5IY0A

Pfmcm n-terminal domain double hexamer
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title Structure of a double hexamer of the Pyrococcus furiosus minichromosome maintenance protein N-terminal domain.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication dna binding protein
total genus 72
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5iy0A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iy0A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 5iy0A01
4JI6L 1S3OA 1B71A 8RXNA 1RDGA 2BH2A 3S15H 3KDFA 4X64Q 1N36Q 1H7VA 1FVIA 4LF9L 2JK8A 1K83H 2JA6H 4LF8Q 4DV5L 4JOIA 2ZM6L 4LUVA 4BBSH 4DR4L 5IP7G 5IP9H 1N8RC 3L7ZC 5GROA 3T1HL 3U58A 3RLNA 2EXDA 4DKAC 2ZJQA 3PF4A 4GLVB 1MKHA 1JB7A 3JC63 4LF5L 5M3FG 4LFAL 3KYVA 2PMZE 2VUMG 4JI6Q 4K9FA 1L1OB 4JI3L 2MQHA 3TS0A 4IPCA 5C0XI 4LF9Q 1VQJA 4GKJL 3AYHB 1PH3A 1D8LA 2DGYA 1B2OA 1JE5A 3F2DA 1PH6A 2R7DA 1VQMA 1W3SA 3SGIA 4ALPA 3A44A 1BFYA 3IRBA 3UE0A 5LMNL 1X65A 4LFAQ 2E5LQ 2A19A 3S2DH 3CD6A 1B8AA 4Y52H 1X6OA 1I3QH 4AIMA 1EQQA 2HHHQ 4GOPA 4A3FG 1R0IA 4H02A 1LKPA 2HQLA 1UE7A 4NB3A 1KRSA 1T9PA 3KJOA 1LTLA 4GKJQ 3EN2A 1YK4A 3ULJA 1IBML 3M7NA 4BY7G 4A93G 1KQSA 2JEAI 3TRZA 4A3EH 3BJUA 2JA8H 2UXCL 4LF7L 1G291 1LKOA 1SMUA 1J6QA 4DV0Q 1I94L 3OTOL 2L15A 1SE8A 3PSIA 1HH2P 4JBWA 2HT1A 1PHJA 5FLXc 1IBMQ 3RZTA 1KXLA 2F3IA 4B3RL 1Q81C 1BBWA 4LFBL 2E2JH 4B3TL 3S1NH 4LF7Q 1V43A 2N8NA 4P72A 4YWLA 2K5HA 1FJGQ 1UWVA 3CCRA 4OWXB 3M85A 3TQYA 4QJFA 4JYAL 3PCOB 1QVFA 2LXJA 2EIFA 2RF4A 5C0XG 1HZAA 4JI8L 1JJ2A 4B3RQ 2OCEA 1E22A 1YHQA 3PUYA 5AI3A 2CWAA 4HJ8A 2R7ZG 3A5ZB 1XNRL 4LFBQ 3CMAA 4A3JG 1AH9A 3M4OH 2YU9H 2YV5A 1B7YB 1T9OA 3FP9A 5M5WH 4DR2Q 4JBKA 1VQ6A 2A1AA 1PVOA 1VQPA 1IXRA 3MEFA 1X3FA 2CQOA 4JOIC 1PH5A 4LF4Q 3CF5A 1NTGA 1WCMG 3H3VI 1C0AA 1EIFA 2R6GA 3GTGH 5H1SE 3I7FA 4DV4L 1SLJA 1CKOA 2JE6I 5J3BA 2YYZA 2Z0SA 1BQ8A 1VCXA 3HKSA 3KF6A 2R93H 1WJJA 4HJ9A 2JEBI 4X62Q 4DV2L 1VQAA 4A3BH 1Y14B 2BH8A 1VCIA 4XTCS 2RCNA 4JI7L 1VQFA 3OYYA 1R0GA 1TWFH 2E8GA 4YCVA 1IRNA 1X55A 3F1ZA 5BR8L 1GO3E 1PYSB 1GVPA 2NZOA 1EWIA 1I6HH 2NN6G 2HIVA 3KYUA 4BBRG 4DPGA 3ER0A 4KHPQ 1UEBA 3M4PA 3PGZA 1CADA 4NXNL 2UU9L 4GOPC 5IYCH 4C3JH 4A75A 1Y1VH 1A62A 4UP9A 4DV2Q 1IBKL 3S1MH 3F2CA 1PA6A 1IZ6A 5IYDH 4GS3A 5C44G 2N78A 3RZDH 1KAWA 3MXNB 2B63G 1NMFA 1Q86C 2OTJA 5BR8Q 3DLLA 3H3VH 2PI2A 4AR5A 3I4MH 4BXXG 4MNOA 4A3GG 4YCUA 2UU9Q 1E8JA 4J15A 1S72A 2KHIA 2I5LX 1IBLL 2UUAQ 1PV4A 4MTNA 3HOUG 1B2JA 1DVBA 2RDVA 1TWAH 1X54A 3J81c 4A3CG 1VQGA 3CCSA 4AR4A 1UE1A 3K7UC 3CCMA 3CXCA 1V9PA 2GVBA 4JI4L 3NBHB 1AE3A 1NY4A 2Q2TA 5M3MG 4PZ6A 4UY8C 1TWGH 3K8AA 1CAAA 4AH6A 3ZJYC 4DV1L 1MIUA 4DAYB 3E0EA 2AWOA 1IBLQ 4A3MG 5M5XH 3F2BA 2VQFL 4B3MQ 1B70B 2ATWA 3NEMA 2D62A 1HNZL 4JG2A 4DUZL 4DR7Q 4JI1Q 2DSXA 1C09A 4QIWE 4JI4Q 3L2PA 3HOYG 1SMWA 2OQ0A 2E2HH 2IHEA 2KKDA 2VZAA 2K2DA 1VQDA 4DV1Q 3RR5A 4X66L 3ULPA 4A3KH 1I50H 1YHAA 4A3DH 1XMQL 1MJEA 2OWOA 1RIPA 4OWWB 1M90C 3GTOH 3CPWA 3KDFB 3H0GH 1HNZQ 4LF6L 1KL9A 3I4NG 1VQ5A 4GN5A 4DV6L 1NBWA 1E3PA 2KBNA 1A0IA 1YVCA 4GLAC 1Y1WG 3I56A 3T1YQ 4DR1L 3KYHC 1VQCA 4X66Q 1PH9A 4HJ7A 4OONA 1SN8A 2JA6G 3K7AH 3HKZG 2V3BB 1HJPA 4DV5Q 1CKNA 2ZM6Q 1K8GA 1WI5A 5IP9G 5IWAL 2IX0A 2OTLA 4BBSG 4DR4Q 5ELOA 1PH8A 3T1HQ 4A76A 2K52A 1Z9FA 2K5VA 1CUKA 4LF5Q 5FJ8H 4DR1Q 1XNQL 1TXYA 4O2DA 4OXPA 4JI3Q 1QCVA 4C3IH 1BE7A 2VNUD 1FJGL 1YJ9A 1LM0A 3PUZA 4GOPB 4UP7A 5IWAQ 4LNQA 3PV0A 2K4KA 1RL2A 3HKZE 4OX9L 1NJIC 5LMNQ 1YI2A 1S40A 4NXML 4KI0A 4L5SA 1XNQQ 4BA1I 3KJPA 2JA7H 1VQBA 2UXBL 2QA4A 1BKBA 1HR0L 4JV5L 1Q12A 2AWNA 4XIGS 2PQAA 3J7ZC 2KCTA 1HNXL 1N32Q 3VDYA 1YBYA 2MFIA 1VQ8A 1IYJB 2IHFA 2UUCL 3UDGA 1X3GA 2YTVA 2K5NA 1U0LA 1PH2A 1VQHA 4EQ5A 1N34L 4OX9Q 2R92H 1XMOL 4A3EG 1O7IA 1OXVA 2JA8G 1IU5A 2UXCQ 1SROA 5LMUL 4GNXC 1I94Q 3TS2A 2UXBQ 3OTOQ 2MO0A 4X65L 2VY3A 1HR0Q 2Q2IA 3J7A5 3KYXA 4JV5Q 1HNXQ 1YEZA 3W1GA 4DR5L 4POGA 1EIYB 3OW2A 3A74A 1N34Q 4DV4Q 3GTKH 1XMOQ 5C4XH 1AE2A 4DAMA 3H15A 3CCLA 2IT1A 4B3TQ 1OXTA 1M1KC 2CCZA 4RG1A 4UP8A 1EOVA 4X65Q 1V1QA 4QL5A 4C3HH 4JYAQ 5IY0A 1Q7YC 1H95A 1TWHH 2GMGA 5C0XJ 1N9WA 4L5QA 4HIMA 4JI8Q 3HOVH 3L0OA 3UDFA 1TWCH 3E9IA 4HJ5A 1P16A 3A0JA 1IROA 4IOCA 5RXNA 2JA9A 4JCVE 2WP8J 1LYLA 1E1OA 4LUOA 4OWTB 4A4IA 3K0XA 4GLXA 1XNRQ 2M4YA 4WJ3M 2WFWA 3HOXH 4LW1A 1Q82C 3RZOH 2BA0A 1CSPA 4LFCL 4APVA 2VL6A 1NNQA 3CCVA 1N32L 3KF6B 1NMGA 3KYWA 4QQBX 2BA1A 4IFDI 1JJGA 1RB9A 3RN2A 2I0QA 4KLKA 3DM3A 1QVCA 3JC66 4UPAA 4LWCA 1GD7A 2JJQA 3RZ6A 4KHZA 3S1RH 2ZJRA 4HIOA 2XGTA 1E7ZA 1SRUA 4R4CA 3J80i 3I55A 2R93G 4LFCQ 2N3SA 4R4OA 3U4ZA 4A3BG 5JJKA 1L1OC 2ZTCA 5C3EH 1HZCA 3S2HH 1KHIA 3FKIH 4P73A 3TEHB 5AI2A 5GAEC 4JI7Q 4DUYL 1CKMA 3JAMc 1YITA 4L5RC 3BZKA 4AQYL 1J5EL 2KN9A 3J81j 2AMCB 4A3IH 4JI5L 5IYCG 4BY1H 1OXXK 3K80C 1Y1VG 4NXNQ 3S24A 3D31A 1YK5A 2PNHA 2WAQG 4AYBG 5IYDG 1IBKQ 4PMWA 1EYGA 2NVQH 4AR6A 3PO3H 4R1JA 4MZ9A 5JEAG 3AQQA 1RYTA 2N49A 4YHHL 4DUYQ 3I4MG 1J5EQ 5GAHC 1I5FA 1T9HA 2ZTDA 4TQUS 4GNXA 1IL2A 4OO1G 5GADC 4JI5Q 3JC62 2C35B 3D0FA 4O0AA 4A3LH 3GD7A 4B3SL 3MPSA 3KF8B 2Q2HA 4QGUA 3CMEA 1XPRA 4X6AH 1X9NA 1SMMA 3PUVA 1QUQA 3HOZH 5JJIA 4GKKL 3HOWH 2WAQE 4AYBE 5DLQE 5IE8A 1QVGA 1YUXA 5LMNW 2LCQA 1MJCA 4IFDG 1OXUA 5FLMH 4DR3L 1ASZA 4JI2L 2Z6KA 1E1TA 1Q1EA 1QYBA 1YHBA 3LGJA 4DNIA 2LSSA 5AJ3L 3RNUA 2JA5H 3UE1A 1VS0A 4B3SQ 2VQFQ 1FGUA 4IJHA 1PH4A 1S2ZA 1WFQA 1QZHA 2VQEL 5IYBH 4GKKQ 2PI2E 4DUZQ 2B3GA 1KIXA 3PO2H 2JQOA 3STBD 1FHMA 2R7FA 1U5KA 4HJAA 2YTYA 4A3KG 3GTMH 2UXDL 1JYBA 3PUWA 4A3DG 3CC7A 7RXNA 4JBMA 1UE5A 5AJ3Q 3CC2A 1OXSC 1XTDA 1XMQQ 4FDBA 3ICEA 4Y7NH 5IP7H 1ZRPA 2A8VA 1NE3A 1LKMA 2K14A 2YTXA 3H0GG 2IY5B 4YY3L 2VQEQ 4LF6Q 1SR3A 1RWDA 1CKNB 5M3FH 1SFOH 4L5TA 1VQNA 4DV6Q 2VUMH 5EAYA 1D7QA 2UXDQ 2MNAA 5JJLA 4TPUA 2MS3A 1Q8KA 3CPFA 4IPHA 4IOAA 4POFA 3PUXA 2EQSA 1A63A 1C7YA 1YV1A 4JBJA 4DV7L 2I5HA 3EIVA 2CKZB 3CP0A 2HR5A 1L1OA 3NENA 1FHHA 2QGQA 4YY3Q 2E5LL 1XPUA 5K36G 1S30A 1YUZA 1SMXA 2HHHL 2OQKA 2PVEA 3Q8DA 4R4IA 4DV3L 5FJ8G 4A3FH 4YWKA 1EFWA 5M5YH 1Q46A 3BU2A 2IX1A 4HIDA 4A93H 3SS2A 1LUZA 2WB1G 1JMCA 4BY7H 4RXNA 2CFMA 1BRFA 1CSQA 6RXNA 3FHWA 5IT9c 1R0JA 3AFPA 4DV7Q 4IO9A 2ES2A 1KD1C 1Q1BA 2PQAB 2K75A 4DV0L 5HGQA 4K0KL 4DV3Q 3CC4A 4NXMQ 1BBUA 5ELNA 4IPGA 2JA7G 3GTPH 2ZJPA 3CCJA 2KHJA 3CCUA 3RLOA 2QEXA 1KRTA 2ASBA 1PH1A 4EX5A 2H5XA 3S16H 1DGSA 1VQIA 3G4SA 2UUCQ 2WB1E 4DR6L 3G71A 2R92G 2F4VL 2Q2UA 4K0KQ 3CAMA 1JT8A 4JC0A 3F8TA 3KFUA 5LMUQ 4HIKA 1HZBA 2Z6KC 4DK3C 5C4JH 3GTLH 3S1QH 1VQLA 1K9MC 2D0OA 4PZ7A 1XJVA 4AR3A 3UDXA 3NELA 3HFZB 2NN6I 4QY7A 2DUDA 3A5UA 1VQKA 4DR5Q 3KOJA 1WYDA 2R7ZH 4DR6Q 3I2ZA 4OO1I 4A3JH 3U50C 3K81C 2F4VQ 5C4XG 2PYAA 3KLWA 4DR2L 1GKHA 3ULLA 3M3YH 2XTIA 4IJLA 2CWPA 4RMFA 4LF4L 1R9TH 1BVSA 1Z47A 4YWMA 3KYYA 2RHSB 1WCMH 1VQOA 3G48A 2Y0SG 1RDVA 2VS1A 3HOVG 1HNWL 1PH7A 1OTCA 1E24A 1R0HA 2ZTEA 5HY6A 1FL0A 3AFQA 4YCWA 3TREA 3JAMi 1K3RA 4LUZA 3ERSX 3B6YA 1YZ6A 3GDEA 2NVXH 1X3EA 2RHQB 2VW9A 1A8VA 1P8LA 4X62L 3HOXG 2KCMA 1T9QA 3PZAA 3QVDA 3U4VA 1HNWQ 1IU6A 3RYGA 3J81i 4ME3A 3M9BA 2E2IH 2V1CC 1XPOA 4R4TA 2Y0SE 3M4QA 2NZHA 4BBRH 4KHPL 1BQ9A 4P71A 1VQ7A 2KENA 1K8AC 4NPSA 1VQ9A 4TVAB 2LXKA 4GN4B 2HIXA 2PVXA 5C44H 3UDIA 1K0RA 2B63H 5C3EG 5E7NA 1PYBA 3FKIG 1W2BA 1JJCB 3AEVA 3PWFA 2B29A 4BXXH 1GM5A 2I5MX 1YIJA 4A3GH 4C2MH 4AQYQ 4P74A 3EBEA 5GQOA 4A3IG 4IPDA 4P75A 4BY1G 3STBC 2UUAL 3GTQH 3HOUH 1L0WA 2ALYB 1G51A 4GNXB 4A3CH 3PO3G 4JI0L 2NVYH 1HZ9A 3PIPA 3G6EA 2UUBL 2FXQA 4DK6C 1YNXA 2K50A 3E9HA 5JEAJ 3CQZH 1QUQB 3BZCA 5M3MH 4YHHQ 1DX8A 1EUJA 2AKWB 2NVTH 3J80c 1PFSA 4B3ML 4PZ8A 4A3MH 2ID0A 2F52A 4A3LG 1C9OA 3W1BA 3CCEA 1R0FA 4JI0Q 4DR7L 1G6PA 1L2FA 3RN5A 4JI1L 1N33L 5GAGC 3HOZG 3I4OA 2UUBQ 3CCQA 3HOWG 1K73C 3WWVA 1B13A 2MO1A 3CW2C 3W5OA 3HOYH 1S24A 1VQEA 1X56A 1KC8C 4IFDJ 1WOCA 4X64L 5FLMG 1QZGA 1N36L 4JI2Q 4R4QA 4DR3Q 1ASYA 2JA5G 2GVAA 4LF8L 1EQRA 1HR0W 1UE6A 3S14H 2QL0A 3GO5A 3GTJH 3S17H 2GN5A 2AHOB 1N33Q 3I4NH 4WJ4A 3PF5A 2D0PA 5IYBG 1VQ4A 4BA2I 4GN3B 3RLFA 3PO2G 3T1YL 1YJNA 1Y1WH 4PG3A 1YJWA 3PIOA
chains in the Genus database with same CATH superfamily
3SR1A 1S3OA 1H7VA 2JA6H 4LF8Q 2E74C 4LUVA 3FVQA 4K2LA 5GROA 1CHQD 4PNYA 1H9RA 2KA7A 2EXDA 3JC63 4GLVB 4CKEA 2VUMG 1PTOF 4G6BA 2BE5C 4JI3L 2MQHA 5C0XI 1U4LA 5C3EL 2CKCA 3J7AV 3S2HL 3FKIL 1LLRD 1PH3A 4AHXA 1HRJA 1PH6A 5IT9L 1W6KA 4ALPA 1BFYA 4A3IL 4BY1L 4R8IA 3GTPB 2E5LQ 4Y52H 4K5VA 1X6OA 1I3QH 1D1KA 4A3FG 4H02A 4FXGC 4DU9A 1H9SA 3TRZA 1ENAA 2JA8H 1JQYD 2UXCL 2NYDA 4X3KA 1LKOA 1SMUA 1J6QA 2L15A 4X6AL 3PSIA 1HH2P 2HT1A 3J7AF 2OT2A 2Y0SB 1IBMQ 3FMCA 2L12A 2A68D 2F3IA 4B3RL 2WAQP 4AYBP 5FLML 3TN2A 2E2JH 1DCZA 4JVZA 4B3TL 1I50L 4LF7Q 1UWVA 4DAPA 1R9TB 4ZRZA 4PMCA 2X69A 4QJFA 1T5XD 2RF4A 5C0XG 4H44C 2K7VA 1SNMA 5AI3A 2CWAA 3QG1A 4HJ8A 3A5ZB 4J1MA 4LFBQ 2B2YC 3CMAA 1AH9A 3J80E 3S1RB 4Y7NL 5IP7L 2B8FA 4JBKA 1PVOA 1VQPA 1IXRA 3MEFA 4X3TA 1I4GA 1PH5A 3JR7A 2A69C 3H3VI 4K8IA 3TZUA 2R6GA 3RUZA 2F4IA 1ZEQX 4NW2A 3L3OC 1S5CD 5J3BA 2YYZA 2XJQA 3PO3B 1VQAA 4ZAIA 3KLSX 2B63B 2BH8A 1QOHA 2RCNA 4LMQD 2I46A 3OYYA 1R0GA 5M5YL 1GO3E 1PYSB 4HCEA 1EWIA 4DPGA 2HIVA 3KYUA 1LTGD 4A93L 4NXNL 1H9MA 1LTID 2PPTA 4C3JH 1JWSD 1LT6D 4QIWB 5CGKA 3I8ZA 1I6VC 4DV2Q 4RGOS 4LJZC 3F2CA 1PA6A 3MC0B 1B50A 1PLFA 2N78A 2F0DA 1X3QA 2B63G 5E4WC 4G4KA 3DLLA 5JEAH 4AR5A 2NVTB 1T5EA 3S16L 2XJVA 2EY5A 2K1BA 4J15A 3J80L 2KHIA 4CJ0B 1IYUA 3A8JE 3J81c 3T56B 4FXDA 1VQGA 1UE1A 4AHYA 2GVBA 5C4JL 4JI4L 3PL5A 1A15A 2FJ2A 4PZ6A 4IFDH 4Z9CB 1TWGH 3K8AA 4AH6A 2C9OA 5E4XA 2ATWA 1ESFA 3NEMA 1WJVA 2D62A 1Y8NB 1E2ZA 4KY6A 4DUZL 1Y1WB 2DSXA 4HMIA 1WCML 2IHEA 1K83B 4DV1Q 5EKIA 1VQDA 4OL7A 2O5JD 4A3KH 2K03A 5IIFA 1I50H 4A3DH 4BBSB 2OWOA 2EYLA 2DJFC 3CPWA 1PMRA 1KDAA 4XDXA 1NBWA 2KBNA 1Y1WG 3QIAA 2WINB 1VQCA 4HJ7A 4OONA 1AZPA 4ZLTF 3K7AH 2B2UC 4DV5Q 3D4DA 1K8GA 4BBSG 5IP9G 3Q6SA 4K6LA 4A76A 2A68C 4RWSC 1WTWA 3LWUA 5FJ8H 4DR1Q 3NQIA 4JPBW 5CBAE 3C46A 4LNQA 3MWYW 2XJRA 2JYOA 1NJIC 1WTQA 3GTQL 4DA2A 3HOUL 4OELB 5CORA 4L5SA 1VQBA 1SYCA 1MBYA 4JV5L 2TSSA 1N32Q 1P7PA 5M3ML 1IYJB 2IHFA 1N34L 1VQHA 2R92H 1QNKA 4RCOA 1NR4A 3TP6A 3MA2B 1IU5A 3IAYA 4GNXC 1I94Q 3TS2A 3OTOQ 2VY3A 2LS01 1HR0Q 2J7ZA 2EOTA 5JPNC 3D3RA 4DR5L 4RH6A 4POGA 2NB0A 3ITPA 3JAME 1EIYB 3OWFA 4KV6A 1XMOQ 2IT1A 5CBEE 3S14L 3C3LA 4X65Q 2KEEA 5EQ0A 4JYAQ 1TWHH 3OPOA 2E2IB 4L5QA 2ENBA 1TWCH 3S15L 3HG9A 2F0EA 1IROA 5RXNA 4OWTB 4LUOA 1E1OA 2AYJA 1LYLA 1A3VA 1LT3D 4IURA 1XNRQ 1PFVA 1STEA 2QDLA 4A3BB 4E6YA 2F0PA 3LWPB 1CSPA 3FDJA 1TWFB 4K2KA 2F0NA 1I6HB 3KYWA 1TVXA 2MGSA 2AUSB 1RB9A 2EJFC 2PMZP 1QVCA 2H4OA 1SNPA 1PZJD 3T13A 1SAPA 2ZJRA 1E7ZA 4R4CA 1PFYA 4LFCQ 2B2VA 2N3SA 3U4ZA 4A3BG 3TP7A 1RKNA 4NP5A 4P73A 4CHTB 5GAEC 1WVLA 4M8AA 1JWUD 4DUYL 1CKMA 1YITA 1J5EL 3NP8A 2KQ3A 1SNQA 3D4RA 5MLC3 1OXXK 5I9OA 1IYVA 2O5JC 3QO2A 1FNVA 4YHHL 5GAEc 3GTLL 2RA4A 3DWPA 5GAHC 2ZTDA 4TQUS 4JI5Q 3JC62 4O0AA 4JAEA 1RYQA 4A3LH 4B3SL 2NTTA 3KF8B 2ICEC 1XPRA 3CMEA 2OEOA 3I4NB 1HCZA 4HSVA 2WAQE 4AYBE 1QVGA 1YUXA 1IKMA 4UDUC 3A54A 3EFXD 1ASZA 4DR3L 5GAHc 3GTOB 1YHBA 3UE1A 2D5DA 1FGUA 4IJHA 4XYQA 2PI2E 3I72A 4CBVA 3PO2H 2IPKD 2JQOA 2R7FA 1FD7D 4XQQA 1CQFA 1G8ZD 1B2TA 3A7LA 2JN4A 7RXNA 3CC7A 1HXYD 5AJ3Q 4FDBA 2J4XA 2KCCA 1I4XA 1NE3A 2A8VA 3HRZC 1XXGA 2VQEQ 2K5QA 1SR3A 5CMDA 1RWDA 4L5TA 5K2ME 2VUMH 1I3QB 2WB1B 1Q8KA 4IPHA 5JJZA 4IOAA 2EQSA 2QCPX 1C7YA 5MF6A 1DYQA 4DV7L 2JSOA 3A56A 2CKZB 3CP0A 4YY3Q 5IYCL 2E5LL 3TMEA 2Z3RB 2RDFA 4DV3L 4R4IA 5IYDL 4A3FH 3RZDL 2IX1A 3OMGA 4C3IG 2WB1G 1JMCA 3I4ML 6RXNA 5IT9c 2F0GA 4GS7D 3V05A 1TS4A 2E2JB 3E6ZX 1ET6A 5CYUA 5A35A 5ISRA 2K6AA 2RQXA 3CC4A 4NXMQ 5ELNA 3K57A 3GTPH 2ZJPA 3RLOA 2WACA 3K58A 1DGSA 3H6MA 5M5XL 5JVG3 1HZBA 4DK3C 2Z9HA 1VMPA 3GTLH 1VQLA 1K9MC 1XJVA 2KHSA 5C0XH 4EQPA 2IL8A 4QY7A 2DUDA 1VQKA 1SE4A 4ZCKA 5EINC 4AI3A 3KLWA 3HOXB 4ULLA 2XTIA 4IJLA 4RMFA 1X32A 2XRSD 1R9TH 1A2UA 5EBCA 2RHSB 1VQOA 2VS1A 3HOVG 2IW3A 4UY81 2QF7A 1HUMA 4FNFA 1K3RA 5JOBA 2F0QA 2G9HD 3GDEA 3KBGA 1X3EA 2RHQB 3WDNA 3HOXG 4J8QA 4KKUA 4ME5A 1T9QA 1GUNA 1SXTA 3U4VA 3S2HB 3CRKC 2E2DC 5JVH1 5C3XA 2V1CC 1XPOA 3BDOA 4R4TA 3ND8A 3M4QA 2NZHA 3CRLC 4BY1B 4P71A 2KENA 2JI1A 1K8AC 2JI2A 4YIJA 4TVAB 3OMCA 5EJWA 5K5PA 1F77A 1BOSA 1WTVA 3DUZA 5KNDA 4G7ZC 3KBXA 1TQOA 3BVZA 2L5TA 2KOLA 3HKZP 2B63H 5C3EG 3C1FA 1EY9A 3FKIG 3PWFA 1TWGB 3MQKB 2PCFB 1GM5A 1DONA 2MJ8A 4A3IG 4P75A 4X3SA 4BY1G 4MHEA 4FF3A 1G51A 2F3VA 2RFKB 4JI0L 2EE1A 3NTIA 2UUBL 4DK6C 1STAA 4WFN1 2K50A 4A3KB 4FF4A 1GUOA 1QUQB 4A3DB 2AKWB 1I50B 5ELDA 2NVTH 3J80c 4QUFA 1Z92B 2IX3A 3MTSA 1CTMA 3Q23A 5C4XL 1V8QA 2A5HA 1R0FA 1R4QB 5GAGC 3I4OA 3CCQA 4R9WA 1B13A 3NE5B 3CW2C 4K14A 1VQEA 1X56A 5FLMG 2JP1A 1N36L 4Y7NB 4R4QA 1ASYA 2GVAA 5CV4A 3R2TA 1N33Q 1ODHA 3PF5A 4G7OC 1BCPF 5GAGc 1O78A 3QR8A 3RLFA 1Y1WH 1Y8OB 4JI6L 8RXNA 4IALA 1FVIA 4LF9L 1K83H 4DV5L 1JR0D 4BBSH 1KDCA 5IP9H 5IP7G 2H1EA 3RLNA 4DKAC 2ZJQA 4LFAL 3O13A 3KYVA 5D65A 2OF1A 2PMZE 1ILPA 4K9FA 1L1OB 3TS0A 3TDQA 3KLRA 2VXWA 3OOCA 3J7YW 3VYRA 4A93B 1DOMA 2ZXOA 1JE5A 2R7DA 1W3SA 5C5LA 3L9AX 3A44A 2F0KA 3SK6A 5MFZA 2A19A 1STYA 3EJIA 4AIMA 2NVQL 3P1HA 5G3LD 3VYUA 3S16B 4GKJQ 1N32L 2PW5A 1QWYA 1YK4A 3M7NA 3QQCE 4A93G 1KQSA 2JEAI 2EY6A 1G291 1I94L 5C4JB 3OTOL 1H9KA 1CI3M 3HOZL 4TRDA 3HOWL 4RHSA 1KXLA 1TWCB 1Q81C 1JC7A 2K28A 3QOLA 2JA5L 1V43A 1PFMA 3CCRA 1KABA 4OWXB 3M85A 4JYAL 1EOTA 3PCOB 1PDQA 1E22A 2DY7A 1ENCA 1XNRL 1E0BA 4H7BA 1PRTF 5M5WH 2CQOA 4JOIC 1SFOL 1HTPA 1NTGA 1WCMG 5C3WA 3I7FA 4ZK9B 2D2CC 1RDPD 1SLJA 2TMPA 3HKSA 1VZHA 3A8KE 2JEBI 4X62Q 4HJ9A 5I6YA 4A3BH 2WKCA 3NFPI 3SK4A 1VCIA 1JB3A 1VQFA 2EYJA 3D8GA 4YCVA 1TWFH 2E8GA 4DV4Q 1D5XC 5BR8L 1GVPA 1I6HH 4BY7L 3TP5A 4GOPC 3C1EA 4A75A 2XN9C 2K5WA 5KYLA 4UP9A 2L0ZA 3S1MH 4I7AA 4GS3A 2FMMA 1KAWA 3G6JB 1BQQT 2OTJA 3OSOA 1O80A 1D1IA 5DEHA 2UU9Q 4CDDC 1S72A 2UUAQ 2RDGA 1PV4A 3HOUG 5CC4A 1DVBA 1CZWA 4JK1C 1D6EC 2QDBA 3SXHA 2AUJD 2X6LA 3S1QL 3NBHB 3H91A 1AE3A 1NY4A 2Q2TA 5M3MG 3MZ5A 3KF8A 1CAAA 1GJXA 1MIUA 2A74C 4DAYB 3E0EA 1IBLQ 1HHVA 4OGQC 5BN5A 3F2BA 4A3JL 1QILA 5ELFA 2PNRC 1HNZL 4JG2A 3M3YL 2LFNA 1JOQA 4KY5A 3S15B 5FO9B 2E2HH 2KKDA 1J9OA 2VZAA 4RA8A 4FF1A 5FLXE 4X66L 1MJEA 4DNTB 2EZVA 1RIPA 3GTOH 4K5XA 3OW7A 2AQ1B 2NVXL 1EL0A 1VQ5A 4GN5A 4KJOA 3EA6A 1YVCA 4A3FB 1QE6A 3I56A 2A6EC 1LTTD 1SE2A 1HJPA 1EIGA 4BBRL 2ZM6Q 3T16A 2V0FA 5IWAL 2IX0A 4XT3B 1WD1A 1EU3A 1EY8A 2OTLA 5ELOA 1PH8A 3VPBE 3MHBA 3ZG6A 4LF5Q 1CUKA 2OXPA 5C44L 1HFGA 1XNQL 4O2DA 4ZQ3A 1QCVA 3H3VC 4C3IH 1BE7A 3Q22A 2VNUD 2F3WA 2Z8LA 4GOPB 4UP7A 1U4MA 4A3GL 4RHRA 3HKZE 1S40A 4NXML 4L8JA 3KJPA 3GTLB 2K32A 2NVYL 3LWOB 3EROA 5FLXL 1PTOD 3QJYA 5J22A 2PYKA 3CQZL 5M9OA 3UDGA 2YTVA 4OX9Q 2G9DA 4A3ML 2FINB 1A3TA 1SROA 2UXBQ 5IODA 2MO0A 3J7A5 2Q2IA 4G57A 4H13C 2F0TA 1HNXQ 1YEZA 3W1GA 3HOYL 3MXUA 2EDGA 4FYDA 3OW2A 2L0CA 2FMCA 2PW7A 3CCLA 3R93A 2AQ3B 3GTJL 1EYCA 3MFGA 3S17L 1EOVA 4UP8A 5J1ZA 1V1QA 1U4PA 5IY0A 1Q7YC 2ZXRA 1EY5A 1EFID 1N9WA 3ND9A 3HOVH 4JW0A 3L0OA 1G91A 3E9IA 4WJ3M 3HOXH 1CQVA 3NTKA 4K6DA 3BG3A 5LL6X 3R2IA 3CCVA 4RGTA 4IUVA 1JJGA 4XGHA 3RN2A 4KLKA 5KNCA 4LWCA 1B3QA 2WAQB 2XGTA 1SRUA 1UUPA 3DXJC 3I55A 5TSSA 3S2DL 1HA5A 2ZTCA 5C3EH 4FF2A 1HZCA 3S2HH 3FKIH 5AI2A 5LHY1 4L5RC 1LACA 2A6HD 1EYDA 3LX0A 2DY8A 4A3IH 5IYCG 4BY1H 1E2VA 4A3EL 3D31A 5FKAC 1YK5A 2WAQG 4AYBG 5IYDG 1IBKQ 4PMWA 3VR3A 4AR6A 3FRPB 1JORA 5I9PA 2C6BA 3I4MG 1BR9A 1T9HA 1IL2A 5M5XB 1EWCA 3MPSA 1EY7A 1NNXA 3S1NL 2Q2HA 5CV5A 1B53A 4IUTA 4X6AH 1SMMA 3T4AC 1QUQA 2QEJC 4GKKL 3BZDB 5DLQE 2LCQA 4PMBA 3TSSA 1MJCA 1LTBD 1NCVA 5FLMH 2XJTA 1GOZA 3I73A 2LSSA 1EY6A 3M4OL 2VQFQ 2YU9L 1KIXA 3STBD 1FHMA 2N88A 2UXDL 3GTGL 1UE5A 1UNSA 3CC2A 5C4HA 1X3PA 1XTDA 1VQ9A 4ZKCB 4Y7NH 5IP7H 2YTXA 1LKMA 1PTOC 2IY5B 4LF6Q 2R93L 1CKNB 4DV6Q 5EAYA 3PUXA 4AHZA 1NAPA 1YV1A 1PZKD 4JBJA 3EIVA 1TS2A 1XWEA 1L1OA 3NENA 1Y1VL 1HQRD 5IGEA 2OQKA 2PVEA 1ZYRD 5EGTA 5M5YH 1Q46A 4HIDA 3SS2A 1DOKA 4A93H 2MP1A 1R0JA 2ES2A 1D5ZC 2P5ZX 2PQAB 1XYIA 1EY4A 4K0KL 2CR8A 1TWAL 1S5FD 4IPGA 4B9WA 3CCJA 3CCUA 4CJ2C 2QEXA 1KRTA 2H5XA 3S16H 5C4XB 2Q2UA 2B2WC 2EJMA 5M5WB 3DEOA 3F8TA 1W6JA 5LMUQ 4HIKA 3AMUA 1KAAA 5C4JH 5C6AA 1KLGD 3NELA 2NN6I 3A5UA 5J39A 3KOJA 4DR6Q 2F4VQ 2F0FA 1MSGA 2PYAA 1ICWA 4ID6A 5C4XG 2KVMA 4QUCA 1GKHA 3H0GL 2CWPA 1VZIA 1BVSA 1Z47A 2A6HC 3KYYA 3Q24A 1WCMH 4KD4A 1PH7A 1OTCA 4JADA 2ZTEA 4HAEA 3TREA 4LUZA 1PTOB 2VB3X 1YZ6A 4X62L 3S1MB 1PFWA 2KCMA 5JVG1 1EQTA 1IU6A 1HNWQ 3J81i 1L0YB 3SHLA 2BDOA 2Y0SE 3A7AB 3JAML 3H9CA 1BQ9A 1SSOA 1TU2B 2LXKA 5D3IB 2NVQB 1ET9A 3VR5A 3BVGA 2CH4W 4HMJA 1JOKA 4CDEC 2NZ1D 1BXTA 1K0RA 2JA7L 1JJCB 2JXMB 3FPPA 3SEBA 4C2MH 5GQOA 3EBEA 2UUAL 3STBC 3GTQH 3HOUH 1U9RA 3HOZB 4GNXB 3DWAA 1GHJA 1RD9D 4F7XA 3PIPA 2FXQA 3GQBA 2SDFA 2E2HB 2EY2A 5M3MH 5JEAJ 1A3UA 2JA5B 1STBA 4C1NI 2M4VA 1PFSA 4HEDA 4PZ8A 4OEMB 1QNUA 3GTKL 4DXGA 2PMZB 4BS9A 3BDCA 3NBHA 3W1BA 1DM0B 4CKBA 3HOZG 3P2AA 4KKTA 3HOWG 1WTHA 2DN8A 4C3HL 2MO1A 4DAYA 1Q8IA 3WOFA 4XXEA 3CKIB 5KYIA 1KC8C 4IFDJ 5IGDA 2CQAA 4JI2Q 1ZYRC 4EQOA 2PPBC 3PKIA 2JA5G 4LF8L 1HR0W 4O42A 5EPJA 1UE6A 3S14H 2QL0A 3GO5A 3WWNB 2GN5A 1SFOB 3RZOL 4GN3B 1YJNA 1YJWA 1KLUD 2KJXA 4C3IB 4NDXA 4X64Q 3S15H 2JK8A 2L1BA 3NHHA 1BUVT 4JOIA 2ZM6L 1N8RC 3L7ZC 3U58A 3S1RL 3VYSA 1JB7A 4LF5L 2QKIC 3K5OA 4TVMA 1AP0A 2K01A 3AYHB 4V0BA 2H12A 4LHLA 3LNNA 1VQMA 3C2PA 1B9NA 3F2UA 4XQNA 1UAPA 3U9OA 3PO3L 1EQQA 2HHHQ 2Z6BA 4GOPA 1R0IA 1ILQA 1LKPA 2HQLA 4NB3A 3H97A 1KRSA 1LTLA 1CHPD 3D6WA 2NYZD 5IGFA 1IBML 4BY7G 1SNOA 5NUCA 1DZ1A 2PZUA 2PZTA 1ESRA 3BJUA 4LF7L 4JAGA 2F0UA 3V96A 4DV0Q 1S4ZA 1U4RA 2HD3A 3S1QB 1SE8A 3AU7A 4EVOA 2GA4B 3DMUA 3MVVA 1PHJA 5FLXc 3HOVB 3RZTA 3TBIB 4FXKC 2IWHA 1G6ZA 1BBWA 4LFBL 1LABA 5ELEA 1SEBD 2N8NA 4P72A 5ELCA 1BNZA 1NSNS 1G2SA 2KECA 3DEPA 1QVFA 1OWBA 5IYBL 2LXJA 2PZWA 1LV9A 4B3RQ 2OCEA 3GTML 3PUYA 1VZGA 1OO9B 4A3JG 1GUSA 2NVXB 1IW7D 2YV5A 1B7YB 1T9OA 4IQZA 4DR2Q 3H94A 5FK9C 4X3UA 1F2ZA 4LF4Q 3CF5A 5M3FL 1DXMA 5C3EB 1CZGA 1C0AA 3FKIB 4BWGB 5H1SE 1ML0D 1STGA 3X3MA 2Z0SA 4RGMA 4A3IB 1JWMD 4XQJA 2HDLA 2HCIA 3W2DA 4DV2L 1Y14B 3I4LA 1IRNA 1X55A 4B8CD 4NKLA 4A3GB 2NZOA 2XJSA 1PFNA 4BBRG 4KHPQ 4ZKBB 3M4PA 4KD3A 5IYCH 5FO7B 1A62A 2NBFA 2NVYB 3NTHA 3MAQA 1IBKL 1HQMC 1IZ6A 5IYDH 5C44G 2XWJB 3RZDH 3MXNB 1Q86C 3I3CA 3H3VH 1KNEA 2PI2A 3FEWX 3I4MH 1B9MA 3VA5A 4A3GG 1LTAD 4YCUA 3EVQA 5EPLA 1B2JA 3LWRB 4L6TB 4LK1C 1BF4A 3CCMA 3K7UC 2F03A 3HOYB 3TP8A 4DK1A 2F0VA 1SNDA 4DV1L 2DNCA 2R7ZL 3VR2A 1K28A 3M4YA 4A3MG 3GTJB 5M5XH 2VQFL 1B70B 2BDNA 2XWBB 4IUUA 1PZID 1SYFA 3MSUA 4JI4Q 3H9BA 2WV6D 1QCBD 2B2YA 3HOYG 2OQ0A 1SJHD 2K2DA 3BYYB 3ULPA 1YHAA 3BDLA 2L4NA 1M90C 5T1GA 3KDFB 4LF6L 2V0EA 4DV6L 2DJGC 4HSPA 4L63B 1SDFA 4GLAC 5C4ZA 3T1YQ 4DR1L 5M5YB 1PH9A 2E2IL 1F2LA 1TS5A 3HKZG 2V3BB 4KK7A 1CKNA 2MHVA 3NUCA 1PZXA 4DR4Q 4KN7C 3S2DB 3T1HQ 1RTNA 1TY0A 2K52A 1FNUA 2K5VA 3WOEA 1BCPD 1NR2A 1YJ9A 3PUZA 5CV7A 3URYA 1ONLA 4BXXL 2IJ0A 5KEEA 4A3EB 3SVMA 2Q8IB 5LMNQ 1YI2A 2A6ED 4A3CL 4Q5VA 1IW7C 1HR0L 2AWNA 2PQAA 1C4QA 3J7ZC 2KCTA 1MGSA 3UI2A 3LWQB 4XXBB 1STHA 1SYBA 1YBYA 1VQ8A 3S1NB 1X3GA 2K5NA 1U0LA 4EQ5A 1XMOL 4A3EG 1O7IA 1OXVA 2KEDA 1JCKB 1F9SA 5LMUL 1AW7A 1B4OA 1D5MC 2VB2X 5I2YA 4X65L 4JV5Q 3KYXA 1WCMB 1CFMA 2LKVA 4TKOB 5FOBB 1VMCA 2RDHA 2YU9B 3A74A 1N34Q 2PQEA 5C4XH 1AE2A 3H15A 4AI0A 4ILWA 1BDOA 1M1KC 1NUCA 1TKWB 3I4NL 4QB4A 2LY7A 4H0LC 4QL5A 2PSMC 3A55A 1H95A 3QB3A 5C0XJ 2XJUA 4HIMA 5IGBA 4JI8Q 2ICIA 2MUYA 2JA9A 4A4IA 2JA6L 2WP8J 4OO1I 4KN4C 1TIID 2FHTA 4LFCL 1MD2D 4APVA 2AUKA 2VL6A 2B2UA 3SE0A 3KF6B 4N8X1 1NMGA 3V2TA 4QQBX 3U9SA 5COYA 3P8BA 3DM3A 4C2MB 4UPAA 4S3SA 4PQXA 3GTQB 3LPEB 4HIOA 3HOUB 1PTOH 3J80i 2R93G 4AI2A 3ONAB 4DNRB 1PRTD 4Y52L 1I3QL 1KHIA 1PYWD 4JI7Q 5M3MB 3JAMc 2EYOA 3SDZA 5E3FA 1IKLA 2KN9A 2SEBD 1K3BC 4JI5L 2NWGA 4U68A 3K80C 1Y1VG 3D4WA 1LTSD 1G2TA 2JA8L 2PNHA 2NVQH 1EZ8A 1B44D 5DNFA 3AQQA 4DUYQ 3H3VM 1J5EQ 3VYTA 4GNXA 1B1ZA 4OO1G 3B0AB 3D0FA 1PFUA 2E2JL 3GV6A 3S14B 1GUGA 1S5BD 1SE3A 3A8IE 4DF7A 3PUVA 3RMHA 3HOZH 3BS1A 3HOWH 2EY1A 2RVLA 5LMNW 2K5DA 3P20A 1OXUA 5L37A 4JI2L 3GP7A 1Q1EA 1AEXA 3LGJA 5AJ3L 2JA5H 4B3SQ 3RNUA 1VS0A 2HQEA 1PH4A 1BCPC 3OIQA 4V196 3PIP1 3E5SA 1WFQA 1QZHA 2VQEL 1B3AA 3PQIA 4CDFC 1WTOA 1DD2A 2B3GA 1I4RA 2B8GA 1U5KA 4HJAA 1WTXA 1PFBA 1JYBA 3PUWA 4JBMA 1OXSC 2M00A 1XMQQ 3ICEA 3D6CA 1R4PB 2B39A 2K14A 5CV9A 3H0GG 4YY3L 1SFOH 2Y0SP 4KTAA 4ODGA 5JJLA 4TPUA 2MS3A 1EQVA 4POFA 4IUPA 1A63A 4G7HC 2I5HA 2R3ZA 4ABNA 2HR5A 1FHHA 4C3JL 2L9HA 1XPUA 2JA7B 1S30A 5K36G 1YUZA 1SMXA 1YNJD 2HHHL 1EFWA 2N55A 1F2MA 2XJPA 4U673 4BY7H 2CFMA 3FHWA 1CSQA 4DV7Q 1FJGQ 3AFPA 1KD1C 3T53B 4DV0L 5JPMC 4DV3Q 2JA7G 3N52A 2RBMA 4MTKA 4E6IA 2ASBA 1VQIA 4F88A 3GTKB 1TWGL 2UUCQ 4GZYC 5IGGA 2RSNA 3NXWA 3G71A 2BCOA 3CAMA 1JT8A 4JC0A 2NTSA 4OIJA 4KMUC 4C3HB 2SNMA 3KFUA 1CM9A 1D2BA 4N8FA 2HCCA 2Z6KC 3HJYB 3S1QH 4XYOA 5I6WA 4PZ7A 3UDXA 1V1OA 2F0OA 4LAAA 5KRUA 4A3KL 1WYDA 4QIWP 4A3DL 1PRTC 2B2TC 4DN4M 4A3JH 1BCPB 3K81C 3U50C 3T51B 4DR2L 3NPPA 1LTRD 2PO4A 3RZOB 5HGTA 3M3YH 2F0LA 4LF4L 5I4DA 4C3HG 4YWMA 3HAXC 4ZN3B 1RDVA 2Y0SG 5F2DA 1WTPA 5HY6A 3MXPA 1FL0A 3AFQA 4YCWA 3K7AL 3JAMi 4ZN1B 3ERSX 3B6YA 2NVXH 3R3OA 3IU3I 3WWLA 3EQLC 4AYBB 2SOBA 3RZDB 3RYGA 4ME3A 5FJ8L 3M9BA 3I4MB 4BBRH 4KHPL 5DM71 1VQ7A 2QW7A 4C1NK 4V190 2J0TD 1KTKA 4ZUJA 1K0SA 3PIP3 2HIXA 2PVXA 4OHJA 5C44H 2EXZA 2O5IC 4O1NA 1XTCD 1PYBA 2O4XA 3P75A 2B29A 2M9VA 2ERJA 4A3GH 2I5MX 3ZYYX 4AQYQ 3OHXC 1VF5C 4IPDA 1GXDC 3MXNA 2R92L 2F0IA 4RKLA 1L0WA 2ALYB 2F0JA 1C48A 3PO3G 1ZKOA 2NVYH 3MXGA 4IZ8A 1HZ9A 3E9HA 2HDMA 2K04A 3CQZH 3BZCA 1DX8A 1EUJA 1I4HA 1RHPA 3KUPA 4DGZA 2SNSA 4A3MH 2ID0A 2F52A 4N9PA 1C9OA 4JI0Q 1G6PA 2C5CA 3RN5A 1N33L 2UUBQ 3GTMB 1K73C 3W5OA 5H1Sc 3HOYH 1TWHL 1PRTB 1WOCA 1HFNA 3PMFA 1TWCL 1YNJC 3E0JA 4B08A 2DNEA 4CDCC 3CHBD 1MHWC 5KNBA 1WTRA 3GTJH 3S17H 5M3FB 2AHOB 1SJED 2D0PA 5IYBG 1VQ4A 4BA2I 1O7YA 3T1YL 3MFYA 3K35A 1B71A 1RDGA 2BH2A 3KDFA 1N36Q 4DR4L 3LWEA 1F4LA 3T1HL 3VA7A 2NUCA 3PF4A 1MKHA 1SYDA 3BVMA 5M3FG 3KLSA 1Y69U 4JI6Q 1TY2A 2A73B 4IPCA 5EIOC 4HN7A 4LF9Q 1VQJA 4GKJL 4HR7B 1D8LA 2DGYA 1B2OA 2G5DA 3F2DA 3SGIA 3IRBA 3UE0A 5LMNL 1X65A 2Z4HA 4DXFA 4LFAQ 3S2DH 3CD6A 1B8AA 2EPBA 2ZXPA 1LT5D 5DM61 1UE7A 3KJOA 1VF7A 1T9PA 3NBIA 3EN2A 3ULJA 1GUTA 3G7LA 4JAFA 1GHKA 2M2LA 4F8MA 4A3EH 3HJWB 2JI3A 4A3LL 2I07B 2M6PA 5C5MA 2AQCA 5KGUA 1FGBD 3NWTA 4M1UB 3QWNA 4JBWA 3IL8A 2B5ID 2R7ZB 1J8IA 1AFPA 2WKDA 5DM73 3S1NH 4YWLA 2K5HA 5JAVA 3TQYA 3HZXA 2RKSA 3X3NA 5E1FA 1RTOA 3PO2L 2EIFA 1HZAA 4JI8L 1JJ2A 2XVSA 1YHQA 2R7ZG 1HA6A 3M4OH 4AI1A 2YU9H 3FP9A 2CVRA 2R61A 3K0YA 1YNND 1VQ6A 2A1AA 1Q3LA 1II3A 1X3FA 4QMGA 1CA5A 2ERSA 2VUML 1BBXC 1EIFA 1V1PB 1NXGA 3GTGH 4DV4L 4J6HA 1CKOA 2JE6I 1BQ8A 2L11A 1VCXA 4IN3A 1XX8A 3KF6A 2R93H 1WJJA 3K5LA 4KKSA 4WRDA 1QQTA 3H99A 4XTCS 1Y8PB 3HP3A 4JI7L 4A3FL 3F1ZA 4KY7A 4RKBA 5I2XA 2NN6G 3K6OA 1HTLD 3ER0A 1UEBA 3PGZA 1CADA 1KDBA 2UU9L 3IFTA 1Q90A 1Y1VH 4P2CB 3CU7A 4NMZA 4I65A 3HOWB 3IKJA 3GTPL 3VR6A 1NMFA 5BR8Q 2WIIB 1JICA 4BXXG 4MNOA 2EVBA 5HURA 4OO1H 1RODA 2KCNA 1E8JA 4WORA 2I5LX 1IBLL 4MTNA 3HS0C 2RDVA 1TWAH 1X54A 4A3CG 5A2QE 3CCSA 2WB1P 4AR4A 1ZXTA 3CXCA 1V9PA 2V4DA 2F0SA 5CR3A 4UY8C 4KJNA 1FR3A 2RSOA 3ZJYC 2AWOA 1K8OA 4B3MQ 5CV6A 1C8CA 1CT1D 2ZT9C 4DK0A 1EU4A 4DR7Q 3DHQA 3AB9A 4JI1Q 1C09A 4QIWE 1R9TL 5EKLA 3L2PA 1SMWA 2Z3QB 5DM63 2JA6B 4ZUIA 3RR5A 2RCFA 1NXEA 1XMQL 4OWWB 1IL8A 3H0GH 1HNZQ 1KL9A 3E3XA 3I4NG 4F87A 4K5WA 1E3PA 1A0IA 3KYHC 1K8MA 4X66Q 4EQNA 1EIHA 4BY7B 1SN8A 2JA6G 5AN9H 3Q0AA 5ELBA 1WI5A 5MFPA 3KK7A 1MSHA 2LMCB 5A2QL 5K36H 1Z9FA 1TXYA 4OXPA 4JI3Q 5AFWA 2B63L 1FJGL 1IHZA 2Q8TA 2AQ2B 1LM0A 4C56C 5BN3A 4IUQA 5IWAQ 3PV0A 2JA8B 2K4KA 1RL2A 4LHNA 3PIO1 4OX9L 2MPMA 1H9SB 3QOJA 4KI0A 1XNQQ 1A2TA 4BA1I 2JA7H 2UXBL 3K5NA 2QA4A 1BKBA 1Q12A 4XIGS 1YNNC 1HNXL 4FVMA 3VDYA 2MFIA 1SMYD 2UUCL 2K33A 1PH2A 4A3JB 2NVTL 2EYFA 2JA8G 2UXCQ 3M3YB 3PKJA 4R8NA 5IGCA 3FDTA 5D3DA 4IUNA 3NK9A 3GTKH 3I90A 1RCVD 4DAMA 3BYTB 4OIKA 4B3TQ 1OXTA 1Z7TA 1AZQA 2CCZA 4RG1A 2HVYC 1ICFB 3J81E 1TS3A 2XNAC 3H09A 4C3HH 1OWCA 2GMGA 5IOCA 1Y1WL 2CW0D 4HCSA 3UDFA 4HJ5A 1P16A 4K8JA 3A0JA 4BBRB 4IOCA 4JCVE 4CJ1B 1K83L 4GLXA 1EEFD 2F0MA 3K0XA 2M4YA 4BBSL 5IP9L 2WFWA 4LW1A 1Q82C 3RZOH 2BA0A 1EYAA 5C44B 1NNQA 2F1MA 3HEJA 4Q0FA 3NWSA 1EZ6A 2K05A 2BA1A 4IFDI 4B9XA 4HTHA 2I0QA 1O7ZA 1STNA 3GV3A 3JC66 4C3JB 1M4VA 1GD7A 2JJQA 3RZ6A 4KHZA 3S1RH 5D14A 2KUMA 2E75C 4R4OA 5JJKA 3FPUB 1L1OC 1S5DD 4QCLA 1BO0A 3TEHB 4FP5D 1RF2D 1I4QA 3CQZB 1SYEA 3BZKA 4CGYB 4AQYL 3LWVB 1SNCA 3J81j 2AMCB 4KHVA 4A3MB 4NXNQ 4C3JG 3S24A 3W3AA 3J81L 1EYGA 3PO3H 4I7ZC 4UHVA 4R1JA 2ZIXA 4MZ9A 4ZYSA 5MGNA 1KNAA 1O7LA 5JEAG 1RYTA 1SYGA 1H9JA 1QJOA 2N49A 1I5FA 1HUNA 5GADC 2C35B 3GD7A 3P7JA 3S17B 3B08B 4QGUA 1X9NA 5BN4A 5JJIA 1HPCA 3NSWA 5IE8A 2EYPA 1QG7A 3K5MA 4IFDG 2XIWA 2Q8RE 3SK8A 2Z6KA 1E1TA 1QYBA 3HKZB 4DNIA 5GADc 2Z1CA 1CA6A 2M6OA 3PIO3 1S2ZA 3NQTA 5M5WL 2Z4IA 5IYBH 4GKKQ 4DUZQ 2B2TA 2BOSA 3N6RA 1TT2A 3RD4A 5FO8B 3GTMH 2YTYA 4A3KG 3K7AB 2FFKB 4MN3A 4A3DG 1E2WA 2APOB 3R8BA 2F0HA 2EYHA 4FO2A 1ZRPA 3VR4A 3J7Y1 2CHBD 4MIUA 5G3LF 1SMYC 3DM1A 5M3FH 4RFBA 1VQNA 3IFDA 4A3BL 2J9UB 1D7QA 2UXDQ 2MNAA 1F9RA 3CPFA 5EPKA 1TWFL 1JE4A 2B2VC 1I6HL 1AN8A 1DOLA 1ENFA 3S9WA 2QGQA 3OWEB 1FYCA 3S1ML 1RJTA 3Q8DA 1I4PA 2EY4E 5CV8A 5FJ8G 4YWKA 3BU2A 1LUZA 4EGVA 4RXNA 1BRFA 1SBBB 3MEHA 2R92B 4IO9A 1Q1BA 1QB5D 1WD0A 2K75A 1DJRD 1UEAB 2E76C 5HGQA 2CW0C 1EEID 1BBUA 2KHJA 2CKAA 1PH1A 4EX5A 3G4SA 2XSCA 2WB1E 4DR6L 2BE5D 3M4OB 2R92G 2F4VL 1VDZA 4K0KQ 4RGNA 2F0WA 1TWHB 5JVH3 2D0OA 2O2LD 4AR3A 1L0XB 3HFZB 1LO5D 4DAVA 2EJGC 3GTGB 2E2HL 2R7ZH 4DR5Q 4U671 3I2ZA 1F9PA 1MI2A 5EKKA 3GTOL 2CH4A 3ULLA 2R93B 3M7GA 3G48A 1HNWL 1E24A 1R0HA 2X6GA 1GUWA 1EY0A 5KIXA 1Y1VB 1F9QA 1V1PA 1A8VA 1P8LA 2VW9A 1S5ED 5DAUA 3PZAA 3QVDA 4XT1B 4DFAA 4WFN3 2E2IH 2XRQD 4C3IL 2NN6H 3DWQA 4QF4A 4NPSA 3ERQA 4GN4B 1TWAB 1TR5A 3UDIA 1M8AA 5E7NA 3I91A 4AHWA 1W2BA 4CKCA 3AEVA 4BXXH 3I70A 1JOOA 1YIJA 2A69D 4P74A 3K59A 1PXUA 1FNWA 4C2M1 2L55A 4A3CH 1CK1A 2HUGA 3G6EA 1YNXA 5LL6S 2B2WA 1Z6HA 4YHHQ 4B3ML 5IT9E 1EWHA 4A3LG 2EYMA 3H0GB 3CCEA 4DR7L 3PO2B 1L2FA 1A6XA 4JI1L 4UAIA 4RCNA 2D9UA 5EBDA 4TSSA 3WWVA 2QILA 1S24A 4WJWA 3HOVL 4X64L 1F2YA 3LNLA 1LT4D 1QZGA 3J7Z1 3HGBA 4PV1C 4DR3Q 5T1IA 1EQRA 4N9TA 4RAUC 2C6AA 3I4NH 4WJ4A 2VUMB 3OIPA 3HOXL 3SK5A 3TZDA 3PO2G 4PG3A 3PIOA
chains in the Genus database with same CATH topology
1S3OA 1H7VA 2JA6H 4LF8Q 4LUVA 5GROA 2EXDA 3JC63 4GLVB 2VUMG 4G6BA 4JI3L 2MQHA 5C0XI 2CKCA 1PH3A 4AHXA 1PH6A 4ALPA 1BFYA 2E5LQ 4Y52H 1X6OA 1I3QH 4A3FG 4H02A 3TRZA 2JA8H 2UXCL 2NYDA 1LKOA 1SMUA 1J6QA 2L15A 3PSIA 1HH2P 2HT1A 1IBMQ 2A68D 2F3IA 4B3RL 2E2JH 4B3TL 4LF7Q 1UWVA 4QJFA 2RF4A 5C0XG 5AI3A 2CWAA 4HJ8A 3A5ZB 4LFBQ 3CMAA 1AH9A 4JBKA 1PVOA 1VQPA 1IXRA 3MEFA 1PH5A 3H3VI 2R6GA 5J3BA 2YYZA 2XJQA 1VQAA 2BH8A 2RCNA 3OYYA 1R0GA 1GO3E 1PYSB 1EWIA 4DPGA 2HIVA 3KYUA 4NXNL 2PPTA 4C3JH 4DV2Q 3F2CA 1PA6A 2N78A 2B63G 3DLLA 4AR5A 2XJVA 4J15A 2KHIA 3J81c 1VQGA 1UE1A 4AHYA 2GVBA 4JI4L 4PZ6A 1TWGH 3K8AA 4AH6A 2ATWA 3NEMA 1WJVA 2D62A 4DUZL 2DSXA 2IHEA 4A3KH 4DV1Q 1VQDA 2O5JD 4A3DH 1I50H 2OWOA 3CPWA 1NBWA 2KBNA 1Y1WG 1VQCA 4HJ7A 4OONA 3K7AH 4DV5Q 4BBSG 1K8GA 5IP9G 4A76A 5FJ8H 4DR1Q 4LNQA 2XJRA 1NJIC 4L5SA 1VQBA 4JV5L 1N32Q 1IYJB 2IHFA 1N34L 1VQHA 2R92H 1IU5A 4GNXC 1I94Q 3TS2A 3OTOQ 2VY3A 1HR0Q 4DR5L 4POGA 1EIYB 1XMOQ 2IT1A 4X65Q 4JYAQ 1TWHH 4L5QA 1TWCH 1IROA 5RXNA 4OWTB 4LUOA 1LYLA 1E1OA 2AYJA 1XNRQ 4E6YA 1CSPA 3KYWA 1RB9A 1QVCA 2ZJRA 1E7ZA 4R4CA 4LFCQ 2N3SA 3U4ZA 4A3BG 4P73A 5GAEC 4DUYL 1CKMA 1YITA 1J5EL 5MLC3 1OXXK 4YHHL 5GAEc 5GAHC 2ZTDA 4TQUS 4JI5Q 3JC62 4O0AA 4JAEA 1RYQA 4A3LH 4B3SL 3KF8B 1XPRA 3CMEA 2WAQE 4AYBE 1QVGA 1YUXA 1ASZA 4DR3L 5GAHc 1YHBA 3UE1A 1FGUA 4IJHA 2PI2E 3PO2H 2JQOA 2R7FA 3CC7A 7RXNA 5AJ3Q 4FDBA 2A8VA 1NE3A 2VQEQ 1SR3A 1RWDA 4L5TA 5K2ME 2VUMH 1Q8KA 4IPHA 4IOAA 2EQSA 1C7YA 5MF6A 4DV7L 2CKZB 3CP0A 4YY3Q 2E5LL 2Z3RB 4DV3L 4R4IA 4A3FH 2IX1A 2WB1G 1JMCA 6RXNA 5IT9c 4GS7D 4NXMQ 3CC4A 5ELNA 3GTPH 2ZJPA 3RLOA 1DGSA 1HZBA 4DK3C 3GTLH 1VQLA 1K9MC 1XJVA 4QY7A 2DUDA 1VQKA 5EINC 4AI3A 3KLWA 2XTIA 4IJLA 4RMFA 1R9TH 2RHSB 1VQOA 2VS1A 3HOVG 4UY81 1K3RA 3GDEA 1X3EA 2RHQB 3HOXG 1T9QA 3U4VA 5JVH1 2V1CC 1XPOA 4R4TA 3M4QA 2NZHA 4P71A 2KENA 2JI1A 1K8AC 2JI2A 1VQ9A 4TVAB 2B63H 5C3EG 3FKIG 3PWFA 1GM5A 4A3IG 4P75A 4BY1G 1G51A 4JI0L 2UUBL 4DK6C 4WFN1 2K50A 1QUQB 2AKWB 2NVTH 3J80c 1Z92B 1R0FA 5GAGC 3I4OA 3CCQA 1B13A 3CW2C 1VQEA 1X56A 5FLMG 1N36L 4R4QA 1ASYA 2GVAA 1N33Q 1ODHA 3PF5A 5GAGc 3RLFA 1Y1WH 4JI6L 8RXNA 1FVIA 4LF9L 1K83H 4DV5L 4BBSH 5IP7G 5IP9H 3RLNA 4DKAC 2ZJQA 4LFAL 3KYVA 2PMZE 4K9FA 1L1OB 3TS0A 1JE5A 2R7DA 1W3SA 3A44A 5MFZA 2A19A 4AIMA 4GKJQ 1N32L 3M7NA 1YK4A 3QQCE 4A93G 1KQSA 2JEAI 1G291 1I94L 3OTOL 1KXLA 1Q81C 1V43A 3CCRA 4OWXB 3M85A 4JYAL 3PCOB 1E22A 1XNRL 5M5WH 2CQOA 4JOIC 1NTGA 1WCMG 3I7FA 1SLJA 3HKSA 1VZHA 4HJ9A 2JEBI 4X62Q 4A3BH 3NFPI 1VCIA 1VQFA 4YCVA 1TWFH 2E8GA 4DV4Q 5BR8L 1GVPA 1I6HH 4GOPC 4A75A 4UP9A 2L0ZA 3S1MH 4GS3A 1KAWA 2OTJA 2UU9Q 1S72A 2UUAQ 1PV4A 3HOUG 1DVBA 3NBHB 1AE3A 1NY4A 2Q2TA 5M3MG 1CAAA 1MIUA 4DAYB 3E0EA 1IBLQ 3F2BA 1HNZL 4JG2A 2E2HH 2KKDA 2VZAA 4X66L 1MJEA 1RIPA 3GTOH 1VQ5A 4GN5A 1YVCA 3I56A 1HJPA 2ZM6Q 2V0FA 5IWAL 2IX0A 2OTLA 5ELOA 1PH8A 3VPBE 3ZG6A 4LF5Q 1CUKA 1XNQL 4O2DA 1QCVA 4C3IH 1BE7A 2VNUD 4GOPB 4UP7A 3HKZE 1S40A 4NXML 3KJPA 3UDGA 2YTVA 4OX9Q 1SROA 2UXBQ 2MO0A 3J7A5 2Q2IA 1HNXQ 1YEZA 3W1GA 3OW2A 3CCLA 4UP8A 1EOVA 1V1QA 5IY0A 1Q7YC 1N9WA 3HOVH 3L0OA 3E9IA 4WJ3M 3HOXH 3CCVA 1JJGA 4XGHA 3RN2A 4KLKA 4LWCA 2XGTA 1SRUA 3I55A 2ZTCA 5C3EH 1HZCA 3S2HH 3FKIH 5AI2A 4L5RC 2A6HD 4A3IH 5IYCG 4BY1H 3D31A 1YK5A 2WAQG 4AYBG 5IYDG 1IBKQ 4PMWA 4AR6A 2C6BA 3I4MG 1T9HA 1IL2A 3MPSA 2Q2HA 4X6AH 1SMMA 1QUQA 4GKKL 5DLQE 2LCQA 1MJCA 5FLMH 2XJTA 2LSSA 2VQFQ 1KIXA 3STBD 1FHMA 2UXDL 1UE5A 3CC2A 1XTDA 4Y7NH 5IP7H 2YTXA 1LKMA 2IY5B 4LF6Q 1CKNB 4DV6Q 5EAYA 3PUXA 4AHZA 1YV1A 4JBJA 3EIVA 1L1OA 3NENA 2OQKA 2PVEA 5M5YH 1Q46A 4HIDA 3SS2A 4A93H 1R0JA 2ES2A 2PQAB 4K0KL 2CR8A 4IPGA 3CCJA 3CCUA 2QEXA 1KRTA 2H5XA 3S16H 2Q2UA 3F8TA 5LMUQ 4HIKA 5C4JH 3NELA 2NN6I 3A5UA 3KOJA 4DR6Q 2F4VQ 5C4XG 2PYAA 1GKHA 2CWPA 1VZIA 1BVSA 1Z47A 3KYYA 1WCMH 1PH7A 1OTCA 4JADA 2ZTEA 3TREA 4LUZA 1YZ6A 4X62L 2KCMA 5JVG1 1HNWQ 1IU6A 3J81i 2Y0SE 1BQ9A 2LXKA 1K0RA 1JJCB 4C2MH 5GQOA 3EBEA 2UUAL 3STBC 3GTQH 3HOUH 4GNXB 3PIPA 2FXQA 5M3MH 5JEAJ 2M4VA 1PFSA 4PZ8A 3W1BA 3HOZG 3P2AA 3HOWG 2MO1A 1KC8C 4IFDJ 4JI2Q 3PKIA 2JA5G 4LF8L 1HR0W 1UE6A 3S14H 2QL0A 3GO5A 3WWNB 2GN5A 4GN3B 1YJNA 1YJWA 3S15H 4X64Q 2JK8A 4JOIA 2ZM6L 1N8RC 3L7ZC 3U58A 1JB7A 4LF5L 4TVMA 3AYHB 2H12A 4LHLA 1VQMA 1EQQA 2HHHQ 4GOPA 1R0IA 1LKPA 2HQLA 4NB3A 1KRSA 1LTLA 1IBML 4BY7G 3BJUA 4LF7L 4JAGA 4DV0Q 1SE8A 1PHJA 5FLXc 3RZTA 1BBWA 4LFBL 2N8NA 4P72A 1QVFA 1OWBA 2LXJA 4B3RQ 2OCEA 3PUYA 1VZGA 4A3JG 1IW7D 2YV5A 1B7YB 1T9OA 4DR2Q 4LF4Q 3CF5A 1C0AA 5H1SE 2Z0SA 4DV2L 1Y14B 1IRNA 1X55A 4B8CD 2NZOA 2XJSA 4BBRG 4KHPQ 3M4PA 5IYCH 1A62A 1IBKL 1IZ6A 5IYDH 5C44G 3RZDH 3MXNB 1Q86C 3H3VH 2PI2A 3I4MH 4A3GG 4YCUA 1B2JA 3CCMA 3K7UC 4DV1L 4A3MG 5M5XH 2VQFL 1B70B 3MSUA 4JI4Q 3HOYG 2OQ0A 2K2DA 3ULPA 1YHAA 1M90C 3KDFB 4LF6L 2V0EA 4DV6L 4GLAC 3T1YQ 4DR1L 1PH9A 3HKZG 2V3BB 1CKNA 4DR4Q 3T1HQ 2K52A 2K5VA 1YJ9A 3PUZA 5LMNQ 1YI2A 2A6ED 1HR0L 2AWNA 2PQAA 3J7ZC 2KCTA 4XXBB 1YBYA 1VQ8A 1X3GA 2K5NA 1U0LA 4EQ5A 1XMOL 4A3EG 1O7IA 1OXVA 5LMUL 4X65L 4JV5Q 3KYXA 3A74A 1N34Q 5C4XH 1AE2A 3H15A 4AI0A 1M1KC 4QL5A 2PSMC 1H95A 5C0XJ 2XJUA 4HIMA 4JI8Q 2JA9A 4A4IA 2WP8J 4OO1I 4LFCL 4APVA 2VL6A 3KF6B 1NMGA 4QQBX 3P8BA 3DM3A 4UPAA 3LPEB 4HIOA 3J80i 2R93G 4AI2A 1KHIA 4JI7Q 3JAMc 2KN9A 4JI5L 3K80C 1Y1VG 2PNHA 2NVQH 3AQQA 4DUYQ 1J5EQ 4GNXA 4OO1G 3B0AB 3D0FA 3PUVA 3HOZH 3HOWH 5LMNW 1OXUA 4JI2L 1Q1EA 3LGJA 5AJ3L 2JA5H 4B3SQ 3RNUA 1VS0A 1PH4A 4V196 3PIP1 1WFQA 1QZHA 2VQEL 2B3GA 1U5KA 4HJAA 1JYBA 3PUWA 4JBMA 1OXSC 1XMQQ 3ICEA 2K14A 3H0GG 4YY3L 1SFOH 5JJLA 4TPUA 2MS3A 4POFA 1A63A 2I5HA 2HR5A 1FHHA 1XPUA 5K36G 1S30A 1YUZA 1SMXA 2HHHL 1EFWA 2XJPA 4BY7H 1FJGQ 2CFMA 1CSQA 3FHWA 4DV7Q 3AFPA 1KD1C 4DV0L 4DV3Q 2JA7G 2ASBA 1VQIA 2UUCQ 3G71A 3CAMA 1JT8A 4JC0A 3KFUA 2Z6KC 3S1QH 4PZ7A 3UDXA 1WYDA 4A3JH 3U50C 3K81C 4DR2L 3M3YH 4LF4L 4YWMA 4ZN3B 1RDVA 2Y0SG 5HY6A 1FL0A 3AFQA 4YCWA 3JAMi 4ZN1B 3ERSX 3B6YA 2NVXH 3IU3I 3WWLA 3RYGA 4ME3A 3M9BA 4BBRH 4KHPL 5DM71 1VQ7A 2HIXA 2PVXA 5C44H 1PYBA 2B29A 2ERJA 4A3GH 2I5MX 4AQYQ 4IPDA 1L0WA 2ALYB 3PO3G 2NVYH 1HZ9A 3E9HA 3CQZH 3BZCA 1DX8A 1EUJA 4A3MH 2ID0A 2F52A 1C9OA 4JI0Q 1G6PA 3RN5A 1N33L 2UUBQ 1K73C 3W5OA 5H1Sc 3HOYH 1WOCA 3GTJH 3S17H 2AHOB 2D0PA 5IYBG 1VQ4A 4BA2I 3T1YL 3K35A 1B71A 1RDGA 2BH2A 3KDFA 1N36Q 4DR4L 3T1HL 3PF4A 1MKHA 5M3FG 4JI6Q 4IPCA 5EIOC 4LF9Q 1VQJA 4GKJL 1D8LA 2DGYA 1B2OA 3F2DA 3SGIA 3IRBA 3UE0A 5LMNL 1X65A 4LFAQ 3S2DH 3CD6A 1B8AA 5DM61 1UE7A 3KJOA 1T9PA 3EN2A 3ULJA 4JAFA 4A3EH 2JI3A 2M6PA 4JBWA 2B5ID 3S1NH 4YWLA 2K5HA 3TQYA 2EIFA 1HZAA 4JI8L 1JJ2A 1YHQA 2R7ZG 3M4OH 4AI1A 2YU9H 3FP9A 1VQ6A 2A1AA 1X3FA 2ERSA 1EIFA 1NXGA 3GTGH 4DV4L 1CKOA 2JE6I 1BQ8A 1VCXA 2R93H 3KF6A 1WJJA 4XTCS 4JI7L 3F1ZA 2NN6G 3ER0A 1UEBA 3PGZA 1CADA 2UU9L 1Y1VH 1NMFA 5BR8Q 4BXXG 4MNOA 1E8JA 2I5LX 1IBLL 4MTNA 2RDVA 1TWAH 1X54A 4A3CG 3CCSA 4AR4A 3CXCA 1V9PA 4UY8C 3ZJYC 2AWOA 4B3MQ 4DR7Q 4JI1Q 1C09A 4QIWE 3L2PA 1SMWA 2Z3QB 3RR5A 1NXEA 1XMQL 4OWWB 3H0GH 1HNZQ 1KL9A 3I4NG 1E3PA 1A0IA 3KYHC 4X66Q 1SN8A 2JA6G 5AN9H 1WI5A 5MFPA 1Z9FA 1TXYA 4OXPA 4JI3Q 1FJGL 1LM0A 5IWAQ 3PV0A 2K4KA 1RL2A 4LHNA 3PIO1 4OX9L 4KI0A 1XNQQ 4BA1I 2JA7H 2UXBL 2QA4A 1BKBA 1Q12A 4XIGS 1HNXL 3VDYA 2MFIA 2UUCL 1PH2A 2JA8G 2UXCQ 3PKJA 3GTKH 4DAMA 4B3TQ 1OXTA 2CCZA 4RG1A 4C3HH 1OWCA 2GMGA 3UDFA 4HJ5A 1P16A 3A0JA 4IOCA 4JCVE 4GLXA 3K0XA 2M4YA 2WFWA 4LW1A 1Q82C 3RZOH 2BA0A 1NNQA 2BA1A 4IFDI 2I0QA 3JC66 1GD7A 2JJQA 3RZ6A 4KHZA 3S1RH 4R4OA 5JJKA 1L1OC 3TEHB 3BZKA 4AQYL 3J81j 2AMCB 4NXNQ 3S24A 1EYGA 3PO3H 4R1JA 2ZIXA 4MZ9A 5MGNA 5JEAG 1RYTA 2N49A 1I5FA 5GADC 2C35B 3GD7A 3B08B 4QGUA 1X9NA 5JJIA 5IE8A 4IFDG 2Z6KA 1E1TA 1QYBA 4DNIA 5GADc 2M6OA 1S2ZA 5IYBH 4GKKQ 4DUZQ 3GTMH 2YTYA 4A3KG 4A3DG 1ZRPA 3J7Y1 5M3FH 1VQNA 2J9UB 1D7QA 2UXDQ 2MNAA 3CPFA 2QGQA 3Q8DA 5FJ8G 4YWKA 3BU2A 1LUZA 4RXNA 1BRFA 4IO9A 1Q1BA 2K75A 5HGQA 1BBUA 2KHJA 2CKAA 1PH1A 4EX5A 3G4SA 2WB1E 4DR6L 2BE5D 2R92G 2F4VL 4K0KQ 2D0OA 4AR3A 3HFZB 2R7ZH 4DR5Q 4U671 3I2ZA 3ULLA 3G48A 1HNWL 1E24A 1R0HA 2VW9A 1A8VA 1P8LA 3PZAA 3QVDA 2E2IH 4NPSA 4GN4B 3UDIA 5E7NA 4AHWA 1W2BA 3AEVA 4BXXH 1YIJA 2A69D 4P74A 4A3CH 3G6EA 1YNXA 4YHHQ 4B3ML 4A3LG 3CCEA 4DR7L 1L2FA 4JI1L 3WWVA 1S24A 4X64L 3LNLA 1QZGA 3J7Z1 4DR3Q 1EQRA 2C6AA 3I4NH 4WJ4A 3PO2G 4PG3A 3PIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 L;  1S3O A;  1B71 A;  8RXN A;  1RDG A;  2BH2 A;  3S15 H;  3KDF A;  4X64 Q;  1N36 Q;  1H7V A;  1FVI A;  4LF9 L;  2JK8 A;  1K83 H;  2JA6 H;  4LF8 Q;  4DV5 L;  4JOI A;  2ZM6 L;  4LUV A;  4BBS H;  4DR4 L;  5IP7 G;  5IP9 H;  1N8R C;  3L7Z C;  5GRO A;  3T1H L;  3U58 A;  3RLN A;  2EXD A;  4DKA C;  2ZJQ A;  3PF4 A;  4GLV B;  1MKH A;  1JB7 A;  3JC6 3;  4LF5 L;  5M3F G;  4LFA L;  3KYV A;  2PMZ E;  2VUM G;  4JI6 Q;  4K9F A;  1L1O B;  4JI3 L;  2MQH A;  3TS0 A;  4IPC A;  5C0X I;  4LF9 Q;  1VQJ A;  4GKJ L;  3AYH B;  1PH3 A;  1D8L A;  2DGY A;  1B2O A;  1JE5 A;  3F2D A;  1PH6 A;  2R7D A;  1VQM A;  1W3S A;  3SGI A;  4ALP A;  3A44 A;  1BFY A;  3IRB A;  3UE0 A;  5LMN L;  1X65 A;  4LFA Q;  2E5L Q;  2A19 A;  3S2D H;  3CD6 A;  1B8A A;  4Y52 H;  1X6O A;  1I3Q H;  4AIM A;  1EQQ A;  2HHH Q;  4GOP A;  4A3F G;  1R0I A;  4H02 A;  1LKP A;  2HQL A;  1UE7 A;  4NB3 A;  1KRS A;  1T9P A;  3KJO A;  1LTL A;  4GKJ Q;  3EN2 A;  1YK4 A;  3ULJ A;  1IBM L;  3M7N A;  4BY7 G;  4A93 G;  1KQS A;  2JEA I;  3TRZ A;  4A3E H;  3BJU A;  2JA8 H;  2UXC L;  4LF7 L;  1G29 1;  1LKO A;  1SMU A;  1J6Q A;  4DV0 Q;  1I94 L;  3OTO L;  2L15 A;  1SE8 A;  3PSI A;  1HH2 P;  4JBW A;  2HT1 A;  1PHJ A;  5FLX c;  1IBM Q;  3RZT A;  1KXL A;  2F3I A;  4B3R L;  1Q81 C;  1BBW A;  4LFB L;  2E2J H;  4B3T L;  3S1N H;  4LF7 Q;  1V43 A;  2N8N A;  4P72 A;  4YWL A;  2K5H A;  1FJG Q;  1UWV A;  3CCR A;  4OWX B;  3M85 A;  3TQY A;  4QJF A;  4JYA L;  3PCO B;  1QVF A;  2LXJ A;  2EIF A;  2RF4 A;  5C0X G;  1HZA A;  4JI8 L;  1JJ2 A;  4B3R Q;  2OCE A;  1E22 A;  1YHQ A;  3PUY A;  5AI3 A;  2CWA A;  4HJ8 A;  2R7Z G;  3A5Z B;  1XNR L;  4LFB Q;  3CMA A;  4A3J G;  1AH9 A;  3M4O H;  2YU9 H;  2YV5 A;  1B7Y B;  1T9O A;  3FP9 A;  5M5W H;  4DR2 Q;  4JBK A;  1VQ6 A;  2A1A A;  1PVO A;  1VQP A;  1IXR A;  3MEF A;  1X3F A;  2CQO A;  4JOI C;  1PH5 A;  4LF4 Q;  3CF5 A;  1NTG A;  1WCM G;  3H3V I;  1C0A A;  1EIF A;  2R6G A;  3GTG H;  5H1S E;  3I7F A;  4DV4 L;  1SLJ A;  1CKO A;  2JE6 I;  5J3B A;  2YYZ A;  2Z0S A;  1BQ8 A;  1VCX A;  3HKS A;  3KF6 A;  2R93 H;  1WJJ A;  4HJ9 A;  2JEB I;  4X62 Q;  4DV2 L;  1VQA A;  4A3B H;  1Y14 B;  2BH8 A;  1VCI A;  4XTC S;  2RCN A;  4JI7 L;  1VQF A;  3OYY A;  1R0G A;  1TWF H;  2E8G A;  4YCV A;  1IRN A;  1X55 A;  3F1Z A;  5BR8 L;  1GO3 E;  1PYS B;  1GVP A;  2NZO A;  1EWI A;  1I6H H;  2NN6 G;  2HIV A;  3KYU A;  4BBR G;  4DPG A;  3ER0 A;  4KHP Q;  1UEB A;  3M4P A;  3PGZ A;  1CAD A;  4NXN L;  2UU9 L;  4GOP C;  5IYC H;  4C3J H;  4A75 A;  1Y1V H;  1A62 A;  4UP9 A;  4DV2 Q;  1IBK L;  3S1M H;  3F2C A;  1PA6 A;  1IZ6 A;  5IYD H;  4GS3 A;  5C44 G;  2N78 A;  3RZD H;  1KAW A;  3MXN B;  2B63 G;  1NMF A;  1Q86 C;  2OTJ A;  5BR8 Q;  3DLL A;  3H3V H;  2PI2 A;  4AR5 A;  3I4M H;  4BXX G;  4MNO A;  4A3G G;  4YCU A;  2UU9 Q;  1E8J A;  4J15 A;  1S72 A;  2KHI A;  2I5L X;  1IBL L;  2UUA Q;  1PV4 A;  4MTN A;  3HOU G;  1B2J A;  1DVB A;  2RDV A;  1TWA H;  1X54 A;  3J81 c;  4A3C G;  1VQG A;  3CCS A;  4AR4 A;  1UE1 A;  3K7U C;  3CCM A;  3CXC A;  1V9P A;  2GVB A;  4JI4 L;  3NBH B;  1AE3 A;  1NY4 A;  2Q2T A;  5M3M G;  4PZ6 A;  4UY8 C;  1TWG H;  3K8A A;  1CAA A;  4AH6 A;  3ZJY C;  4DV1 L;  1MIU A;  4DAY B;  3E0E A;  2AWO A;  1IBL Q;  4A3M G;  5M5X H;  3F2B A;  2VQF L;  4B3M Q;  1B70 B;  2ATW A;  3NEM A;  2D62 A;  1HNZ L;  4JG2 A;  4DUZ L;  4DR7 Q;  4JI1 Q;  2DSX A;  1C09 A;  4QIW E;  4JI4 Q;  3L2P A;  3HOY G;  1SMW A;  2OQ0 A;  2E2H H;  2IHE A;  2KKD A;  2VZA A;  2K2D A;  1VQD A;  4DV1 Q;  3RR5 A;  4X66 L;  3ULP A;  4A3K H;  1I50 H;  1YHA A;  4A3D H;  1XMQ L;  1MJE A;  2OWO A;  1RIP A;  4OWW B;  1M90 C;  3GTO H;  3CPW A;  3KDF B;  3H0G H;  1HNZ Q;  4LF6 L;  1KL9 A;  3I4N G;  1VQ5 A;  4GN5 A;  4DV6 L;  1NBW A;  1E3P A;  2KBN A;  1A0I A;  1YVC A;  4GLA C;  1Y1W G;  3I56 A;  3T1Y Q;  4DR1 L;  3KYH C;  1VQC A;  4X66 Q;  1PH9 A;  4HJ7 A;  4OON A;  1SN8 A;  2JA6 G;  3K7A H;  3HKZ G;  2V3B B;  1HJP A;  4DV5 Q;  1CKN A;  2ZM6 Q;  1K8G A;  1WI5 A;  5IP9 G;  5IWA L;  2IX0 A;  2OTL A;  4BBS G;  4DR4 Q;  5ELO A;  1PH8 A;  3T1H Q;  4A76 A;  2K52 A;  1Z9F A;  2K5V A;  1CUK A;  4LF5 Q;  5FJ8 H;  4DR1 Q;  1XNQ L;  1TXY A;  4O2D A;  4OXP A;  4JI3 Q;  1QCV A;  4C3I H;  1BE7 A;  2VNU D;  1FJG L;  1YJ9 A;  1LM0 A;  3PUZ A;  4GOP B;  4UP7 A;  5IWA Q;  4LNQ A;  3PV0 A;  2K4K A;  1RL2 A;  3HKZ E;  4OX9 L;  1NJI C;  5LMN Q;  1YI2 A;  1S40 A;  4NXM L;  4KI0 A;  4L5S A;  1XNQ Q;  4BA1 I;  3KJP A;  2JA7 H;  1VQB A;  2UXB L;  2QA4 A;  1BKB A;  1HR0 L;  4JV5 L;  1Q12 A;  2AWN A;  4XIG S;  2PQA A;  3J7Z C;  2KCT A;  1HNX L;  1N32 Q;  3VDY A;  1YBY A;  2MFI A;  1VQ8 A;  1IYJ B;  2IHF A;  2UUC L;  3UDG A;  1X3G A;  2YTV A;  2K5N A;  1U0L A;  1PH2 A;  1VQH A;  4EQ5 A;  1N34 L;  4OX9 Q;  2R92 H;  1XMO L;  4A3E G;  1O7I A;  1OXV A;  2JA8 G;  1IU5 A;  2UXC Q;  1SRO A;  5LMU L;  4GNX C;  1I94 Q;  3TS2 A;  2UXB Q;  3OTO Q;  2MO0 A;  4X65 L;  2VY3 A;  1HR0 Q;  2Q2I A;  3J7A 5;  3KYX A;  4JV5 Q;  1HNX Q;  1YEZ A;  3W1G A;  4DR5 L;  4POG A;  1EIY B;  3OW2 A;  3A74 A;  1N34 Q;  4DV4 Q;  3GTK H;  1XMO Q;  5C4X H;  1AE2 A;  4DAM A;  3H15 A;  3CCL A;  2IT1 A;  4B3T Q;  1OXT A;  1M1K C;  2CCZ A;  4RG1 A;  4UP8 A;  1EOV A;  4X65 Q;  1V1Q A;  4QL5 A;  4C3H H;  4JYA Q;  5IY0 A;  1Q7Y C;  1H95 A;  1TWH H;  2GMG A;  5C0X J;  1N9W A;  4L5Q A;  4HIM A;  4JI8 Q;  3HOV H;  3L0O A;  3UDF A;  1TWC H;  3E9I A;  4HJ5 A;  1P16 A;  3A0J A;  1IRO A;  4IOC A;  5RXN A;  2JA9 A;  4JCV E;  2WP8 J;  1LYL A;  1E1O A;  4LUO A;  4OWT B;  4A4I A;  3K0X A;  4GLX A;  1XNR Q;  2M4Y A;  4WJ3 M;  2WFW A;  3HOX H;  4LW1 A;  1Q82 C;  3RZO H;  2BA0 A;  1CSP A;  4LFC L;  4APV A;  2VL6 A;  1NNQ A;  3CCV A;  1N32 L;  3KF6 B;  1NMG A;  3KYW A;  4QQB X;  2BA1 A;  4IFD I;  1JJG A;  1RB9 A;  3RN2 A;  2I0Q A;  4KLK A;  3DM3 A;  1QVC A;  3JC6 6;  4UPA A;  4LWC A;  1GD7 A;  2JJQ A;  3RZ6 A;  4KHZ A;  3S1R H;  2ZJR A;  4HIO A;  2XGT A;  1E7Z A;  1SRU A;  4R4C A;  3J80 i;  3I55 A;  2R93 G;  4LFC Q;  2N3S A;  4R4O A;  3U4Z A;  4A3B G;  5JJK A;  1L1O C;  2ZTC A;  5C3E H;  1HZC A;  3S2H H;  1KHI A;  3FKI H;  4P73 A;  3TEH B;  5AI2 A;  5GAE C;  4JI7 Q;  4DUY L;  1CKM A;  3JAM c;  1YIT A;  4L5R C;  3BZK A;  4AQY L;  1J5E L;  2KN9 A;  3J81 j;  2AMC B;  4A3I H;  4JI5 L;  5IYC G;  4BY1 H;  1OXX K;  3K80 C;  1Y1V G;  4NXN Q;  3S24 A;  3D31 A;  1YK5 A;  2PNH A;  2WAQ G;  4AYB G;  5IYD G;  1IBK Q;  4PMW A;  1EYG A;  2NVQ H;  4AR6 A;  3PO3 H;  4R1J A;  4MZ9 A;  5JEA G;  3AQQ A;  1RYT A;  2N49 A;  4YHH L;  4DUY Q;  3I4M G;  1J5E Q;  5GAH C;  1I5F A;  1T9H A;  2ZTD A;  4TQU S;  4GNX A;  1IL2 A;  4OO1 G;  5GAD C;  4JI5 Q;  3JC6 2;  2C35 B;  3D0F A;  4O0A A;  4A3L H;  3GD7 A;  4B3S L;  3MPS A;  3KF8 B;  2Q2H A;  4QGU A;  3CME A;  1XPR A;  4X6A H;  1X9N A;  1SMM A;  3PUV A;  1QUQ A;  3HOZ H;  5JJI A;  4GKK L;  3HOW H;  2WAQ E;  4AYB E;  5DLQ E;  5IE8 A;  1QVG A;  1YUX A;  5LMN W;  2LCQ A;  1MJC A;  4IFD G;  1OXU A;  5FLM H;  4DR3 L;  1ASZ A;  4JI2 L;  2Z6K A;  1E1T A;  1Q1E A;  1QYB A;  1YHB A;  3LGJ A;  4DNI A;  2LSS A;  5AJ3 L;  3RNU A;  2JA5 H;  3UE1 A;  1VS0 A;  4B3S Q;  2VQF Q;  1FGU A;  4IJH A;  1PH4 A;  1S2Z A;  1WFQ A;  1QZH A;  2VQE L;  5IYB H;  4GKK Q;  2PI2 E;  4DUZ Q;  2B3G A;  1KIX A;  3PO2 H;  2JQO A;  3STB D;  1FHM A;  2R7F A;  1U5K A;  4HJA A;  2YTY A;  4A3K G;  3GTM H;  2UXD L;  1JYB A;  3PUW A;  4A3D G;  3CC7 A;  7RXN A;  4JBM A;  1UE5 A;  5AJ3 Q;  3CC2 A;  1OXS C;  1XTD A;  1XMQ Q;  4FDB A;  3ICE A;  4Y7N H;  5IP7 H;  1ZRP A;  2A8V A;  1NE3 A;  1LKM A;  2K14 A;  2YTX A;  3H0G G;  2IY5 B;  4YY3 L;  2VQE Q;  4LF6 Q;  1SR3 A;  1RWD A;  1CKN B;  5M3F H;  1SFO H;  4L5T A;  1VQN A;  4DV6 Q;  2VUM H;  5EAY A;  1D7Q A;  2UXD Q;  2MNA A;  5JJL A;  4TPU A;  2MS3 A;  1Q8K A;  3CPF A;  4IPH A;  4IOA A;  4POF A;  3PUX A;  2EQS A;  1A63 A;  1C7Y A;  1YV1 A;  4JBJ A;  4DV7 L;  2I5H A;  3EIV A;  2CKZ B;  3CP0 A;  2HR5 A;  1L1O A;  3NEN A;  1FHH A;  2QGQ A;  4YY3 Q;  2E5L L;  1XPU A;  5K36 G;  1S30 A;  1YUZ A;  1SMX A;  2HHH L;  2OQK A;  2PVE A;  3Q8D A;  4R4I A;  4DV3 L;  5FJ8 G;  4A3F H;  4YWK A;  1EFW A;  5M5Y H;  1Q46 A;  3BU2 A;  2IX1 A;  4HID A;  4A93 H;  3SS2 A;  1LUZ A;  2WB1 G;  1JMC A;  4BY7 H;  4RXN A;  2CFM A;  1BRF A;  1CSQ A;  6RXN A;  3FHW A;  5IT9 c;  1R0J A;  3AFP A;  4DV7 Q;  4IO9 A;  2ES2 A;  1KD1 C;  1Q1B A;  2PQA B;  2K75 A;  4DV0 L;  5HGQ A;  4K0K L;  4DV3 Q;  3CC4 A;  4NXM Q;  1BBU A;  5ELN A;  4IPG A;  2JA7 G;  3GTP H;  2ZJP A;  3CCJ A;  2KHJ A;  3CCU A;  3RLO A;  2QEX A;  1KRT A;  2ASB A;  1PH1 A;  4EX5 A;  2H5X A;  3S16 H;  1DGS A;  1VQI A;  3G4S A;  2UUC Q;  2WB1 E;  4DR6 L;  3G71 A;  2R92 G;  2F4V L;  2Q2U A;  4K0K Q;  3CAM A;  1JT8 A;  4JC0 A;  3F8T A;  3KFU A;  5LMU Q;  4HIK A;  1HZB A;  2Z6K C;  4DK3 C;  5C4J H;  3GTL H;  3S1Q H;  1VQL A;  1K9M C;  2D0O A;  4PZ7 A;  1XJV A;  4AR3 A;  3UDX A;  3NEL A;  3HFZ B;  2NN6 I;  4QY7 A;  2DUD A;  3A5U A;  1VQK A;  4DR5 Q;  3KOJ A;  1WYD A;  2R7Z H;  4DR6 Q;  3I2Z A;  4OO1 I;  4A3J H;  3U50 C;  3K81 C;  2F4V Q;  5C4X G;  2PYA A;  3KLW A;  4DR2 L;  1GKH A;  3ULL A;  3M3Y H;  2XTI A;  4IJL A;  2CWP A;  4RMF A;  4LF4 L;  1R9T H;  1BVS A;  1Z47 A;  4YWM A;  3KYY A;  2RHS B;  1WCM H;  1VQO A;  3G48 A;  2Y0S G;  1RDV A;  2VS1 A;  3HOV G;  1HNW L;  1PH7 A;  1OTC A;  1E24 A;  1R0H A;  2ZTE A;  5HY6 A;  1FL0 A;  3AFQ A;  4YCW A;  3TRE A;  3JAM i;  1K3R A;  4LUZ A;  3ERS X;  3B6Y A;  1YZ6 A;  3GDE A;  2NVX H;  1X3E A;  2RHQ B;  2VW9 A;  1A8V A;  1P8L A;  4X62 L;  3HOX G;  2KCM A;  1T9Q A;  3PZA A;  3QVD A;  3U4V A;  1HNW Q;  1IU6 A;  3RYG A;  3J81 i;  4ME3 A;  3M9B A;  2E2I H;  2V1C C;  1XPO A;  4R4T A;  2Y0S E;  3M4Q A;  2NZH A;  4BBR H;  4KHP L;  1BQ9 A;  4P71 A;  1VQ7 A;  2KEN A;  1K8A C;  4NPS A;  1VQ9 A;  4TVA B;  2LXK A;  4GN4 B;  2HIX A;  2PVX A;  5C44 H;  3UDI A;  1K0R A;  2B63 H;  5C3E G;  5E7N A;  1PYB A;  3FKI G;  1W2B A;  1JJC B;  3AEV A;  3PWF A;  2B29 A;  4BXX H;  1GM5 A;  2I5M X;  1YIJ A;  4A3G H;  4C2M H;  4AQY Q;  4P74 A;  3EBE A;  5GQO A;  4A3I G;  4IPD A;  4P75 A;  4BY1 G;  3STB C;  2UUA L;  3GTQ H;  3HOU H;  1L0W A;  2ALY B;  1G51 A;  4GNX B;  4A3C H;  3PO3 G;  4JI0 L;  2NVY H;  1HZ9 A;  3PIP A;  3G6E A;  2UUB L;  2FXQ A;  4DK6 C;  1YNX A;  2K50 A;  3E9H A;  5JEA J;  3CQZ H;  1QUQ B;  3BZC A;  5M3M H;  4YHH Q;  1DX8 A;  1EUJ A;  2AKW B;  2NVT H;  3J80 c;  1PFS A;  4B3M L;  4PZ8 A;  4A3M H;  2ID0 A;  2F52 A;  4A3L G;  1C9O A;  3W1B A;  3CCE A;  1R0F A;  4JI0 Q;  4DR7 L;  1G6P A;  1L2F A;  3RN5 A;  4JI1 L;  1N33 L;  5GAG C;  3HOZ G;  3I4O A;  2UUB Q;  3CCQ A;  3HOW G;  1K73 C;  3WWV A;  1B13 A;  2MO1 A;  3CW2 C;  3W5O A;  3HOY H;  1S24 A;  1VQE A;  1X56 A;  1KC8 C;  4IFD J;  1WOC A;  4X64 L;  5FLM G;  1QZG A;  1N36 L;  4JI2 Q;  4R4Q A;  4DR3 Q;  1ASY A;  2JA5 G;  2GVA A;  4LF8 L;  1EQR A;  1HR0 W;  1UE6 A;  3S14 H;  2QL0 A;  3GO5 A;  3GTJ H;  3S17 H;  2GN5 A;  2AHO B;  1N33 Q;  3I4N H;  4WJ4 A;  3PF5 A;  2D0P A;  5IYB G;  1VQ4 A;  4BA2 I;  4GN3 B;  3RLF A;  3PO2 G;  3T1Y L;  1YJN A;  1Y1W H;  4PG3 A;  1YJW A;  3PIO A; 
#chains in the Genus database with same CATH topology
 3SR1 A;  1S3O A;  1H7V A;  2JA6 H;  4LF8 Q;  2E74 C;  4LUV A;  3FVQ A;  4K2L A;  5GRO A;  1CHQ D;  4PNY A;  1H9R A;  2KA7 A;  2EXD A;  3JC6 3;  4GLV B;  4CKE A;  2VUM G;  1PTO F;  4G6B A;  2BE5 C;  4JI3 L;  2MQH A;  5C0X I;  1U4L A;  5C3E L;  2CKC A;  3J7A V;  3S2H L;  3FKI L;  1LLR D;  1PH3 A;  4AHX A;  1HRJ A;  1PH6 A;  5IT9 L;  1W6K A;  4ALP A;  1BFY A;  4A3I L;  4BY1 L;  4R8I A;  3GTP B;  2E5L Q;  4Y52 H;  4K5V A;  1X6O A;  1I3Q H;  1D1K A;  4A3F G;  4H02 A;  4FXG C;  4DU9 A;  1H9S A;  3TRZ A;  1ENA A;  2JA8 H;  1JQY D;  2UXC L;  2NYD A;  4X3K A;  1LKO A;  1SMU A;  1J6Q A;  2L15 A;  4X6A L;  3PSI A;  1HH2 P;  2HT1 A;  3J7A F;  2OT2 A;  2Y0S B;  1IBM Q;  3FMC A;  2L12 A;  2A68 D;  2F3I A;  4B3R L;  2WAQ P;  4AYB P;  5FLM L;  3TN2 A;  2E2J H;  1DCZ A;  4JVZ A;  4B3T L;  1I50 L;  4LF7 Q;  1UWV A;  4DAP A;  1R9T B;  4ZRZ A;  4PMC A;  2X69 A;  4QJF A;  1T5X D;  2RF4 A;  5C0X G;  4H44 C;  2K7V A;  1SNM A;  5AI3 A;  2CWA A;  3QG1 A;  4HJ8 A;  3A5Z B;  4J1M A;  4LFB Q;  2B2Y C;  3CMA A;  1AH9 A;  3J80 E;  3S1R B;  4Y7N L;  5IP7 L;  2B8F A;  4JBK A;  1PVO A;  1VQP A;  1IXR A;  3MEF A;  4X3T A;  1I4G A;  1PH5 A;  3JR7 A;  2A69 C;  3H3V I;  4K8I A;  3TZU A;  2R6G A;  3RUZ A;  2F4I A;  1ZEQ X;  4NW2 A;  3L3O C;  1S5C D;  5J3B A;  2YYZ A;  2XJQ A;  3PO3 B;  1VQA A;  4ZAI A;  3KLS X;  2B63 B;  2BH8 A;  1QOH A;  2RCN A;  4LMQ D;  2I46 A;  3OYY A;  1R0G A;  5M5Y L;  1GO3 E;  1PYS B;  4HCE A;  1EWI A;  4DPG A;  2HIV A;  3KYU A;  1LTG D;  4A93 L;  4NXN L;  1H9M A;  1LTI D;  2PPT A;  4C3J H;  1JWS D;  1LT6 D;  4QIW B;  5CGK A;  3I8Z A;  1I6V C;  4DV2 Q;  4RGO S;  4LJZ C;  3F2C A;  1PA6 A;  3MC0 B;  1B50 A;  1PLF A;  2N78 A;  2F0D A;  1X3Q A;  2B63 G;  5E4W C;  4G4K A;  3DLL A;  5JEA H;  4AR5 A;  2NVT B;  1T5E A;  3S16 L;  2XJV A;  2EY5 A;  2K1B A;  4J15 A;  3J80 L;  2KHI A;  4CJ0 B;  1IYU A;  3A8J E;  3J81 c;  3T56 B;  4FXD A;  1VQG A;  1UE1 A;  4AHY A;  2GVB A;  5C4J L;  4JI4 L;  3PL5 A;  1A15 A;  2FJ2 A;  4PZ6 A;  4IFD H;  4Z9C B;  1TWG H;  3K8A A;  4AH6 A;  2C9O A;  5E4X A;  2ATW A;  1ESF A;  3NEM A;  1WJV A;  2D62 A;  1Y8N B;  1E2Z A;  4KY6 A;  4DUZ L;  1Y1W B;  2DSX A;  4HMI A;  1WCM L;  2IHE A;  1K83 B;  4DV1 Q;  5EKI A;  1VQD A;  4OL7 A;  2O5J D;  4A3K H;  2K03 A;  5IIF A;  1I50 H;  4A3D H;  4BBS B;  2OWO A;  2EYL A;  2DJF C;  3CPW A;  1PMR A;  1KDA A;  4XDX A;  1NBW A;  2KBN A;  1Y1W G;  3QIA A;  2WIN B;  1VQC A;  4HJ7 A;  4OON A;  1AZP A;  4ZLT F;  3K7A H;  2B2U C;  4DV5 Q;  3D4D A;  1K8G A;  4BBS G;  5IP9 G;  3Q6S A;  4K6L A;  4A76 A;  2A68 C;  4RWS C;  1WTW A;  3LWU A;  5FJ8 H;  4DR1 Q;  3NQI A;  4JPB W;  5CBA E;  3C46 A;  4LNQ A;  3MWY W;  2XJR A;  2JYO A;  1NJI C;  1WTQ A;  3GTQ L;  4DA2 A;  3HOU L;  4OEL B;  5COR A;  4L5S A;  1VQB A;  1SYC A;  1MBY A;  4JV5 L;  2TSS A;  1N32 Q;  1P7P A;  5M3M L;  1IYJ B;  2IHF A;  1N34 L;  1VQH A;  2R92 H;  1QNK A;  4RCO A;  1NR4 A;  3TP6 A;  3MA2 B;  1IU5 A;  3IAY A;  4GNX C;  1I94 Q;  3TS2 A;  3OTO Q;  2VY3 A;  2LS0 1;  1HR0 Q;  2J7Z A;  2EOT A;  5JPN C;  3D3R A;  4DR5 L;  4RH6 A;  4POG A;  2NB0 A;  3ITP A;  3JAM E;  1EIY B;  3OWF A;  4KV6 A;  1XMO Q;  2IT1 A;  5CBE E;  3S14 L;  3C3L A;  4X65 Q;  2KEE A;  5EQ0 A;  4JYA Q;  1TWH H;  3OPO A;  2E2I B;  4L5Q A;  2ENB A;  1TWC H;  3S15 L;  3HG9 A;  2F0E A;  1IRO A;  5RXN A;  4OWT B;  4LUO A;  1E1O A;  2AYJ A;  1LYL A;  1A3V A;  1LT3 D;  4IUR A;  1XNR Q;  1PFV A;  1STE A;  2QDL A;  4A3B B;  4E6Y A;  2F0P A;  3LWP B;  1CSP A;  3FDJ A;  1TWF B;  4K2K A;  2F0N A;  1I6H B;  3KYW A;  1TVX A;  2MGS A;  2AUS B;  1RB9 A;  2EJF C;  2PMZ P;  1QVC A;  2H4O A;  1SNP A;  1PZJ D;  3T13 A;  1SAP A;  2ZJR A;  1E7Z A;  4R4C A;  1PFY A;  4LFC Q;  2B2V A;  2N3S A;  3U4Z A;  4A3B G;  3TP7 A;  1RKN A;  4NP5 A;  4P73 A;  4CHT B;  5GAE C;  1WVL A;  4M8A A;  1JWU D;  4DUY L;  1CKM A;  1YIT A;  1J5E L;  3NP8 A;  2KQ3 A;  1SNQ A;  3D4R A;  5MLC 3;  1OXX K;  5I9O A;  1IYV A;  2O5J C;  3QO2 A;  1FNV A;  4YHH L;  5GAE c;  3GTL L;  2RA4 A;  3DWP A;  5GAH C;  2ZTD A;  4TQU S;  4JI5 Q;  3JC6 2;  4O0A A;  4JAE A;  1RYQ A;  4A3L H;  4B3S L;  2NTT A;  3KF8 B;  2ICE C;  1XPR A;  3CME A;  2OEO A;  3I4N B;  1HCZ A;  4HSV A;  2WAQ E;  4AYB E;  1QVG A;  1YUX A;  1IKM A;  4UDU C;  3A54 A;  3EFX D;  1ASZ A;  4DR3 L;  5GAH c;  3GTO B;  1YHB A;  3UE1 A;  2D5D A;  1FGU A;  4IJH A;  4XYQ A;  2PI2 E;  3I72 A;  4CBV A;  3PO2 H;  2IPK D;  2JQO A;  2R7F A;  1FD7 D;  4XQQ A;  1CQF A;  1G8Z D;  1B2T A;  3A7L A;  2JN4 A;  7RXN A;  3CC7 A;  1HXY D;  5AJ3 Q;  4FDB A;  2J4X A;  2KCC A;  1I4X A;  1NE3 A;  2A8V A;  3HRZ C;  1XXG A;  2VQE Q;  2K5Q A;  1SR3 A;  5CMD A;  1RWD A;  4L5T A;  5K2M E;  2VUM H;  1I3Q B;  2WB1 B;  1Q8K A;  4IPH A;  5JJZ A;  4IOA A;  2EQS A;  2QCP X;  1C7Y A;  5MF6 A;  1DYQ A;  4DV7 L;  2JSO A;  3A56 A;  2CKZ B;  3CP0 A;  4YY3 Q;  5IYC L;  2E5L L;  3TME A;  2Z3R B;  2RDF A;  4DV3 L;  4R4I A;  5IYD L;  4A3F H;  3RZD L;  2IX1 A;  3OMG A;  4C3I G;  2WB1 G;  1JMC A;  3I4M L;  6RXN A;  5IT9 c;  2F0G A;  4GS7 D;  3V05 A;  1TS4 A;  2E2J B;  3E6Z X;  1ET6 A;  5CYU A;  5A35 A;  5ISR A;  2K6A A;  2RQX A;  3CC4 A;  4NXM Q;  5ELN A;  3K57 A;  3GTP H;  2ZJP A;  3RLO A;  2WAC A;  3K58 A;  1DGS A;  3H6M A;  5M5X L;  5JVG 3;  1HZB A;  4DK3 C;  2Z9H A;  1VMP A;  3GTL H;  1VQL A;  1K9M C;  1XJV A;  2KHS A;  5C0X H;  4EQP A;  2IL8 A;  4QY7 A;  2DUD A;  1VQK A;  1SE4 A;  4ZCK A;  5EIN C;  4AI3 A;  3KLW A;  3HOX B;  4ULL A;  2XTI A;  4IJL A;  4RMF A;  1X32 A;  2XRS D;  1R9T H;  1A2U A;  5EBC A;  2RHS B;  1VQO A;  2VS1 A;  3HOV G;  2IW3 A;  4UY8 1;  2QF7 A;  1HUM A;  4FNF A;  1K3R A;  5JOB A;  2F0Q A;  2G9H D;  3GDE A;  3KBG A;  1X3E A;  2RHQ B;  3WDN A;  3HOX G;  4J8Q A;  4KKU A;  4ME5 A;  1T9Q A;  1GUN A;  1SXT A;  3U4V A;  3S2H B;  3CRK C;  2E2D C;  5JVH 1;  5C3X A;  2V1C C;  1XPO A;  3BDO A;  4R4T A;  3ND8 A;  3M4Q A;  2NZH A;  3CRL C;  4BY1 B;  4P71 A;  2KEN A;  2JI1 A;  1K8A C;  2JI2 A;  4YIJ A;  4TVA B;  3OMC A;  5EJW A;  5K5P A;  1F77 A;  1BOS A;  1WTV A;  3DUZ A;  5KND A;  4G7Z C;  3KBX A;  1TQO A;  3BVZ A;  2L5T A;  2KOL A;  3HKZ P;  2B63 H;  5C3E G;  3C1F A;  1EY9 A;  3FKI G;  3PWF A;  1TWG B;  3MQK B;  2PCF B;  1GM5 A;  1DON A;  2MJ8 A;  4A3I G;  4P75 A;  4X3S A;  4BY1 G;  4MHE A;  4FF3 A;  1G51 A;  2F3V A;  2RFK B;  4JI0 L;  2EE1 A;  3NTI A;  2UUB L;  4DK6 C;  1STA A;  4WFN 1;  2K50 A;  4A3K B;  4FF4 A;  1GUO A;  1QUQ B;  4A3D B;  2AKW B;  1I50 B;  5ELD A;  2NVT H;  3J80 c;  4QUF A;  1Z92 B;  2IX3 A;  3MTS A;  1CTM A;  3Q23 A;  5C4X L;  1V8Q A;  2A5H A;  1R0F A;  1R4Q B;  5GAG C;  3I4O A;  3CCQ A;  4R9W A;  1B13 A;  3NE5 B;  3CW2 C;  4K14 A;  1VQE A;  1X56 A;  5FLM G;  2JP1 A;  1N36 L;  4Y7N B;  4R4Q A;  1ASY A;  2GVA A;  5CV4 A;  3R2T A;  1N33 Q;  1ODH A;  3PF5 A;  4G7O C;  1BCP F;  5GAG c;  1O78 A;  3QR8 A;  3RLF A;  1Y1W H;  1Y8O B;  4JI6 L;  8RXN A;  4IAL A;  1FVI A;  4LF9 L;  1K83 H;  4DV5 L;  1JR0 D;  4BBS H;  1KDC A;  5IP9 H;  5IP7 G;  2H1E A;  3RLN A;  4DKA C;  2ZJQ A;  4LFA L;  3O13 A;  3KYV A;  5D65 A;  2OF1 A;  2PMZ E;  1ILP A;  4K9F A;  1L1O B;  3TS0 A;  3TDQ A;  3KLR A;  2VXW A;  3OOC A;  3J7Y W;  3VYR A;  4A93 B;  1DOM A;  2ZXO A;  1JE5 A;  2R7D A;  1W3S A;  5C5L A;  3L9A X;  3A44 A;  2F0K A;  3SK6 A;  5MFZ A;  2A19 A;  1STY A;  3EJI A;  4AIM A;  2NVQ L;  3P1H A;  5G3L D;  3VYU A;  3S16 B;  4GKJ Q;  1N32 L;  2PW5 A;  1QWY A;  1YK4 A;  3M7N A;  3QQC E;  4A93 G;  1KQS A;  2JEA I;  2EY6 A;  1G29 1;  1I94 L;  5C4J B;  3OTO L;  1H9K A;  1CI3 M;  3HOZ L;  4TRD A;  3HOW L;  4RHS A;  1KXL A;  1TWC B;  1Q81 C;  1JC7 A;  2K28 A;  3QOL A;  2JA5 L;  1V43 A;  1PFM A;  3CCR A;  1KAB A;  4OWX B;  3M85 A;  4JYA L;  1EOT A;  3PCO B;  1PDQ A;  1E22 A;  2DY7 A;  1ENC A;  1XNR L;  1E0B A;  4H7B A;  1PRT F;  5M5W H;  2CQO A;  4JOI C;  1SFO L;  1HTP A;  1NTG A;  1WCM G;  5C3W A;  3I7F A;  4ZK9 B;  2D2C C;  1RDP D;  1SLJ A;  2TMP A;  3HKS A;  1VZH A;  3A8K E;  2JEB I;  4X62 Q;  4HJ9 A;  5I6Y A;  4A3B H;  2WKC A;  3NFP I;  3SK4 A;  1VCI A;  1JB3 A;  1VQF A;  2EYJ A;  3D8G A;  4YCV A;  1TWF H;  2E8G A;  4DV4 Q;  1D5X C;  5BR8 L;  1GVP A;  1I6H H;  4BY7 L;  3TP5 A;  4GOP C;  3C1E A;  4A75 A;  2XN9 C;  2K5W A;  5KYL A;  4UP9 A;  2L0Z A;  3S1M H;  4I7A A;  4GS3 A;  2FMM A;  1KAW A;  3G6J B;  1BQQ T;  2OTJ A;  3OSO A;  1O80 A;  1D1I A;  5DEH A;  2UU9 Q;  4CDD C;  1S72 A;  2UUA Q;  2RDG A;  1PV4 A;  3HOU G;  5CC4 A;  1DVB A;  1CZW A;  4JK1 C;  1D6E C;  2QDB A;  3SXH A;  2AUJ D;  2X6L A;  3S1Q L;  3NBH B;  3H91 A;  1AE3 A;  1NY4 A;  2Q2T A;  5M3M G;  3MZ5 A;  3KF8 A;  1CAA A;  1GJX A;  1MIU A;  2A74 C;  4DAY B;  3E0E A;  1IBL Q;  1HHV A;  4OGQ C;  5BN5 A;  3F2B A;  4A3J L;  1QIL A;  5ELF A;  2PNR C;  1HNZ L;  4JG2 A;  3M3Y L;  2LFN A;  1JOQ A;  4KY5 A;  3S15 B;  5FO9 B;  2E2H H;  2KKD A;  1J9O A;  2VZA A;  4RA8 A;  4FF1 A;  5FLX E;  4X66 L;  1MJE A;  4DNT B;  2EZV A;  1RIP A;  3GTO H;  4K5X A;  3OW7 A;  2AQ1 B;  2NVX L;  1EL0 A;  1VQ5 A;  4GN5 A;  4KJO A;  3EA6 A;  1YVC A;  4A3F B;  1QE6 A;  3I56 A;  2A6E C;  1LTT D;  1SE2 A;  1HJP A;  1EIG A;  4BBR L;  2ZM6 Q;  3T16 A;  2V0F A;  5IWA L;  2IX0 A;  4XT3 B;  1WD1 A;  1EU3 A;  1EY8 A;  2OTL A;  5ELO A;  1PH8 A;  3VPB E;  3MHB A;  3ZG6 A;  4LF5 Q;  1CUK A;  2OXP A;  5C44 L;  1HFG A;  1XNQ L;  4O2D A;  4ZQ3 A;  1QCV A;  3H3V C;  4C3I H;  1BE7 A;  3Q22 A;  2VNU D;  2F3W A;  2Z8L A;  4GOP B;  4UP7 A;  1U4M A;  4A3G L;  4RHR A;  3HKZ E;  1S40 A;  4NXM L;  4L8J A;  3KJP A;  3GTL B;  2K32 A;  2NVY L;  3LWO B;  3ERO A;  5FLX L;  1PTO D;  3QJY A;  5J22 A;  2PYK A;  3CQZ L;  5M9O A;  3UDG A;  2YTV A;  4OX9 Q;  2G9D A;  4A3M L;  2FIN B;  1A3T A;  1SRO A;  2UXB Q;  5IOD A;  2MO0 A;  3J7A 5;  2Q2I A;  4G57 A;  4H13 C;  2F0T A;  1HNX Q;  1YEZ A;  3W1G A;  3HOY L;  3MXU A;  2EDG A;  4FYD A;  3OW2 A;  2L0C A;  2FMC A;  2PW7 A;  3CCL A;  3R93 A;  2AQ3 B;  3GTJ L;  1EYC A;  3MFG A;  3S17 L;  1EOV A;  4UP8 A;  5J1Z A;  1V1Q A;  1U4P A;  5IY0 A;  1Q7Y C;  2ZXR A;  1EY5 A;  1EFI D;  1N9W A;  3ND9 A;  3HOV H;  4JW0 A;  3L0O A;  1G91 A;  3E9I A;  4WJ3 M;  3HOX H;  1CQV A;  3NTK A;  4K6D A;  3BG3 A;  5LL6 X;  3R2I A;  3CCV A;  4RGT A;  4IUV A;  1JJG A;  4XGH A;  3RN2 A;  4KLK A;  5KNC A;  4LWC A;  1B3Q A;  2WAQ B;  2XGT A;  1SRU A;  1UUP A;  3DXJ C;  3I55 A;  5TSS A;  3S2D L;  1HA5 A;  2ZTC A;  5C3E H;  4FF2 A;  1HZC A;  3S2H H;  3FKI H;  5AI2 A;  5LHY 1;  4L5R C;  1LAC A;  2A6H D;  1EYD A;  3LX0 A;  2DY8 A;  4A3I H;  5IYC G;  4BY1 H;  1E2V A;  4A3E L;  3D31 A;  5FKA C;  1YK5 A;  2WAQ G;  4AYB G;  5IYD G;  1IBK Q;  4PMW A;  3VR3 A;  4AR6 A;  3FRP B;  1JOR A;  5I9P A;  2C6B A;  3I4M G;  1BR9 A;  1T9H A;  1IL2 A;  5M5X B;  1EWC A;  3MPS A;  1EY7 A;  1NNX A;  3S1N L;  2Q2H A;  5CV5 A;  1B53 A;  4IUT A;  4X6A H;  1SMM A;  3T4A C;  1QUQ A;  2QEJ C;  4GKK L;  3BZD B;  5DLQ E;  2LCQ A;  4PMB A;  3TSS A;  1MJC A;  1LTB D;  1NCV A;  5FLM H;  2XJT A;  1GOZ A;  3I73 A;  2LSS A;  1EY6 A;  3M4O L;  2VQF Q;  2YU9 L;  1KIX A;  3STB D;  1FHM A;  2N88 A;  2UXD L;  3GTG L;  1UE5 A;  1UNS A;  3CC2 A;  5C4H A;  1X3P A;  1XTD A;  1VQ9 A;  4ZKC B;  4Y7N H;  5IP7 H;  2YTX A;  1LKM A;  1PTO C;  2IY5 B;  4LF6 Q;  2R93 L;  1CKN B;  4DV6 Q;  5EAY A;  3PUX A;  4AHZ A;  1NAP A;  1YV1 A;  1PZK D;  4JBJ A;  3EIV A;  1TS2 A;  1XWE A;  1L1O A;  3NEN A;  1Y1V L;  1HQR D;  5IGE A;  2OQK A;  2PVE A;  1ZYR D;  5EGT A;  5M5Y H;  1Q46 A;  4HID A;  3SS2 A;  1DOK A;  4A93 H;  2MP1 A;  1R0J A;  2ES2 A;  1D5Z C;  2P5Z X;  2PQA B;  1XYI A;  1EY4 A;  4K0K L;  2CR8 A;  1TWA L;  1S5F D;  4IPG A;  4B9W A;  3CCJ A;  3CCU A;  4CJ2 C;  2QEX A;  1KRT A;  2H5X A;  3S16 H;  5C4X B;  2Q2U A;  2B2W C;  2EJM A;  5M5W B;  3DEO A;  3F8T A;  1W6J A;  5LMU Q;  4HIK A;  3AMU A;  1KAA A;  5C4J H;  5C6A A;  1KLG D;  3NEL A;  2NN6 I;  3A5U A;  5J39 A;  3KOJ A;  4DR6 Q;  2F4V Q;  2F0F A;  1MSG A;  2PYA A;  1ICW A;  4ID6 A;  5C4X G;  2KVM A;  4QUC A;  1GKH A;  3H0G L;  2CWP A;  1VZI A;  1BVS A;  1Z47 A;  2A6H C;  3KYY A;  3Q24 A;  1WCM H;  4KD4 A;  1PH7 A;  1OTC A;  4JAD A;  2ZTE A;  4HAE A;  3TRE A;  4LUZ A;  1PTO B;  2VB3 X;  1YZ6 A;  4X62 L;  3S1M B;  1PFW A;  2KCM A;  5JVG 1;  1EQT A;  1IU6 A;  1HNW Q;  3J81 i;  1L0Y B;  3SHL A;  2BDO A;  2Y0S E;  3A7A B;  3JAM L;  3H9C A;  1BQ9 A;  1SSO A;  1TU2 B;  2LXK A;  5D3I B;  2NVQ B;  1ET9 A;  3VR5 A;  3BVG A;  2CH4 W;  4HMJ A;  1JOK A;  4CDE C;  2NZ1 D;  1BXT A;  1K0R A;  2JA7 L;  1JJC B;  2JXM B;  3FPP A;  3SEB A;  4C2M H;  5GQO A;  3EBE A;  2UUA L;  3STB C;  3GTQ H;  3HOU H;  1U9R A;  3HOZ B;  4GNX B;  3DWA A;  1GHJ A;  1RD9 D;  4F7X A;  3PIP A;  2FXQ A;  3GQB A;  2SDF A;  2E2H B;  2EY2 A;  5M3M H;  5JEA J;  1A3U A;  2JA5 B;  1STB A;  4C1N I;  2M4V A;  1PFS A;  4HED A;  4PZ8 A;  4OEM B;  1QNU A;  3GTK L;  4DXG A;  2PMZ B;  4BS9 A;  3BDC A;  3NBH A;  3W1B A;  1DM0 B;  4CKB A;  3HOZ G;  3P2A A;  4KKT A;  3HOW G;  1WTH A;  2DN8 A;  4C3H L;  2MO1 A;  4DAY A;  1Q8I A;  3WOF A;  4XXE A;  3CKI B;  5KYI A;  1KC8 C;  4IFD J;  5IGD A;  2CQA A;  4JI2 Q;  1ZYR C;  4EQO A;  2PPB C;  3PKI A;  2JA5 G;  4LF8 L;  1HR0 W;  4O42 A;  5EPJ A;  1UE6 A;  3S14 H;  2QL0 A;  3GO5 A;  3WWN B;  2GN5 A;  1SFO B;  3RZO L;  4GN3 B;  1YJN A;  1YJW A;  1KLU D;  2KJX A;  4C3I B;  4NDX A;  4X64 Q;  3S15 H;  2JK8 A;  2L1B A;  3NHH A;  1BUV T;  4JOI A;  2ZM6 L;  1N8R C;  3L7Z C;  3U58 A;  3S1R L;  3VYS A;  1JB7 A;  4LF5 L;  2QKI C;  3K5O A;  4TVM A;  1AP0 A;  2K01 A;  3AYH B;  4V0B A;  2H12 A;  4LHL A;  3LNN A;  1VQM A;  3C2P A;  1B9N A;  3F2U A;  4XQN A;  1UAP A;  3U9O A;  3PO3 L;  1EQQ A;  2HHH Q;  2Z6B A;  4GOP A;  1R0I A;  1ILQ A;  1LKP A;  2HQL A;  4NB3 A;  3H97 A;  1KRS A;  1LTL A;  1CHP D;  3D6W A;  2NYZ D;  5IGF A;  1IBM L;  4BY7 G;  1SNO A;  5NUC A;  1DZ1 A;  2PZU A;  2PZT A;  1ESR A;  3BJU A;  4LF7 L;  4JAG A;  2F0U A;  3V96 A;  4DV0 Q;  1S4Z A;  1U4R A;  2HD3 A;  3S1Q B;  1SE8 A;  3AU7 A;  4EVO A;  2GA4 B;  3DMU A;  3MVV A;  1PHJ A;  5FLX c;  3HOV B;  3RZT A;  3TBI B;  4FXK C;  2IWH A;  1G6Z A;  1BBW A;  4LFB L;  1LAB A;  5ELE A;  1SEB D;  2N8N A;  4P72 A;  5ELC A;  1BNZ A;  1NSN S;  1G2S A;  2KEC A;  3DEP A;  1QVF A;  1OWB A;  5IYB L;  2LXJ A;  2PZW A;  1LV9 A;  4B3R Q;  2OCE A;  3GTM L;  3PUY A;  1VZG A;  1OO9 B;  4A3J G;  1GUS A;  2NVX B;  1IW7 D;  2YV5 A;  1B7Y B;  1T9O A;  4IQZ A;  4DR2 Q;  3H94 A;  5FK9 C;  4X3U A;  1F2Z A;  4LF4 Q;  3CF5 A;  5M3F L;  1DXM A;  5C3E B;  1CZG A;  1C0A A;  3FKI B;  4BWG B;  5H1S E;  1ML0 D;  1STG A;  3X3M A;  2Z0S A;  4RGM A;  4A3I B;  1JWM D;  4XQJ A;  2HDL A;  2HCI A;  3W2D A;  4DV2 L;  1Y14 B;  3I4L A;  1IRN A;  1X55 A;  4B8C D;  4NKL A;  4A3G B;  2NZO A;  2XJS A;  1PFN A;  4BBR G;  4KHP Q;  4ZKB B;  3M4P A;  4KD3 A;  5IYC H;  5FO7 B;  1A62 A;  2NBF A;  2NVY B;  3NTH A;  3MAQ A;  1IBK L;  1HQM C;  1IZ6 A;  5IYD H;  5C44 G;  2XWJ B;  3RZD H;  3MXN B;  1Q86 C;  3I3C A;  3H3V H;  1KNE A;  2PI2 A;  3FEW X;  3I4M H;  1B9M A;  3VA5 A;  4A3G G;  1LTA D;  4YCU A;  3EVQ A;  5EPL A;  1B2J A;  3LWR B;  4L6T B;  4LK1 C;  1BF4 A;  3CCM A;  3K7U C;  2F03 A;  3HOY B;  3TP8 A;  4DK1 A;  2F0V A;  1SND A;  4DV1 L;  2DNC A;  2R7Z L;  3VR2 A;  1K28 A;  3M4Y A;  4A3M G;  3GTJ B;  5M5X H;  2VQF L;  1B70 B;  2BDN A;  2XWB B;  4IUU A;  1PZI D;  1SYF A;  3MSU A;  4JI4 Q;  3H9B A;  2WV6 D;  1QCB D;  2B2Y A;  3HOY G;  2OQ0 A;  1SJH D;  2K2D A;  3BYY B;  3ULP A;  1YHA A;  3BDL A;  2L4N A;  1M90 C;  5T1G A;  3KDF B;  4LF6 L;  2V0E A;  4DV6 L;  2DJG C;  4HSP A;  4L63 B;  1SDF A;  4GLA C;  5C4Z A;  3T1Y Q;  4DR1 L;  5M5Y B;  1PH9 A;  2E2I L;  1F2L A;  1TS5 A;  3HKZ G;  2V3B B;  4KK7 A;  1CKN A;  2MHV A;  3NUC A;  1PZX A;  4DR4 Q;  4KN7 C;  3S2D B;  3T1H Q;  1RTN A;  1TY0 A;  2K52 A;  1FNU A;  2K5V A;  3WOE A;  1BCP D;  1NR2 A;  1YJ9 A;  3PUZ A;  5CV7 A;  3URY A;  1ONL A;  4BXX L;  2IJ0 A;  5KEE A;  4A3E B;  3SVM A;  2Q8I B;  5LMN Q;  1YI2 A;  2A6E D;  4A3C L;  4Q5V A;  1IW7 C;  1HR0 L;  2AWN A;  2PQA A;  1C4Q A;  3J7Z C;  2KCT A;  1MGS A;  3UI2 A;  3LWQ B;  4XXB B;  1STH A;  1SYB A;  1YBY A;  1VQ8 A;  3S1N B;  1X3G A;  2K5N A;  1U0L A;  4EQ5 A;  1XMO L;  4A3E G;  1O7I A;  1OXV A;  2KED A;  1JCK B;  1F9S A;  5LMU L;  1AW7 A;  1B4O A;  1D5M C;  2VB2 X;  5I2Y A;  4X65 L;  4JV5 Q;  3KYX A;  1WCM B;  1CFM A;  2LKV A;  4TKO B;  5FOB B;  1VMC A;  2RDH A;  2YU9 B;  3A74 A;  1N34 Q;  2PQE A;  5C4X H;  1AE2 A;  3H15 A;  4AI0 A;  4ILW A;  1BDO A;  1M1K C;  1NUC A;  1TKW B;  3I4N L;  4QB4 A;  2LY7 A;  4H0L C;  4QL5 A;  2PSM C;  3A55 A;  1H95 A;  3QB3 A;  5C0X J;  2XJU A;  4HIM A;  5IGB A;  4JI8 Q;  2ICI A;  2MUY A;  2JA9 A;  4A4I A;  2JA6 L;  2WP8 J;  4OO1 I;  4KN4 C;  1TII D;  2FHT A;  4LFC L;  1MD2 D;  4APV A;  2AUK A;  2VL6 A;  2B2U A;  3SE0 A;  3KF6 B;  4N8X 1;  1NMG A;  3V2T A;  4QQB X;  3U9S A;  5COY A;  3P8B A;  3DM3 A;  4C2M B;  4UPA A;  4S3S A;  4PQX A;  3GTQ B;  3LPE B;  4HIO A;  3HOU B;  1PTO H;  3J80 i;  2R93 G;  4AI2 A;  3ONA B;  4DNR B;  1PRT D;  4Y52 L;  1I3Q L;  1KHI A;  1PYW D;  4JI7 Q;  5M3M B;  3JAM c;  2EYO A;  3SDZ A;  5E3F A;  1IKL A;  2KN9 A;  2SEB D;  1K3B C;  4JI5 L;  2NWG A;  4U68 A;  3K80 C;  1Y1V G;  3D4W A;  1LTS D;  1G2T A;  2JA8 L;  2PNH A;  2NVQ H;  1EZ8 A;  1B44 D;  5DNF A;  3AQQ A;  4DUY Q;  3H3V M;  1J5E Q;  3VYT A;  4GNX A;  1B1Z A;  4OO1 G;  3B0A B;  3D0F A;  1PFU A;  2E2J L;  3GV6 A;  3S14 B;  1GUG A;  1S5B D;  1SE3 A;  3A8I E;  4DF7 A;  3PUV A;  3RMH A;  3HOZ H;  3BS1 A;  3HOW H;  2EY1 A;  2RVL A;  5LMN W;  2K5D A;  3P20 A;  1OXU A;  5L37 A;  4JI2 L;  3GP7 A;  1Q1E A;  1AEX A;  3LGJ A;  5AJ3 L;  2JA5 H;  4B3S Q;  3RNU A;  1VS0 A;  2HQE A;  1PH4 A;  1BCP C;  3OIQ A;  4V19 6;  3PIP 1;  3E5S A;  1WFQ A;  1QZH A;  2VQE L;  1B3A A;  3PQI A;  4CDF C;  1WTO A;  1DD2 A;  2B3G A;  1I4R A;  2B8G A;  1U5K A;  4HJA A;  1WTX A;  1PFB A;  1JYB A;  3PUW A;  4JBM A;  1OXS C;  2M00 A;  1XMQ Q;  3ICE A;  3D6C A;  1R4P B;  2B39 A;  2K14 A;  5CV9 A;  3H0G G;  4YY3 L;  1SFO H;  2Y0S P;  4KTA A;  4ODG A;  5JJL A;  4TPU A;  2MS3 A;  1EQV A;  4POF A;  4IUP A;  1A63 A;  4G7H C;  2I5H A;  2R3Z A;  4ABN A;  2HR5 A;  1FHH A;  4C3J L;  2L9H A;  1XPU A;  2JA7 B;  1S30 A;  5K36 G;  1YUZ A;  1SMX A;  1YNJ D;  2HHH L;  1EFW A;  2N55 A;  1F2M A;  2XJP A;  4U67 3;  4BY7 H;  2CFM A;  3FHW A;  1CSQ A;  4DV7 Q;  1FJG Q;  3AFP A;  1KD1 C;  3T53 B;  4DV0 L;  5JPM C;  4DV3 Q;  2JA7 G;  3N52 A;  2RBM A;  4MTK A;  4E6I A;  2ASB A;  1VQI A;  4F88 A;  3GTK B;  1TWG L;  2UUC Q;  4GZY C;  5IGG A;  2RSN A;  3NXW A;  3G71 A;  2BCO A;  3CAM A;  1JT8 A;  4JC0 A;  2NTS A;  4OIJ A;  4KMU C;  4C3H B;  2SNM A;  3KFU A;  1CM9 A;  1D2B A;  4N8F A;  2HCC A;  2Z6K C;  3HJY B;  3S1Q H;  4XYO A;  5I6W A;  4PZ7 A;  3UDX A;  1V1O A;  2F0O A;  4LAA A;  5KRU A;  4A3K L;  1WYD A;  4QIW P;  4A3D L;  1PRT C;  2B2T C;  4DN4 M;  4A3J H;  1BCP B;  3K81 C;  3U50 C;  3T51 B;  4DR2 L;  3NPP A;  1LTR D;  2PO4 A;  3RZO B;  5HGT A;  3M3Y H;  2F0L A;  4LF4 L;  5I4D A;  4C3H G;  4YWM A;  3HAX C;  4ZN3 B;  1RDV A;  2Y0S G;  5F2D A;  1WTP A;  5HY6 A;  3MXP A;  1FL0 A;  3AFQ A;  4YCW A;  3K7A L;  3JAM i;  4ZN1 B;  3ERS X;  3B6Y A;  2NVX H;  3R3O A;  3IU3 I;  3WWL A;  3EQL C;  4AYB B;  2SOB A;  3RZD B;  3RYG A;  4ME3 A;  5FJ8 L;  3M9B A;  3I4M B;  4BBR H;  4KHP L;  5DM7 1;  1VQ7 A;  2QW7 A;  4C1N K;  4V19 0;  2J0T D;  1KTK A;  4ZUJ A;  1K0S A;  3PIP 3;  2HIX A;  2PVX A;  4OHJ A;  5C44 H;  2EXZ A;  2O5I C;  4O1N A;  1XTC D;  1PYB A;  2O4X A;  3P75 A;  2B29 A;  2M9V A;  2ERJ A;  4A3G H;  2I5M X;  3ZYY X;  4AQY Q;  3OHX C;  1VF5 C;  4IPD A;  1GXD C;  3MXN A;  2R92 L;  2F0I A;  4RKL A;  1L0W A;  2ALY B;  2F0J A;  1C48 A;  3PO3 G;  1ZKO A;  2NVY H;  3MXG A;  4IZ8 A;  1HZ9 A;  3E9H A;  2HDM A;  2K04 A;  3CQZ H;  3BZC A;  1DX8 A;  1EUJ A;  1I4H A;  1RHP A;  3KUP A;  4DGZ A;  2SNS A;  4A3M H;  2ID0 A;  2F52 A;  4N9P A;  1C9O A;  4JI0 Q;  1G6P A;  2C5C A;  3RN5 A;  1N33 L;  2UUB Q;  3GTM B;  1K73 C;  3W5O A;  5H1S c;  3HOY H;  1TWH L;  1PRT B;  1WOC A;  1HFN A;  3PMF A;  1TWC L;  1YNJ C;  3E0J A;  4B08 A;  2DNE A;  4CDC C;  3CHB D;  1MHW C;  5KNB A;  1WTR A;  3GTJ H;  3S17 H;  5M3F B;  2AHO B;  1SJE D;  2D0P A;  5IYB G;  1VQ4 A;  4BA2 I;  1O7Y A;  3T1Y L;  3MFY A;  3K35 A;  1B71 A;  1RDG A;  2BH2 A;  3KDF A;  1N36 Q;  4DR4 L;  3LWE A;  1F4L A;  3T1H L;  3VA7 A;  2NUC A;  3PF4 A;  1MKH A;  1SYD A;  3BVM A;  5M3F G;  3KLS A;  1Y69 U;  4JI6 Q;  1TY2 A;  2A73 B;  4IPC A;  5EIO C;  4HN7 A;  4LF9 Q;  1VQJ A;  4GKJ L;  4HR7 B;  1D8L A;  2DGY A;  1B2O A;  2G5D A;  3F2D A;  3SGI A;  3IRB A;  3UE0 A;  5LMN L;  1X65 A;  2Z4H A;  4DXF A;  4LFA Q;  3S2D H;  3CD6 A;  1B8A A;  2EPB A;  2ZXP A;  1LT5 D;  5DM6 1;  1UE7 A;  3KJO A;  1VF7 A;  1T9P A;  3NBI A;  3EN2 A;  3ULJ A;  1GUT A;  3G7L A;  4JAF A;  1GHK A;  2M2L A;  4F8M A;  4A3E H;  3HJW B;  2JI3 A;  4A3L L;  2I07 B;  2M6P A;  5C5M A;  2AQC A;  5KGU A;  1FGB D;  3NWT A;  4M1U B;  3QWN A;  4JBW A;  3IL8 A;  2B5I D;  2R7Z B;  1J8I A;  1AFP A;  2WKD A;  5DM7 3;  3S1N H;  4YWL A;  2K5H A;  5JAV A;  3TQY A;  3HZX A;  2RKS A;  3X3N A;  5E1F A;  1RTO A;  3PO2 L;  2EIF A;  1HZA A;  4JI8 L;  1JJ2 A;  2XVS A;  1YHQ A;  2R7Z G;  1HA6 A;  3M4O H;  4AI1 A;  2YU9 H;  3FP9 A;  2CVR A;  2R61 A;  3K0Y A;  1YNN D;  1VQ6 A;  2A1A A;  1Q3L A;  1II3 A;  1X3F A;  4QMG A;  1CA5 A;  2ERS A;  2VUM L;  1BBX C;  1EIF A;  1V1P B;  1NXG A;  3GTG H;  4DV4 L;  4J6H A;  1CKO A;  2JE6 I;  1BQ8 A;  2L11 A;  1VCX A;  4IN3 A;  1XX8 A;  3KF6 A;  2R93 H;  1WJJ A;  3K5L A;  4KKS A;  4WRD A;  1QQT A;  3H99 A;  4XTC S;  1Y8P B;  3HP3 A;  4JI7 L;  4A3F L;  3F1Z A;  4KY7 A;  4RKB A;  5I2X A;  2NN6 G;  3K6O A;  1HTL D;  3ER0 A;  1UEB A;  3PGZ A;  1CAD A;  1KDB A;  2UU9 L;  3IFT A;  1Q90 A;  1Y1V H;  4P2C B;  3CU7 A;  4NMZ A;  4I65 A;  3HOW B;  3IKJ A;  3GTP L;  3VR6 A;  1NMF A;  5BR8 Q;  2WII B;  1JIC A;  4BXX G;  4MNO A;  2EVB A;  5HUR A;  4OO1 H;  1ROD A;  2KCN A;  1E8J A;  4WOR A;  2I5L X;  1IBL L;  4MTN A;  3HS0 C;  2RDV A;  1TWA H;  1X54 A;  4A3C G;  5A2Q E;  3CCS A;  2WB1 P;  4AR4 A;  1ZXT A;  3CXC A;  1V9P A;  2V4D A;  2F0S A;  5CR3 A;  4UY8 C;  4KJN A;  1FR3 A;  2RSO A;  3ZJY C;  2AWO A;  1K8O A;  4B3M Q;  5CV6 A;  1C8C A;  1CT1 D;  2ZT9 C;  4DK0 A;  1EU4 A;  4DR7 Q;  3DHQ A;  3AB9 A;  4JI1 Q;  1C09 A;  4QIW E;  1R9T L;  5EKL A;  3L2P A;  1SMW A;  2Z3Q B;  5DM6 3;  2JA6 B;  4ZUI A;  3RR5 A;  2RCF A;  1NXE A;  1XMQ L;  4OWW B;  1IL8 A;  3H0G H;  1HNZ Q;  1KL9 A;  3E3X A;  3I4N G;  4F87 A;  4K5W A;  1E3P A;  1A0I A;  3KYH C;  1K8M A;  4X66 Q;  4EQN A;  1EIH A;  4BY7 B;  1SN8 A;  2JA6 G;  5AN9 H;  3Q0A A;  5ELB A;  1WI5 A;  5MFP A;  3KK7 A;  1MSH A;  2LMC B;  5A2Q L;  5K36 H;  1Z9F A;  1TXY A;  4OXP A;  4JI3 Q;  5AFW A;  2B63 L;  1FJG L;  1IHZ A;  2Q8T A;  2AQ2 B;  1LM0 A;  4C56 C;  5BN3 A;  4IUQ A;  5IWA Q;  3PV0 A;  2JA8 B;  2K4K A;  1RL2 A;  4LHN A;  3PIO 1;  4OX9 L;  2MPM A;  1H9S B;  3QOJ A;  4KI0 A;  1XNQ Q;  1A2T A;  4BA1 I;  2JA7 H;  2UXB L;  3K5N A;  2QA4 A;  1BKB A;  1Q12 A;  4XIG S;  1YNN C;  1HNX L;  4FVM A;  3VDY A;  2MFI A;  1SMY D;  2UUC L;  2K33 A;  1PH2 A;  4A3J B;  2NVT L;  2EYF A;  2JA8 G;  2UXC Q;  3M3Y B;  3PKJ A;  4R8N A;  5IGC A;  3FDT A;  5D3D A;  4IUN A;  3NK9 A;  3GTK H;  3I90 A;  1RCV D;  4DAM A;  3BYT B;  4OIK A;  4B3T Q;  1OXT A;  1Z7T A;  1AZQ A;  2CCZ A;  4RG1 A;  2HVY C;  1ICF B;  3J81 E;  1TS3 A;  2XNA C;  3H09 A;  4C3H H;  1OWC A;  2GMG A;  5IOC A;  1Y1W L;  2CW0 D;  4HCS A;  3UDF A;  4HJ5 A;  1P16 A;  4K8J A;  3A0J A;  4BBR B;  4IOC A;  4JCV E;  4CJ1 B;  1K83 L;  4GLX A;  1EEF D;  2F0M A;  3K0X A;  2M4Y A;  4BBS L;  5IP9 L;  2WFW A;  4LW1 A;  1Q82 C;  3RZO H;  2BA0 A;  1EYA A;  5C44 B;  1NNQ A;  2F1M A;  3HEJ A;  4Q0F A;  3NWS A;  1EZ6 A;  2K05 A;  2BA1 A;  4IFD I;  4B9X A;  4HTH A;  2I0Q A;  1O7Z A;  1STN A;  3GV3 A;  3JC6 6;  4C3J B;  1M4V A;  1GD7 A;  2JJQ A;  3RZ6 A;  4KHZ A;  3S1R H;  5D14 A;  2KUM A;  2E75 C;  4R4O A;  5JJK A;  3FPU B;  1L1O C;  1S5D D;  4QCL A;  1BO0 A;  3TEH B;  4FP5 D;  1RF2 D;  1I4Q A;  3CQZ B;  1SYE A;  3BZK A;  4CGY B;  4AQY L;  3LWV B;  1SNC A;  3J81 j;  2AMC B;  4KHV A;  4A3M B;  4NXN Q;  4C3J G;  3S24 A;  3W3A A;  3J81 L;  1EYG A;  3PO3 H;  4I7Z C;  4UHV A;  4R1J A;  2ZIX A;  4MZ9 A;  4ZYS A;  5MGN A;  1KNA A;  1O7L A;  5JEA G;  1RYT A;  1SYG A;  1H9J A;  1QJO A;  2N49 A;  1I5F A;  1HUN A;  5GAD C;  2C35 B;  3GD7 A;  3P7J A;  3S17 B;  3B08 B;  4QGU A;  1X9N A;  5BN4 A;  5JJI A;  1HPC A;  3NSW A;  5IE8 A;  2EYP A;  1QG7 A;  3K5M A;  4IFD G;  2XIW A;  2Q8R E;  3SK8 A;  2Z6K A;  1E1T A;  1QYB A;  3HKZ B;  4DNI A;  5GAD c;  2Z1C A;  1CA6 A;  2M6O A;  3PIO 3;  1S2Z A;  3NQT A;  5M5W L;  2Z4I A;  5IYB H;  4GKK Q;  4DUZ Q;  2B2T A;  2BOS A;  3N6R A;  1TT2 A;  3RD4 A;  5FO8 B;  3GTM H;  2YTY A;  4A3K G;  3K7A B;  2FFK B;  4MN3 A;  4A3D G;  1E2W A;  2APO B;  3R8B A;  2F0H A;  2EYH A;  4FO2 A;  1ZRP A;  3VR4 A;  3J7Y 1;  2CHB D;  4MIU A;  5G3L F;  1SMY C;  3DM1 A;  5M3F H;  4RFB A;  1VQN A;  3IFD A;  4A3B L;  2J9U B;  1D7Q A;  2UXD Q;  2MNA A;  1F9R A;  3CPF A;  5EPK A;  1TWF L;  1JE4 A;  2B2V C;  1I6H L;  1AN8 A;  1DOL A;  1ENF A;  3S9W A;  2QGQ A;  3OWE B;  1FYC A;  3S1M L;  1RJT A;  3Q8D A;  1I4P A;  2EY4 E;  5CV8 A;  5FJ8 G;  4YWK A;  3BU2 A;  1LUZ A;  4EGV A;  4RXN A;  1BRF A;  1SBB B;  3MEH A;  2R92 B;  4IO9 A;  1Q1B A;  1QB5 D;  1WD0 A;  2K75 A;  1DJR D;  1UEA B;  2E76 C;  5HGQ A;  2CW0 C;  1EEI D;  1BBU A;  2KHJ A;  2CKA A;  1PH1 A;  4EX5 A;  3G4S A;  2XSC A;  2WB1 E;  4DR6 L;  2BE5 D;  3M4O B;  2R92 G;  2F4V L;  1VDZ A;  4K0K Q;  4RGN A;  2F0W A;  1TWH B;  5JVH 3;  2D0O A;  2O2L D;  4AR3 A;  1L0X B;  3HFZ B;  1LO5 D;  4DAV A;  2EJG C;  3GTG B;  2E2H L;  2R7Z H;  4DR5 Q;  4U67 1;  3I2Z A;  1F9P A;  1MI2 A;  5EKK A;  3GTO L;  2CH4 A;  3ULL A;  2R93 B;  3M7G A;  3G48 A;  1HNW L;  1E24 A;  1R0H A;  2X6G A;  1GUW A;  1EY0 A;  5KIX A;  1Y1V B;  1F9Q A;  1V1P A;  1A8V A;  1P8L A;  2VW9 A;  1S5E D;  5DAU A;  3PZA A;  3QVD A;  4XT1 B;  4DFA A;  4WFN 3;  2E2I H;  2XRQ D;  4C3I L;  2NN6 H;  3DWQ A;  4QF4 A;  4NPS A;  3ERQ A;  4GN4 B;  1TWA B;  1TR5 A;  3UDI A;  1M8A A;  5E7N A;  3I91 A;  4AHW A;  1W2B A;  4CKC A;  3AEV A;  4BXX H;  3I70 A;  1JOO A;  1YIJ A;  2A69 D;  4P74 A;  3K59 A;  1PXU A;  1FNW A;  4C2M 1;  2L55 A;  4A3C H;  1CK1 A;  2HUG A;  3G6E A;  1YNX A;  5LL6 S;  2B2W A;  1Z6H A;  4YHH Q;  4B3M L;  5IT9 E;  1EWH A;  4A3L G;  2EYM A;  3H0G B;  3CCE A;  4DR7 L;  3PO2 B;  1L2F A;  1A6X A;  4JI1 L;  4UAI A;  4RCN A;  2D9U A;  5EBD A;  4TSS A;  3WWV A;  2QIL A;  1S24 A;  4WJW A;  3HOV L;  4X64 L;  1F2Y A;  3LNL A;  1LT4 D;  1QZG A;  3J7Z 1;  3HGB A;  4PV1 C;  4DR3 Q;  5T1I A;  1EQR A;  4N9T A;  4RAU C;  2C6A A;  3I4N H;  4WJ4 A;  2VUM B;  3OIP A;  3HOX L;  3SK5 A;  3TZD A;  3PO2 G;  4PG3 A;  3PIO A; 
#chains in the Genus database with same CATH homology
 1S3O A;  1H7V A;  2JA6 H;  4LF8 Q;  4LUV A;  5GRO A;  2EXD A;  3JC6 3;  4GLV B;  2VUM G;  4G6B A;  4JI3 L;  2MQH A;  5C0X I;  2CKC A;  1PH3 A;  4AHX A;  1PH6 A;  4ALP A;  1BFY A;  2E5L Q;  4Y52 H;  1X6O A;  1I3Q H;  4A3F G;  4H02 A;  3TRZ A;  2JA8 H;  2UXC L;  2NYD A;  1LKO A;  1SMU A;  1J6Q A;  2L15 A;  3PSI A;  1HH2 P;  2HT1 A;  1IBM Q;  2A68 D;  2F3I A;  4B3R L;  2E2J H;  4B3T L;  4LF7 Q;  1UWV A;  4QJF A;  2RF4 A;  5C0X G;  5AI3 A;  2CWA A;  4HJ8 A;  3A5Z B;  4LFB Q;  3CMA A;  1AH9 A;  4JBK A;  1PVO A;  1VQP A;  1IXR A;  3MEF A;  1PH5 A;  3H3V I;  2R6G A;  5J3B A;  2YYZ A;  2XJQ A;  1VQA A;  2BH8 A;  2RCN A;  3OYY A;  1R0G A;  1GO3 E;  1PYS B;  1EWI A;  4DPG A;  2HIV A;  3KYU A;  4NXN L;  2PPT A;  4C3J H;  4DV2 Q;  3F2C A;  1PA6 A;  2N78 A;  2B63 G;  3DLL A;  4AR5 A;  2XJV A;  4J15 A;  2KHI A;  3J81 c;  1VQG A;  1UE1 A;  4AHY A;  2GVB A;  4JI4 L;  4PZ6 A;  1TWG H;  3K8A A;  4AH6 A;  2ATW A;  3NEM A;  1WJV A;  2D62 A;  4DUZ L;  2DSX A;  2IHE A;  4A3K H;  4DV1 Q;  1VQD A;  2O5J D;  4A3D H;  1I50 H;  2OWO A;  3CPW A;  1NBW A;  2KBN A;  1Y1W G;  1VQC A;  4HJ7 A;  4OON A;  3K7A H;  4DV5 Q;  4BBS G;  1K8G A;  5IP9 G;  4A76 A;  5FJ8 H;  4DR1 Q;  4LNQ A;  2XJR A;  1NJI C;  4L5S A;  1VQB A;  4JV5 L;  1N32 Q;  1IYJ B;  2IHF A;  1N34 L;  1VQH A;  2R92 H;  1IU5 A;  4GNX C;  1I94 Q;  3TS2 A;  3OTO Q;  2VY3 A;  1HR0 Q;  4DR5 L;  4POG A;  1EIY B;  1XMO Q;  2IT1 A;  4X65 Q;  4JYA Q;  1TWH H;  4L5Q A;  1TWC H;  1IRO A;  5RXN A;  4OWT B;  4LUO A;  1LYL A;  1E1O A;  2AYJ A;  1XNR Q;  4E6Y A;  1CSP A;  3KYW A;  1RB9 A;  1QVC A;  2ZJR A;  1E7Z A;  4R4C A;  4LFC Q;  2N3S A;  3U4Z A;  4A3B G;  4P73 A;  5GAE C;  4DUY L;  1CKM A;  1YIT A;  1J5E L;  5MLC 3;  1OXX K;  4YHH L;  5GAE c;  5GAH C;  2ZTD A;  4TQU S;  4JI5 Q;  3JC6 2;  4O0A A;  4JAE A;  1RYQ A;  4A3L H;  4B3S L;  3KF8 B;  1XPR A;  3CME A;  2WAQ E;  4AYB E;  1QVG A;  1YUX A;  1ASZ A;  4DR3 L;  5GAH c;  1YHB A;  3UE1 A;  1FGU A;  4IJH A;  2PI2 E;  3PO2 H;  2JQO A;  2R7F A;  3CC7 A;  7RXN A;  5AJ3 Q;  4FDB A;  2A8V A;  1NE3 A;  2VQE Q;  1SR3 A;  1RWD A;  4L5T A;  5K2M E;  2VUM H;  1Q8K A;  4IPH A;  4IOA A;  2EQS A;  1C7Y A;  5MF6 A;  4DV7 L;  2CKZ B;  3CP0 A;  4YY3 Q;  2E5L L;  2Z3R B;  4DV3 L;  4R4I A;  4A3F H;  2IX1 A;  2WB1 G;  1JMC A;  6RXN A;  5IT9 c;  4GS7 D;  4NXM Q;  3CC4 A;  5ELN A;  3GTP H;  2ZJP A;  3RLO A;  1DGS A;  1HZB A;  4DK3 C;  3GTL H;  1VQL A;  1K9M C;  1XJV A;  4QY7 A;  2DUD A;  1VQK A;  5EIN C;  4AI3 A;  3KLW A;  2XTI A;  4IJL A;  4RMF A;  1R9T H;  2RHS B;  1VQO A;  2VS1 A;  3HOV G;  4UY8 1;  1K3R A;  3GDE A;  1X3E A;  2RHQ B;  3HOX G;  1T9Q A;  3U4V A;  5JVH 1;  2V1C C;  1XPO A;  4R4T A;  3M4Q A;  2NZH A;  4P71 A;  2KEN A;  2JI1 A;  1K8A C;  2JI2 A;  1VQ9 A;  4TVA B;  2B63 H;  5C3E G;  3FKI G;  3PWF A;  1GM5 A;  4A3I G;  4P75 A;  4BY1 G;  1G51 A;  4JI0 L;  2UUB L;  4DK6 C;  4WFN 1;  2K50 A;  1QUQ B;  2AKW B;  2NVT H;  3J80 c;  1Z92 B;  1R0F A;  5GAG C;  3I4O A;  3CCQ A;  1B13 A;  3CW2 C;  1VQE A;  1X56 A;  5FLM G;  1N36 L;  4R4Q A;  1ASY A;  2GVA A;  1N33 Q;  1ODH A;  3PF5 A;  5GAG c;  3RLF A;  1Y1W H;  4JI6 L;  8RXN A;  1FVI A;  4LF9 L;  1K83 H;  4DV5 L;  4BBS H;  5IP7 G;  5IP9 H;  3RLN A;  4DKA C;  2ZJQ A;  4LFA L;  3KYV A;  2PMZ E;  4K9F A;  1L1O B;  3TS0 A;  1JE5 A;  2R7D A;  1W3S A;  3A44 A;  5MFZ A;  2A19 A;  4AIM A;  4GKJ Q;  1N32 L;  3M7N A;  1YK4 A;  3QQC E;  4A93 G;  1KQS A;  2JEA I;  1G29 1;  1I94 L;  3OTO L;  1KXL A;  1Q81 C;  1V43 A;  3CCR A;  4OWX B;  3M85 A;  4JYA L;  3PCO B;  1E22 A;  1XNR L;  5M5W H;  2CQO A;  4JOI C;  1NTG A;  1WCM G;  3I7F A;  1SLJ A;  3HKS A;  1VZH A;  4HJ9 A;  2JEB I;  4X62 Q;  4A3B H;  3NFP I;  1VCI A;  1VQF A;  4YCV A;  1TWF H;  2E8G A;  4DV4 Q;  5BR8 L;  1GVP A;  1I6H H;  4GOP C;  4A75 A;  4UP9 A;  2L0Z A;  3S1M H;  4GS3 A;  1KAW A;  2OTJ A;  2UU9 Q;  1S72 A;  2UUA Q;  1PV4 A;  3HOU G;  1DVB A;  3NBH B;  1AE3 A;  1NY4 A;  2Q2T A;  5M3M G;  1CAA A;  1MIU A;  4DAY B;  3E0E A;  1IBL Q;  3F2B A;  1HNZ L;  4JG2 A;  2E2H H;  2KKD A;  2VZA A;  4X66 L;  1MJE A;  1RIP A;  3GTO H;  1VQ5 A;  4GN5 A;  1YVC A;  3I56 A;  1HJP A;  2ZM6 Q;  2V0F A;  5IWA L;  2IX0 A;  2OTL A;  5ELO A;  1PH8 A;  3VPB E;  3ZG6 A;  4LF5 Q;  1CUK A;  1XNQ L;  4O2D A;  1QCV A;  4C3I H;  1BE7 A;  2VNU D;  4GOP B;  4UP7 A;  3HKZ E;  1S40 A;  4NXM L;  3KJP A;  3UDG A;  2YTV A;  4OX9 Q;  1SRO A;  2UXB Q;  2MO0 A;  3J7A 5;  2Q2I A;  1HNX Q;  1YEZ A;  3W1G A;  3OW2 A;  3CCL A;  4UP8 A;  1EOV A;  1V1Q A;  5IY0 A;  1Q7Y C;  1N9W A;  3HOV H;  3L0O A;  3E9I A;  4WJ3 M;  3HOX H;  3CCV A;  1JJG A;  4XGH A;  3RN2 A;  4KLK A;  4LWC A;  2XGT A;  1SRU A;  3I55 A;  2ZTC A;  5C3E H;  1HZC A;  3S2H H;  3FKI H;  5AI2 A;  4L5R C;  2A6H D;  4A3I H;  5IYC G;  4BY1 H;  3D31 A;  1YK5 A;  2WAQ G;  4AYB G;  5IYD G;  1IBK Q;  4PMW A;  4AR6 A;  2C6B A;  3I4M G;  1T9H A;  1IL2 A;  3MPS A;  2Q2H A;  4X6A H;  1SMM A;  1QUQ A;  4GKK L;  5DLQ E;  2LCQ A;  1MJC A;  5FLM H;  2XJT A;  2LSS A;  2VQF Q;  1KIX A;  3STB D;  1FHM A;  2UXD L;  1UE5 A;  3CC2 A;  1XTD A;  4Y7N H;  5IP7 H;  2YTX A;  1LKM A;  2IY5 B;  4LF6 Q;  1CKN B;  4DV6 Q;  5EAY A;  3PUX A;  4AHZ A;  1YV1 A;  4JBJ A;  3EIV A;  1L1O A;  3NEN A;  2OQK A;  2PVE A;  5M5Y H;  1Q46 A;  4HID A;  3SS2 A;  4A93 H;  1R0J A;  2ES2 A;  2PQA B;  4K0K L;  2CR8 A;  4IPG A;  3CCJ A;  3CCU A;  2QEX A;  1KRT A;  2H5X A;  3S16 H;  2Q2U A;  3F8T A;  5LMU Q;  4HIK A;  5C4J H;  3NEL A;  2NN6 I;  3A5U A;  3KOJ A;  4DR6 Q;  2F4V Q;  5C4X G;  2PYA A;  1GKH A;  2CWP A;  1VZI A;  1BVS A;  1Z47 A;  3KYY A;  1WCM H;  1PH7 A;  1OTC A;  4JAD A;  2ZTE A;  3TRE A;  4LUZ A;  1YZ6 A;  4X62 L;  2KCM A;  5JVG 1;  1HNW Q;  1IU6 A;  3J81 i;  2Y0S E;  1BQ9 A;  2LXK A;  1K0R A;  1JJC B;  4C2M H;  5GQO A;  3EBE A;  2UUA L;  3STB C;  3GTQ H;  3HOU H;  4GNX B;  3PIP A;  2FXQ A;  5M3M H;  5JEA J;  2M4V A;  1PFS A;  4PZ8 A;  3W1B A;  3HOZ G;  3P2A A;  3HOW G;  2MO1 A;  1KC8 C;  4IFD J;  4JI2 Q;  3PKI A;  2JA5 G;  4LF8 L;  1HR0 W;  1UE6 A;  3S14 H;  2QL0 A;  3GO5 A;  3WWN B;  2GN5 A;  4GN3 B;  1YJN A;  1YJW A;  3S15 H;  4X64 Q;  2JK8 A;  4JOI A;  2ZM6 L;  1N8R C;  3L7Z C;  3U58 A;  1JB7 A;  4LF5 L;  4TVM A;  3AYH B;  2H12 A;  4LHL A;  1VQM A;  1EQQ A;  2HHH Q;  4GOP A;  1R0I A;  1LKP A;  2HQL A;  4NB3 A;  1KRS A;  1LTL A;  1IBM L;  4BY7 G;  3BJU A;  4LF7 L;  4JAG A;  4DV0 Q;  1SE8 A;  1PHJ A;  5FLX c;  3RZT A;  1BBW A;  4LFB L;  2N8N A;  4P72 A;  1QVF A;  1OWB A;  2LXJ A;  4B3R Q;  2OCE A;  3PUY A;  1VZG A;  4A3J G;  1IW7 D;  2YV5 A;  1B7Y B;  1T9O A;  4DR2 Q;  4LF4 Q;  3CF5 A;  1C0A A;  5H1S E;  2Z0S A;  4DV2 L;  1Y14 B;  1IRN A;  1X55 A;  4B8C D;  2NZO A;  2XJS A;  4BBR G;  4KHP Q;  3M4P A;  5IYC H;  1A62 A;  1IBK L;  1IZ6 A;  5IYD H;  5C44 G;  3RZD H;  3MXN B;  1Q86 C;  3H3V H;  2PI2 A;  3I4M H;  4A3G G;  4YCU A;  1B2J A;  3CCM A;  3K7U C;  4DV1 L;  4A3M G;  5M5X H;  2VQF L;  1B70 B;  3MSU A;  4JI4 Q;  3HOY G;  2OQ0 A;  2K2D A;  3ULP A;  1YHA A;  1M90 C;  3KDF B;  4LF6 L;  2V0E A;  4DV6 L;  4GLA C;  3T1Y Q;  4DR1 L;  1PH9 A;  3HKZ G;  2V3B B;  1CKN A;  4DR4 Q;  3T1H Q;  2K52 A;  2K5V A;  1YJ9 A;  3PUZ A;  5LMN Q;  1YI2 A;  2A6E D;  1HR0 L;  2AWN A;  2PQA A;  3J7Z C;  2KCT A;  4XXB B;  1YBY A;  1VQ8 A;  1X3G A;  2K5N A;  1U0L A;  4EQ5 A;  1XMO L;  4A3E G;  1O7I A;  1OXV A;  5LMU L;  4X65 L;  4JV5 Q;  3KYX A;  3A74 A;  1N34 Q;  5C4X H;  1AE2 A;  3H15 A;  4AI0 A;  1M1K C;  4QL5 A;  2PSM C;  1H95 A;  5C0X J;  2XJU A;  4HIM A;  4JI8 Q;  2JA9 A;  4A4I A;  2WP8 J;  4OO1 I;  4LFC L;  4APV A;  2VL6 A;  3KF6 B;  1NMG A;  4QQB X;  3P8B A;  3DM3 A;  4UPA A;  3LPE B;  4HIO A;  3J80 i;  2R93 G;  4AI2 A;  1KHI A;  4JI7 Q;  3JAM c;  2KN9 A;  4JI5 L;  3K80 C;  1Y1V G;  2PNH A;  2NVQ H;  3AQQ A;  4DUY Q;  1J5E Q;  4GNX A;  4OO1 G;  3B0A B;  3D0F A;  3PUV A;  3HOZ H;  3HOW H;  5LMN W;  1OXU A;  4JI2 L;  1Q1E A;  3LGJ A;  5AJ3 L;  2JA5 H;  4B3S Q;  3RNU A;  1VS0 A;  1PH4 A;  4V19 6;  3PIP 1;  1WFQ A;  1QZH A;  2VQE L;  2B3G A;  1U5K A;  4HJA A;  1JYB A;  3PUW A;  4JBM A;  1OXS C;  1XMQ Q;  3ICE A;  2K14 A;  3H0G G;  4YY3 L;  1SFO H;  5JJL A;  4TPU A;  2MS3 A;  4POF A;  1A63 A;  2I5H A;  2HR5 A;  1FHH A;  1XPU A;  5K36 G;  1S30 A;  1YUZ A;  1SMX A;  2HHH L;  1EFW A;  2XJP A;  4BY7 H;  1FJG Q;  2CFM A;  1CSQ A;  3FHW A;  4DV7 Q;  3AFP A;  1KD1 C;  4DV0 L;  4DV3 Q;  2JA7 G;  2ASB A;  1VQI A;  2UUC Q;  3G71 A;  3CAM A;  1JT8 A;  4JC0 A;  3KFU A;  2Z6K C;  3S1Q H;  4PZ7 A;  3UDX A;  1WYD A;  4A3J H;  3U50 C;  3K81 C;  4DR2 L;  3M3Y H;  4LF4 L;  4YWM A;  4ZN3 B;  1RDV A;  2Y0S G;  5HY6 A;  1FL0 A;  3AFQ A;  4YCW A;  3JAM i;  4ZN1 B;  3ERS X;  3B6Y A;  2NVX H;  3IU3 I;  3WWL A;  3RYG A;  4ME3 A;  3M9B A;  4BBR H;  4KHP L;  5DM7 1;  1VQ7 A;  2HIX A;  2PVX A;  5C44 H;  1PYB A;  2B29 A;  2ERJ A;  4A3G H;  2I5M X;  4AQY Q;  4IPD A;  1L0W A;  2ALY B;  3PO3 G;  2NVY H;  1HZ9 A;  3E9H A;  3CQZ H;  3BZC A;  1DX8 A;  1EUJ A;  4A3M H;  2ID0 A;  2F52 A;  1C9O A;  4JI0 Q;  1G6P A;  3RN5 A;  1N33 L;  2UUB Q;  1K73 C;  3W5O A;  5H1S c;  3HOY H;  1WOC A;  3GTJ H;  3S17 H;  2AHO B;  2D0P A;  5IYB G;  1VQ4 A;  4BA2 I;  3T1Y L;  3K35 A;  1B71 A;  1RDG A;  2BH2 A;  3KDF A;  1N36 Q;  4DR4 L;  3T1H L;  3PF4 A;  1MKH A;  5M3F G;  4JI6 Q;  4IPC A;  5EIO C;  4LF9 Q;  1VQJ A;  4GKJ L;  1D8L A;  2DGY A;  1B2O A;  3F2D A;  3SGI A;  3IRB A;  3UE0 A;  5LMN L;  1X65 A;  4LFA Q;  3S2D H;  3CD6 A;  1B8A A;  5DM6 1;  1UE7 A;  3KJO A;  1T9P A;  3EN2 A;  3ULJ A;  4JAF A;  4A3E H;  2JI3 A;  2M6P A;  4JBW A;  2B5I D;  3S1N H;  4YWL A;  2K5H A;  3TQY A;  2EIF A;  1HZA A;  4JI8 L;  1JJ2 A;  1YHQ A;  2R7Z G;  3M4O H;  4AI1 A;  2YU9 H;  3FP9 A;  1VQ6 A;  2A1A A;  1X3F A;  2ERS A;  1EIF A;  1NXG A;  3GTG H;  4DV4 L;  1CKO A;  2JE6 I;  1BQ8 A;  1VCX A;  2R93 H;  3KF6 A;  1WJJ A;  4XTC S;  4JI7 L;  3F1Z A;  2NN6 G;  3ER0 A;  1UEB A;  3PGZ A;  1CAD A;  2UU9 L;  1Y1V H;  1NMF A;  5BR8 Q;  4BXX G;  4MNO A;  1E8J A;  2I5L X;  1IBL L;  4MTN A;  2RDV A;  1TWA H;  1X54 A;  4A3C G;  3CCS A;  4AR4 A;  3CXC A;  1V9P A;  4UY8 C;  3ZJY C;  2AWO A;  4B3M Q;  4DR7 Q;  4JI1 Q;  1C09 A;  4QIW E;  3L2P A;  1SMW A;  2Z3Q B;  3RR5 A;  1NXE A;  1XMQ L;  4OWW B;  3H0G H;  1HNZ Q;  1KL9 A;  3I4N G;  1E3P A;  1A0I A;  3KYH C;  4X66 Q;  1SN8 A;  2JA6 G;  5AN9 H;  1WI5 A;  5MFP A;  1Z9F A;  1TXY A;  4OXP A;  4JI3 Q;  1FJG L;  1LM0 A;  5IWA Q;  3PV0 A;  2K4K A;  1RL2 A;  4LHN A;  3PIO 1;  4OX9 L;  4KI0 A;  1XNQ Q;  4BA1 I;  2JA7 H;  2UXB L;  2QA4 A;  1BKB A;  1Q12 A;  4XIG S;  1HNX L;  3VDY A;  2MFI A;  2UUC L;  1PH2 A;  2JA8 G;  2UXC Q;  3PKJ A;  3GTK H;  4DAM A;  4B3T Q;  1OXT A;  2CCZ A;  4RG1 A;  4C3H H;  1OWC A;  2GMG A;  3UDF A;  4HJ5 A;  1P16 A;  3A0J A;  4IOC A;  4JCV E;  4GLX A;  3K0X A;  2M4Y A;  2WFW A;  4LW1 A;  1Q82 C;  3RZO H;  2BA0 A;  1NNQ A;  2BA1 A;  4IFD I;  2I0Q A;  3JC6 6;  1GD7 A;  2JJQ A;  3RZ6 A;  4KHZ A;  3S1R H;  4R4O A;  5JJK A;  1L1O C;  3TEH B;  3BZK A;  4AQY L;  3J81 j;  2AMC B;  4NXN Q;  3S24 A;  1EYG A;  3PO3 H;  4R1J A;  2ZIX A;  4MZ9 A;  5MGN A;  5JEA G;  1RYT A;  2N49 A;  1I5F A;  5GAD C;  2C35 B;  3GD7 A;  3B08 B;  4QGU A;  1X9N A;  5JJI A;  5IE8 A;  4IFD G;  2Z6K A;  1E1T A;  1QYB A;  4DNI A;  5GAD c;  2M6O A;  1S2Z A;  5IYB H;  4GKK Q;  4DUZ Q;  3GTM H;  2YTY A;  4A3K G;  4A3D G;  1ZRP A;  3J7Y 1;  5M3F H;  1VQN A;  2J9U B;  1D7Q A;  2UXD Q;  2MNA A;  3CPF A;  2QGQ A;  3Q8D A;  5FJ8 G;  4YWK A;  3BU2 A;  1LUZ A;  4RXN A;  1BRF A;  4IO9 A;  1Q1B A;  2K75 A;  5HGQ A;  1BBU A;  2KHJ A;  2CKA A;  1PH1 A;  4EX5 A;  3G4S A;  2WB1 E;  4DR6 L;  2BE5 D;  2R92 G;  2F4V L;  4K0K Q;  2D0O A;  4AR3 A;  3HFZ B;  2R7Z H;  4DR5 Q;  4U67 1;  3I2Z A;  3ULL A;  3G48 A;  1HNW L;  1E24 A;  1R0H A;  2VW9 A;  1A8V A;  1P8L A;  3PZA A;  3QVD A;  2E2I H;  4NPS A;  4GN4 B;  3UDI A;  5E7N A;  4AHW A;  1W2B A;  3AEV A;  4BXX H;  1YIJ A;  2A69 D;  4P74 A;  4A3C H;  3G6E A;  1YNX A;  4YHH Q;  4B3M L;  4A3L G;  3CCE A;  4DR7 L;  1L2F A;  4JI1 L;  3WWV A;  1S24 A;  4X64 L;  3LNL A;  1QZG A;  3J7Z 1;  4DR3 Q;  1EQR A;  2C6A A;  3I4N H;  4WJ4 A;  3PO2 G;  4PG3 A;  3PIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...