4C3IG 3S15H 2Z0SA 1HZ9A 4CKCA 1VS0A 1FJGL 1K0RA 4WFN1 1KAAA 4POGA 2R61A 2DUDA 3TRZA 4PMCA 4HIMA 2XNAC 3S2HL 1KRTA 1R0GA 3RN5A 4JV5Q 4IO9A 2X6LA 2QDLA 1EOTA 4B3MQ 3HOZG 5BR8L 3UDFA 2UUCQ 1NXEA 1IYUA 2F0SA 1BCPD 1PTOD 4HJ5A 4RCOA 3LWEA 4K2LA 4FNFA 5C0XH 2NN6I 2IWHA 3QB3A 1PH9A 2NVQB 1K28A 1NNQA 1XX8A 4H0LC 1GVPA 1O7ZA 2JK8A 2JQOA 4KKTA 3F2CA 3IAYA 2NN6G 2QEJC 1SE8A 5F2DA 3CQZL 5HURA 1ICFB 3I3CA 5M3MG 5M5YH 1PYSB 4CJ1B 2O5JD 1H9SA 2B8GA 3GTQH 2FHTA 4A93B 3QG1A 3S1NH 1GUTA 5M5YL 3GV6A 4OO1G 1U4RA 2KCNA 1TVXA 2ENBA 4GOPC 5JJLA 4JYAQ 2JA8L 5JVH1 2RCNA 4KN4C 4EX5A 2Y0SB 1R4PB 2PO4A 1J5EQ 1LTGD 1SRUA 4PNYA 5H1SE 5FO8B 2XJPA 1MJCA 3JR7A 1JICA 2MFIA 2YTVA 1WTQA 3HOVG 1IL8A 3HOYG 4X62Q 1EYDA 1NE3A 1TWGH 2WKCA 1II3A 3DEPA 1VQIA 2XVSA 1AW7A 2EY6A 2PW5A 3ONAB 2K7VA 3IFDA 4YCWA 3BS1A 1F9SA 2L9HA 4K0KQ 1L1OC 4KD3A 3M3YB 4XQNA 3NE5B 1YBYA 5KNDA 4IOCA 4DV7L 1F9PA 2E2DC 4H02A 2LMCB 3I4ML 1SE3A 1W6JA 1IXRA 4R8NA 5M5WH 2JXMB 4DFAA 1GJXA 2KA7A 1U5KA 1F9QA 3BDOA 4EQ5A 3H94A 3NSWA 3S17L 4QIWE 3M7GA 1F9RA 4DPGA 3KYHC 1W3SA 4DAPA 4HIOA 2E2IB 2F0DA 2C5CA 4DV7Q 2KN9A 4ZUJA 3MFGA 3MHBA 1G91A 2IW3A 3TSSA 3EA6A 2CCZA 4ZRZA 3NBHB 3QOLA 2JA5L 5EBCA 4TPUA 5EPKA 4GS3A 5IYDL 3BZDB 4ULLA 1VQPA 1OTCA 2E2HL 3KJOA 4DR2Q 1WOCA 4JI8Q 2Z1CA 4UP7A 3ITPA 3S2DH 3OWEB 2R7ZG 4OL7A 1HNZQ 2A73B 5G3LD 1AEXA 5C6AA 2VUMB 1AE2A 3RZOL 1EWIA 4AYBE 3TP5A 5C0XJ 3HGBA 1W2BA 3KLRA 4CDEC 5FLXL 1IW7C 3JAMi 3JC62 3LWVB 3MXNB 1VQDA 4JI4Q 4H7BA 4A3FH 3GTOB 1PYBA 3RZOH 1VZHA 1PH4A 2F4VQ 4C2MB 2N3SA 5MLC3 5IYCL 4XXEA 1WTVA 1RYTA 2MPMA 4AI2A 4DNIA 3V05A 5J1ZA 4XTCS 1JT8A 4JI2Q 4FF4A 3T1YL 2UXDL 2NVYH 4AYBP 2MGSA 4A3JL 1R4QB 1V9PA 3MXNA 4APVA 1TU2B 2E2JH 1FYCA 4DV3L 2EYLA 2PYKA 2OQKA 2F0IA 3F1ZA 2CQAA 4R4CA 3BYTB 3J7ZC 4QUCA 4Q5VA 2VY3A 2M4YA 4HJ8A 3PGZA 4JAEA 2E74C 1RDGA 4RGNA 2OXPA 1UWVA 2M6PA 1X32A 1K73C 1KDCA 1STEA 3K7AH 3CC2A 2TMPA 2IX1A 4K9FA 4JI8L 5M3FG 2JA6B 3AEVA 4DU9A 3HOXG 3AB9A 1KXLA 1NCVA 1IL2A 4UY8C 4A3KB 4NMZA 1H9MA 1K8AC 3A8JE 2XRSD 3HOVH 1OXTA 3D31A 1HHVA 4E6YA 1F4LA 1SYDA 5IP9L 1HFGA 2F0VA 3A5UA 4IUVA 4X66Q 1C4QA 1VQKA 3K7AB 1O7YA 5KNBA 5ELOA 2JYOA 4GOPA 2MS3A 3DXJC 4HR7B 4IUQA 3QOJA 1P7PA 4C3JG 3CCRA 2IPKD 1CI3M 2APOB 3T1YQ 2L15A 2UXDQ 1EFID 1BF4A 1L2FA 2WB1G 3HKZG 4N9TA 4HCSA 2K5DA 3B0AB 2LCQA 2NVXH 5KYIA 4DR5L 2ZJQA 2UXBL 2MQHA 3PO3L 1PXUA 1PH1A 1GUGA 1NMGA 2CVRA 4AH6A 1LO5D 3VYSA 2SEBD 4LF5Q 2A6HC 2VS1A 2L11A 1B53A 5IODA 3W1BA 4DV3Q 2DN8A 1VQ4A 1Z92B 1FD7D 2F0NA 3PO2B 4KHZA 1XMQQ 1EL0A 3HOXL 2B3GA 1Y1VH 3U4VA 2CHBD 4C3JL 5I6YA 1PRTD 1HR0W 2UXBQ 5I6WA 1I4QA 4A3GB 3T13A 1T9QA 5DLQE 4AR5A 1N34Q 4E6IA 1VQJA 2DNCA 3HEJA 4AHYA 2K50A 2NWGA 3NXWA 3R3OA 1F77A 1NBWA 2CQOA 4BBSH 1GOZA 4ZAIA 3M3YH 2WV6D 1RTOA 4LF6L 1TS5A 3RMHA 1ENAA 4DV4Q 1KQSA 1ET6A 3GTGB 3PO2G 3NTHA 2RHQB 1HR0L 1SR3A 1K83H 3C1EA 1EEFD 5FKAC 4A3MH 3C2PA 1X3QA 4U68A 1TWAB 1L0YB 1BRFA 1RB9A 2RFKB 1FJGQ 1RD9D 2MNAA 1DM0B 1A6XA 2V0EA 4R4IA 1GUWA 1FGUA 1HZCA 1Y8PB 1PFUA 3BDLA 4C56C 1JJ2A 2HDMA 3A8IE 3CKIB 1QCBD 3RLNA 2EZVA 1I50B 2D0OA 5I9PA 5GADC 2F0OA 1MD2D 2R7ZL 3GTQL 2MO0A 2GVAA 3D3RA 1B9MA 2AUKA 1VZGA 3J80E 4J6HA 3STBD 1Y1VG 1LYLA 4M1UB 2B2WA 2RDVA 4KHPL 3BYYB 4RA8A 3NWSA 1IBMQ 1X3FA 2WAQP 1DXMA 3DWPA 1H9SB 3RLOA 4MHEA 3HOWG 4IFDG 3PWFA 2K33A 3J81j 1NUCA 2OT2A 3MC0B 4Y52L 2K03A 1HQRD 2BOSA 1K3BC 3ND8A 5M3FB 3E6ZX 3FKIL 1IU5A 4U671 4KHVA 1QILA 4IURA 4A3KH 4HCEA 4IOAA 4GKJQ 3TP8A 4RG1A 2KEDA 3W1GA 4BBSL 2ICEC 4YY3Q 1RF2D 1X6OA 3G6EA 2K5VA 4DR3L 3I72A 1STHA 5C4JL 2B2WC 3CHBD 2KCTA 1TY0A 4DAMA 4LFAQ 4DNRB 1SMMA 4C3HL 3PF4A 1PFBA 5ISRA 5JVG1 3N52A 1BCPF 1PTOF 1L0WA 2V3BB 3AQQA 2YU9H 4B8CD 2NVTH 4ZYSA 1W6KA 5D65A 1BDOA 1EEID 1I94L 1PTOH 3HOXH 1R9TB 2XJQA 2HIVA 1TS3A 1HH2P 3X3MA 4KY6A 2NVTB 4A3IH 4IUPA 4AI0A 2UXCL 1K8OA 3I4MG 2B5ID 1PH5A 5MGNA 4JI6L 1YNJC 3CCQA 1DOMA 1PRTB 3FRPB 1CAAA 1SE2A 2DNEA 1SNQA 1KHIA 4FP5D 2KECA 4F87A 4ZUIA 1EY5A 4GNXA 3MWYW 3OMGA 2VQEQ 3TZDA 3EN2A 3LPEB 3F2BA 3AMUA 1IRNA 1EY9A 3N6RA 4JI7L 4L5QA 2TSSA 3DLLA 5C44H 2UXCQ 3S1QL 1E24A 2NTSA 3CU7A 3QJYA 2F0HA 1ESFA 5H1Sc 1HQMC 3S14L 1EY4A 1RYQA 1QWYA 1WTOA 4AR6A 2V4DA 3HOUG 3RUZA 1SYFA 4JI4L 4NW2A 1S24A 2AUJD 5GAEC 1RWDA 4P71A 4WJ3M 1SYGA 4LFAL 1PFYA 4A3BH 4ZKCB 3CRKC 4GS7D 1PA6A 1XNQQ 1X54A 1FHMA 3LWUA 1YUZA 4DV2L 4DR7Q 4CHTB 4UDUC 3PIPA 1P16A 2F0PA 3FHWA 2C6AA 1RDPD 5E4XA 3D6WA 4A3LL 2E8GA 5FO9B 1OXVA 1BUVT 2JA7G 3WWNB 5GAGC 2ZIXA 2B39A 3BVMA 3HOWB 1EQRA 2MUYA 4AI1A 3K80C 3M9BA 2EQSA 3PKIA 1EOVA 2E76C 2FXQA 1OO9B 1WI5A 2EY5A 4R4TA 4FXDA 1YEZA 1NMFA 3NQTA 1HNWL 1GHJA 2EJFC 3I4NH 1YZ6A 4A3KG 1JR0D 5IP7G 3KYWA 1VF7A 2F03A 3UE0A 3K5MA 2Q8TA 1HNZL 1N33L 1B50A 4X3UA 6RXNA 2L4NA 1D1KA 1GM5A 5FO7B 1IBLQ 2HHHL 1V1PA 5CBEE 5CC4A 4JADA 4CGYB 1XXGA 1EY8A 3FPUB 5IY0A 2A69D 1PMRA 5AI2A 2PNRC 3SK6A 1EYCA 1MIUA 1KNAA 3H3VC 4QUFA 3U50C 4I7ZC 2K52A 1TR5A 3HOZB 1PFSA 1O78A 5BN5A 4V0BA 1X55A 2JEAI 3M4OH 2IT1A 1FVIA 4RMFA 3M7NA 3L9AX 1ZYRD 1VQ5A 1Q1BA 4ME5A 1O80A 1YUXA 4BBRB 4DGZA 4GKKL 4N8FA 1CT1D 4LJZC 5M3MH 1K8MA 4OGQC 5C3EL 1TXYA 2QILA 3CXCA 1WD1A 3WOEA 1WCML 5FLMG 4A3JB 1XPUA 4JOIC 3SK4A 1VQ8A 3GP7A 1QZGA 3UE1A 3M4OL 1XMQL 1E0BA 1CUKA 4OELB 4TQUS 5I2YA 2A68C 1BR9A 4PQXA 5C4HA 1EU4A 2NVQL 2LFNA 1X3EA 4Q0FA 5GADc 2K2DA 4G7OC 2XGTA 2E2JL 2WINB 1GO3E 1UAPA 3U4ZA 2ZTDA 2PVXA 2EYPA 1EZ8A 2F0QA 3K0XA 2AQ3B 4A3JH 3BVZA 3OIPA 1VQLA 1X56A 1CSPA 2ID0A 3OOCA 2JA6L 3TQYA 2D62A 3GTLL 4JAFA 4A3JG 2YV5A 1U4MA 2H12A 3AFPA 3H3VH 1ZYRC 1QUQA 5L37A 2PMZP 2GMGA 1GUSA 5M5XB 4DR4Q 2R92G 1KD1C 4WJWA 4YY3L 5EBDA 4ZN1B 1E2VA 3H91A 2RCFA 4QB4A 3VYTA 3CC7A 3Q22A 3SHLA 4B08A 3MQKB 3P8BA 2E5LQ 4A93G 2M2LA 1CADA 3K5OA 2ASBA 4WORA 4A3EH 5BN3A 3S2HH 1YHBA 3S24A 2KCCA 5C3EB 2UUAQ 4DN4M 4IPGA 3KLSA 2YYZA 3D8GA 4A3CG 1JORA 1MSGA 1A3VA 4BBSB 2L0ZA 2LS01 3LWOB 2AWOA 4DUZL 4LF7L 3HZXA 1AE3A 5GAHC 4P74A 4WJ4A 2PMZE 3TP7A 3T1HL 3A74A 1Q8KA 1E22A 1UUPA 2A5HA 2VW9A 1QQTA 1LT5D 1S4ZA 3CC4A 2F52A 5C3WA 5IGFA 2GN5A 5KEEA 5IGBA 1ENFA 1FGBD 1R9TL 5KGUA 1LKOA 4B3RL 1I4PA 3W3AA 3R2TA 3MAQA 5LMNQ 1U9RA 4AR3A 4QMGA 1Y8NB 3RN2A 4A3DB 3JAME 2UUCL 2FFKB 4QQBX 4DR3Q 3MXUA 3I55A 1TWFH 3EIVA 3HS0C 1SMXA 4OO1I 1KNEA 1SYEA 4A3MB 4A3BB 4R4OA 1G6ZA 1SBBB 5C3XA 1KABA 1TWAL 2XJTA 5JPMC 5IWAL 1WCMG 3H0GG 3K81C 4AR4A 2DGYA 3LWRB 4JAGA 1U0LA 3J7AV 3VA5A 4DV6L 1EIFA 3RZDL 1YVCA 3AU7A 2JA7H 1I3QH 4HEDA 2F0JA 2EJGC 2PI2A 4FXGC 1HCZA 4K8JA 1TY2A 5ELNA 2YTYA 1GUNA 3URYA 1CHPD 4BY1L 2QCPX 1ML0D 4RGMA 4EGVA 2PPBC 3A7LA 1EYAA 3CP0A 4JI3Q 3KF8B 4IJHA 3QIAA 1Y69U 4ZCKA 3CAMA 3QR8A 4JI0L 2RQXA 4FF2A 2R7ZH 3PCOB 2A74C 4X64Q 2R6GA 3GTKH 4PZ7A 4RFBA 1A63A 5IP7L 3JAML 2EE1A 2LY7A 3HOWL 2BA0A 2QW7A 1PH6A 3J7AF 3PZAA 1SJHD 4LF8L 3TREA 1HUMA 3HOYB 3PIP3 3PQIA 2A6EC 1MGSA 5JEAH 1O7LA 3T56B 1R0JA 1SSOA 2ZT9C 1S3OA 2M9VA 1TKWB 1SMUA 1GUOA 1N36L 2A19A 2VQEL 3CPFA 1Y1WB 3I73A 5IGEA 4JI7Q 1DOKA 4DUYL 3TS0A 1K9MC 3HOZH 4A3FL 3PUVA 4CJ2C 1VQ7A 2R93G 2C9OA 1E3PA 4NXML 3VDYA 2KQ3A 5CV4A 4ILWA 2K5QA 1C09A 1S5FD 3OMCA 2B2VC 2A1AA 3K35A 2RA4A 4IUUA 2F0FA 2VB3X 2JA6H 4I7AA 2EPBA 1PRTC 4A3KL 4K6LA 2LKVA 3MTSA 2G9DA 2JI3A 1NTGA 1SNCA 1BXTA 5FJ8H 1I94Q 2A8VA 5BN4A 3LNLA 1ZEQX 4TVAB 4B3ML 1TS2A 4V190 3FP9A 1QVCA 3TN2A 4L6TB 3NTKA 3VA7A 2A69C 1EY6A 1CKOA 1EWCA 3JAMc 2N78A 3NHHA 3J7Y1 1GXDC 5D3IB 3HOYL 1NXGA 5LMNL 2K75A 1J8IA 4JG2A 2RSNA 3B08B 5T1IA 3W5OA 3HOWH 1A15A 4KN7C 1RIPA 1VQHA 1WTRA 1F2YA 4YWMA 2Z6BA 4Y7NB 3ZYYX 1IKLA 2JA8G 4GOPB 4A3IB 1VQ6A 1G2SA 5IP9H 3S1NB 4DR1Q 1VQ9A 1QB5D 3TDQA 2N8NA 4BY7H 3K5NA 2UUBL 3K59A 1MHWC 1B1ZA 2JA5B 4XYQA 2CFMA 2RDHA 3KLSX 2NVQH 2L0CA 1B2OA 2JA8H 2BDNA 2DJGC 2E75C 1HJPA 4X65Q 1HXYD 4QIWB 1EY7A 4XQQA 2ATWA 2PQAB 3OSOA 3KFUA 3U9OA 2UUAL 1FR3A 3PUXA 3GTJL 5C44G 3EFXD 2VQFQ 4A93H 2HQEA 2F0MA 1STBA 3NK9A 3PO2H 1SNDA 1H9KA 2Z4HA 1G51A 4HN7A 1HFNA 5IGDA 2Z3QB 4AHZA 1UEAB 3P20A 5FJ8G 2UU9Q 3NFPI 1FNUA 5JJZA 2WKDA 3S1RL 1I4GA 2KENA 4LHLA 2Z3RB 2EXDA 5M3FL 3FKIB 1GD7A 4O0AA 4BY1H 4IUTA 1CM9A 1YJNA 1DX8A 1Y14B 3J7YW 3CMAA 1E7ZA 5J22A 4MTNA 3Q23A 4B3RQ 4YHHL 4ZLTF 2OEOA 3HKZB 4PMBA 3HOYH 3UDXA 2EYJA 1PH3A 4A3GG 2OQ0A 4B3SL 1PH7A 1KIXA 1R0HA 1QYBA 3H9BA 1IYJB 1HTLD 3OIQA 5K36G 3ZJYC 3C3LA 1EIGA 5HY6A 2R3ZA 1YNJD 4DV0Q 1RTNA 5ELBA 4M8AA 4G7ZC 4LNQA 2B2TC 1VCIA 3H09A 3OW7A 1LTAD 2L12A 4JW0A 3PUYA 4DK6C 1PZXA 2CW0D 5FLXE 3C1FA 5FJ8L 1CKNB 1JWSD 3NP8A 1Q12A 2F0GA 4BXXL 5IYDH 3P75A 1FNVA 1LABA 2D0PA 3S16L 2OTJA 1LV9A 5EAYA 1SFOH 1TWAH 1TWCL 1K3RA 1PH2A 3HOUL 5IGGA 5C44L 1YI2A 1GKHA 3PO3G 2EOTA 4AI3A 1TWHB 5CMDA 4FXKC 3PIO3 2L55A 3GTJH 3K58A 2F4IA 4LUOA 1KC8C 4EQOA 3PMFA 1VQOA 2WACA 4OXPA 1LUZA 3I4LA 3QWNA 1TWHH 4OEMB 1F2LA
chains in the Genus database with same CATH topology
1Z47A 1RWDA 3PIP1 4P71A 3TEHB 2PQAA 5HGQA 3CMEA 1HR0Q 4WJ3M 1BQ8A 1OWCA 2RF4A 2DSXA 4LFAL 3I4MH 3CQZH 4A3BH 3HKZE 3OTOL 4DR5Q 4BY7G 4LF7Q 4GS7D 1QVGA 1PA6A 1M90C 1XNQQ 1X54A 1FHMA 1VQAA 4LUVA 4JV5L 1YUZA 4X64L 4DV2L 4DR7Q 2NZHA 1O7IA 1UE1A 5IP9G 4HIKA 3PIPA 4OX9Q 1UE6A 5GAEc 1I50H 1P16A 1XTDA 2ZTCA 2C6AA 4XGHA 2NYDA 2R7DA 3FHWA 2R7FA 4UPAA 3L2PA 2E8GA 3S1RH 1OXVA 2JA7G 4BA2I 4GKKQ 4X62L 3WWNB 5GAGC 3G4SA 2ZIXA 2WAQG 1X9NA 2Q2TA 4C2MH 2K14A 5LMUL 4KI0A 5GAHc 1EQRA 4AHXA 4DV2Q 3GDEA 4AI1A 3K80C 3M9BA 1KL9A 3HKSA 1L1OB 2EQSA 3E9IA 1VQGA 4IPCA 2NZOA 3BU2A 3PKIA 1EOVA 2FXQA 3WWLA 5IP7H 3H0GH 2JJQA 5M5XH 1WI5A 2N49A 3J80i 2EIFA 3EBEA 2QEXA 3S16H 4V196 4HJ9A 4R4TA 3S1QH 1YEZA 1NMFA 4HIDA 2RHSB 3A5ZB 3STBC 4NXMQ 1HNWL 1HZAA 4A3MG 2CKAA 3I4NH 2KKDA 3QQCE 7RXNA 1YZ6A 2K5HA 5IP7G 4A3KG 1S40A 1MJEA 3KYWA 1YIJA 4LFBL 3UE0A 3P2AA 5GROA 2CKZB 3HFZB 3ER0A 1HNZL 3KDFA 3ULLA 1G291 1VQMA 1N33L 2AMCB 6RXNA 5AI3A 2CWPA 5C4XH 4G6BA 1GM5A 2Q2IA 3L7ZC 2XJRA 4PZ8A 5E7NA 1HNXL 4BBSG 1IBLQ 3KYVA 2PI2E 2HHHL 3CF5A 4DK3C 4YCUA 3S15H 2Z0SA 1HZ9A 4JADA 2VL6A 2PVEA 1VS0A 3ULPA 1K0RA 4WFN1 1V43A 1FJGL 4XXBB 1PHJA 1DVBA 1MKHA 5IY0A 2A69D 4POGA 2IX0A 4A3FG 1XPOA 2UU9L 3F2DA 5AI2A 2ZTEA 3Q8DA 1OXUA 2DUDA 4NXNL 2F4VL 4B3TL 3KF6B 3TRZA 1IW7D 1MIUA 1SN8A 4HIMA 4A3BG 5MFZA 1R0GA 2JEBI 1KRTA 3U50C 3RN5A 4IO9A 4C3HH 1JJCB 4AQYL 2K52A 4OWWB 2WB1E 4JV5Q 2QGQA 5K2ME 2KBNA 3T1HQ 1PFSA 2UXCL 2R93H 4B3MQ 3HOZG 5BR8L 3UDFA 2UUCQ 1NXEA 2PPTA 4JI3L 4HJ5A 4L5SA 5J3BA 4DUZQ 4HJ7A 4MNOA 1ODHA 3GO5A 1X55A 2NN6I 5JJKA 2JEAI 3M4OH 4A3CH 4YWLA 1FVIA 2IT1A 4GLAC 4RMFA 1PH9A 3M7NA 1NNQA 1PH8A 1B70B 1VQ5A 1GVPA 1Q1BA 3B6YA 2JK8A 1YUXA 2JQOA 3F2CA 3CCEA 3FKIG 2NN6G 4A3EG 2BH2A 4GKKL 1S30A 1SE8A 5EINC 5C3EH 5M3MH 5FLMH 2C6BA 5EIOC 2WFWA 2ERSA 1TXYA 2AKWB 4UY81 2ZM6L 3CXCA 4LFBQ 2HHHQ 5M3MG 5M5YH 1RDVA 1PYSB 4JOIC 2O5JD 5FLMG 3G71A 1VQ8A 1XPUA 1QZGA 4BXXG 4OWXB 5DM61 3S1NH 4R1JA 1D8LA 3UE1A 4OO1G 4ME3A 2JA5G 1XMQL 4QY7A 3S17H 1CUKA 1HNWQ 4TQUS 2AWNA 3AFQA 4GOPC 3NELA 1UE7A 4A75A 3CCMA 1QUQB 4A3DH 5JJLA 4JYAQ 5GAGc 5JVH1 2RCNA 1R0FA 4EX5A 1J5EQ 1X3EA 5GADc 3I56A 2K2DA 1SRUA 2XGTA 5H1SE 1GO3E 3U4ZA 2XJPA 3PKJA 1MJCA 2ZTDA 2PVXA 3I2ZA 4A3IG 2MFIA 2YTVA 5LMNW 3K0XA 4NXNQ 3HOVG 2MO1A 4A3JH 1L1OA 1VQLA 4P73A 4X62Q 1X56A 1NE3A 1CSPA 3HOYG 1TWGH 2ID0A 3TQYA 2D62A 1VQIA 1N32Q 4JAFA 3ZG6A 2GVBA 2YTXA 2YV5A 4YWKA 2H12A 1YK4A 5FLXc 4A3JG 4YCWA 1YITA 3AFPA 4JI5L 1CSQA 3H3VH 4K0KQ 1L1OC 3UDGA 1QUQA 1YBYA 4IOCA 2OTLA 4UP9A 4DV7L 2GMGA 4LW1A 1BFYA 4H02A 3J80c 4DR4Q 1G6PA 1N32L 4BA1I 2CWAA 3AYHB 1IXRA 1T9HA 1KD1C 2I0QA 3QVDA 1Q82C 4YY3L 2R92G 1OXSC 5IE8A 5M5WH 4LF9Q 1WFQA 3RZDH 1P8LA 5JJIA 3A44A 3PUWA 4J15A 1U5KA 1M1KC 3RZ6A 2XJSA 4ZN1B 2B29A 4EQ5A 4LF5L 3CC7A 4QIWE 2UUBQ 4A76A 4DPGA 4DAYB 4DV1Q 3KYHC 1J5EL 3P8BA 1W3SA 2E5LQ 4PMWA 4HIOA 3S14H 2E2IH 1PV4A 4A93G 3J7A5 1CADA 4DV7Q 2ASBA 2KN9A 3PSIA 4A3EH 1IZ6A 2OCEA 3S2HH 1YHBA 4AHWA 1X65A 3ERSX 3S24A 1IROA 2CCZA 3NBHB 1E1OA 2UUAQ 1EYGA 4IPGA 4C3JH 4TPUA 2H5XA 1C9OA 4GS3A 2YYZA 1WJVA 1VQPA 1OTCA 4A3CG 2BA1A 3KJOA 1ASZA 4DR2Q 1WOCA 4JI8Q 4UP7A 3PIOA 4POFA 1H7VA 2L0ZA 4LF7L 2AWOA 4DUZL 4GNXB 3S2DH 2I5HA 2R7ZG 1AE3A 5GAHC 4P74A 4OONA 1HNZQ 4WJ4A 2PMZE 4DV6Q 3BZCA 4O2DA 1AE2A 1WJJA 1EWIA 4LUZA 4JBWA 4AYBE 4X66L 5IYBG 5C0XJ 3J81i 3T1HL 1NJIC 3A74A 3IRBA 4A4IA 3JC63 4DV4L 1W2BA 1Q8KA 1E22A 4JI6Q 1E1TA 2VW9A 4Y52H 4QJFA 3CC4A 3JAMi 2F52A 4DV0L 3JC62 1SMWA 3MXNB 1VQDA 4JI4Q 2PSMC 4A3FH 2GN5A 1JMCA 4DR4L 2ALYB 5RXNA 2UXCQ 2XTIA 2HIXA 1EIYB 1LKOA 1PYBA 4LF9L 4B3RL 1XMOL 3RZOH 2JA9A 1VZHA 2IY5B 3K7UC 1PH4A 2F4VQ 1R0IA 4Y7NH 2N3SA 5MLC3 4FDBA 5LMNQ 3JC66 1RYTA 1OWBA 4AI2A 4DNIA 4AR3A 4DR7L 3RN2A 1UEBA 1BE7A 1ZRPA 2Y0SE 4XTCS 4JI2Q 1JT8A 3T1YL 2UXDL 2NVYH 2UUCL 3CCLA 4DR6Q 4DR3Q 4QQBX 3I55A 1JJGA 1TWFH 4BBRG 1IBML 1D7QA 3KDFB 2IHFA 3EIVA 1SMXA 1V9PA 4OO1I 4YCVA 3I4NG 3KYXA 1BQ9A 4APVA 1QZHA 2LXJA 3KLWA 2E2JH 4R4OA 3CD6A 1XNQL 3MPSA 4DV3L 2Q2HA 3GTGH 3D0FA 1XNRL 1YV1A 2OQKA 2XJTA 3F1ZA 4BBRH 5IWAL 1WCMG 3H0GG 4R4CA 3J7ZC 2B63H 2VNUD 3K81C 2Q2UA 3CPWA 2PYAA 2M4YA 4AR4A 1KAWA 2DGYA 2VY3A 1JE5A 4JAEA 3PGZA 3MEFA 4JOIA 1RDGA 4JAGA 4JC0A 1Q81C 1U0LA 2ES2A 4QGUA 3WWVA 1UWVA 2M6PA 4DV6L 3E9HA 1EIFA 1K73C 1B13A 1YVCA 2JA7H 2NVTH 1I3QH 3K7AH 3CC2A 2VZAA 1SROA 2JE6I 2ZM6Q 2IX1A 4JI5Q 4K9FA 2PI2A 4JI8L 5M3FG 3BJUA 2OWOA 1Z9FA 2Z6KC 2LSSA 3CW2C 5ELNA 2YTYA 5AJ3Q 4JBMA 3AEVA 1H95A 3HOXG 3SGIA 3GD7A 1KXLA 4LF4Q 2F3IA 1IL2A 4UY8C 2AYJA 1C7YA 4GLXA 4JI3Q 3CP0A 1C0AA 3KF8B 4IJHA 1K8AC 1LM0A 3HOVH 1OXTA 3D31A 1UE5A 3CAMA 4E6YA 1DGSA 2C35B 4JI0L 2R7ZH 3A5UA 1Q86C 3GTKH 3PCOB 4X64Q 3GTQH 2R6GA 4X66Q 2ERJA 1VQKA 4PZ7A 1A63A 4IJLA 5IT9c 5BR8Q 5ELOA 1Y1WH 2I5MX 4GOPA 1XNRQ 3VPBE 2MS3A 5MFPA 1K8GA 3GTOH 2QL0A 3GTPH 3KYUA 4A3DG 1XJVA 2BA0A 1Q7YC 4DR2L 1TWCH 3PZAA 1PH6A 3CCRA 4IFDI 2WAQE 4LF8L 4A3LG 1N9WA 3TREA 2JA5H 3T1YQ 2L15A 1FL0A 4LFCQ 2UXDQ 1L2FA 2WB1G 1R9TH 4BXXH 1A62A 3HKZG 1B7YB 4A3LH 8RXNA 1R0JA 5IYDG 4OWTB 3ULJA 3OW2A 1JB7A 3B0AB 2LCQA 1S3OA 2NVXH 1SLJA 4DR5L 2ZJQA 2UXBL 1SMUA 3I7FA 2MQHA 4DV1L 1N36L 4ZN3B 2E5LL 1JYBA 1VZIA 2A19A 2VQEL 1NMGA 4GNXC 3RNUA 1PH1A 3CPFA 4LHNA 4AH6A 4JI7Q 1Y1WG 3S1MH 4LF5Q 4DUYL 3TS0A 1K9MC 2VS1A 3HOZH 2R92H 4NPSA 3PUVA 4R4QA 3W1BA 4DV3Q 1VQ7A 4A3GH 2R93G 1VQ4A 1Z92B 1VCXA 1E3PA 4KHZA 1XMQQ 3PF5A 3VDYA 4NXML 2B3GA 1Y1VH 3U4VA 1C09A 4LF6Q 1YJWA 3K8AA 4JI2L 2XJUA 2A1AA 1HR0W 3K35A 1S72A 2UXBQ 3DM3A 1S2ZA 4JBJA 5M3FH 4BY1G 1IBKL 2JA6H 2BE5D 3F8TA 1T9QA 1HZBA 5DLQE 4AR5A 1N34Q 1VQJA 3M4QA 4AHYA 2K50A 1RL2A 3OYYA 4C3IH 3A0JA 4KHPQ 3KOJA 1NBWA 5DM71 2JI3A 2CQOA 4GN5A 1NTGA 4BBSH 1KRSA 3RR5A 5FJ8H 1I94Q 2A8VA 1VQNA 3M3YH 4AIMA 4LF6L 2J9UB 4DV4Q 2A6HD 3LNLA 4TVAB 4B3ML 1KQSA 2QA4A 1WCMH 3FP9A 1EQQA 1QVCA 3PO2G 1LKMA 1YK5A 1V1QA 2RHQB 1SR3A 3CCJA 1K83H 1HR0L 4JI0Q 2A68D 2ZJPA 4A3MH 4JYAL 3OTOQ 3RLFA 1CKOA 1NY4A 1B2JA 3J7Z1 1BRFA 2HQLA 2N78A 3JAMc 1RB9A 1FJGQ 3J7Y1 2LXKA 1FHHA 5GQOA 2MNAA 3TS2A 2V0EA 3IU3I 1NXGA 4R4IA 1XPRA 5LMNL 2K75A 4GKJL 1FGUA 1HZCA 3NEMA 1CKMA 1IBLL 4JG2A 1I6HH 1JJ2A 4PZ6A 1E8JA 2WP8J 3B08B 3W5OA 5AJ3L 3HOWH 4DV5Q 1RIPA 1VQHA 3G48A 3RLNA 4YWMA 1T9PA 1IBKQ 4X6AH 1AH9A 3U58A 1WYDA 4XIGS 1VQFA 2D0OA 4MZ9A 5IYCG 2JA8G 5K36G 4GOPB 5GADC 1XMOQ 1VQ6A 5IP9H 5C4JH 2MO0A 2GVAA 4DR1Q 1VQ9A 4UP8A 3J81c 5MF6A 1J6QA 1VZGA 4JI1Q 4AQYQ 2N8NA 1Y1VG 1LYLA 3STBD 4BY7H 3CCSA 2UUBL 4TVMA 3PIO1 2JI2A 4DUYQ 4JCVE 3H3VI 2RDVA 4KHPL 5IYCH 2AHOB 1IBMQ 1A0IA 2K4KA 2CFMA 1X3FA 2IHEA 5IYBH 1B8AA 4HJAA 2NVQH 1B2OA 3I4MG 2JA8H 1VQBA 2M4VA 3RLOA 3HOWG 4L5RC 2PNHA 5AN9H 1YHQA 1PVOA 4IFDG 4DR6L 4LFCL 3PWFA 1HJPA 3J81j 4X65Q 5C4XG 3NENA 2XJVA 2ZJRA 3KF6A 2PQAB 2ATWA 4PG3A 3PV0A 5JEAJ 3KFUA 3L0OA 3RZTA 5JEAG 5LMUQ 2UUAL 3PUXA 3PO3H 4P75A 1IU5A 4U671 4DV5L 4IPHA 4A3KH 4LWCA 1BBWA 1QCVA 5C44G 2VQFQ 5IWAQ 4A93H 4IOAA 1YJ9A 3RYGA 1X3GA 3PUZA 3PO2H 4GN4B 4GKJQ 4IFDJ 3MSUA 4RG1A 4P72A 1OXXK 3W1GA 1G51A 3GTLH 4YY3Q 2Z3QB 4AHZA 1X6OA 3G6EA 2K5VA 4DR3L 1A8VA 3I4OA 4B3SQ 2HT1A 1BBUA 2Y0SG 3E0EA 4DKAC 5FJ8G 3NFPI 2KCTA 3CCUA 4DAMA 4HJ8A 2UU9Q 4LF4L 1QVFA 4LFAQ 4YHHQ 1SMMA 3KJPA 1N8RC 2KENA 4LHLA 4B3TQ 4RXNA 1CKNA 3PF4A 2Z3RB 1YHAA 5JVG1 2EXDA 1L0WA 2YU9H 2V3BB 3AQQA 1N36Q 1B71A 4B8CD 1GD7A 1LKPA 2JI1A 2I5LX 2V1CC 4L5TA 4O0AA 5C0XI 1I94L 4BY1H 1YJNA 1DX8A 1Y14B 2BH8A 4ALPA 3CMAA 2JA6G 1E7ZA 2HR5A 4QL5A 3HOXH 4MTNA 2XJQA 4B3RQ 4YHHL 4IPDA 2HIVA 1IU6A 3CCVA 3HOYH 4K0KL 2A6ED 3UDXA 1HH2P 3ICEA 2Z6KA 1PH3A 4JBKA 2OQ0A 4B3SL 1PH7A 4A3IH 1KIXA 4A3GG 1R0HA 1BKBA 4LF8Q 1QYBA 4AI0A 1VQCA 1IYJB 2CKCA 3BZKA 1I5FA 2B5ID 4KLKA 4NB3A 3ZJYC 2M6OA 5MGNA 5HY6A 1PH5A 4JI6L 1EUJA 4OX9L 1Q46A 1T9OA 2K5NA 3CCQA 4DV0Q 3LGJA 4LNQA 1VCIA 2B63G 1CAAA 3GTMH 3SS2A 3PUYA 4DK6C 3M85A 4GNXA 1KHIA 3HOUH 1CKNB 1YNXA 2E2HH 1Q12A 2VUMG 2KCMA 1N34L 2VQEQ 5IYDH 2VQFL 2V0FA 3LPEB 2D0PA 3EN2A 1IRNA 3F2BA 4JI7L 2OTJA 5EAYA 1EFWA 4L5QA 1SFOH 1TWAH 1ASYA 1K3RA 2KHIA 2KHJA 3DLLA 1VQEA 4AYBG 5C44H 1BVSA 4DR1L 1E24A 4GN3B 4GLVB 3H15A 1YI2A 1PH2A 3UDIA 1GKHA 5H1Sc 4X65L 5C3EG 4AI3A 3PO3G 1LTLA 3FKIH 1RYQA 3KYYA 3GTJH 1KC8C 4LUOA 1HNXQ 4AR6A 2VUMH 1Q1EA 2CR8A 1VQOA 3HOUG 3M4PA 4OXPA 1LUZA 5C0XG 4JI4L 1N33Q 4JI1L 1S24A 1TWHH 5GAEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z47 A;  1RWD A;  4P71 A;  3TEH B;  5HGQ A;  2PQA A;  1HR0 Q;  3CME A;  4WJ3 M;  1BQ8 A;  2RF4 A;  4LFA L;  2DSX A;  3I4M H;  4A3B H;  3CQZ H;  3HKZ E;  3OTO L;  4DR5 Q;  4BY7 G;  4LF7 Q;  1QVG A;  1PA6 A;  1M90 C;  1XNQ Q;  1X54 A;  1FHM A;  1VQA A;  4LUV A;  4JV5 L;  1YUZ A;  4X64 L;  4DV2 L;  4DR7 Q;  2NZH A;  1O7I A;  1UE1 A;  5IP9 G;  4HIK A;  3PIP A;  4OX9 Q;  1UE6 A;  1I50 H;  1P16 A;  1XTD A;  2ZTC A;  3FHW A;  2R7D A;  4UPA A;  3S1R H;  2R7F A;  3L2P A;  2E8G A;  4BA2 I;  1OXV A;  2JA7 G;  4GKK Q;  4X62 L;  5GAG C;  3G4S A;  2WAQ G;  1X9N A;  2Q2T A;  4C2M H;  2K14 A;  5LMU L;  4KI0 A;  1EQR A;  4DV2 Q;  3GDE A;  3K80 C;  3M9B A;  1KL9 A;  3HKS A;  1L1O B;  2EQS A;  3E9I A;  1VQG A;  4IPC A;  2NZO A;  3BU2 A;  1EOV A;  2FXQ A;  5IP7 H;  5M5X H;  3H0G H;  2JJQ A;  1WI5 A;  2N49 A;  3J80 i;  2EIF A;  3EBE A;  2QEX A;  3S16 H;  4HJ9 A;  4R4T A;  3S1Q H;  1YEZ A;  1NMF A;  4HID A;  2RHS B;  3A5Z B;  3STB C;  4NXM Q;  1HNW L;  1HZA A;  4A3M G;  3I4N H;  2KKD A;  7RXN A;  1YZ6 A;  2K5H A;  5IP7 G;  4A3K G;  1MJE A;  1S40 A;  3KYW A;  1YIJ A;  4LFB L;  3UE0 A;  5GRO A;  2CKZ B;  3HFZ B;  3ER0 A;  1HNZ L;  3KDF A;  3ULL A;  1G29 1;  1VQM A;  1N33 L;  2AMC B;  6RXN A;  5AI3 A;  2CWP A;  5C4X H;  1GM5 A;  2Q2I A;  3L7Z C;  4PZ8 A;  5E7N A;  1HNX L;  4BBS G;  1IBL Q;  3KYV A;  2PI2 E;  2HHH L;  3CF5 A;  4DK3 C;  4YCU A;  3S15 H;  2Z0S A;  1HZ9 A;  2VL6 A;  2PVE A;  1VS0 A;  3ULP A;  1K0R A;  1V43 A;  1FJG L;  1PHJ A;  1DVB A;  1MKH A;  5IY0 A;  1XPO A;  4POG A;  2IX0 A;  4A3F G;  2UU9 L;  3F2D A;  5AI2 A;  2ZTE A;  3Q8D A;  1OXU A;  2DUD A;  4NXN L;  2F4V L;  4B3T L;  3KF6 B;  3TRZ A;  1MIU A;  1SN8 A;  4HIM A;  4A3B G;  2JEB I;  1R0G A;  1KRT A;  3U50 C;  3RN5 A;  4OWW B;  4IO9 A;  4C3H H;  1JJC B;  4AQY L;  2K52 A;  4JV5 Q;  2WB1 E;  2QGQ A;  3T1H Q;  2KBN A;  1PFS A;  2R93 H;  4B3M Q;  3HOZ G;  5BR8 L;  3UDF A;  2UUC Q;  4JI3 L;  4HJ5 A;  4L5S A;  5J3B A;  4DUZ Q;  4HJ7 A;  4MNO A;  3GO5 A;  1X55 A;  2NN6 I;  5JJK A;  2JEA I;  3M4O H;  4A3C H;  4YWL A;  1FVI A;  2IT1 A;  4GLA C;  4RMF A;  1PH9 A;  3M7N A;  1NNQ A;  1PH8 A;  1B70 B;  1VQ5 A;  1GVP A;  1Q1B A;  3B6Y A;  2JK8 A;  1YUX A;  2JQO A;  3F2C A;  3CCE A;  3FKI G;  2NN6 G;  4A3E G;  2BH2 A;  4GKK L;  1S30 A;  1SE8 A;  5C3E H;  5M3M H;  5FLM H;  2WFW A;  2ZM6 L;  1TXY A;  2AKW B;  3CXC A;  4LFB Q;  2HHH Q;  5M3M G;  5M5Y H;  1RDV A;  1PYS B;  4JOI C;  5FLM G;  3G71 A;  1VQ8 A;  1XPU A;  4BXX G;  1QZG A;  4OWX B;  3S1N H;  4R1J A;  1D8L A;  3UE1 A;  4OO1 G;  4ME3 A;  2JA5 G;  1XMQ L;  4QY7 A;  1CUK A;  1HNW Q;  4TQU S;  2AWN A;  3AFQ A;  4GOP C;  3NEL A;  1UE7 A;  4A75 A;  3CCM A;  1QUQ B;  4A3D H;  5JJL A;  4JYA Q;  2RCN A;  1R0F A;  4EX5 A;  1J5E Q;  1X3E A;  3I56 A;  2K2D A;  1SRU A;  2XGT A;  5H1S E;  1GO3 E;  3U4Z A;  4A3I G;  2ZTD A;  1MJC A;  3I2Z A;  2PVX A;  2MFI A;  2YTV A;  5LMN W;  3K0X A;  4NXN Q;  3HOV G;  2MO1 A;  4A3J H;  1L1O A;  1VQL A;  4P73 A;  4X62 Q;  1X56 A;  1NE3 A;  1CSP A;  3HOY G;  1TWG H;  2ID0 A;  3TQY A;  2D62 A;  1VQI A;  1N32 Q;  2YTX A;  4YWK A;  2GVB A;  4A3J G;  2YV5 A;  5JJI A;  5FLX c;  1YK4 A;  4YCW A;  1YIT A;  3AFP A;  4JI5 L;  1CSQ A;  3H3V H;  4K0K Q;  1L1O C;  3UDG A;  1QUQ A;  1YBY A;  4IOC A;  2OTL A;  4UP9 A;  4DV7 L;  2GMG A;  4LW1 A;  1BFY A;  4H02 A;  3J80 c;  4DR4 Q;  1G6P A;  1N32 L;  4BA1 I;  2CWA A;  3AYH B;  1IXR A;  1T9H A;  1KD1 C;  2I0Q A;  3QVD A;  1Q82 C;  4YY3 L;  2R92 G;  1OXS C;  5IE8 A;  5M5W H;  4LF9 Q;  1WFQ A;  3RZD H;  1P8L A;  3A44 A;  3PUW A;  4J15 A;  1U5K A;  1M1K C;  3RZ6 A;  2B29 A;  4EQ5 A;  4LF5 L;  3CC7 A;  4QIW E;  2UUB Q;  4A76 A;  4DPG A;  4DAY B;  4DV1 Q;  3KYH C;  1J5E L;  1W3S A;  3S14 H;  2E5L Q;  4PMW A;  4HIO A;  2E2I H;  1PV4 A;  4A93 G;  3J7A 5;  1CAD A;  4DV7 Q;  2ASB A;  2KN9 A;  3PSI A;  4A3E H;  1IZ6 A;  2OCE A;  3S2H H;  1YHB A;  3S24 A;  1X65 A;  3ERS X;  1IRO A;  2CCZ A;  3NBH B;  1E1O A;  2UUA Q;  1EYG A;  4IPG A;  4C3J H;  4TPU A;  2H5X A;  1C9O A;  4GS3 A;  2YYZ A;  1VQP A;  1OTC A;  4A3C G;  2BA1 A;  3KJO A;  1ASZ A;  4DR2 Q;  1WOC A;  4JI8 Q;  4UP7 A;  3PIO A;  4POF A;  1H7V A;  4LF7 L;  2AWO A;  4DUZ L;  4GNX B;  3S2D H;  2I5H A;  2R7Z G;  1AE3 A;  5GAH C;  4P74 A;  4OON A;  1HNZ Q;  4WJ4 A;  2PMZ E;  4DV6 Q;  3BZC A;  4O2D A;  1AE2 A;  1WJJ A;  1EWI A;  4LUZ A;  4JBW A;  4AYB E;  4X66 L;  5IYB G;  5C0X J;  3J81 i;  3T1H L;  1NJI C;  3A74 A;  3IRB A;  4A4I A;  3JC6 3;  4DV4 L;  1W2B A;  1Q8K A;  1E22 A;  4JI6 Q;  1E1T A;  2VW9 A;  4Y52 H;  4QJF A;  3CC4 A;  3JAM i;  2F52 A;  4DV0 L;  3JC6 2;  1SMW A;  3MXN B;  1VQD A;  4JI4 Q;  4A3F H;  2GN5 A;  1JMC A;  4DR4 L;  2ALY B;  5RXN A;  2UXC Q;  2XTI A;  2HIX A;  1EIY B;  1LKO A;  1PYB A;  4LF9 L;  4B3R L;  1XMO L;  3RZO H;  2JA9 A;  2IY5 B;  3K7U C;  1PH4 A;  2F4V Q;  1R0I A;  4Y7N H;  2N3S A;  4FDB A;  5LMN Q;  3JC6 6;  1RYT A;  4DNI A;  4DR7 L;  4AR3 A;  3RN2 A;  1UEB A;  1BE7 A;  1ZRP A;  2Y0S E;  4XTC S;  4JI2 Q;  1JT8 A;  3T1Y L;  2UXD L;  2NVY H;  2UUC L;  3CCL A;  4DR6 Q;  4DR3 Q;  4QQB X;  3I55 A;  1JJG A;  1TWF H;  4BBR G;  1IBM L;  1D7Q A;  3KDF B;  2IHF A;  3EIV A;  1SMX A;  1V9P A;  4OO1 I;  4YCV A;  3I4N G;  3KYX A;  1BQ9 A;  4APV A;  1QZH A;  2LXJ A;  3KLW A;  2E2J H;  4R4O A;  3CD6 A;  1XNQ L;  3MPS A;  4DV3 L;  2Q2H A;  3GTG H;  3D0F A;  1XNR L;  1YV1 A;  2OQK A;  3F1Z A;  4BBR H;  5IWA L;  1WCM G;  3H0G G;  4R4C A;  3J7Z C;  2B63 H;  2VNU D;  3K81 C;  2Q2U A;  3CPW A;  2PYA A;  2M4Y A;  4AR4 A;  1TWH H;  2DGY A;  2VY3 A;  1JE5 A;  3PGZ A;  4JOI A;  3MEF A;  1Q81 C;  1RDG A;  3S17 H;  4JC0 A;  1U0L A;  2ES2 A;  4QGU A;  3WWV A;  1UWV A;  4DV6 L;  1K73 C;  3E9H A;  1EIF A;  1B13 A;  1YVC A;  2JA7 H;  1I3Q H;  3K7A H;  3CC2 A;  2VZA A;  1SRO A;  2JE6 I;  2ZM6 Q;  2IX1 A;  4JI5 Q;  4K9F A;  2PI2 A;  4JI8 L;  5M3F G;  3BJU A;  2OWO A;  1Z9F A;  2Z6K C;  2LSS A;  3CW2 C;  5ELN A;  2YTY A;  5AJ3 Q;  4JBM A;  3AEV A;  1H95 A;  3HOX G;  3SGI A;  3GD7 A;  1KXL A;  4LF4 Q;  2F3I A;  1IL2 A;  4UY8 C;  1C7Y A;  4GLX A;  4JI3 Q;  3CP0 A;  1C0A A;  3KF8 B;  4IJH A;  1K8A C;  1LM0 A;  3HOV H;  1OXT A;  3D31 A;  1UE5 A;  3CAM A;  1DGS A;  2C35 B;  4JI0 L;  2R7Z H;  3A5U A;  1Q86 C;  3GTK H;  3PCO B;  4X64 Q;  3GTQ H;  2R6G A;  4X66 Q;  1VQK A;  4PZ7 A;  1A63 A;  4IJL A;  5IT9 c;  5BR8 Q;  5ELO A;  1Y1W H;  2I5M X;  4GOP A;  1XNR Q;  3GTO H;  2MS3 A;  1K8G A;  3GTP H;  2QL0 A;  3KYU A;  4A3D G;  1XJV A;  2BA0 A;  1Q7Y C;  4DR2 L;  1TWC H;  3PZA A;  1PH6 A;  3CCR A;  4IFD I;  2WAQ E;  4LF8 L;  4A3L G;  1N9W A;  3TRE A;  2JA5 H;  3T1Y Q;  2L15 A;  1FL0 A;  4LFC Q;  2UXD Q;  1L2F A;  2WB1 G;  1R9T H;  4BXX H;  1A62 A;  3HKZ G;  1B7Y B;  4A3L H;  8RXN A;  1R0J A;  5IYD G;  4OWT B;  3ULJ A;  3OW2 A;  1JB7 A;  2LCQ A;  1S3O A;  2NVX H;  1SLJ A;  4DR5 L;  2ZJQ A;  2UXB L;  1SMU A;  3I7F A;  2MQH A;  4DV1 L;  1N36 L;  2E5L L;  1JYB A;  2A19 A;  2VQE L;  1PH1 A;  1NMG A;  4GNX C;  3RNU A;  3CPF A;  4AH6 A;  4JI7 Q;  1Y1W G;  3S1M H;  4LF5 Q;  4DUY L;  3TS0 A;  1K9M C;  2VS1 A;  3HOZ H;  2R92 H;  4NPS A;  3PUV A;  4R4Q A;  3W1B A;  4DV3 Q;  1VQ7 A;  4A3G H;  2R93 G;  1VQ4 A;  1VCX A;  1E3P A;  4KHZ A;  1XMQ Q;  3PF5 A;  3VDY A;  4NXM L;  2B3G A;  1Y1V H;  3U4V A;  1C09 A;  4LF6 Q;  1YJW A;  3K8A A;  4JI2 L;  2A1A A;  1HR0 W;  1S72 A;  2UXB Q;  3DM3 A;  1S2Z A;  4JBJ A;  5M3F H;  4BY1 G;  1IBK L;  2JA6 H;  3F8T A;  1T9Q A;  1HZB A;  5DLQ E;  4AR5 A;  1N34 Q;  1VQJ A;  3M4Q A;  3OYY A;  2K50 A;  1RL2 A;  4C3I H;  4KHP Q;  3A0J A;  3KOJ A;  1NBW A;  2CQO A;  4GN5 A;  4BBS H;  1NTG A;  1KRS A;  3RR5 A;  5FJ8 H;  1I94 Q;  2A8V A;  1VQN A;  3M3Y H;  4AIM A;  4LF6 L;  4DV4 Q;  4B3M L;  4TVA B;  1KQS A;  2QA4 A;  1WCM H;  3FP9 A;  1EQQ A;  1QVC A;  3PO2 G;  1LKM A;  1YK5 A;  1V1Q A;  2RHQ B;  1SR3 A;  3CCJ A;  1K83 H;  1HR0 L;  4JI0 Q;  2ZJP A;  4A3M H;  4JYA L;  3OTO Q;  3RLF A;  1CKO A;  1NY4 A;  1B2J A;  1BRF A;  2HQL A;  2N78 A;  3JAM c;  1RB9 A;  1FJG Q;  2LXK A;  1FHH A;  5GQO A;  2MNA A;  3TS2 A;  4R4I A;  1XPR A;  5LMN L;  2K75 A;  4GKJ L;  1FGU A;  1HZC A;  3NEM A;  1CKM A;  1IBL L;  4JG2 A;  1I6H H;  1JJ2 A;  4PZ6 A;  1E8J A;  2WP8 J;  3W5O A;  5AJ3 L;  3HOW H;  4DV5 Q;  1RIP A;  1VQH A;  3G48 A;  3RLN A;  4YWM A;  1T9P A;  1IBK Q;  4X6A H;  1AH9 A;  3U58 A;  1WYD A;  4XIG S;  1VQF A;  2D0O A;  4MZ9 A;  5IYC G;  2JA8 G;  4GOP B;  5GAD C;  1XMO Q;  1VQ6 A;  5IP9 H;  5C4J H;  2MO0 A;  2GVA A;  4DR1 Q;  1VQ9 A;  4UP8 A;  3J81 c;  1J6Q A;  4JI1 Q;  4AQY Q;  2N8N A;  1Y1V G;  1LYL A;  3STB D;  4BY7 H;  3CCS A;  2UUB L;  4DUY Q;  4JCV E;  3H3V I;  2RDV A;  4KHP L;  5IYC H;  2AHO B;  1IBM Q;  1A0I A;  2K4K A;  2CFM A;  1X3F A;  2IHE A;  5IYB H;  1B8A A;  4HJA A;  2NVQ H;  1B2O A;  2JA8 H;  1VQB A;  3RLO A;  3HOW G;  4L5R C;  2PNH A;  1YHQ A;  1PVO A;  4IFD G;  4DR6 L;  4LFC L;  3PWF A;  1HJP A;  3J81 j;  4X65 Q;  5C4X G;  3NEN A;  2ZJR A;  3KF6 A;  2PQA B;  2ATW A;  4PG3 A;  3PV0 A;  5JEA J;  3KFU A;  3L0O A;  3RZT A;  5JEA G;  5LMU Q;  2UUA L;  3PUX A;  3PO3 H;  4P75 A;  1IU5 A;  4DV5 L;  4IPH A;  4A3K H;  4LWC A;  1BBW A;  1QCV A;  5C44 G;  2VQF Q;  5IWA Q;  4A93 H;  4IOA A;  1YJ9 A;  3RYG A;  1X3G A;  3PUZ A;  3PO2 H;  4GN4 B;  4GKJ Q;  4IFD J;  4RG1 A;  4P72 A;  1OXX K;  3W1G A;  1G51 A;  3GTL H;  4YY3 Q;  1X6O A;  3G6E A;  2K5V A;  4DR3 L;  1A8V A;  3I4O A;  4B3S Q;  2HT1 A;  1BBU A;  2Y0S G;  3E0E A;  4DKA C;  5FJ8 G;  2KCT A;  3CCU A;  2UU9 Q;  4DAM A;  4HJ8 A;  4LF4 L;  1QVF A;  4LFA Q;  4YHH Q;  1SMM A;  3KJP A;  1N8R C;  2KEN A;  4B3T Q;  4RXN A;  1CKN A;  3PF4 A;  1YHA A;  2EXD A;  2YU9 H;  1L0W A;  2V3B B;  3AQQ A;  1N36 Q;  1B71 A;  2I5L X;  1GD7 A;  1LKP A;  2V1C C;  4L5T A;  4O0A A;  5C0X I;  4BY1 H;  2NVT H;  1I94 L;  1YJN A;  1DX8 A;  1Y14 B;  2BH8 A;  4ALP A;  3CMA A;  2JA6 G;  1E7Z A;  2HR5 A;  4QL5 A;  3HOX H;  4MTN A;  4B3R Q;  4K0K L;  4YHH L;  4IPD A;  2HIV A;  1IU6 A;  3CCV A;  3HOY H;  3UDX A;  1HH2 P;  3ICE A;  2Z6K A;  1PH3 A;  4JBK A;  2OQ0 A;  4B3S L;  1PH7 A;  4A3I H;  1KIX A;  4A3G G;  1R0H A;  1BKB A;  4LF8 Q;  1QYB A;  1VQC A;  3BZK A;  1IYJ B;  4KLK A;  4NB3 A;  1I5F A;  3I4M G;  3ZJY C;  1PH5 A;  4OX9 L;  2UXC L;  5K36 G;  5HY6 A;  4JI6 L;  1EUJ A;  1Q46 A;  1T9O A;  2K5N A;  3CCQ A;  4DV0 Q;  3LGJ A;  4LNQ A;  1VCI A;  2B63 G;  1CAA A;  3GTM H;  3SS2 A;  3PUY A;  4DK6 C;  3M85 A;  4GNX A;  1KHI A;  3HOU H;  1CKN B;  1YNX A;  2E2H H;  1Q12 A;  2VUM G;  2KCM A;  1N34 L;  2VQE Q;  5IYD H;  2VQF L;  2D0P A;  3EN2 A;  3F2B A;  2OTJ A;  1IRN A;  4JI7 L;  5EAY A;  1EFW A;  4L5Q A;  1SFO H;  1TWA H;  1ASY A;  1K3R A;  2KHI A;  2KHJ A;  3DLL A;  1VQE A;  4AYB G;  5C44 H;  1BVS A;  4DR1 L;  1E24 A;  4GN3 B;  4GLV B;  3H15 A;  1YI2 A;  1PH2 A;  3UDI A;  1GKH A;  3PO3 G;  4X65 L;  5C3E G;  1LTL A;  3FKI H;  3GTJ H;  3KYY A;  1KC8 C;  4LUO A;  1HNX Q;  4AR6 A;  2VUM H;  1Q1E A;  1VQO A;  3HOU G;  3M4P A;  4OXP A;  1LUZ A;  5C0X G;  4JI4 L;  1N33 Q;  4JI1 L;  1S24 A;  1KAW A;  5GAE C; 
#chains in the Genus database with same CATH topology
 4JK1 C;  4XT1 B;  1Z47 A;  3IFT A;  3PIP 1;  3TEH B;  5HGQ A;  4C3H B;  4RCN A;  2E2J B;  2DSX A;  2G9H D;  3H6M A;  3BVG A;  1M90 C;  2D9U A;  1FNW A;  2EYF A;  4JV5 L;  4EQP A;  4X64 L;  2NZH A;  1BNZ A;  3H97 A;  5IT9 L;  1UE6 A;  3S14 B;  1I50 H;  3PO3 B;  4XGH A;  2NYD A;  4UPA A;  4BA2 I;  4NP5 A;  1ENC A;  3S15 B;  2Q2T A;  4C2M H;  4NDX A;  3FMC A;  3S1M B;  1DJR D;  2K14 A;  5LMU L;  1I6H B;  1PFV A;  5M5X L;  2EY2 A;  5C4X B;  5HGT A;  4H13 C;  3HKS A;  5E4W C;  3S1Q H;  1VQG A;  4IPC A;  2NZO A;  1ZKO A;  3VR4 A;  3J80 i;  3EBE A;  4V19 6;  4HJ9 A;  4A3G L;  2NTT A;  4HID A;  3STB C;  4NXM Q;  1B44 D;  2CKA A;  2KKD A;  1PRT F;  3S9W A;  1MJE A;  4DAV A;  4H44 C;  1S5B D;  5GRO A;  1G29 1;  3HOU B;  2Q2I A;  5IYB L;  2BCO A;  3L7Z C;  4BBS G;  3KYV A;  2PI2 E;  1I3Q L;  2VL6 A;  2EY4 E;  4A3E B;  1DVB A;  3F2D A;  2F3V A;  1XWE A;  2ZTE A;  4B3T L;  3KF6 B;  1IW7 D;  1SN8 A;  4XT3 B;  1ILP A;  2JEB I;  4C3H H;  1JJC B;  4L8J A;  3CQZ B;  5CV9 A;  2WB1 E;  1PZK D;  5K2M E;  2KBN A;  3MXG A;  3T1H Q;  4CBV A;  2R93 L;  2PPT A;  4JI3 L;  3I90 A;  5J3B A;  4DUZ Q;  3NPP A;  4MNO A;  5LL6 X;  1TII D;  3GO5 A;  1I50 L;  3MXP A;  4A3C H;  4YWL A;  4GLA C;  4RGT A;  1BO0 A;  1V1P B;  2DJF C;  4KKS A;  5DNF A;  2WB1 P;  1J9O A;  2BH2 A;  3FKI G;  1Y1V L;  4A3D L;  1CQV A;  5C3E H;  5EIN C;  5FLM H;  2WFW A;  5EIO C;  4X3K A;  2ERS A;  2ZM6 L;  4UY8 1;  1STA A;  3R93 A;  1NAP A;  2HHH Q;  2FJ2 A;  4OWX B;  1ZXT A;  4R1J A;  1LAC A;  1AFP A;  4A3M L;  4ME3 A;  2JA5 G;  2EDG A;  1STY A;  2AWN A;  1TWG L;  3AFQ A;  3J80 L;  2F0E A;  3NEL A;  1UE7 A;  4A3D H;  1JE4 A;  2RDG A;  5CR3 A;  2NVX L;  2RVL A;  2K28 A;  3M3Y L;  3I56 A;  2WII B;  4A3C L;  2RDF A;  3V2T A;  3I2Z A;  5LMN W;  1JOK A;  3GTK L;  2PW7 A;  2MO1 A;  2ZXP A;  5M5Y B;  1L1O A;  1EQT A;  1SE4 A;  4KJN A;  2IX3 A;  4P73 A;  2H4O A;  2RBM A;  1DYQ A;  4YWK A;  2GVB A;  5M3M B;  4HSP A;  4JI5 L;  4KY7 A;  1H9J A;  4EVO A;  1CSQ A;  3MFY A;  4BY1 B;  3MA2 B;  3LWQ B;  3UDG A;  5C4J B;  3DUZ A;  4UP9 A;  4BWG B;  1G6P A;  4BA1 I;  2MP1 A;  1B3Q A;  5EQ0 A;  3AYH B;  1T9H A;  3SDZ A;  3QVD A;  2B63 B;  3SEB A;  1OXS C;  2JA7 L;  4LF9 Q;  1WFQ A;  3RZD H;  1P8L A;  4C2M 1;  1ROD A;  4J15 A;  4OO1 H;  2B29 A;  3EQL C;  4LF5 L;  4XQJ A;  4DK0 A;  3SE0 A;  4A76 A;  4DV1 Q;  5FLM L;  3S14 H;  2NVT L;  2E2I H;  5TSS A;  3PSI A;  4ZK9 B;  4AHW A;  1X65 A;  3ERS X;  1IRO A;  4L63 B;  2I46 A;  4KV6 A;  4HMJ A;  5G3L F;  2P5Z X;  1WTP A;  1WJV A;  5M5W B;  1CZG A;  2BA1 A;  1LTB D;  5C5M A;  3PIO A;  4POF A;  2CH4 W;  4GNX B;  2I5H A;  3E5S A;  4KK7 A;  1YHQ A;  3BZC A;  5IYB G;  4DV2 Q;  1WJJ A;  1NJI C;  4LUZ A;  1K8G A;  4X66 L;  2F3W A;  3HOV L;  1MI2 A;  4A4I A;  5KRU A;  4ID6 A;  4DV4 L;  1WD0 A;  4R8I A;  4Y52 H;  4QJF A;  4DV0 L;  3A54 A;  1D6E C;  1SMW A;  2PSM C;  1JMC A;  3U9S A;  2ALY B;  2XTI A;  4X3T A;  3WOF A;  2HIX A;  1DCZ A;  1H9R A;  4IQZ A;  4LF9 L;  4IN3 A;  1XMO L;  2IY5 B;  3GTP L;  3K7U C;  1R0I A;  2VUM L;  1CHQ D;  1LLR D;  4FDB A;  5EPL A;  1OWB A;  4DR7 L;  1BE7 A;  2CH4 A;  1QNK A;  1PZI D;  5DM7 3;  4C3I L;  2B63 L;  1E2W A;  1TQO A;  1M8A A;  3I4N G;  2HD3 A;  2LXJ A;  3KLW A;  2XN9 C;  1SXT A;  2OF1 A;  3FPP A;  3CD6 A;  3GQB A;  3KF8 A;  2Y0S P;  3S16 B;  2PZW A;  4BBR H;  3CPW A;  2PYA A;  3D4R A;  1KAW A;  4JOI A;  3GTP H;  1JE5 A;  1KTK A;  2F1M A;  4QGU A;  4TSS A;  3OPO A;  4CKB A;  1WTX A;  3E9H A;  1B13 A;  4KY5 A;  1SRO A;  3M4Y A;  5LL6 S;  2ZM6 Q;  1K83 L;  4RWS C;  2OWO A;  3BJU A;  1Z9F A;  2Z6K C;  3FEW X;  2LSS A;  3CW2 C;  4ZKB B;  4UHV A;  5AJ3 Q;  3DWQ A;  2KHS A;  4AYB B;  3GD7 A;  4LF4 Q;  2F3I A;  1VF5 C;  2FMM A;  1B9N A;  1SNM A;  4GLX A;  1VMC A;  1C0A A;  2GA4 B;  1DGS A;  1Q86 C;  3BG3 A;  3GV3 A;  4HAE A;  2PZT A;  4CJ0 B;  1T5X D;  5IT9 c;  2B2Y A;  1BQQ T;  1XNR Q;  5MFP A;  2WAQ B;  3KYU A;  4A3D G;  3E0J A;  2JA8 B;  3HKZ P;  1AN8 A;  4CDD C;  1C48 A;  4A3L G;  2KUM A;  1RJT A;  2JA5 H;  1CFM A;  1FL0 A;  4CDC C;  1RHP A;  1B7Y B;  5IYD G;  3HOZ L;  4OWT B;  3ULJ A;  1JB7 A;  1CZW A;  3KBX A;  1SLJ A;  3H0G B;  4ZN3 B;  2E5L L;  1JYB A;  1VZI A;  3HG9 A;  3SXH A;  3RNU A;  4IFD H;  3LWP B;  4LHN A;  2F0T A;  1WVL A;  3DEO A;  2NYZ D;  2R92 H;  2N88 A;  3NBI A;  1B3A A;  4A3G H;  1HRJ A;  3H99 A;  3PF5 A;  3HRZ C;  4LF6 Q;  1YJW A;  3K8A A;  2K5W A;  4K5X A;  3IKJ A;  1RCV D;  4CDF C;  1S2Z A;  1K83 B;  4JBJ A;  1JOQ A;  4IUN A;  4BY1 G;  3GTG L;  3OWF A;  1IBK L;  2BE5 D;  3F8T A;  1HZB A;  2RSO A;  3NBH A;  3M4Q A;  4C3I H;  2HDL A;  4KHP Q;  3A0J A;  3KOJ A;  5DM7 1;  2XWJ B;  4JVZ A;  2EXZ A;  1KRS A;  4FYD A;  3OHX C;  4KTA A;  1DD2 A;  4AIM A;  2J9U B;  2A6H D;  2R93 B;  3SVM A;  2QA4 A;  3A56 A;  1EQQ A;  4ZQ3 A;  2IL8 A;  3GTL B;  3R8B A;  1YK5 A;  1V1Q A;  3CCJ A;  2SNM A;  2A68 D;  4N8X 1;  5A2Q L;  4JYA L;  2KJX A;  3RLF A;  4UAI A;  3A55 A;  4DF7 A;  1B2J A;  3J7Z 1;  2HQL A;  2LXK A;  4G57 A;  1F2M A;  3IU3 I;  1XPR A;  4GKJ L;  3NEM A;  4DNT B;  1CKM A;  5DAU A;  5CYU A;  3GTO L;  4X6A H;  1Y1W L;  1WTW A;  3U58 A;  1VQF A;  4MZ9 A;  5EKK A;  2EYM A;  5FK9 C;  4UP8 A;  3J81 c;  1STG A;  2B2V A;  4JI1 Q;  5J39 A;  3I4N B;  4JPB W;  4TVM A;  4JCV E;  3H3V I;  5IYC H;  2AHO B;  1A0I A;  2K4K A;  4HJA A;  5IYB H;  1B8A A;  1VDZ A;  1VQB A;  2M4V A;  4L5R C;  1PDQ A;  1F2Z A;  5AN9 H;  3L3O C;  1PVO A;  4DR6 L;  4LFC L;  4F8M A;  1NR2 A;  2O4X A;  2ZJR A;  2XJV A;  3VR2 A;  3KF6 A;  1QJO A;  4PG3 A;  3PV0 A;  1HA6 A;  3L0O A;  3RZT A;  5LMU Q;  3PO3 H;  2XIW A;  5COY A;  4P75 A;  4CKE A;  2QDB A;  4DV5 L;  4IPH A;  4LWC A;  1QCV A;  1LTI D;  5IWA Q;  1YJ9 A;  3RYG A;  1X3G A;  4IFD J;  2FIN B;  2F0L A;  2DY7 A;  4P72 A;  1OXX K;  1I4R A;  1S5E D;  3IL8 A;  3CRL C;  5E3F A;  3I4O A;  1XYI A;  4C1N K;  1BBU A;  3VYU A;  4DKA C;  1QVF A;  3VYR A;  1A2U A;  2RKS A;  4TRD A;  3KJP A;  4B3T Q;  3ERO A;  1CKN A;  1PFN A;  2R92 L;  1N36 Q;  1B71 A;  2I5L X;  4L5T A;  3GTJ B;  2JI1 A;  4RKL A;  1SMY C;  2M00 A;  5FOB B;  2BH8 A;  5JVH 3;  5IT9 E;  4K0K L;  3HP3 A;  1IU6 A;  5AFW A;  2A6E D;  2JP1 A;  1V8Q A;  4JBK A;  3S2D B;  4LF8 Q;  1VQC A;  3Q24 A;  3HJY B;  1I5F A;  4IZ8 A;  5IIF A;  2M6O A;  1K0S A;  4U67 3;  1Q46 A;  1T9O A;  3LGJ A;  2HCI A;  4B9X A;  2XWB B;  3GTM H;  3M85 A;  4BY7 L;  5EJW A;  3HOU H;  2E2H H;  2KCM A;  1PZJ D;  1M4V A;  4PV1 C;  2ZXR A;  2V0F A;  4P2C B;  1YNN C;  4KMU C;  2NUC A;  4DR1 L;  4GN3 B;  3H15 A;  1AP0 A;  3UDI A;  3GTM L;  3KUP A;  4RAU C;  5C3E G;  1STN A;  1LTL A;  4EQN A;  1CQF A;  3FKI H;  1ESR A;  1Q1E A;  3MEH A;  4RGO S;  5C0X G;  1N33 Q;  2O2L D;  1HR0 Q;  3CME A;  1BOS A;  1BQ8 A;  5D3D A;  4OHJ A;  3D4W A;  3I4M H;  3CQZ H;  3HKZ E;  4MN3 A;  1I4X A;  1IYV A;  4LUV A;  2D2C C;  1SYB A;  3S2H B;  1O7I A;  1UE1 A;  4K5V A;  1WTH A;  3KK7 A;  1G2T A;  1XTD A;  2AUS B;  2JN4 A;  4DA2 A;  4F7X A;  2R7D A;  3S1R H;  1QNU A;  3P1H A;  3L2P A;  4GKK Q;  1PFM A;  4X62 L;  4QCL A;  2Q8I B;  3G4S A;  3J81 L;  4FO2 A;  3R2I A;  3S2D L;  5JOB A;  4AHX A;  1LTR D;  3GDE A;  2AQC A;  1PFW A;  1D5M C;  1KL9 A;  1L1O B;  3BU2 A;  5IP7 H;  5COR A;  1NR4 A;  2N49 A;  5I4D A;  2EIF A;  2QEX A;  1BBX C;  1QOH A;  3I91 A;  1V1O A;  2B2Y C;  2RHS B;  3X3N A;  3A5Z B;  1HZA A;  1LT4 D;  2K5H A;  1TWC B;  4LFB L;  1SNP A;  1E2Z A;  3ER0 A;  3J81 E;  3KDF A;  1VQM A;  2AMC B;  5C4Z A;  5AI3 A;  2CWP A;  4G6B A;  4PZ8 A;  5E7N A;  3CF5 A;  3K7A L;  2O5I C;  4X3S A;  2K32 A;  5EKI A;  2PVE A;  3ULP A;  1V43 A;  3G7L A;  4XXB B;  1PHJ A;  1MKH A;  1SMY D;  5KNC A;  1XPO A;  2UU9 L;  2IX0 A;  3NUC A;  4A3F G;  2K1B A;  2L1B A;  2NBF A;  3Q8D A;  1OXU A;  4NXN L;  2F4V L;  1JWM D;  4A3B G;  5MFZ A;  1JOO A;  4OWW B;  4AQY L;  1XTC D;  1QG7 A;  4A93 L;  2KEE A;  2QGQ A;  3RZD B;  4KKU A;  3C46 A;  3I4M B;  2R93 H;  5JPN C;  1WCM B;  1B4O A;  5E1F A;  4GZY C;  4L5S A;  4HJ7 A;  1ODH A;  3M4O B;  3GTP B;  1KLG D;  2FMC A;  4N9P A;  3W2D A;  5JJK A;  3S17 B;  3S1N L;  1PH8 A;  1B70 B;  5D14 A;  3B6Y A;  1C8C A;  1LT3 D;  3CCE A;  4A3E G;  1S30 A;  2C6B A;  1G8Z D;  1YNN D;  2AKW B;  4LFB Q;  3G71 A;  1RDV A;  3LNN A;  4LMQ D;  4BXX G;  5DEH A;  4IAL A;  5DM6 1;  1D8L A;  3DM1 A;  3ND9 A;  3Q6S A;  2EY1 A;  4QY7 A;  1HNW Q;  3MVV A;  1HPC A;  3WDN A;  4G4K A;  2F0W A;  1QE6 A;  2K6A A;  1QUQ B;  3CCM A;  4A75 A;  3HAX C;  5GAG c;  4BBR L;  1R0F A;  2G5D A;  2IJ0 A;  1HA5 A;  3RD4 A;  2AQ1 B;  3RZO B;  3HJW B;  4C3H G;  4A3I G;  3PKJ A;  4NXN Q;  3E3X A;  1JB3 A;  5LHY 1;  3T4A C;  1N32 Q;  4S3S A;  2YTX A;  3ZG6 A;  1LTS D;  5JJI A;  5FLX c;  1YK4 A;  1YIT A;  5IOC A;  2F0U A;  3DMU A;  4BS9 A;  2OTL A;  4LW1 A;  1BFY A;  3J80 c;  1N32 L;  5C5L A;  5A35 A;  2CWA A;  5CV6 A;  2SNS A;  2I0Q A;  1Q82 C;  2VXW A;  5IE8 A;  3D6C A;  3A44 A;  3PUW A;  1M1K C;  3RZ6 A;  2XJS A;  1I4H A;  4J1M A;  2UUB Q;  1D5X C;  4DAY B;  5M3M L;  1J5E L;  2AQ2 B;  4PMW A;  1Y1V B;  3SK5 A;  4RKB A;  1CA5 A;  1PV4 A;  5EGT A;  3J7A 5;  5IGC A;  1Z7T A;  1IZ6 A;  2OCE A;  2EVB A;  5CV7 A;  1JCK B;  3ERQ A;  1E1O A;  1EYG A;  3VR6 A;  1L0X B;  4C3J H;  2H5X A;  1C9O A;  3H0G L;  2PMZ B;  2EYO A;  1KLU D;  1ASZ A;  3T53 B;  3FVQ A;  2NVX B;  1H7V A;  1S5D D;  5T1G A;  1SFO L;  4Z9C B;  2J0T D;  4OON A;  4DV6 Q;  4O2D A;  4OIJ A;  4JBW A;  3NQI A;  3J81 i;  1AZP A;  3IRB A;  3JC6 3;  4JI6 Q;  5C44 B;  1E1T A;  4O1N A;  3TME A;  4ODG A;  2YU9 B;  4RHR A;  2KOL A;  4DR4 L;  5RXN A;  4Y7N L;  1EIY B;  2JA9 A;  4A3B L;  1D5Z C;  4Y7N H;  1AZQ A;  1UNS A;  3JC6 6;  1Q8I A;  4K14 A;  1DOL A;  1UEB A;  5ELD A;  1ZRP A;  2Y0S E;  3T51 B;  3CCL A;  4DR6 Q;  1JJG A;  1PYW D;  4BBR G;  1IBM L;  5NUC A;  3KDF B;  2IHF A;  1D7Q A;  4YCV A;  3KYX A;  1BQ9 A;  1QZH A;  1HUN A;  4LAA A;  1XNQ L;  3MPS A;  1KDB A;  2BDO A;  2Q2H A;  3D0F A;  1EQV A;  3GTG H;  2PCF B;  1YV1 A;  1XNR L;  2VNU D;  1I6H L;  2B63 H;  2Q2U A;  3S17 H;  1MBY A;  3FDT A;  3MEF A;  4OIK A;  3TBI B;  2HVY C;  1I6V C;  4JC0 A;  4ABN A;  1Q81 C;  2ES2 A;  3WWV A;  5K36 H;  5M5W L;  3EVQ A;  2VZA A;  2JE6 I;  4JI5 Q;  4C3J B;  1ILQ A;  3P7J A;  4R9W A;  4JBM A;  1H95 A;  2PQE A;  3A8K E;  5A2Q E;  2WB1 B;  1SDF A;  3A7A B;  3SGI A;  1D2B A;  1SNO A;  3F2U A;  2AYJ A;  1TWF B;  2J7Z A;  1C7Y A;  3I4N L;  5EKL A;  1LM0 A;  1UE5 A;  1TS4 A;  3V96 A;  2C35 B;  1D1I A;  2ERJ A;  1I3Q B;  1T5E A;  2YU9 L;  3K57 A;  4IJL A;  2VB2 X;  5BR8 Q;  1Y1W H;  4MTK A;  2I5M X;  3GTO H;  3VPB E;  2QL0 A;  4A3E L;  5I2X A;  1XJV A;  4G7H C;  1Y8O B;  1Q7Y C;  4DR2 L;  1TWC H;  5CV5 A;  2E2I L;  3TP6 A;  4IFD I;  2WAQ E;  1N9W A;  4YIJ A;  4LFC Q;  4FF1 A;  1BCP B;  1PTO B;  1R9T H;  1A62 A;  3HOX B;  4BXX H;  4A3L H;  8RXN A;  1EWH A;  2NN6 H;  3OW2 A;  4F88 A;  4NKL A;  3I7F A;  4I65 A;  4DV1 L;  1X3P A;  4GNX C;  1RKN A;  3S1M H;  1Y1W G;  3VR3 A;  4WFN 3;  4NPS A;  3GTQ B;  2R7Z B;  1EZ6 A;  4R4Q A;  1VCX A;  1Q3L A;  2X69 A;  2K04 A;  3SK8 A;  2O5J C;  4JI2 L;  2XJU A;  1S72 A;  1HTP A;  3DM3 A;  4HSV A;  3H9C A;  5M3F H;  2EYH A;  1KDA A;  1SYC A;  3O13 A;  3BDC A;  2J4X A;  4FF3 A;  2L5T A;  5ELE A;  2I07 B;  3OYY A;  5M9O A;  1RL2 A;  1NNX A;  4GN5 A;  2XRQ D;  4DXF A;  5I9O A;  3RR5 A;  4RH6 A;  1CA6 A;  1VQN A;  1LTT D;  4RHS A;  3VR5 A;  1WCM H;  4BY7 B;  3H3V M;  1LKM A;  2NZ1 D;  5JVG 3;  4JI0 Q;  1LT6 D;  2ZJP A;  2B2T A;  3S15 L;  3OTO Q;  2ZXO A;  1NY4 A;  4A3I L;  2B8F A;  3I8Z A;  1Q90 A;  1FHH A;  5GQO A;  3TS2 A;  4MIU A;  3T16 A;  4DK1 A;  3GTM B;  3NWT A;  1IBL L;  5K5P A;  1I6H H;  5CV8 A;  4PZ6 A;  1E8J A;  2WP8 J;  5AJ3 L;  2H1E A;  4DV5 Q;  3G48 A;  1AH9 A;  1IBK Q;  1T9P A;  5JAV A;  4TKO B;  4X6A L;  1WYD A;  1JC7 A;  4XIG S;  5IYC G;  1ET9 A;  1XMO Q;  1JQY D;  2XSC A;  1MSH A;  2X6G A;  5C4J H;  1BCP C;  1PTO C;  2HUG A;  2NVY L;  5MF6 A;  1J6Q A;  3I70 A;  3QO2 A;  4AQY Q;  2K01 A;  4QF4 A;  3CCS A;  5EPJ A;  3PIO 1;  2JI2 A;  4DUY Q;  3DHQ A;  2JSO A;  2IHE A;  2MJ8 A;  5CBA E;  3DWA A;  3MZ5 A;  5KYL A;  3KBG A;  2PNH A;  1VMP A;  4O42 A;  1A3T A;  1EY0 A;  4J8Q A;  3EJI A;  5C4X G;  1DZ1 A;  3NEN A;  3HOV B;  2SDF A;  1EIH A;  5JEA J;  2SOB A;  2B2U A;  5JEA G;  4HTH A;  1EU3 A;  3S1R B;  5ELC A;  1BBW A;  3PUZ A;  4GN4 B;  3PL5 A;  3MSU A;  2E2H B;  2CW0 C;  2PZU A;  1SAP A;  3GTL H;  4KD4 A;  2DY8 A;  4B3S Q;  1A8V A;  4C1N I;  2HT1 A;  2Y0S G;  3E0E A;  3CCU A;  2Z9H A;  4LF4 L;  4K5W A;  4XYO A;  2B2U C;  4YHH Q;  2QF7 A;  3SR1 A;  1N8R C;  3PO2 L;  4RXN A;  1A2T A;  1U4L A;  1YHA A;  5ELF A;  4C3I B;  3G6J B;  2V1C C;  1LKP A;  5C0X I;  5KIX A;  2JA6 G;  4ALP A;  2HR5 A;  4QL5 A;  4IPD A;  1TWG B;  3CCV A;  2QKI C;  1SFO B;  3ICE A;  2Z6K A;  1DON A;  4WRD A;  1BKB A;  5DM6 3;  3S1Q B;  3BZK A;  4KLK A;  2CKC A;  2Q8R E;  2NVY B;  4NB3 A;  1IHZ A;  4OX9 L;  1EUJ A;  2K05 A;  1ONL A;  2MHV A;  3UI2 A;  2Z8L A;  3GTK B;  2K5N A;  2R92 B;  2B63 G;  1TWH L;  3SS2 A;  1U4P A;  1YNX A;  2VUM G;  1N34 L;  1ICW A;  1Z6H A;  2N55 A;  2VQF L;  3LX0 A;  3NTI A;  1EFW A;  4A3F B;  1ASY A;  2KHI A;  4K8I A;  2KHJ A;  1VQE A;  4AYB G;  1BVS A;  4GLV B;  2D5D A;  2ICI A;  3K5L A;  4LK1 C;  4X65 L;  2JA7 B;  3KYY A;  1CTM A;  1HNX Q;  2VUM H;  2CR8 A;  1IKM A;  1PLF A;  3M4P A;  4DAY A;  4JI1 L;  2WAQ G;  2PQA A;  3Q0A A;  1OWC A;  3S1M L;  2RF4 A;  3OTO L;  4DR5 Q;  4BY7 G;  4LF7 Q;  1QVG A;  3TZU A;  1VQA A;  2NB0 A;  3D4D A;  2F0K A;  2HCC A;  5IP9 G;  4HIK A;  1A3U A;  4OX9 Q;  5GAE c;  3K6O A;  2ZTC A;  3FDJ A;  2R7F A;  1NSN S;  3K0Y A;  4QIW P;  1JWU D;  1X9N A;  1GHK A;  1TWF L;  4HMI A;  4KI0 A;  5GAH c;  4XDX A;  4K6D A;  5CGK A;  3E9I A;  5M5X H;  3WWL A;  3H0G H;  2JJQ A;  2Z4I A;  4DXG A;  3S16 H;  1CK1 A;  1S5C D;  1SJE D;  1TT2 A;  4A3M G;  1SEB D;  3QQC E;  7RXN A;  1S40 A;  1YIJ A;  4B9W A;  3P2A A;  5C4X L;  2CKZ B;  3HFZ B;  2KVM A;  3ULL A;  2EJM A;  5C4X H;  4FVM A;  4K2K A;  2XJR A;  1HNX L;  2BE5 C;  1B2T A;  4KJO A;  4YCU A;  4DK3 C;  4C3I G;  3S15 H;  2Z0S A;  1HZ9 A;  4CKC A;  1VS0 A;  1FJG L;  1K0R A;  4WFN 1;  1KAA A;  4POG A;  2R61 A;  2DUD A;  3TRZ A;  4PMC A;  4HIM A;  2XNA C;  3S2H L;  1KRT A;  1R0G A;  3RN5 A;  4JV5 Q;  4IO9 A;  2X6L A;  2QDL A;  1EOT A;  4B3M Q;  3HOZ G;  5BR8 L;  3UDF A;  2UUC Q;  1NXE A;  1IYU A;  2F0S A;  1BCP D;  1PTO D;  4HJ5 A;  4RCO A;  3LWE A;  4K2L A;  4FNF A;  5C0X H;  2NN6 I;  2IWH A;  3QB3 A;  1PH9 A;  2NVQ B;  1K28 A;  1NNQ A;  1XX8 A;  4H0L C;  1GVP A;  1O7Z A;  2JK8 A;  2JQO A;  4KKT A;  3F2C A;  3IAY A;  2NN6 G;  2QEJ C;  1SE8 A;  5F2D A;  3CQZ L;  5HUR A;  1ICF B;  3I3C A;  5M3M G;  5M5Y H;  1PYS B;  4CJ1 B;  2O5J D;  1H9S A;  2B8G A;  3GTQ H;  2FHT A;  4A93 B;  3QG1 A;  3S1N H;  1GUT A;  5M5Y L;  3GV6 A;  4OO1 G;  1U4R A;  2KCN A;  1TVX A;  2ENB A;  4GOP C;  5JJL A;  4JYA Q;  2JA8 L;  5JVH 1;  2RCN A;  4KN4 C;  4EX5 A;  2Y0S B;  1R4P B;  2PO4 A;  1J5E Q;  1LTG D;  1SRU A;  4PNY A;  5H1S E;  5FO8 B;  2XJP A;  1MJC A;  3JR7 A;  1JIC A;  2MFI A;  2YTV A;  1WTQ A;  3HOV G;  1IL8 A;  3HOY G;  4X62 Q;  1EYD A;  1NE3 A;  1TWG H;  2WKC A;  1II3 A;  3DEP A;  1VQI A;  2XVS A;  1AW7 A;  2EY6 A;  2PW5 A;  3ONA B;  2K7V A;  3IFD A;  4YCW A;  3BS1 A;  1F9S A;  2L9H A;  4K0K Q;  1L1O C;  4KD3 A;  3M3Y B;  4XQN A;  3NE5 B;  1YBY A;  5KND A;  4IOC A;  4DV7 L;  1F9P A;  2E2D C;  4H02 A;  2LMC B;  3I4M L;  1SE3 A;  1W6J A;  1IXR A;  4R8N A;  5M5W H;  2JXM B;  4DFA A;  1GJX A;  2KA7 A;  1U5K A;  1F9Q A;  3BDO A;  4EQ5 A;  3H94 A;  3NSW A;  3S17 L;  4QIW E;  3M7G A;  1F9R A;  4DPG A;  3KYH C;  1W3S A;  4DAP A;  4HIO A;  2E2I B;  2F0D A;  2C5C A;  4DV7 Q;  2KN9 A;  4ZUJ A;  3MFG A;  3MHB A;  1G91 A;  2IW3 A;  3TSS A;  3EA6 A;  2CCZ A;  4ZRZ A;  3NBH B;  3QOL A;  2JA5 L;  5EBC A;  4TPU A;  5EPK A;  4GS3 A;  5IYD L;  3BZD B;  4ULL A;  1VQP A;  1OTC A;  2E2H L;  3KJO A;  4DR2 Q;  1WOC A;  4JI8 Q;  2Z1C A;  4UP7 A;  3ITP A;  3S2D H;  3OWE B;  2R7Z G;  4OL7 A;  1HNZ Q;  2A73 B;  5G3L D;  1AEX A;  5C6A A;  2VUM B;  1AE2 A;  3RZO L;  1EWI A;  4AYB E;  3TP5 A;  5C0X J;  3HGB A;  1W2B A;  3KLR A;  4CDE C;  5FLX L;  1IW7 C;  3JAM i;  3JC6 2;  3LWV B;  3MXN B;  1VQD A;  4JI4 Q;  4H7B A;  4A3F H;  3GTO B;  1PYB A;  3RZO H;  1VZH A;  1PH4 A;  2F4V Q;  4C2M B;  2N3S A;  5MLC 3;  5IYC L;  4XXE A;  1WTV A;  1RYT A;  2MPM A;  4AI2 A;  4DNI A;  3V05 A;  5J1Z A;  4XTC S;  1JT8 A;  4JI2 Q;  4FF4 A;  3T1Y L;  2UXD L;  2NVY H;  4AYB P;  2MGS A;  4A3J L;  1R4Q B;  1V9P A;  3MXN A;  4APV A;  1TU2 B;  2E2J H;  1FYC A;  4DV3 L;  2EYL A;  2PYK A;  2OQK A;  2F0I A;  3F1Z A;  2CQA A;  4R4C A;  3BYT B;  3J7Z C;  4QUC A;  4Q5V A;  2VY3 A;  2M4Y A;  4HJ8 A;  3PGZ A;  4JAE A;  2E74 C;  1RDG A;  4RGN A;  2OXP A;  1UWV A;  2M6P A;  1X32 A;  1K73 C;  1KDC A;  1STE A;  3K7A H;  3CC2 A;  2TMP A;  2IX1 A;  4K9F A;  4JI8 L;  5M3F G;  2JA6 B;  3AEV A;  4DU9 A;  3HOX G;  3AB9 A;  1KXL A;  1NCV A;  1IL2 A;  4UY8 C;  4A3K B;  4NMZ A;  1H9M A;  1K8A C;  3A8J E;  2XRS D;  3HOV H;  1OXT A;  3D31 A;  1HHV A;  4E6Y A;  1F4L A;  1SYD A;  5IP9 L;  1HFG A;  2F0V A;  3A5U A;  4IUV A;  4X66 Q;  1C4Q A;  1VQK A;  3K7A B;  1O7Y A;  5KNB A;  5ELO A;  2JYO A;  4GOP A;  2MS3 A;  3DXJ C;  4HR7 B;  4IUQ A;  3QOJ A;  1P7P A;  4C3J G;  3CCR A;  2IPK D;  1CI3 M;  2APO B;  3T1Y Q;  2L15 A;  2UXD Q;  1EFI D;  1BF4 A;  1L2F A;  2WB1 G;  3HKZ G;  4N9T A;  4HCS A;  2K5D A;  3B0A B;  2LCQ A;  2NVX H;  5KYI A;  4DR5 L;  2ZJQ A;  2UXB L;  2MQH A;  3PO3 L;  1PXU A;  1PH1 A;  1GUG A;  1NMG A;  2CVR A;  4AH6 A;  1LO5 D;  3VYS A;  2SEB D;  4LF5 Q;  2A6H C;  2VS1 A;  2L11 A;  1B53 A;  5IOD A;  3W1B A;  4DV3 Q;  2DN8 A;  1VQ4 A;  1Z92 B;  1FD7 D;  2F0N A;  3PO2 B;  4KHZ A;  1XMQ Q;  1EL0 A;  3HOX L;  2B3G A;  1Y1V H;  3U4V A;  2CHB D;  4C3J L;  5I6Y A;  1PRT D;  1HR0 W;  2UXB Q;  5I6W A;  1I4Q A;  4A3G B;  3T13 A;  1T9Q A;  5DLQ E;  4AR5 A;  1N34 Q;  4E6I A;  1VQJ A;  2DNC A;  3HEJ A;  4AHY A;  2K50 A;  2NWG A;  3NXW A;  3R3O A;  1F77 A;  1NBW A;  2CQO A;  4BBS H;  1GOZ A;  4ZAI A;  3M3Y H;  2WV6 D;  1RTO A;  4LF6 L;  1TS5 A;  3RMH A;  1ENA A;  4DV4 Q;  1KQS A;  1ET6 A;  3GTG B;  3PO2 G;  3NTH A;  2RHQ B;  1HR0 L;  1SR3 A;  1K83 H;  3C1E A;  1EEF D;  5FKA C;  4A3M H;  3C2P A;  1X3Q A;  4U68 A;  1TWA B;  1L0Y B;  1BRF A;  1RB9 A;  2RFK B;  1FJG Q;  1RD9 D;  2MNA A;  1DM0 B;  1A6X A;  2V0E A;  4R4I A;  1GUW A;  1FGU A;  1HZC A;  1Y8P B;  1PFU A;  3BDL A;  4C56 C;  1JJ2 A;  2HDM A;  3A8I E;  3CKI B;  1QCB D;  3RLN A;  2EZV A;  1I50 B;  2D0O A;  5I9P A;  5GAD C;  2F0O A;  1MD2 D;  2R7Z L;  3GTQ L;  2MO0 A;  2GVA A;  3D3R A;  1B9M A;  2AUK A;  1VZG A;  3J80 E;  4J6H A;  3STB D;  1Y1V G;  1LYL A;  4M1U B;  2B2W A;  2RDV A;  4KHP L;  3BYY B;  4RA8 A;  3NWS A;  1IBM Q;  1X3F A;  2WAQ P;  1DXM A;  3DWP A;  1H9S B;  3RLO A;  4MHE A;  3HOW G;  4IFD G;  3PWF A;  2K33 A;  3J81 j;  1NUC A;  2OT2 A;  3MC0 B;  4Y52 L;  2K03 A;  1HQR D;  2BOS A;  1K3B C;  3ND8 A;  5M3F B;  3E6Z X;  3FKI L;  1IU5 A;  4U67 1;  4KHV A;  1QIL A;  4IUR A;  4A3K H;  4HCE A;  4IOA A;  4GKJ Q;  3TP8 A;  4RG1 A;  2KED A;  3W1G A;  4BBS L;  2ICE C;  4YY3 Q;  1RF2 D;  1X6O A;  3G6E A;  2K5V A;  4DR3 L;  3I72 A;  1STH A;  5C4J L;  2B2W C;  3CHB D;  2KCT A;  1TY0 A;  4DAM A;  4LFA Q;  4DNR B;  1SMM A;  4C3H L;  3PF4 A;  1PFB A;  5ISR A;  5JVG 1;  3N52 A;  1BCP F;  1PTO F;  1L0W A;  2V3B B;  3AQQ A;  2YU9 H;  4B8C D;  2NVT H;  4ZYS A;  1W6K A;  5D65 A;  1BDO A;  1EEI D;  1I94 L;  1PTO H;  3HOX H;  1R9T B;  2XJQ A;  2HIV A;  1TS3 A;  1HH2 P;  3X3M A;  4KY6 A;  2NVT B;  4A3I H;  4IUP A;  4AI0 A;  2UXC L;  1K8O A;  3I4M G;  2B5I D;  1PH5 A;  5MGN A;  4JI6 L;  1YNJ C;  3CCQ A;  1DOM A;  1PRT B;  3FRP B;  1CAA A;  1SE2 A;  2DNE A;  1SNQ A;  1KHI A;  4FP5 D;  2KEC A;  4F87 A;  4ZUI A;  1EY5 A;  4GNX A;  3MWY W;  3OMG A;  2VQE Q;  3TZD A;  3EN2 A;  3LPE B;  3F2B A;  3AMU A;  1IRN A;  1EY9 A;  3N6R A;  4JI7 L;  4L5Q A;  2TSS A;  3DLL A;  5C44 H;  2UXC Q;  3S1Q L;  1E24 A;  2NTS A;  3CU7 A;  3QJY A;  2F0H A;  1ESF A;  5H1S c;  1HQM C;  3S14 L;  1EY4 A;  1RYQ A;  1QWY A;  1WTO A;  4AR6 A;  2V4D A;  3HOU G;  3RUZ A;  1SYF A;  4JI4 L;  4NW2 A;  1S24 A;  2AUJ D;  5GAE C;  1RWD A;  4P71 A;  4WJ3 M;  1SYG A;  4LFA L;  1PFY A;  4A3B H;  4ZKC B;  3CRK C;  4GS7 D;  1PA6 A;  1XNQ Q;  1X54 A;  1FHM A;  3LWU A;  1YUZ A;  4DV2 L;  4DR7 Q;  4CHT B;  4UDU C;  3PIP A;  1P16 A;  2F0P A;  3FHW A;  2C6A A;  1RDP D;  5E4X A;  3D6W A;  4A3L L;  2E8G A;  5FO9 B;  1OXV A;  1BUV T;  2JA7 G;  3WWN B;  5GAG C;  2ZIX A;  2B39 A;  3BVM A;  3HOW B;  1EQR A;  2MUY A;  4AI1 A;  3K80 C;  3M9B A;  2EQS A;  3PKI A;  1EOV A;  2E76 C;  2FXQ A;  1OO9 B;  1WI5 A;  2EY5 A;  4R4T A;  4FXD A;  1YEZ A;  1NMF A;  3NQT A;  1HNW L;  1GHJ A;  2EJF C;  3I4N H;  1YZ6 A;  4A3K G;  1JR0 D;  5IP7 G;  3KYW A;  1VF7 A;  2F03 A;  3UE0 A;  3K5M A;  2Q8T A;  1HNZ L;  1N33 L;  1B50 A;  4X3U A;  6RXN A;  2L4N A;  1D1K A;  1GM5 A;  5FO7 B;  1IBL Q;  2HHH L;  1V1P A;  5CBE E;  5CC4 A;  4JAD A;  4CGY B;  1XXG A;  1EY8 A;  3FPU B;  5IY0 A;  2A69 D;  1PMR A;  5AI2 A;  2PNR C;  3SK6 A;  1EYC A;  1MIU A;  1KNA A;  3H3V C;  4QUF A;  3U50 C;  4I7Z C;  2K52 A;  1TR5 A;  3HOZ B;  1PFS A;  1O78 A;  5BN5 A;  4V0B A;  1X55 A;  2JEA I;  3M4O H;  2IT1 A;  1FVI A;  4RMF A;  3M7N A;  3L9A X;  1ZYR D;  1VQ5 A;  1Q1B A;  4ME5 A;  1O80 A;  1YUX A;  4BBR B;  4DGZ A;  4GKK L;  4N8F A;  1CT1 D;  4LJZ C;  5M3M H;  1K8M A;  4OGQ C;  5C3E L;  1TXY A;  2QIL A;  3CXC A;  1WD1 A;  3WOE A;  1WCM L;  5FLM G;  4A3J B;  1XPU A;  4JOI C;  3SK4 A;  1VQ8 A;  3GP7 A;  1QZG A;  3UE1 A;  3M4O L;  1XMQ L;  1E0B A;  1CUK A;  4OEL B;  4TQU S;  5I2Y A;  2A68 C;  1BR9 A;  4PQX A;  5C4H A;  1EU4 A;  2NVQ L;  2LFN A;  1X3E A;  4Q0F A;  5GAD c;  2K2D A;  4G7O C;  2XGT A;  2E2J L;  2WIN B;  1GO3 E;  1UAP A;  3U4Z A;  2ZTD A;  2PVX A;  2EYP A;  1EZ8 A;  2F0Q A;  3K0X A;  2AQ3 B;  4A3J H;  3BVZ A;  3OIP A;  1VQL A;  1X56 A;  1CSP A;  2ID0 A;  3OOC A;  2JA6 L;  3TQY A;  2D62 A;  3GTL L;  4JAF A;  4A3J G;  2YV5 A;  1U4M A;  2H12 A;  3AFP A;  3H3V H;  1ZYR C;  1QUQ A;  5L37 A;  2PMZ P;  2GMG A;  1GUS A;  5M5X B;  4DR4 Q;  2R92 G;  1KD1 C;  4WJW A;  4YY3 L;  5EBD A;  4ZN1 B;  1E2V A;  3H91 A;  2RCF A;  4QB4 A;  3VYT A;  3CC7 A;  3Q22 A;  3SHL A;  4B08 A;  3MQK B;  3P8B A;  2E5L Q;  4A93 G;  2M2L A;  1CAD A;  3K5O A;  2ASB A;  4WOR A;  4A3E H;  5BN3 A;  3S2H H;  1YHB A;  3S24 A;  2KCC A;  5C3E B;  2UUA Q;  4DN4 M;  4IPG A;  3KLS A;  2YYZ A;  3D8G A;  4A3C G;  1JOR A;  1MSG A;  1A3V A;  4BBS B;  2L0Z A;  2LS0 1;  3LWO B;  2AWO A;  4DUZ L;  4LF7 L;  3HZX A;  1AE3 A;  5GAH C;  4P74 A;  4WJ4 A;  2PMZ E;  3TP7 A;  3T1H L;  3A74 A;  1Q8K A;  1E22 A;  1UUP A;  2A5H A;  2VW9 A;  1QQT A;  1LT5 D;  1S4Z A;  3CC4 A;  2F52 A;  5C3W A;  5IGF A;  2GN5 A;  5KEE A;  5IGB A;  1ENF A;  1FGB D;  1R9T L;  5KGU A;  1LKO A;  4B3R L;  1I4P A;  3W3A A;  3R2T A;  3MAQ A;  5LMN Q;  1U9R A;  4AR3 A;  4QMG A;  1Y8N B;  3RN2 A;  4A3D B;  3JAM E;  2UUC L;  2FFK B;  4QQB X;  4DR3 Q;  3MXU A;  3I55 A;  1TWF H;  3EIV A;  3HS0 C;  1SMX A;  4OO1 I;  1KNE A;  1SYE A;  4A3M B;  4A3B B;  4R4O A;  1G6Z A;  1SBB B;  5C3X A;  1KAB A;  1TWA L;  2XJT A;  5JPM C;  5IWA L;  1WCM G;  3H0G G;  3K81 C;  4AR4 A;  2DGY A;  3LWR B;  4JAG A;  1U0L A;  3J7A V;  3VA5 A;  4DV6 L;  1EIF A;  3RZD L;  1YVC A;  3AU7 A;  2JA7 H;  1I3Q H;  4HED A;  2F0J A;  2EJG C;  2PI2 A;  4FXG C;  1HCZ A;  4K8J A;  1TY2 A;  5ELN A;  2YTY A;  1GUN A;  3URY A;  1CHP D;  4BY1 L;  2QCP X;  1ML0 D;  4RGM A;  4EGV A;  2PPB C;  3A7L A;  1EYA A;  3CP0 A;  4JI3 Q;  3KF8 B;  4IJH A;  3QIA A;  1Y69 U;  4ZCK A;  3CAM A;  3QR8 A;  4JI0 L;  2RQX A;  4FF2 A;  2R7Z H;  3PCO B;  2A74 C;  4X64 Q;  2R6G A;  3GTK H;  4PZ7 A;  4RFB A;  1A63 A;  5IP7 L;  3JAM L;  2EE1 A;  2LY7 A;  3HOW L;  2BA0 A;  2QW7 A;  1PH6 A;  3J7A F;  3PZA A;  1SJH D;  4LF8 L;  3TRE A;  1HUM A;  3HOY B;  3PIP 3;  3PQI A;  2A6E C;  1MGS A;  5JEA H;  1O7L A;  3T56 B;  1R0J A;  1SSO A;  2ZT9 C;  1S3O A;  2M9V A;  1TKW B;  1SMU A;  1GUO A;  1N36 L;  2A19 A;  2VQE L;  3CPF A;  1Y1W B;  3I73 A;  5IGE A;  4JI7 Q;  1DOK A;  4DUY L;  3TS0 A;  1K9M C;  3HOZ H;  4A3F L;  3PUV A;  4CJ2 C;  1VQ7 A;  2R93 G;  2C9O A;  1E3P A;  4NXM L;  3VDY A;  2KQ3 A;  5CV4 A;  4ILW A;  2K5Q A;  1C09 A;  1S5F D;  3OMC A;  2B2V C;  2A1A A;  3K35 A;  2RA4 A;  4IUU A;  2F0F A;  2VB3 X;  2JA6 H;  4I7A A;  2EPB A;  1PRT C;  4A3K L;  4K6L A;  2LKV A;  3MTS A;  2G9D A;  2JI3 A;  1NTG A;  1SNC A;  1BXT A;  5FJ8 H;  1I94 Q;  2A8V A;  5BN4 A;  3LNL A;  1ZEQ X;  4TVA B;  4B3M L;  1TS2 A;  4V19 0;  3FP9 A;  1QVC A;  3TN2 A;  4L6T B;  3NTK A;  3VA7 A;  2A69 C;  1EY6 A;  1CKO A;  1EWC A;  3JAM c;  2N78 A;  3NHH A;  3J7Y 1;  1GXD C;  5D3I B;  3HOY L;  1NXG A;  5LMN L;  2K75 A;  1J8I A;  4JG2 A;  2RSN A;  3B08 B;  5T1I A;  3W5O A;  3HOW H;  1A15 A;  4KN7 C;  1RIP A;  1VQH A;  1WTR A;  1F2Y A;  4YWM A;  2Z6B A;  4Y7N B;  3ZYY X;  1IKL A;  2JA8 G;  4GOP B;  4A3I B;  1VQ6 A;  1G2S A;  5IP9 H;  3S1N B;  4DR1 Q;  1VQ9 A;  1QB5 D;  3TDQ A;  2N8N A;  4BY7 H;  3K5N A;  2UUB L;  3K59 A;  1MHW C;  1B1Z A;  2JA5 B;  4XYQ A;  2CFM A;  2RDH A;  3KLS X;  2NVQ H;  2L0C A;  1B2O A;  2JA8 H;  2BDN A;  2DJG C;  2E75 C;  1HJP A;  4X65 Q;  1HXY D;  4QIW B;  1EY7 A;  4XQQ A;  2ATW A;  2PQA B;  3OSO A;  3KFU A;  3U9O A;  2UUA L;  1FR3 A;  3PUX A;  3GTJ L;  5C44 G;  3EFX D;  2VQF Q;  4A93 H;  2HQE A;  2F0M A;  1STB A;  3NK9 A;  3PO2 H;  1SND A;  1H9K A;  2Z4H A;  1G51 A;  4HN7 A;  1HFN A;  5IGD A;  2Z3Q B;  4AHZ A;  1UEA B;  3P20 A;  5FJ8 G;  2UU9 Q;  3NFP I;  1FNU A;  5JJZ A;  2WKD A;  3S1R L;  1I4G A;  2KEN A;  4LHL A;  2Z3R B;  2EXD A;  5M3F L;  3FKI B;  1GD7 A;  4O0A A;  4BY1 H;  4IUT A;  1CM9 A;  1YJN A;  1DX8 A;  1Y14 B;  3J7Y W;  3CMA A;  1E7Z A;  5J22 A;  4MTN A;  3Q23 A;  4B3R Q;  4YHH L;  4ZLT F;  2OEO A;  3HKZ B;  4PMB A;  3HOY H;  3UDX A;  2EYJ A;  1PH3 A;  4A3G G;  2OQ0 A;  4B3S L;  1PH7 A;  1KIX A;  1R0H A;  1QYB A;  3H9B A;  1IYJ B;  1HTL D;  3OIQ A;  5K36 G;  3ZJY C;  3C3L A;  1EIG A;  5HY6 A;  2R3Z A;  1YNJ D;  4DV0 Q;  1RTN A;  5ELB A;  4M8A A;  4G7Z C;  4LNQ A;  2B2T C;  1VCI A;  3H09 A;  3OW7 A;  1LTA D;  2L12 A;  4JW0 A;  3PUY A;  4DK6 C;  1PZX A;  2CW0 D;  5FLX E;  3C1F A;  5FJ8 L;  1CKN B;  1JWS D;  3NP8 A;  1Q12 A;  2F0G A;  4BXX L;  5IYD H;  3P75 A;  1FNV A;  1LAB A;  2D0P A;  3S16 L;  2OTJ A;  1LV9 A;  5EAY A;  1SFO H;  1TWA H;  1TWC L;  1K3R A;  1PH2 A;  3HOU L;  5IGG A;  5C44 L;  1YI2 A;  1GKH A;  3PO3 G;  2EOT A;  4AI3 A;  1TWH B;  5CMD A;  4FXK C;  3PIO 3;  2L55 A;  3GTJ H;  3K58 A;  2F4I A;  4LUO A;  1KC8 C;  4EQO A;  3PMF A;  1VQO A;  2WAC A;  4OXP A;  1LUZ A;  3I4L A;  3QWN A;  1TWH H;  4OEM B;  1F2L A; 
#chains in the Genus database with same CATH homology
 1Z47 A;  1RWD A;  3PIP 1;  4P71 A;  3TEH B;  2PQA A;  5HGQ A;  3CME A;  1HR0 Q;  4WJ3 M;  1BQ8 A;  1OWC A;  2RF4 A;  2DSX A;  4LFA L;  3I4M H;  3CQZ H;  4A3B H;  3HKZ E;  3OTO L;  4DR5 Q;  4BY7 G;  4LF7 Q;  4GS7 D;  1QVG A;  1PA6 A;  1M90 C;  1XNQ Q;  1X54 A;  1FHM A;  1VQA A;  4LUV A;  4JV5 L;  1YUZ A;  4X64 L;  4DV2 L;  4DR7 Q;  2NZH A;  1O7I A;  1UE1 A;  5IP9 G;  4HIK A;  3PIP A;  4OX9 Q;  1UE6 A;  5GAE c;  1I50 H;  1P16 A;  1XTD A;  2ZTC A;  2C6A A;  4XGH A;  2NYD A;  2R7D A;  3FHW A;  2R7F A;  4UPA A;  3L2P A;  2E8G A;  3S1R H;  1OXV A;  2JA7 G;  4BA2 I;  4GKK Q;  4X62 L;  3WWN B;  5GAG C;  3G4S A;  2ZIX A;  2WAQ G;  1X9N A;  2Q2T A;  4C2M H;  2K14 A;  5LMU L;  4KI0 A;  5GAH c;  1EQR A;  4AHX A;  4DV2 Q;  3GDE A;  4AI1 A;  3K80 C;  3M9B A;  1KL9 A;  3HKS A;  1L1O B;  2EQS A;  3E9I A;  1VQG A;  4IPC A;  2NZO A;  3BU2 A;  3PKI A;  1EOV A;  2FXQ A;  3WWL A;  5IP7 H;  3H0G H;  2JJQ A;  5M5X H;  1WI5 A;  2N49 A;  3J80 i;  2EIF A;  3EBE A;  2QEX A;  3S16 H;  4V19 6;  4HJ9 A;  4R4T A;  3S1Q H;  1YEZ A;  1NMF A;  4HID A;  2RHS B;  3A5Z B;  3STB C;  4NXM Q;  1HNW L;  1HZA A;  4A3M G;  2CKA A;  3I4N H;  2KKD A;  3QQC E;  7RXN A;  1YZ6 A;  2K5H A;  5IP7 G;  4A3K G;  1S40 A;  1MJE A;  3KYW A;  1YIJ A;  4LFB L;  3UE0 A;  3P2A A;  5GRO A;  2CKZ B;  3HFZ B;  3ER0 A;  1HNZ L;  3KDF A;  3ULL A;  1G29 1;  1VQM A;  1N33 L;  2AMC B;  6RXN A;  5AI3 A;  2CWP A;  5C4X H;  4G6B A;  1GM5 A;  2Q2I A;  3L7Z C;  2XJR A;  4PZ8 A;  5E7N A;  1HNX L;  4BBS G;  1IBL Q;  3KYV A;  2PI2 E;  2HHH L;  3CF5 A;  4DK3 C;  4YCU A;  3S15 H;  2Z0S A;  1HZ9 A;  4JAD A;  2VL6 A;  2PVE A;  1VS0 A;  3ULP A;  1K0R A;  4WFN 1;  1V43 A;  1FJG L;  4XXB B;  1PHJ A;  1DVB A;  1MKH A;  5IY0 A;  2A69 D;  4POG A;  2IX0 A;  4A3F G;  1XPO A;  2UU9 L;  3F2D A;  5AI2 A;  2ZTE A;  3Q8D A;  1OXU A;  2DUD A;  4NXN L;  2F4V L;  4B3T L;  3KF6 B;  3TRZ A;  1IW7 D;  1MIU A;  1SN8 A;  4HIM A;  4A3B G;  5MFZ A;  1R0G A;  2JEB I;  1KRT A;  3U50 C;  3RN5 A;  4IO9 A;  4C3H H;  1JJC B;  4AQY L;  2K52 A;  4OWW B;  2WB1 E;  4JV5 Q;  2QGQ A;  5K2M E;  2KBN A;  3T1H Q;  1PFS A;  2UXC L;  2R93 H;  4B3M Q;  3HOZ G;  5BR8 L;  3UDF A;  2UUC Q;  1NXE A;  2PPT A;  4JI3 L;  4HJ5 A;  4L5S A;  5J3B A;  4DUZ Q;  4HJ7 A;  4MNO A;  1ODH A;  3GO5 A;  1X55 A;  2NN6 I;  5JJK A;  2JEA I;  3M4O H;  4A3C H;  4YWL A;  1FVI A;  2IT1 A;  4GLA C;  4RMF A;  1PH9 A;  3M7N A;  1NNQ A;  1PH8 A;  1B70 B;  1VQ5 A;  1GVP A;  1Q1B A;  3B6Y A;  2JK8 A;  1YUX A;  2JQO A;  3F2C A;  3CCE A;  3FKI G;  2NN6 G;  4A3E G;  2BH2 A;  4GKK L;  1S30 A;  1SE8 A;  5EIN C;  5C3E H;  5M3M H;  5FLM H;  2C6B A;  5EIO C;  2WFW A;  2ERS A;  1TXY A;  2AKW B;  4UY8 1;  2ZM6 L;  3CXC A;  4LFB Q;  2HHH Q;  5M3M G;  5M5Y H;  1RDV A;  1PYS B;  4JOI C;  2O5J D;  5FLM G;  3G71 A;  1VQ8 A;  1XPU A;  1QZG A;  4BXX G;  4OWX B;  5DM6 1;  3S1N H;  4R1J A;  1D8L A;  3UE1 A;  4OO1 G;  4ME3 A;  2JA5 G;  1XMQ L;  4QY7 A;  3S17 H;  1CUK A;  1HNW Q;  4TQU S;  2AWN A;  3AFQ A;  4GOP C;  3NEL A;  1UE7 A;  4A75 A;  3CCM A;  1QUQ B;  4A3D H;  5JJL A;  4JYA Q;  5GAG c;  5JVH 1;  2RCN A;  1R0F A;  4EX5 A;  1J5E Q;  1X3E A;  5GAD c;  3I56 A;  2K2D A;  1SRU A;  2XGT A;  5H1S E;  1GO3 E;  3U4Z A;  2XJP A;  3PKJ A;  1MJC A;  2ZTD A;  2PVX A;  3I2Z A;  4A3I G;  2MFI A;  2YTV A;  5LMN W;  3K0X A;  4NXN Q;  3HOV G;  2MO1 A;  4A3J H;  1L1O A;  1VQL A;  4P73 A;  4X62 Q;  1X56 A;  1NE3 A;  1CSP A;  3HOY G;  1TWG H;  2ID0 A;  3TQY A;  2D62 A;  1VQI A;  1N32 Q;  4JAF A;  3ZG6 A;  2GVB A;  2YTX A;  2YV5 A;  4YWK A;  2H12 A;  1YK4 A;  5FLX c;  4A3J G;  4YCW A;  1YIT A;  3AFP A;  4JI5 L;  1CSQ A;  3H3V H;  4K0K Q;  1L1O C;  3UDG A;  1QUQ A;  1YBY A;  4IOC A;  2OTL A;  4UP9 A;  4DV7 L;  2GMG A;  4LW1 A;  1BFY A;  4H02 A;  3J80 c;  4DR4 Q;  1G6P A;  1N32 L;  4BA1 I;  2CWA A;  3AYH B;  1IXR A;  1T9H A;  1KD1 C;  2I0Q A;  3QVD A;  1Q82 C;  4YY3 L;  2R92 G;  1OXS C;  5IE8 A;  5M5W H;  4LF9 Q;  1WFQ A;  3RZD H;  1P8L A;  5JJI A;  3A44 A;  3PUW A;  4J15 A;  1U5K A;  1M1K C;  3RZ6 A;  2XJS A;  4ZN1 B;  2B29 A;  4EQ5 A;  4LF5 L;  3CC7 A;  4QIW E;  2UUB Q;  4A76 A;  4DPG A;  4DAY B;  4DV1 Q;  3KYH C;  1J5E L;  3P8B A;  1W3S A;  2E5L Q;  4PMW A;  4HIO A;  3S14 H;  2E2I H;  1PV4 A;  4A93 G;  3J7A 5;  1CAD A;  4DV7 Q;  2ASB A;  2KN9 A;  3PSI A;  4A3E H;  1IZ6 A;  2OCE A;  3S2H H;  1YHB A;  4AHW A;  1X65 A;  3ERS X;  3S24 A;  1IRO A;  2CCZ A;  3NBH B;  1E1O A;  2UUA Q;  1EYG A;  4IPG A;  4C3J H;  4TPU A;  2H5X A;  1C9O A;  4GS3 A;  2YYZ A;  1WJV A;  1VQP A;  1OTC A;  4A3C G;  2BA1 A;  3KJO A;  1ASZ A;  4DR2 Q;  1WOC A;  4JI8 Q;  4UP7 A;  3PIO A;  4POF A;  1H7V A;  2L0Z A;  4LF7 L;  2AWO A;  4DUZ L;  4GNX B;  3S2D H;  2I5H A;  2R7Z G;  1AE3 A;  5GAH C;  4P74 A;  4OON A;  1HNZ Q;  4WJ4 A;  2PMZ E;  4DV6 Q;  3BZC A;  4O2D A;  1AE2 A;  1WJJ A;  1EWI A;  4LUZ A;  4JBW A;  4AYB E;  4X66 L;  5IYB G;  5C0X J;  3J81 i;  3T1H L;  1NJI C;  3A74 A;  3IRB A;  4A4I A;  3JC6 3;  4DV4 L;  1W2B A;  1Q8K A;  1E22 A;  4JI6 Q;  1E1T A;  2VW9 A;  4Y52 H;  4QJF A;  3CC4 A;  3JAM i;  2F52 A;  4DV0 L;  3JC6 2;  1SMW A;  3MXN B;  1VQD A;  4JI4 Q;  2PSM C;  4A3F H;  2GN5 A;  1JMC A;  4DR4 L;  2ALY B;  5RXN A;  2UXC Q;  2XTI A;  2HIX A;  1EIY B;  1LKO A;  1PYB A;  4LF9 L;  4B3R L;  1XMO L;  3RZO H;  2JA9 A;  1VZH A;  2IY5 B;  3K7U C;  1PH4 A;  2F4V Q;  1R0I A;  4Y7N H;  2N3S A;  5MLC 3;  4FDB A;  5LMN Q;  3JC6 6;  1RYT A;  1OWB A;  4AI2 A;  4DNI A;  4AR3 A;  4DR7 L;  3RN2 A;  1UEB A;  1BE7 A;  1ZRP A;  2Y0S E;  4XTC S;  4JI2 Q;  1JT8 A;  3T1Y L;  2UXD L;  2NVY H;  2UUC L;  3CCL A;  4DR6 Q;  4DR3 Q;  4QQB X;  3I55 A;  1JJG A;  1TWF H;  4BBR G;  1IBM L;  1D7Q A;  3KDF B;  2IHF A;  3EIV A;  1SMX A;  1V9P A;  4OO1 I;  4YCV A;  3I4N G;  3KYX A;  1BQ9 A;  4APV A;  1QZH A;  2LXJ A;  3KLW A;  2E2J H;  4R4O A;  3CD6 A;  1XNQ L;  3MPS A;  4DV3 L;  2Q2H A;  3GTG H;  3D0F A;  1XNR L;  1YV1 A;  2OQK A;  2XJT A;  3F1Z A;  4BBR H;  5IWA L;  1WCM G;  3H0G G;  4R4C A;  3J7Z C;  2B63 H;  2VNU D;  3K81 C;  2Q2U A;  3CPW A;  2PYA A;  2M4Y A;  4AR4 A;  1KAW A;  2DGY A;  2VY3 A;  1JE5 A;  4JAE A;  3PGZ A;  3MEF A;  4JOI A;  1RDG A;  4JAG A;  4JC0 A;  1Q81 C;  1U0L A;  2ES2 A;  4QGU A;  3WWV A;  1UWV A;  2M6P A;  4DV6 L;  3E9H A;  1EIF A;  1K73 C;  1B13 A;  1YVC A;  2JA7 H;  2NVT H;  1I3Q H;  3K7A H;  3CC2 A;  2VZA A;  1SRO A;  2JE6 I;  2ZM6 Q;  2IX1 A;  4JI5 Q;  4K9F A;  2PI2 A;  4JI8 L;  5M3F G;  3BJU A;  2OWO A;  1Z9F A;  2Z6K C;  2LSS A;  3CW2 C;  5ELN A;  2YTY A;  5AJ3 Q;  4JBM A;  3AEV A;  1H95 A;  3HOX G;  3SGI A;  3GD7 A;  1KXL A;  4LF4 Q;  2F3I A;  1IL2 A;  4UY8 C;  2AYJ A;  1C7Y A;  4GLX A;  4JI3 Q;  3CP0 A;  1C0A A;  3KF8 B;  4IJH A;  1K8A C;  1LM0 A;  3HOV H;  1OXT A;  3D31 A;  1UE5 A;  3CAM A;  4E6Y A;  1DGS A;  2C35 B;  4JI0 L;  2R7Z H;  3A5U A;  1Q86 C;  3GTK H;  3PCO B;  4X64 Q;  3GTQ H;  2R6G A;  4X66 Q;  2ERJ A;  1VQK A;  4PZ7 A;  1A63 A;  4IJL A;  5IT9 c;  5BR8 Q;  5ELO A;  1Y1W H;  2I5M X;  4GOP A;  1XNR Q;  3VPB E;  2MS3 A;  5MFP A;  1K8G A;  3GTO H;  2QL0 A;  3GTP H;  3KYU A;  4A3D G;  1XJV A;  2BA0 A;  1Q7Y C;  4DR2 L;  1TWC H;  3PZA A;  1PH6 A;  3CCR A;  4IFD I;  2WAQ E;  4LF8 L;  4A3L G;  1N9W A;  3TRE A;  2JA5 H;  3T1Y Q;  2L15 A;  1FL0 A;  4LFC Q;  2UXD Q;  1L2F A;  2WB1 G;  1R9T H;  4BXX H;  1A62 A;  3HKZ G;  1B7Y B;  4A3L H;  8RXN A;  1R0J A;  5IYD G;  4OWT B;  3ULJ A;  3OW2 A;  1JB7 A;  3B0A B;  2LCQ A;  1S3O A;  2NVX H;  1SLJ A;  4DR5 L;  2ZJQ A;  2UXB L;  1SMU A;  3I7F A;  2MQH A;  4DV1 L;  1N36 L;  4ZN3 B;  2E5L L;  1JYB A;  1VZI A;  2A19 A;  2VQE L;  1NMG A;  4GNX C;  3RNU A;  1PH1 A;  3CPF A;  4LHN A;  4AH6 A;  4JI7 Q;  1Y1W G;  3S1M H;  4LF5 Q;  4DUY L;  3TS0 A;  1K9M C;  2VS1 A;  3HOZ H;  2R92 H;  4NPS A;  3PUV A;  4R4Q A;  3W1B A;  4DV3 Q;  1VQ7 A;  4A3G H;  2R93 G;  1VQ4 A;  1Z92 B;  1VCX A;  1E3P A;  4KHZ A;  1XMQ Q;  3PF5 A;  3VDY A;  4NXM L;  2B3G A;  1Y1V H;  3U4V A;  1C09 A;  4LF6 Q;  1YJW A;  3K8A A;  4JI2 L;  2XJU A;  2A1A A;  1HR0 W;  3K35 A;  1S72 A;  2UXB Q;  3DM3 A;  1S2Z A;  4JBJ A;  5M3F H;  4BY1 G;  1IBK L;  2JA6 H;  2BE5 D;  3F8T A;  1T9Q A;  1HZB A;  5DLQ E;  4AR5 A;  1N34 Q;  1VQJ A;  3M4Q A;  4AHY A;  2K50 A;  1RL2 A;  3OYY A;  4C3I H;  3A0J A;  4KHP Q;  3KOJ A;  1NBW A;  5DM7 1;  2JI3 A;  2CQO A;  4GN5 A;  1NTG A;  4BBS H;  1KRS A;  3RR5 A;  5FJ8 H;  1I94 Q;  2A8V A;  1VQN A;  3M3Y H;  4AIM A;  4LF6 L;  2J9U B;  4DV4 Q;  2A6H D;  3LNL A;  4TVA B;  4B3M L;  1KQS A;  2QA4 A;  1WCM H;  3FP9 A;  1EQQ A;  1QVC A;  3PO2 G;  1LKM A;  1YK5 A;  1V1Q A;  2RHQ B;  1SR3 A;  3CCJ A;  1K83 H;  1HR0 L;  4JI0 Q;  2A68 D;  2ZJP A;  4A3M H;  4JYA L;  3OTO Q;  3RLF A;  1CKO A;  1NY4 A;  1B2J A;  3J7Z 1;  1BRF A;  2HQL A;  2N78 A;  3JAM c;  1RB9 A;  1FJG Q;  3J7Y 1;  2LXK A;  1FHH A;  5GQO A;  2MNA A;  3TS2 A;  2V0E A;  3IU3 I;  1NXG A;  4R4I A;  1XPR A;  5LMN L;  2K75 A;  4GKJ L;  1FGU A;  1HZC A;  3NEM A;  1CKM A;  1IBL L;  4JG2 A;  1I6H H;  1JJ2 A;  4PZ6 A;  1E8J A;  2WP8 J;  3B08 B;  3W5O A;  5AJ3 L;  3HOW H;  4DV5 Q;  1RIP A;  1VQH A;  3G48 A;  3RLN A;  4YWM A;  1T9P A;  1IBK Q;  4X6A H;  1AH9 A;  3U58 A;  1WYD A;  4XIG S;  1VQF A;  2D0O A;  4MZ9 A;  5IYC G;  2JA8 G;  5K36 G;  4GOP B;  5GAD C;  1XMO Q;  1VQ6 A;  5IP9 H;  5C4J H;  2MO0 A;  2GVA A;  4DR1 Q;  1VQ9 A;  4UP8 A;  3J81 c;  5MF6 A;  1J6Q A;  1VZG A;  4JI1 Q;  4AQY Q;  2N8N A;  1Y1V G;  1LYL A;  3STB D;  4BY7 H;  3CCS A;  2UUB L;  4TVM A;  3PIO 1;  2JI2 A;  4DUY Q;  4JCV E;  3H3V I;  2RDV A;  4KHP L;  5IYC H;  2AHO B;  1IBM Q;  1A0I A;  2K4K A;  2CFM A;  1X3F A;  2IHE A;  5IYB H;  1B8A A;  4HJA A;  2NVQ H;  1B2O A;  3I4M G;  2JA8 H;  1VQB A;  2M4V A;  3RLO A;  3HOW G;  4L5R C;  2PNH A;  5AN9 H;  1YHQ A;  1PVO A;  4IFD G;  4DR6 L;  4LFC L;  3PWF A;  1HJP A;  3J81 j;  4X65 Q;  5C4X G;  3NEN A;  2XJV A;  2ZJR A;  3KF6 A;  2PQA B;  2ATW A;  4PG3 A;  3PV0 A;  5JEA J;  3KFU A;  3L0O A;  3RZT A;  5JEA G;  5LMU Q;  2UUA L;  3PUX A;  3PO3 H;  4P75 A;  1IU5 A;  4U67 1;  4DV5 L;  4IPH A;  4A3K H;  4LWC A;  1BBW A;  1QCV A;  5C44 G;  2VQF Q;  5IWA Q;  4A93 H;  4IOA A;  1YJ9 A;  3RYG A;  1X3G A;  3PUZ A;  3PO2 H;  4GN4 B;  4GKJ Q;  4IFD J;  3MSU A;  4RG1 A;  4P72 A;  1OXX K;  3W1G A;  1G51 A;  3GTL H;  4YY3 Q;  2Z3Q B;  4AHZ A;  1X6O A;  3G6E A;  2K5V A;  4DR3 L;  1A8V A;  3I4O A;  4B3S Q;  2HT1 A;  1BBU A;  2Y0S G;  3E0E A;  4DKA C;  5FJ8 G;  3NFP I;  2KCT A;  3CCU A;  4DAM A;  4HJ8 A;  2UU9 Q;  4LF4 L;  1QVF A;  4LFA Q;  4YHH Q;  1SMM A;  3KJP A;  1N8R C;  2KEN A;  4LHL A;  4B3T Q;  4RXN A;  1CKN A;  3PF4 A;  2Z3R B;  1YHA A;  5JVG 1;  2EXD A;  1L0W A;  2YU9 H;  2V3B B;  3AQQ A;  1N36 Q;  1B71 A;  4B8C D;  1GD7 A;  1LKP A;  2JI1 A;  2I5L X;  2V1C C;  4L5T A;  4O0A A;  5C0X I;  1I94 L;  4BY1 H;  1YJN A;  1DX8 A;  1Y14 B;  2BH8 A;  4ALP A;  3CMA A;  2JA6 G;  1E7Z A;  2HR5 A;  4QL5 A;  3HOX H;  4MTN A;  2XJQ A;  4B3R Q;  4YHH L;  4IPD A;  2HIV A;  1IU6 A;  3CCV A;  3HOY H;  4K0K L;  2A6E D;  3UDX A;  1HH2 P;  3ICE A;  2Z6K A;  1PH3 A;  4JBK A;  2OQ0 A;  4B3S L;  1PH7 A;  4A3I H;  1KIX A;  4A3G G;  1R0H A;  1BKB A;  4LF8 Q;  1QYB A;  4AI0 A;  1VQC A;  1IYJ B;  2CKC A;  3BZK A;  1I5F A;  2B5I D;  4KLK A;  4NB3 A;  3ZJY C;  2M6O A;  5MGN A;  5HY6 A;  1PH5 A;  4JI6 L;  1EUJ A;  4OX9 L;  1Q46 A;  1T9O A;  2K5N A;  3CCQ A;  4DV0 Q;  3LGJ A;  4LNQ A;  1VCI A;  2B63 G;  1CAA A;  3GTM H;  3SS2 A;  3PUY A;  4DK6 C;  3M85 A;  4GNX A;  1KHI A;  3HOU H;  1CKN B;  1YNX A;  2E2H H;  1Q12 A;  2VUM G;  2KCM A;  1N34 L;  2VQE Q;  5IYD H;  2VQF L;  2V0F A;  3LPE B;  2D0P A;  3EN2 A;  1IRN A;  3F2B A;  4JI7 L;  2OTJ A;  5EAY A;  1EFW A;  4L5Q A;  1SFO H;  1TWA H;  1ASY A;  1K3R A;  2KHI A;  2KHJ A;  3DLL A;  1VQE A;  4AYB G;  5C44 H;  1BVS A;  4DR1 L;  1E24 A;  4GN3 B;  4GLV B;  3H15 A;  1YI2 A;  1PH2 A;  3UDI A;  1GKH A;  5H1S c;  4X65 L;  5C3E G;  4AI3 A;  3PO3 G;  1LTL A;  3FKI H;  1RYQ A;  3KYY A;  3GTJ H;  1KC8 C;  4LUO A;  1HNX Q;  4AR6 A;  2VUM H;  1Q1E A;  2CR8 A;  1VQO A;  3HOU G;  3M4P A;  4OXP A;  1LUZ A;  5C0X G;  4JI4 L;  1N33 Q;  4JI1 L;  1S24 A;  1TWH H;  5GAE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...