5IY0A

Pfmcm n-terminal domain double hexamer
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title Structure of a double hexamer of the Pyrococcus furiosus minichromosome maintenance protein N-terminal domain.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication dna binding protein
total genus 72
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5iy0A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iy0A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 5iy0A01
3FKIH 4POGA 3HOYH 4A3EG 3RZDH 2NVTH 2D0OA 3AYHB 2PYAA 1OXSC 3OYYA 1R0HA 1X3FA 4LWCA 3WWVA 5LMUQ 1JB7A 2UUBL 1D7QA 1Q1EA 1K8GA 3I4MG 4R1JA 5AI3A 4BY1G 3E0EA 5IWAL 4A3KH 2BA0A 1PHJA 3M7NA 4A3CG 1FHMA 1OXXK 1R0IA 1Q1BA 3S17H 1YNXA 2AWNA 1S24A 1UWVA 4GLAC 2R7ZG 4DR7L 1MKHA 3GTPH 4DUZQ 1VQBA 1AE3A 3HOUG 4OXPA 5IE8A 4MZ9A 3CD6A 1NMGA 1R0JA 6RXNA 4X66Q 4A3BH 4IFDI 3EBEA 1VQ9A 2UU9Q 2A8VA 1VQLA 1H7VA 1YK4A 5GROA 2WAQE 2HHHQ 1RDGA 4DR6Q 1NY4A 4LFCL 4B3ML 2NN6I 1IBMQ 4K0KL 1CAAA 2CQOA 3CAMA 5FJ8H 3LGJA 1C7YA 1SN8A 1EFWA 4A3DH 3CCQA 2ZM6L 4DV2Q 3PWFA 1L0WA 3S1RH 3GTOH 1TXYA 2UXCQ 4GLXA 1HR0W 4J15A 2WB1E 4NXNL 1YV1A 4DPGA 4HJ5A 3I7FA 2ZJPA 2MFIA 1VQ5A 4RMFA 4C3JH 5C3EG 3U4VA 4QY7A 4IPHA 5IY0A 2JE6I 1LKPA 4HJ9A 1QUQA 3CC2A 1GVPA 4A3MG 3S1NH 4AQYQ 2BH2A 7RXNA 1B71A 1SR3A 1IBLL 5C44H 1FJGQ 3PO2H 3PUYA 2PQAA 4HJAA 4O0AA 1YBYA 3G4SA 1HNZQ 4P75A 1LKOA 1HZCA 1W3SA 4B3TQ 1YUZA 3H15A 2ZJRA 3CCJA 2JA8H 1V43A 5FLXc 4L5RC 4YHHL 3S2HH 3S1QH 4P72A 4P74A 1GO3E 3MXNB 4DR2Q 2HIVA 2CWPA 3CW2C 1VQCA 1A62A 4R4CA 3CMAA 3ULPA 4B3SQ 3RYGA 3FKIG 3RNUA 3HOYG 4LNQA 4PG3A 5M5YH 1N36L 1HNXL 4X64Q 2EXDA 1LM0A 4LF4L 1T9QA 4Y52H 5JJKA 2N8NA 3M4QA 3UE1A 1FJGL 3TQYA 4A3KG 2E5LQ 3RN5A 1CADA 4OX9L 4A75A 4IOAA 1Q81C 1UE6A 5M5WH 3GO5A 2IHEA 3BU2A 3STBD 4TQUS 3GTJH 4GNXB 3OW2A 4A93G 2CKZB 2WAQG 3CCVA 1EWIA 4LUOA 4PZ7A 2UUAQ 2UUCL 4A3BG 4JI5L 4OO1G 1VQIA 2DUDA 2UXBL 4B3SL 3S2DH 1X9NA 2PNHA 3ZJYC 1E7ZA 2VNUD 3CCLA 2YU9H 4GS3A 1BQ9A 1C09A 4OO1I 4JI0L 1YEZA 2WB1G 3U58A 1A0IA 5IYBH 1NTGA 3UDGA 2KHJA 1KAWA 4DR3Q 3BJUA 1PH5A 5FJ8G 4WJ4A 2KBNA 5IT9c 3A5ZB 4DV3L 4A3DG 1XPOA 4A3FH 3PO3H 3KYYA 4JI4Q 2D0PA 4JBJA 1T9PA 1Z47A 4KHZA 1KD1C 1IYJB 3D31A 2MQHA 4LF8L 4LUZA 3UDXA 4X62Q 1XMQL 3PCOB 5GAGC 1XMOQ 2CFMA 2RHQB 4MTNA 2RF4A 3I4OA 3RLOA 3I4NH 1YHQA 4NXML 3GTKH 4BBSH 3TS2A 1I3QH 1B7YB 3KYUA 3PO2G 4DV4Q 5C44G 4YY3Q 4UP8A 2PVXA 2LXJA 2ZTDA 4GKJL 4X6AH 2B3GA 1QVFA 1RB9A 2HR5A 2HIXA 1QVGA 3CCMA 3T1YQ 2JA8G 5ELOA 1BFYA 1C9OA 3RLFA 4AR6A 3PUVA 3JC63 2VQFL 2GN5A 4OWWB 1SMUA 2CWAA 3UDFA 4TPUA 1PYBA 2KKDA 3L0OA 1XMOL 3TS0A 3GD7A 1SMWA 4UP7A 3DLLA 2Y0SE 1EUJA 1RWDA 3KF6B 2JQOA 1ZRPA 1JYBA 1J6QA 1VQGA 2JA5H 3H3VH 4FDBA 5LMNQ 3MPSA 1OXVA 4R4TA 1EQQA 4WJ3M 2E2HH 2UXDL 3F2DA 2K75A 4GOPB 3CC7A 1N8RC 1L1OA 2F52A 1VQ7A 4DAYB 1SMMA 4KHPL 5JEAJ 1XNQL 3M9BA 1PH9A 1K73C 1VQKA 1TWHH 3GDEA 3HOXH 1MJCA 1E8JA 5BR8L 2HQLA 5GAHC 1I5FA 4R4IA 2QL0A 4B3RL 1Q82C 4OONA 3K80C 4X65Q 1T9OA 4BA2I 4LFBL 1E1OA 2QGQA 2VW9A 2YV5A 1VQHA 3KYVA 4L5TA 1E1TA 3CPFA 4JG2A 3W5OA 1VQPA 4DV7L 1BE7A 1M90C 1DVBA 3HOZH 1UE7A 4JCVE 5IYBG 2VUMH 1U0LA 2B63H 2ZJQA 4LF6L 4JI3Q 4UPAA 2PI2E 4R4OA 1X65A 2OCEA 5GAEC 4HIKA 1W2BA 4GN4B 2I0QA 4A3FG 3K0XA 3MEFA 3KDFA 3NBHB 1YITA 4POFA 3PO3G 1OTCA 4XIGS 1LUZA 5M5XH 1YJWA 4GKKQ 1X3EA 1B8AA 4JOIA 5LMUL 1XJVA 1BBWA 1UEBA 1Z9FA 4DV5Q 1N32Q 4DV1Q 3S14H 3JC62 4HIOA 2ASBA 4DUYQ 2Z0SA 4X65L 1R9TH 3I4NG 4IFDJ 1VCIA 5JJIA 2KCTA 3CF5A 1FL0A 1CKNA 4LFAQ 3AEVA 4BBSG 1VQDA 2OWOA 1YHAA 4DUZL 1V9PA 2AHOB 1K9MC 3L7ZC 3U50C 1E3PA 4X66L 2DSXA 2OQ0A 1WFQA 2YYZA 1G51A 2EQSA 2UU9L 2JA7H 5IP7H 2Q2HA 1QCVA 1WI5A 1HR0Q 2Y0SG 3A74A 3EIVA 3F8TA 2LCQA 1PV4A 2E2IH 2HHHL 4DR6L 3IRBA 4JI1Q 1IBML 4LF5Q 3TRZA 5GQOA 2IX0A 1G6PA 1K0RA 2IT1A 3I2ZA 4DV2L 2F4VQ 3M4OH 4HJ7A 2UXCL 4DR5Q 3AFPA 1YJNA 4KI0A 4YWLA 4RXNA 3JAMc 1N34Q 2JA5G 1CSQA 3PGZA 1VS0A 2KCMA 4JI8Q 3W1BA 2IX1A 1K83H 1X6OA 4DR4Q 3H3VI 2I5HA 2GVAA 1QVCA 4O2DA 3QVDA 1A8VA 2A19A 4C3IH 1HH2P 2NZHA 1CKOA 1PVOA 2AKWB 3HOXG 1PFSA 1L2FA 4LF9Q 1QYBA 4AQYL 1AH9A 4DK3C 4JI2Q 1IBKQ 4UY8C 3AFQA 4Y7NH 5IP9H 1UE1A 1HNZL 1L1OC 1VQFA 4B3TL 1FHHA 1WCMH 2Z6KA 3KF8B 1LTLA 2N49A 1X56A 3HOZG 2Q2UA 4RG1A 5C4XH 2R93H 4DR2L 4JBKA 4JI6Q 2VUMG 2B63G 1YHBA 4K9FA 1T9HA 1JE5A 1U5KA 2XTIA 4DV0Q 1MIUA 1EYGA 1XNRQ 4DR4L 2OTJA 4JBWA 3JAMi 3PUWA 3J80c 4A3JH 2VL6A 4X64L 2JK8A 2JA6H 3J7ZC 4JV5Q 4LF7Q 2K52A 1R0FA 4GNXA 4MNOA 2E5LL 1Y1WH 3W1GA 4OWTB 2XGTA 1IU5A 1IZ6A 3T1HQ 4BY7H 5HY6A 3PIOA 1PH8A 4A3GH 1RYTA 1JJGA 3K7AH 1N33Q 8RXNA 3A0JA 2KENA 4JOIC 5J3BA 4A76A 3E9HA 2UUAL 1AE2A 4HJ8A 4YWMA 5IYCH 5GADC 3GTGH 2JA7G 5IP7G 2JEAI 1HNWQ 2EIFA 5EAYA 3CPWA 4ME3A 4BXXH 3K8AA 1HZBA 1YVCA 2V1CC 3OTOQ 4A3IH 4DR3L 4GN5A 3FHWA 2LSSA 2JEBI 3L2PA 3CCEA 1YJ9A 4PMWA 1BKBA 3PUZA 1HZAA 4JI4L 3PZAA 1Q46A 3PUXA 4QIWE 2ID0A 3DM3A 1KL9A 2CCZA 1I94Q 2B29A 4X62L 2MO0A 3KJPA 2ALYB 2OTLA 2IY5B 2YTXA 3HOVH 1EQRA 4L5SA 1I50H 2RHSB 5C4JH 3NEMA 3RZOH 1SFOH 4IJLA 3J7A5 3NELA 4NPSA 1NMFA 3GTQH 3J81j 1FGUA 2K4KA 3KOJA 4NB3A 2VQEQ 4DV4L 1YIJA 4YY3L 4XTCS 4A3LH 1IRNA 2I5MX 5IP9G 1OXTA 3KYHC 4DK6C 1FVIA 1V1QA 1JMCA 2RCNA 3T1YL 1PH1A 5IYDH 2UUBQ 1JJCB 5JEAG 1WCMG 1LYLA 4BBRH 3KF6A 2AWOA 5IWAQ 2YTYA 2HT1A 5C0XJ 5HGQA 1I94L 2R93G 1P16A 2BA1A 1K3RA 1CUKA 1ASZA 2KN9A 3RZTA 3RLNA 1XTDA 3SGIA 3A5UA 4DR7Q 4DAMA 4GOPA 2NVQH 1TWCH 1NNQA 2R6GA 2E8GA 4A93H 5RXNA 2OQKA 1RL2A 4A3JG 3GTMH 1S72A 2JA6G 2Z6KC 5LMNL 3F2BA 1M1KC 3D0FA 1IXRA 3EN2A 3ICEA 1KXLA 1Y1WG 3B6YA 4DR1Q 4DKAC 4APVA 1N9WA 4A3GG 2ES2A 4BY7G 2NZOA 1H95A 2PVEA 4TVAB 3PF5A 2ATWA 4LFCQ 4B3MQ 4K0KQ 3RR5A 4GLVB 4R4QA 2K5NA 1KHIA 4BA1I 1DGSA 1QZHA 3ER0A 2V3BB 3CCRA 3PIPA 2ZM6Q 3F1ZA 3KDFB 2K14A 4GNXC 1LKMA 1XPRA 4AIMA 5IYCG 2LXKA 3K81C 4NXNQ 2FXQA 1O7IA 4IFDG 1Q86C 3KYXA 3M3YH 4JYAQ 1NBWA 1BBUA 3TREA 2C35B 1SRUA 1Y1VH 4IPGA 4UP9A 3I56A 1PH4A 5H1SE 4BXXG 4A3IG 4H02A 5M3FH 4HIDA 4YWKA 4DV6Q 4JI3L 4YCWA 4AYBE 1CKNB 2PI2A 2MNAA 2D62A 2NN6G 2R92H 4DR1L 3G71A 1IBLQ 1OXUA 2PMZE 3KJOA 1NJIC 4GKKL 2AMCB 5M3MH 1KC8C 4LW1A 5ELNA 1IU6A 1TWFH 3PSIA 4DV5L 4QQBX 1N32L 1QUQB 4DV1L 1YK5A 3HOVG 4DUYL 2JJQA 4GN3B 1YUXA 4YHHQ 3GTLH 5AJ3Q 4LFAL 2PQAB 2WP8J 1WJJA 1S3OA 2MO1A 4JYAL 4KLKA 3ERSX 1VQ4A 1PH6A 2N78A 1EIFA 4AH6A 2GMGA 3J81c 1UE5A 1VQEA 3RN2A 4A3LG 4DV6L 1DX8A 1N36Q 3A44A 2F3IA 3FP9A 1HNXQ 5IYDG 4LF4Q 3HOWH 1VQ8A 2VS1A 4BBRG 1HR0L 3BZCA 1SROA 1TWAH 2A1AA 2K50A 1E24A 4QL5A 1S30A 4JI1L 4OX9Q 4LF5L 1J5EQ 3KLWA 1PA6A 1HZ9A 4PZ8A 2F4VL 1HJPA 2DGYA 2BH8A 3G48A 3PV0A 4IJHA 1Q8KA 2ZTCA 1Y14B 5FLMH 3M85A 4C3HH 5AJ3L 4DR5L 1P8LA 1N34L 1CKMA 1EIYB 1X55A 4JI8L 2UUCQ 4JI5Q 3UE0A 4OWXB 4EX5A 1JT8A 2UXBQ 4IOCA 1A63A 4GOPC 4JI0Q 2Q2IA 3CXCA 4P73A 4JI7Q 4LF9L 3HKZE 5JJLA 1NE3A 3RZ6A 1S2ZA 1S40A 3H0GH 3J81i 4DV3Q 3TEHB 1PH2A 1E22A 1B13A 4JI2L 1IBKL 1Q12A 2K5VA 4A3EH 1KIXA 2RDVA 3Q8DA 3S24A 1J5EL 3CC4A 1D8LA 2E2JH 1BRFA 4LF8Q 4AYBG 4JBMA 1XMQQ 1B2JA 1GD7A 3CP0A 3JC66 2NVYH 4YCUA 3U4ZA 2IHFA 2QEXA 1Y1VG 1Q7YC 4BY1H 3I4MH 1I6HH 1ASYA 2L15A 4A3CH 5M3FG 4JI6L 3SS2A 4NXMQ 2KHIA 4DV0L 4IO9A 1B70B 2K5HA 1XNRL 4P71A 1KRTA 3G6EA 2R92G 2R7ZH 1BVSA 1B2OA 2ZTEA 2VQEL 3HFZB 2K2DA 3VDYA 1MJEA 3HOUH 3BZKA 4JC0A 1VQOA 5M3MG 4GKJQ 2H5XA 1X3GA 3K7UC 4JV5L 4JI7L 1YZ6A 4LF7L 1VQJA 3E9IA 1IROA 3M4PA 5DLQE 4LUVA 1YI2A 3ULJA 4HIMA 3J80i 4C2MH 1SLJA 1IL2A 3T1HL 3S1MH 4EQ5A 2VQFQ 1GM5A 1SE8A 1N33L 1RDVA 4QGUA 1VQNA 2I5LX 1R0GA 1PH7A 1VCXA 3KFUA 1VQMA 1JJ2A 3HKSA 2VY3A 1XPUA 1BQ8A 4AR3A 5E7NA 1TWGH 4IPDA 1GKHA 1X54A 2VZAA 4A4IA 3HOWG 4YCVA 1HNWL 2QA4A 2UXDQ 3I55A 1KRSA 3S16H 5C3EH 1EOVA 5AI2A 1WOCA 3OTOL 4KHPQ 1C0AA 1XNQQ 4QJFA 4DNIA 1G291 2M4YA 4ALPA 2MS3A 1VQAA 5LMNW 4A3MH 1K8AC 5BR8Q 1PH3A 5K36G 3PF4A 5FLMG 4B3RQ 4PZ6A 3KYWA 1WYDA 1L1OB 5C4XG 3CQZH 3CCUA 2R7DA 3AQQA 2GVBA 1SMXA 2WFWA 1KQSA 2NVXH 1VQ6A 4LFBQ 1PYSB 3HKZG 3ULLA 5C0XG 2R7FA 4AR4A 3NENA 3S15H 2N3SA 2JA9A 1CSPA 4DV7Q 2YTVA 3F2CA 3CMEA 3CCSA 2Q2TA 4AR5A 5C0XI 3STBC 1QZGA 4LF6Q 3H0GG 4L5QA 1RIPA 3UDIA 4IPCA
chains in the Genus database with same CATH superfamily
2NVTH 2O5IC 2JP1A 1V1PA 1EL0A 2NVXB 1D7QA 3P7JA 1SXTA 1EWCA 5AI3A 1S5FD 4BY1G 3EA6A 3S15B 4A3CG 1Q1BA 1PZXA 2R7ZG 3HOUL 2ERJA 3GTPH 1BNZA 1VQBA 1AE3A 1UUPA 4NDXA 4OXPA 1WD0A 3CD6A 4X66Q 3RZDB 3SXHA 2UU9Q 3WDNA 2A8VA 3WWLA 1VQLA 5IT9E 4RAUC 1A2TA 4LFCL 3D6CA 4B3ML 1CAAA 2CQOA 2ERSA 4CGYB 2XVSA 3Q24A 1SN8A 4K8IA 1L0WA 1LTTD 4ZUJA 4NXNL 1YV1A 1DOLA 4DK0A 2ZJPA 2MFIA 1VQ5A 1NR2A 4OEMB 2J7ZA 2QW7A 1DXMA 1G2SA 3U4VA 4CDFC 1HHVA 1GUOA 1K0SA 2A6ED 2WB1B 2KQ3A 1SSOA 1O7LA 2NVXL 1ZXTA 2BH2A 1HFNA 2OT2A 2PQAA 4HJAA 3S1RB 3S15L 3TSSA 3TMEA 1Z7TA 4P75A 1W3SA 3G6JB 4B3TQ 3H15A 1ICFB 2RSNA 1ENAA 3S1QH 3CW2C 1A62A 3RZDL 3NSWA 1SJED 3T4AC 1FNUA 1SNQA 1TY2A 4LNQA 2F0FA 5C44B 4E6IA 1LM0A 3IFTA 1T9QA 4LF4L 4EQNA 1O80A 2G9HD 3UE1A 3RN5A 4H7BA 2JA8B 4OX9L 4A75A 4IOAA 1Q81C 1I6VC 1PXUA 2JXMB 2IHEA 3BU2A 3GTJH 4LUOA 4U671 5L37A 4JI5L 4OO1G 1VQIA 5M5YB 1SDFA 2DUDA 3O13A 4LAAA 4B3SL 2UXBL 3S2DH 5CV9A 2CW0D 2YU9H 1C09A 2PO4A 4JI0L 1NTGA 3S1RL 5FJ8G 2KBNA 4X3SA 5MFZA 4DV3L 4A3FH 4JI4Q 2D0PA 1T9PA 3PQIA 3UDXA 2KVMA 1KNEA 2R7ZB 5F2DA 3RLOA 2PW5A 3NQIA 5C44L 2K6AA 4DV4Q 2PVXA 2LXJA 3PO3B 2CH4A 1QVFA 1RB9A 2JA8L 1QVGA 1BBXC 3CCMA 1B3QA 1CHPD 1DM0B 1C9OA 4K14A 1JOQA 3OW7A 4N8FA 3NFPI 2SNMA 5KEEA 2XJPA 3QWNA 5KIXA 1SMUA 4OWWB 3I4NB 2NUCA 4TPUA 5JPMC 2KKDA 5M5YL 1TWGB 2B2YC 3L0OA 1SMWA 4UHVA 1XMOL 2IWHA 4Y52L 2XJVA 1J6QA 1L0YB 3MA2B 4CDDC 3H3VH 5DNFA 2EPBA 1QILA 4RCOA 1JWUD 2K75A 3CC7A 1N8RC 1L1OA 4RWSC 1TVXA 3OHXC 1HA5A 2JN4A 2Q8RE 1NAPA 1I5FA 4WJWA 2QL0A 4ZCKA 1VF7A 5J22A 1II3A 3A7AB 1JQYD 2JA5B 3BDLA 1FNVA 1VQHA 4JG2A 5IYBL 2E2HB 1EZ6A 4JCVE 4U673 2VUMH 1PTOF 3PO3L 3J80E 2B63H 1TT2A 2OCEA 1TWHB 3E3XA 3MEFA 3KDFA 3OMGA 4FF3A 5M5XH 2A6HD 1B8AA 4IUTA 4JOIA 5LMUL 1OO9B 2XNAC 5E1FA 3I4NL 2B2WC 1TWGL 4DA2A 4DUYQ 2Z0SA 2ASBA 4E6YA 5JJIA 1H9MA 4J6HA 2KCTA 4BBSG 1CKNA 4IUVA 1VQDA 4BS9A 1QNKA 2AHOB 2CKAA 3LWOB 3L7ZC 1E3PA 1EQVA 5IP7H 4R8NA 1EU4A 1HR0Q 2KOLA 3A74A 4JW0A 3F8TA 5KNCA 2HHHL 5HURA 4ILWA 4LF5Q 3V96A 2JA5L 4HSVA 2F0GA 3M4OH 1G6ZA 1YJNA 2E2HL 5LL6S 4JI8Q 1I4PA 1M4VA 1HA6A 3H3VI 1TWHL 1QVCA 1EQTA 2K32A 2OEOA 1PVOA 1CKOA 3HOXG 1PFSA 4AQYL 2M6OA 4K5XA 4NKLA 5J1ZA 4QB4A 1EY4A 3AFQA 1UE1A 1F2YA 1SYEA 3EVQA 4Z9CB 1VQFA 2F0JA 2QILA 2EJMA 1V1OA 2Q2UA 3BVZA 4RG1A 1QB5D 4EGVA 5I2XA 4DR2L 4JBKA 1YHBA 4K9FA 1EYGA 1EY7A 1DONA 4MTKA 1LT3D 2VL6A 1EY9A 3S14L 3J7ZC 4JV5Q 2K52A 3BVGA 3LWQB 5ELEA 2E5LL 5EBDA 4NW2A 2XGTA 5J39A 1IU5A 3T1HQ 5HY6A 3K7AH 3A0JA 3QG1A 4AI1A 2K1BA 2KENA 4ZRZA 4QUFA 4UY81 4IURA 2MUYA 2L0ZA 4KY7A 2EZVA 5IYCH 5GADC 2JA7G 4RGMA 4P2CB 2JEAI 3CPWA 2PCFB 4BXXH 2JI2A 4A3IH 1YVCA 2V1CC 3OTOQ 4DR3L 3FHWA 2LSSA 4DGZA 1NR4A 3L2PA 1YJ9A 3HJWB 2NN6H 1PZJD 1HUNA 3PZAA 3PUXA 4QIWE 2ICEC 3DM3A 1KL9A 3SDZA 2F0PA 2B29A 2AQCA 2VB2X 2IY5B 2JYOA 5C4JH 3NEMA 3J7A5 1CQFA 5BN5A 2OXPA 3LNLA 2LS01 3B0AB 4Y7NL 4ZQ3A 4YY3L 2EY6A 2PPTA 2J9UB 4A3LH 1QOHA 5IP9G 4B9XA 2SEBD 3BG3A 5COYA 1PH1A 4G6BA 4HMIA 5JEAG 1PFUA 2JI1A 1LYLA 1SMYD 2HT1A 5C0XJ 1I94L 2R93G 1ZEQX 1CUKA 3RLNA 1V1PB 2EXZA 4DAMA 1TWCH 4A3JL 2XWBB 2R6GA 2E8GA 4A93H 5RXNA 1RL2A 4B08A 1S72A 2JA6G 5LMNL 5JVG1 3CU7A 4R9WA 1Y8NB 1Y1WG 3B6YA 2X6LA 4FP5D 1LTID 4APVA 4BY7G 3QJYA 5I6WA 4LFCQ 4B3MQ 4Q0FA 3SK6A 4XT1B 1QZHA 2NVQB 1DGSA 2Z1CA 2K14A 4GNXC 1LKMA 4AIMA 3NBIA 2LXKA 4NXNQ 4JYAQ 4ULLA 3I56A 1SRUA 4I7AA 4KK7A 4HIDA 4JI3L 3URYA 4AYBE 4XDXA 1TR5A 3OIPA 2V0FA 3V05A 3G71A 2PMZE 1EIHA 2F0KA 5M3MH 4H0LC 4LW1A 1CK1A 5ELNA 5E3FA 3PSIA 3RZOL 1N32L 3MXUA 2JJQA 1YUXA 1Y1VB 4LFAL 4AHYA 2PQAB 2NTTA 3ERSX 3SK4A 3TP5A 1PH6A 2GMGA 5KYIA 3A44A 5IYDG 2KEEA 4LF4Q 3HOWH 1VQ8A 1B50A 4QL5A 2A1AA 2NVQL 3GV3A 4OX9Q 3GTLB 1HJPA 2DGYA 3G48A 1ESRA 2AQ2B 2ZTCA 3LWPB 1PZKD 2SNSA 1EIYB 3D6WA 1P8LA 1CKMA 3FPUB 4JAGA 1PRTD 2QEJC 4JI5Q 3UE0A 2UXBQ 3BDCA 3WWNB 3TDQA 1WTVA 4JI0Q 5LL6X 5JVG3 4P73A 5JJLA 1MSGA 3R2TA 1S2ZA 1BF4A 4FVMA 4DV3Q 1E22A 3QOLA 1NXEA 3S24A 4K2KA 1D8LA 1Y1VL 4AYBG 4EQPA 3U4ZA 3CP0A 3H3VC 3X3NA 4BY1H 1KDCA 1MHWC 2L15A 4A3CH 5M3FG 3SS2A 1XWEA 3NTKA 2KHIA 2R7ZH 1B70B 2SDFA 1KRTA 2ZTEA 5H1Sc 2K2DA 3H0GB 4JC0A 1Y1WB 3U9OA 4JI7L 1YZ6A 3VYSA 4LF7L 3GTLL 4R8IA 3J80i 1IL2A 3S1MH 2NVYB 1SE8A 1RDVA 4V190 1VQNA 1R0GA 2E75C 2K01A 3GTGB 2F0QA 1SE3A 2F4IA 3HKSA 2F0TA 2VY3A 1XPUA 4QIWB 1QNUA 1TWGH 2VZAA 4A4IA 1HNWL 1KRSA 5IP9L 1ILQA 1U4PA 3A8IE 3BYYB 5AI2A 5GAHc 3TP6A 1C0AA 1E0BA 3QOJA 5FLML 3I90A 4ALPA 1FNWA 2MS3A 1ESFA 1K8AC 2LY7A 1PFBA 1CA5A 5K36G 4C3HG 1Y69U 3KYWA 1L1OB 4AI3A 2R7DA 2GVBA 5I4DA 2N88A 3ULLA 3R2IA 5JOBA 3NENA 1GUWA 2AQ3B 1O78A 2F0EA 2IX3A 3CMEA 3CCSA 3H0GL 5C3EB 3DWQA 1SYGA 4K6DA 1RIPA 2VQEL 3HJYB 4A3MB 4KHVA 4A3EG 2L0CA 3AYHB 2NVYL 2PYAA 3V2TA 3OYYA 1X3FA 5I9OA 5LMUQ 2UUBL 3Q0AA 2BA0A 5EBCA 1R0IA 1YNXA 2AWNA 1S5DD 3ITPA 1LV9A 2F3WA 3HOUG 5IE8A 3FKIB 2O5JC 1NMGA 3BVMA 4IFDI 4OO1H 3EBEA 1XTCD 3I73A 3UI2A 1H7VA 2HHHQ 2DNCA 1RDGA 2LMCB 3S17B 4K0KL 5FJ8H 1C7YA 3DWAA 2ZM6L 3PWFA 3GTOH 2EY5A 2FHTA 2WB1E 4HJ5A 3I7FA 5C3EL 4A3BB 1C8CA 3LNNA 3W2DA 1A3UA 5EIOC 4A3ML 4HJ9A 1LKPA 1QUQA 3P75A 1PFMA 3S1NH 5EQ0A 3CQZL 4AQYQ 3VA7A 1IBLL 2WIIB 4A3DB 5T1GA 2B2YA 1LKOA 1DCZA 1HZCA 2ZJRA 1V43A 5FLXc 4C3JB 3S2HH 1IHZA 4P72A 4DR2Q 3FKIL 1VQCA 3RYGA 3HRZC 3PO2B 2O4XA 1N36L 1HNXL 3H91A 1RJTA 3S17L 1Q8IA 1FJGL 4A3KG 2E5LQ 3LWRB 2EYLA 3P20A 5D65A 3STBD 4TQUS 4A3BL 2JI3A 1MD2D 2L1BA 3CCVA 1GUGA 3DXJC 2UUCL 2Z3RB 5C4ZA 4X3UA 4CJ1B 1GOZA 4OO1I 5E4XA 2HVYC 2WB1G 4A3DL 2B2WA 4CKCA 3K5OA 2E74C 4DR3Q 5IT9c 3IKJA 1XPOA 5M5WB 1Z47A 1A3TA 1J8IA 4C3JL 1IYJB 5IGEA 1B53A 3NP8A 4LF8L 3PCOB 2B2UC 4DU9A 3CRKC 2B2TC 4ZKCB 4BBSH 3PO2L 4QIWP 5D14A 5C44G 4YY3Q 2B3GA 3EROA 1ZYRC 4K5WA 5EKKA 5CC4A 2WKCA 2JA8G 3MFGA 2D5DA 2VQFL 2GN5A 1HQRD 3UDFA 5CMDA 1PYBA 2ZXPA 1H9JA 3DLLA 1RCVD 2Y0SE 2JQOA 3FDTA 1JYBA 1AZQA 2Z4HA 3DEPA 1EY8A 1SE2A 5LMNQ 3MPSA 1OXVA 4R4TA 3KLSX 1YNJC 1STBA 1PRTC 1VQ7A 1KABA 4DAYB 5M5WL 1PH9A 1K73C 1VQKA 1GHKA 3HOXH 1FGBD 2HQLA 1FR3A 1PRTF 4R4IA 5GAHC 4B3RL 4OONA 2XN9C 4X65Q 5CV5A 3H09A 2B5ID 4IN3A 5CV4A 2QGQA 2VW9A 3TP8A 4L5TA 3W5OA 3K59A 1E1TA 2MPMA 1WTPA 4DV7L 1M90C 1DVBA 3KLSA 1UE7A 4ZAIA 5IYBG 1TU2B 2D2CC 2ZJQA 1NXGA 1JWMD 4JI3Q 4R4OA 1X65A 3MXGA 1SEBD 3PO3G 1YITA 4POFA 2BE5C 4A3KB 1XJVA 2EJFC 1BBWA 2F0MA 1N32Q 1PYWD 5FK9C 2RDGA 3I4NG 4IFDJ 4AYBP 3HOZB 4LFAQ 3AEVA 3H94A 4IUNA 4X6AL 1I4HA 2PMZP 1SJHD 5DAUA 4DUZL 1JOKA 3JAML 2F0IA 1K9MC 1BCPB 1F9SA 4HSPA 1PFYA 2YYZA 1G51A 4I7ZC 1I4XA 1SYFA 5CR3A 2JA7H 2Q2HA 1QCVA 1WI5A 2Y0SG 4DR6L 3IRBA 1HRJA 3TRZA 5GQOA 1RDPD 1K0RA 2IT1A 3ND8A 2MJ8A 2UXCL 2J0TD 3AFPA 2JA5G 4YWLA 4HEDA 1VS0A 2KCMA 4V0BA 2WINB 3W1BA 4B8CD 2RCFA 4DR4Q 1A2UA 5C3XA 2EDGA 4O2DA 3QVDA 4OGQC 2E2IB 1HH2P 4CJ0B 1SBBB 3FDJA 4A3KL 2PPBC 1AH9A 2NB0A 4DK3C 4UY8C 1JICA 5IP9H 4ODGA 1L0XB 3C1FA 3HOZL 1FHHA 1F2MA 5EPJA 5JEAH 3KF8B 1LTLA 1X56A 1K83B 4J1MA 3E5SA 2R93H 4C3IB 3LWVB 1U5KA 1DJRD 1MIUA 2OTJA 4ME5A 4C56C 3JAMi 3A8KE 1I4QA 3PUWA 3J80c 4X64L 2JK8A 2JA6H 4LF7Q 4GNXA 1Y1WH 4OWTB 3IL8A 2CKCA 4BY7H 3PIOA 1JJGA 3I4LA 8RXNA 1IW7C 3RD4A 4A76A 1MGSA 3E9HA 4KD3A 2E2IL 3GTGH 1HNWQ 1UEAB 1B4OA 3IFDA 3K8AA 4A3GB 1QG7A 2F1MA 4PMWA 1BKBA 4WRDA 1Q46A 3N52A 3EQLC 2ID0A 2CCZA 1K83L 4X62L 1CA6A 2MO0A 3ONAB 4C3IL 1EQRA 1DOMA 1RKNA 2I46A 5EPLA 3HAXC 1I3QB 2RHSB 1LACA 3N6RA 2N55A 4NPSA 1X3QA 1NMFA 2KEDA 3H6MA 1NUCA 3GTQH 3BDOA 3J81j 1FGUA 2VQEQ 3MQKB 1OXTA 2Y0SB 4N9TA 1FVIA 4DK6C 2E2DC 3T1YL 5IYDH 2UUBQ 1JJCB 3TBIB 3KF6A 3HOVB 4KD4A 4ZKBB 5HGQA 1P16A 2BA1A 1DZ1A 4KV6A 1SFOB 1PTOC 4PV1C 1XTDA 3A5UA 4JPBW 4K5VA 4A3JG 4C1NI 2A69D 1ENCA 4JAFA 4CDCC 1M1KC 2APOB 1LT4D 4A3GL 3D4WA 1WTOA 4BBRB 3IU3I 2NZOA 1H95A 3PF5A 4TVAB 3K5NA 4K0KQ 2EVBA 2K5NA 1KHIA 1H9SB 3F1ZA 1LTGD 4EVOA 2ZM6Q 1I3QL 1FYCA 3R3OA 3GTMB 1O7IA 5EINC 3KYXA 3NBHA 1Q86C 3M3YH 1G8ZD 1NBWA 1JC7A 2C35B 4IPGA 1PH4A 3NPPA 1TS3A 5M3FH 4RCNA 1W6JA 4YWKA 4YCWA 2MNAA 2PI2A 1SE4A 2M2LA 4DR1L 3J81L 4AHXA 2WB1P 1IBLQ 4GKKL 3S14B 2AMCB 4DN4M 3HOVL 1KC8C 1IU6A 1TWFH 4DV5L 1SFOL 1QUQB 4DV1L 3LWUA 1BQQT 3R93A 2P5ZX 5AJ3Q 2WP8J 2MO1A 2PZUA 1C4QA 4KLKA 1VQ4A 2R92B 2N78A 1EIFA 1XXGA 1EZ8A 4DV6L 4BBRL 1N36Q 1HNXQ 1C48A 2VS1A 3BZCA 5ELCA 1F9RA 3H9BA 1J5EQ 5FO7B 3GTML 1VF5C 4RGNA 2F4VL 5K36H 4DR5L 1Y14B 1ET6A 3HZXA 1PTOB 4C3HH 5D3IB 1X55A 2UUCQ 1JT8A 4N9PA 1IKLA 1SNPA 4GOPC 1TWAB 1DD2A 3TP7A 3CXCA 1FD7D 3BYTB 5CV7A 4Y7NB 4LF9L 3RZ6A 3A7LA 3J81i 3AB9A 3TEHB 4JI2L 1B13A 2KUMA 5HGTA 1Q12A 1XYIA 4HCSA 4A3EH 1KIXA 2RDVA 3ERQA 3CC4A 4PQXA 4LF8Q 4JBMA 5CYUA 3JC66 3VR5A 1A6XA 1XX8A 2IHFA 2KHSA 1Y1VG 3HKZB 1I4GA 1ASYA 2R92L 4JI6L 2M6PA 4DV0L 4A3JB 1LT5D 4BA2I 1XNRL 1F2ZA 1MJEA 3HOUH 3BZKA 2K03A 2H5XA 1X3GA 3K7UC 1D2BA 4DFAA 3E9IA 4LUVA 5LHY1 4KKSA 4HIMA 5EKLA 3I4MB 1IKMA 2A6EC 2VQFQ 1B9MA 3SR1A 2I5LX 1Q90A 2BDNA 2EYJA 1VCXA 1JJ2A 2Z8LA 1TWAL 4LMQD 3VR4A 1PMRA 4YCVA 3I55A 4IQZA 4WORA 2WV6D 5C5MA 1S5CD 1EOVA 4C2MB 1WOCA 4JADA 3PIP1 4QJFA 1B2TA 1G291 2KCCA 2Y0SP 1RHPA 1VDZA 1X3PA 2EY1A 5FLMG 4B3RQ 1WYDA 3ZYYX 3CCUA 2NVXH 3AQQA 1KQSA 3RZOB 3P8BA 2KJXA 4FF2A 5C0XG 1D1IA 3FEWX 3S15H 3H9CA 2N3SA 4DAYA 5GAEc 1CSPA 2V4DA 4DV7Q 3F2CA 3S16B 3SEBA 4AR5A 1EIGA 1TS5A 3H0GG 5FO9B 4IPCA 4POGA 3RZDH 1U4LA 2DN8A 1STGA 3I4ML 2CW0C 4LWCA 3WWVA 4PMBA 1Q1EA 1K8GA 4O42A 4R1JA 3NHHA 5IWAL 4A3KH 1R4QB 2RSOA 1VZIA 1TKWB 1R4PB 1S24A 1UWVA 4GLAC 1MKHA 4DUZQ 2CHBD 1WTQA 2FJ2A 4MZ9A 4GS7D 6RXNA 2NVTB 1E2ZA 4FF4A 4ZUIA 1VQ9A 5GROA 4DR6Q 1NY4A 2B2UA 4DNTB 2NN6I 3CAMA 3LGJA 4CDEC 2RDFA 1EFWA 2B2TA 5FKAC 5CBAE 3CCQA 3S1RH 2K5QA 3GTPB 3PL5A 2UXCQ 4GLXA 4PMCA 1TQOA 1HR0W 2WAQB 3S16L 2XJSA 3MTSA 5KNDA 5C3EG 4QY7A 1WTRA 5IY0A 2JE6I 1GVPA 2K7VA 4A3MG 3D8GA 7RXNA 1B71A 1SR3A 1U4RA 5C44H 2B2VC 4O0AA 1YBYA 3PIP3 5C5LA 1YNND 1GHJA 2ICIA 2AUJD 1YUZA 4AI0A 3CCJA 2JA8H 2K33A 4ID6A 2PZWA 1KTKA 1DOKA 4P74A 3MXNB 3SK8A 3ULPA 2NVTL 4B3SQ 3M4YA 1LLRD 3FKIG 3RNUA 3HOYG 3VA5A 5M5YH 1AW7A 5BN4A 4X64Q 5MLC3 4Y52H 3KF8A 5K2ME 3M4QA 3TQYA 1QE6A 3WOFA 3GTPL 5C3WA 1K8OA 4F7XA 3T53B 2DJFC 3DHQA 4S3SA 1I4RA 3C46A 3OW2A 3C1EA 4GNXB 2A6HC 4NMZA 4QUCA 4PZ7A 4A3BG 1CHQD 2K05A 3ZJYC 2VNUD 3CCLA 1BQ9A 2I07B 2B8GA 2HCCA 2MHVA 1A0IA 1B9NA 5IYBH 3U58A 3AMUA 2XJTA 2KHJA 2E2JB 1D1KA 3A5ZB 4A3DG 3PO3H 4FF1A 1HXYD 3GTJB 4KHZA 2OF1A 4X62Q 3PMFA 1XMQL 2MP1A 2R61A 4C3JG 1XMOQ 2RHQB 2H12A 2XIWA 2YU9B 3I4NH 5T1IA 4NXML 5JAVA 3NWSA 4TKOB 3MEHA 5DM71 3TS2A 1I3QH 1J9OA 3KYUA 3PO2G 1GUTA 4UP8A 4GKJL 3A55A 3S1QL 3T1YQ 5ELOA 1BFYA 5AFWA 3RLFA 4AR6A 3PUVA 1CFMA 2HDMA 3JAME 2CWAA 2QDLA 5G3LD 3TS0A 3GD7A 5D3DA 1AZPA 1RWDA 1UAPA 3KF6B 1ZRPA 2JA5H 3T56B 1JB3A 2Z3QB 1H9RA 4FDBA 2QDBA 4WJ3M 1ILPA 2E2HH 2UXDL 4CKEA 2E2JL 2F52A 1SMMA 1SNMA 1B3AA 5DM61 1XNQL 3GTJL 4L8JA 1TWHH 3GDEA 5KRUA 1MJCA 3CQZB 4B9WA 3TN2A 1B44D 1Q82C 1EU3A 3K5LA 3S2DL 1GXDC 3K80C 1T9OA 4FYDA 1E1OA 2YU9L 2YV5A 1VQPA 3CPFA 3J7AF 1BE7A 1SYBA 3D3RA 3HOYB 1U0LA 2C9OA 4LF6L 4UPAA 5GAEC 3K6OA 1H9SA 3L3OC 1M8AA 1CZWA 3NBHB 4KKUA 4GKKQ 1X3EA 3DWPA 1O7YA 4DV5Q 4DV1Q 4KTAA 3QB3A 3S14H 3JC62 4HIOA 2HDLA 4KY6A 1VCIA 2DY8A 4L63B 3CF5A 1CTMA 2M4VA 3VR6A 1YHAA 1WTWA 1VMPA 2EYPA 2XJUA 2F0VA 5CV6A 4KMUC 4XQJA 2CR8A 2QCPX 2DSXA 5DM73 5MGNA 2IL8A 1BDOA 1PV4A 1AEXA 2LCQA 4RFBA 1IBML 3P2AA 2M00A 2IX0A 1G6PA 3DM1A 2F4VQ 4DV2L 2DJGC 2WKDA 1Z6HA 4KKTA 4DR5Q 4IALA 4RXNA 1CSQA 3PGZA 1SMYC 3HOYL 1RTOA 2IX1A 4AHWA 2AUSB 2L9HA 2NZHA 2NTSA 4LF9Q 1QYBA 4GZYC 1MI2A 4JI2Q 3M4OB 4Y7NH 5DM63 1HNZL 2EYFA 2XRSD 3T13A 2AUKA 2HUGA 3HGBA 3HOZG 5IODA 4JI6Q 1GUSA 1T9HA 1JE5A 4DV0Q 1XNRQ 4H13C 3NK9A 4A3JH 4FXGC 1PFNA 2NWGA 2H1EA 2K5WA 3MFYA 4TSSA 4F88A 2G5DA 2UUAL 3D4RA 5IP7L 3F2UA 4YWMA 2NYDA 5TSSA 3VR2A 2EIFA 3K57A 5EAYA 1HZBA 1PDQA 2RDHA 3J7Y1 3M4OL 2NZ1D 4GN5A 3CCEA 1NSNS 3K7AB 2G9DA 1BR9A 3G7LA 3MSUA 1T5XD 3QQCE 1D5XC 1I94Q 1AN8A 2L12A 3KJPA 3GTKB 1LTAD 3K0YA 1WVLA 4L5SA 1PFVA 3RZOH 4CHTB 4C3IG 3J81E 3B08B 4A3IB 4XYQA 2XJRA 4NB3A 3GV6A 2CQAA 1TIID 5A2QL 3H99A 1OWCA 5MFPA 2RVLA 1WCMG 5JJZA 3D4DA 5IWAQ 5C4XG 3VR3A 5C4JB 1K3RA 2BOSA 3SGIA 3RZTA 2A68D 4GOPA 2NVQH 1NNQA 2V0EA 2XWJB 1LT6D 1S5ED 4LJZC 2Z6KC 3T51B 4G7OC 3NXWA 3D0FA 1PZID 3RUZA 3ICEA 1KXLA 3K7AL 3QIAA 4DKAC 2F0SA 4A3GG 2ES2A 2BDOA 1K8MA 4GLVB 4WJ4A 3GTKL 5IYCL 2V3BB 1TWCB 4TRDA 4A93B 4X3TA 1S5BD 1WD1A 4BXXL 5MF6A 3FRPB 3NWTA 5NUCA 4IFDG 4A3IL 1BBUA 1IYVA 3TREA 4KJOA 1Y1VH 4UP9A 3OOCA 3IAYA 2HQEA 2E76C 2LFNA 4XXBB 4IUQA 5CORA 2ZXOA 1OXUA 4X3KA 3GQBA 3KJOA 1NJIC 1WTHA 4DXGA 2EY4E 1R9TB 2M9VA 3C3LA 5C4JL 4QQBX 1E2WA 3HOVG 3R8BA 4CBVA 2PZTA 3GTLH 5CGKA 1WJJA 4JYAL 4A3LL 2DNEA 2EJGC 4KN4C 1BOSA 1VQEA 3RN2A 3LX0A 1DX8A 5M3MB 1ICWA 1PRTB 4BBRG 2EE1A 3J7AV 2LKVA 1TWCL 3MXNA 2EOTA 5G3LF 4JI1L 3KLWA 4A93L 5IGGA 1PA6A 4PZ8A 4OHJA 1F9PA 2BH8A 2QKIC 3A54A 5FLMH 1N34L 1D6EC 1HQMC 4OWXB 5C0XH 4IOCA 2PW7A 3HOWB 3I70A 3OWFA 1KAAA 2Q2IA 3SVMA 4JI7Q 3HKZE 1R9TL 1S40A 3H0GH 1STHA 5GAGc 1ONLA 1IBKL 2K5VA 1WCMB 2VXWA 4OELB 2E2JH 4OL7A 5C4XB 5GADc 1XMQQ 1B2JA 1GD7A 2NVYH 3MHBA 4YCUA 1Q7YC 3L9AX 4NXMQ 2K5HA 2KA7A 2EYHA 3G6EA 2R92G 1RTNA 5M3ML 1B2OA 5IGDA 3VDYA 1VQOA 4GKJQ 1LABA 2GA4B 5M9OA 1IROA 1YI2A 4RHSA 4LK1C 1SLJA 4BY1B 1N33L 4QGUA 4F87A 2A74C 4RKBA 1PH7A 3OPOA 4JAEA 3HOWL 1BQ8A 4AR3A 4IPDA 1GKHA 2B2VA 2WACA 2QA4A 2UXDQ 3PKIA 2RKSA 4DNRB 5C3EH 3FVQA 1SYCA 3S1MB 1WCML 1XNQQ 1GUNA 1QCBD 3MWYW 2M4YA 1VQAA 5LMNW 4A3MH 5C4XL 1PH3A 3PF4A 1I50B 3CQZH 1VQ6A 2C5CA 1SMXA 1PYSB 3HKZG 2R7FA 4AR4A 2JA9A 5I9PA 2Q2TA 4QMGA 5C0XI 3STBC 1P7PA 1QZGA 5DEHA 1RODA 4LF6Q 3ZG6A 3UDIA 3FKIH 3HOYH 2D0OA 4XT3B 5I6YA 2Q8TA 5FO8B 1OXSC 1JB7A 1R0HA 4BY1L 4A3CL 3I3CA 3I4MG 3CKIB 4AHZA 3E0EA 1PHJA 2R7ZL 4DF7A 3M7NA 1FHMA 1OXXK 3S17H 4DR7L 1Y8OB 4HAEA 5K5PA 3K5MA 1BO0A 1DYQA 4YIJA 1SYDA 1AFPA 2RA4A 1EEFD 4UDUC 1R0JA 4A3BH 3S1ML 1EY0A 3I72A 1IYUA 1EYDA 1D5ZC 1YK4A 2F0DA 2WAQE 1I50L 1IBMQ 3CRLC 4A3DH 3Q22A 4DV2Q 3BS1A 1TXYA 3JR7A 4J15A 3NTHA 4DPGA 4M8AA 1MSHA 1EWHA 2X6GA 2F3VA 5FLXL 1CQVA 2XRQD 4RMFA 4C3JH 4F8MA 2EY2A 1KDBA 4IPHA 1STNA 1ODHA 3CC2A 3U9SA 2FMMA 3X3MA 1FJGQ 3PO2H 4FNFA 3PUYA 5IGCA 2FFKB 1F9QA 3GTOB 3G4SA 1HNZQ 2PYKA 5CV8A 1H9KA 4L5RC 4YHHL 1U9RA 4RKLA 1GO3E 3MVVA 2HIVA 2CWPA 4R4CA 3CMAA 3S1NB 1IL8A 4PG3A 2A68C 1CT1D 2EXDA 4XYOA 1D5MC 5EGTA 5JJKA 2N8NA 4NP5A 1GJXA 1CADA 3S2HB 1EYAA 3QR8A 5IT9L 1UE6A 2TMPA 4FXDA 5M5WH 1ENFA 4OIJA 3GO5A 1NCVA 2PNRC 2CKZB 2WAQG 1EYCA 1EWIA 4H44C 2UUAQ 1X32A 1X9NA 2PNHA 3VYUA 1E7ZA 4GS3A 2L5TA 1EY6A 1WTXA 1EFID 5FJ8L 1YEZA 3UDGA 1SNDA 1KAWA 1Q3LA 3GTOL 3BJUA 1PH5A 2PQEA 1WJVA 4HN7A 1A15A 3KYYA 3EFXD 2F0HA 4JBJA 1I6HB 1KD1C 2F0OA 3D31A 2MQHA 4LUZA 5EPKA 4ABNA 1JE4A 5BN3A 2O5JD 1KLUD 5GAGC 2CFMA 2EYMA 3SK5A 4MTNA 2RF4A 3I4OA 3HEJA 3S1NL 1YHQA 3GTKH 1ZKOA 5EKIA 3KLRA 1B7YB 1STAA 1U4MA 5ELFA 5JVH1 4M1UB 2ZTDA 2RQXA 4X6AH 3ND9A 2HR5A 2HIXA 4G57A 4JVZA 1BXTA 3S2HL 1LO5D 5AN9H 1G2TA 1SNCA 1VMCA 5EJWA 3FMCA 1JWSD 4EQOA 4BBSB 2Z4IA 4RGOS 4UP7A 2RBMA 1TS2A 2XJQA 3TZUA 1EUJA 2CH4W 1VQGA 4PNYA 1T5EA 2K04A 5KGUA 1EQQA 2A73B 3PKJA 1SAPA 2EYOA 3F2DA 4GOPB 5C6AA 2BCOA 1NNXA 3K58A 2L11A 5JEAJ 4KHPL 3M9BA 5KNBA 1I6HL 2B8FA 4MIUA 2B39A 1E8JA 2IW3A 4FO2A 5BR8L 2ZT9C 3SHLA 1HUMA 3OMCA 4LFBL 2DY7A 1K28A 2J4XA 4LHNA 3KYVA 2NYZD 4K8JA 4HCEA 3HOZH 1QJOA 1AP0A 2PI2E 2X69A 4WFN1 4HIKA 1W2BA 2I0QA 3H3VM 4GN4B 4A3FG 3K0XA 3HOXB 1JOOA 3A8JE 1RF2D 3J7YW 1OTCA 4XIGS 1LUZA 1YJWA 4K2LA 1Z9FA 1UEBA 3HP3A 3I91A 1B1ZA 4BBSL 5IOCA 4X65L 1R9TH 1FL0A 1PFWA 1JR0D 3DUZA 2OWOA 5I2YA 1V9PA 3Q6SA 3U50C 2Z6BA 4X66L 3SE0A 2OQ0A 1WFQA 4DAVA 2EQSA 2UU9L 1W6KA 3LPEB 5JVH3 1SNOA 3EIVA 2E2IH 3VYTA 3E0JA 4N8X1 4JI1Q 4IZ8A 3I2ZA 3GP7A 1BCPD 4HJ7A 4C1NK 2TSSA 4KI0A 3JAMc 1N34Q 5ELDA 1ZYRD 1K83H 1X6OA 4DAPA 2JA7B 4QF4A 4K6LA 3HOXL 2I5HA 1BUVT 2GVAA 2RFKB 3HG9A 3KBGA 2A19A 1A8VA 4C3IH 3LWEA 2AKWB 5IGFA 4G7ZC 4G7HC 1L2FA 4L6TB 2L4NA 1KDAA 3J80L 2A69C 1IBKQ 3KBXA 3MXPA 1L1OC 3S1QB 4B3TL 5ELBA 1WCMH 2Z6KA 1ET9A 2N49A 1HTPA 1YNJD 1STYA 5JPNC 5C4XH 3HKZP 2VUMG 2B63G 2XTIA 4DR4L 3E6ZX 4JBWA 4BWGB 3BZDB 4KY5A 5A2QE 1EY5A 4ZYSA 4RA8A 5C4HA 1R0FA 4WFN3 4MNOA 3W1GA 1IZ6A 4HR7B 4A3GH 1PH8A 4C2M1 1RYTA 3A56A 3OIQA 1N33Q 2R93B 4Q5VA 1ML0D 5A35A 4JOIC 5J3BA 4ZN3B 3S2DB 4JK1C 2JA7L 1AE2A 4HJ8A 2BE5D 1QWYA 4CJ2C 3DMUA 2JA6B 5IP7G 2F0UA 4IFDH 4HTHA 3S9WA 1K3BC 3NTIA 4ME3A 5ISRA 4TVMA 4A3FB 4U68A 4BY7B 2ZIXA 1EEID 2JEBI 4DK1A 4RGTA 3PUZA 1HZAA 4JI4L 3Q23A 2MGSA 1CM9A 3J7Z1 2F0NA 1HCZA 2ALYB 1TS4A 2OTLA 2YTXA 4ZLTF 3HS0C 3HOVH 3OWEB 1I50H 1SFOH 4IJLA 2IPKD 3NELA 4FXKC 2XSCA 1G91A 2CVRA 2K4KA 3KOJA 3VPBE 4DV4L 1YIJA 3WOEA 4RH6A 2Z9HA 4XTCS 2F03A 3NE5B 1IRNA 2I5MX 2NBFA 3T16A 3KYHC 1V1QA 1JMCA 1EOTA 2RCNA 4UAIA 2R93L 3FPPA 4BBRH 2AWOA 2YTYA 4IUUA 1ASZA 4J8QA 2KN9A 4DR7Q 4G4KA 2O2LD 3GTQB 2JA6L 2OQKA 1RD9D 3GTMH 3F2BA 1Y1WL 4A3FL 3RMHA 1IXRA 3EN2A 4BY7L 2SOBA 4V196 4DR1Q 1KLGD 3AU7A 4LHLA 1N9WA 4ZK9B 1TY0A 2PVEA 2ATWA 1O7ZA 4O1NA 2K5DA 3RR5A 4R4QA 4BA1I 3ER0A 3CCRA 3GTGL 3PIPA 1XPRA 3KDFB 3MC0B 3H97A 5IIFA 1HFGA 5IYCG 1Z92B 1S4ZA 3K81C 4DXFA 3KUPA 2FXQA 2VUMB 2B63B 5KYLA 2WAQP 1HPCA 4XQNA 4BXXG 4HMJA 5H1SE 4A3IG 4H02A 4XXEA 4DV6Q 5M5XB 2L55A 2KECA 1CKNB 2R92H 2D62A 2NN6G 4XQQA 1CZGA 1IW7D 1Y8PB 2K28A 4IUPA 1CI3M 1HTLD 3DEOA 1UNSA 1YK5A 3TZDA 4AYBB 4DUYL 3NUCA 3M3YB 4GN3B 3GTQL 4YHHQ 2PMZB 1S3OA 5M3FB 1PTOH 4I65A 1VZGA 4XGHA 4AH6A 4A3LG 3J81c 5IYDL 1UE5A 2AYJA 2F3IA 3FP9A 3P1HA 2HD3A 3PIO1 2R3ZA 1TWFB 3NQTA 5E4WC 1HR0L 1SROA 1TWAH 2K50A 1E24A 3CHBD 1S30A 2FINB 4LF5L 1HZ9A 3OSOA 1STEA 3PV0A 3M85A 2VUML 4IJHA 1Q8KA 4A93G 2B63L 5AJ3L 3MAQA 2F0WA 3VYRA 4JI8L 4EX5A 4CKBA 5M5XL 2H4OA 1KNAA 4QCLA 1LTSD 3EJIA 1A63A 3I8ZA 4MN3A 1NE3A 1PTOD 1PH2A 1MBYA 3K35A 4MHEA 3Q8DA 3M3YL 4ZN1B 2ENBA 4C3HB 1J5EL 1VZHA 1BRFA 3W3AA 2QEXA 5M3FL 3I4MH 1I6HH 5IGBA 2QF7A 2HCIA 3KK7A 4KJNA 4IO9A 3JC63 1F2LA 4P71A 2ZXRA 1BVSA 3HFZB 1TWFL 5M3MG 4A3EB 4JV5L 1JORA 1VQJA 1LTBD 3M4PA 5DLQE 2PSMC 3ULJA 1PLFA 4C2MH 3T1HL 1V8QA 4EQ5A 1E2VA 1GM5A 3M7GA 1RYQA 4OIKA 2C6AA 2F0LA 1YNNC 3KFUA 1VQMA 3HOUB 2AQ1B 5E7NA 2D9UA 1BCPC 1X54A 2FMCA 3HOWG 1LTRD 4RHRA 3S16H 5CBEE 5FOBB 3OTOL 4KHPQ 1A3VA 2C6BA 2IJ0A 4DNIA 1BCPF 3PIO3 4C3HL 1F77A 5BR8Q 1QQTA 2KCNA 3QO2A 4PZ6A 5FLXE 1JCKB 2WFWA 4LFBQ 1OWBA 4AI2A 3MZ5A 2YTVA 4KN7C 3C2PA 2VB3X 2A5HA 4A3EL 2Q8IB 1F4LA 2JSOA 4L5QA
chains in the Genus database with same CATH topology
2NVTH 1D7QA 5AI3A 4BY1G 4A3CG 1Q1BA 2R7ZG 2ERJA 3GTPH 1VQBA 1AE3A 4OXPA 3CD6A 4X66Q 2UU9Q 2A8VA 3WWLA 1VQLA 4LFCL 4B3ML 1CAAA 2CQOA 2ERSA 1SN8A 1L0WA 4NXNL 1YV1A 2ZJPA 2MFIA 1VQ5A 3U4VA 2A6ED 2BH2A 2PQAA 4HJAA 4P75A 1W3SA 4B3TQ 3H15A 3S1QH 3CW2C 1A62A 4LNQA 1LM0A 4LF4L 1T9QA 3UE1A 3RN5A 4OX9L 4A75A 4IOAA 1Q81C 2IHEA 3BU2A 3GTJH 4LUOA 4U671 4JI5L 4OO1G 1VQIA 2DUDA 2UXBL 4B3SL 3S2DH 2YU9H 1C09A 4JI0L 1NTGA 5FJ8G 2KBNA 5MFZA 4DV3L 4A3FH 4JI4Q 2D0PA 1T9PA 3UDXA 3RLOA 4DV4Q 2PVXA 2LXJA 1QVFA 1RB9A 1QVGA 3CCMA 1C9OA 3NFPI 2XJPA 4OWWB 1SMUA 4TPUA 1XMOL 2KKDA 3L0OA 1SMWA 2XJVA 1J6QA 3H3VH 2K75A 3CC7A 1N8RC 1L1OA 1I5FA 2QL0A 1VQHA 4JG2A 4JCVE 2VUMH 2B63H 2OCEA 3MEFA 3KDFA 5M5XH 2A6HD 1B8AA 4JOIA 5LMUL 2ASBA 4DUYQ 2Z0SA 4E6YA 5JJIA 2KCTA 4BBSG 1CKNA 1VQDA 2AHOB 2CKAA 3L7ZC 1E3PA 5IP7H 1HR0Q 3A74A 3F8TA 2HHHL 4LF5Q 3M4OH 1YJNA 4JI8Q 3H3VI 1QVCA 1PVOA 1CKOA 3HOXG 1PFSA 4AQYL 2M6OA 3AFQA 1UE1A 1VQFA 2Q2UA 4RG1A 4DR2L 4JBKA 1YHBA 4K9FA 1EYGA 2VL6A 3J7ZC 4JV5Q 2K52A 2E5LL 2XGTA 1IU5A 3T1HQ 5HY6A 3K7AH 3A0JA 4AI1A 2KENA 4UY81 2L0ZA 5IYCH 5GADC 2JA7G 2JEAI 3CPWA 4BXXH 2JI2A 4A3IH 1YVCA 2V1CC 3OTOQ 4DR3L 3FHWA 2LSSA 3L2PA 1YJ9A 3PZAA 3PUXA 4QIWE 3DM3A 1KL9A 2B29A 2IY5B 5C4JH 3NEMA 3J7A5 3LNLA 3B0AB 4YY3L 2PPTA 2J9UB 4A3LH 5IP9G 1PH1A 4G6BA 5JEAG 2JI1A 1LYLA 2HT1A 5C0XJ 1I94L 2R93G 1CUKA 3RLNA 4DAMA 1TWCH 2R6GA 2E8GA 4A93H 5RXNA 1RL2A 1S72A 2JA6G 5LMNL 5JVG1 1Y1WG 3B6YA 4APVA 4BY7G 4LFCQ 4B3MQ 1QZHA 1DGSA 2K14A 4GNXC 1LKMA 4AIMA 4NXNQ 2LXKA 4JYAQ 3I56A 1SRUA 4HIDA 4JI3L 4AYBE 2V0FA 3G71A 2PMZE 5M3MH 4LW1A 5ELNA 3PSIA 1N32L 2JJQA 1YUXA 4LFAL 4AHYA 2PQAB 3ERSX 1PH6A 2GMGA 3A44A 5IYDG 4LF4Q 3HOWH 1VQ8A 4QL5A 2A1AA 4OX9Q 1HJPA 2DGYA 3G48A 2ZTCA 1EIYB 1P8LA 1CKMA 4JAGA 4JI5Q 3UE0A 2UXBQ 3WWNB 4JI0Q 4P73A 5JJLA 1S2ZA 4DV3Q 1E22A 1NXEA 3S24A 1D8LA 4AYBG 3U4ZA 3CP0A 4BY1H 2L15A 4A3CH 5M3FG 3SS2A 2KHIA 2R7ZH 1B70B 1KRTA 2ZTEA 5H1Sc 2K2DA 4JC0A 4JI7L 1YZ6A 4LF7L 3J80i 1IL2A 3S1MH 1SE8A 1RDVA 1VQNA 1R0GA 3HKSA 2VY3A 1XPUA 1TWGH 2VZAA 4A4IA 1HNWL 1KRSA 5AI2A 5GAHc 1C0AA 4ALPA 2MS3A 5K36G 1K8AC 3KYWA 1L1OB 4AI3A 2R7DA 2GVBA 3ULLA 3NENA 3CMEA 3CCSA 2VQEL 1RIPA 4A3EG 3AYHB 2PYAA 3OYYA 1X3FA 5LMUQ 2UUBL 2BA0A 1R0IA 1YNXA 2AWNA 3HOUG 5IE8A 1NMGA 4IFDI 3EBEA 1H7VA 2HHHQ 1RDGA 4K0KL 5FJ8H 1C7YA 2ZM6L 3PWFA 3GTOH 2WB1E 4HJ5A 3I7FA 5EIOC 4HJ9A 1LKPA 1QUQA 3S1NH 4AQYQ 1IBLL 1LKOA 1HZCA 2ZJRA 1V43A 5FLXc 3S2HH 4P72A 4DR2Q 1VQCA 3RYGA 1N36L 1HNXL 1FJGL 4A3KG 2E5LQ 3STBD 4TQUS 2JI3A 3CCVA 2UUCL 2Z3RB 4OO1I 2WB1G 4DR3Q 5IT9c 1XPOA 1Z47A 1IYJB 4LF8L 3PCOB 4BBSH 5C44G 4YY3Q 2B3GA 2JA8G 2VQFL 2GN5A 3UDFA 1PYBA 3DLLA 2Y0SE 2JQOA 1JYBA 5LMNQ 3MPSA 1OXVA 4R4TA 1VQ7A 4DAYB 1PH9A 1K73C 1VQKA 3HOXH 2HQLA 5GAHC 4R4IA 4B3RL 4OONA 4X65Q 2B5ID 2QGQA 2VW9A 4L5TA 3W5OA 1E1TA 4DV7L 1M90C 1DVBA 1UE7A 5IYBG 2ZJQA 1NXGA 4JI3Q 4R4OA 1X65A 3PO3G 1YITA 4POFA 1XJVA 1BBWA 1N32Q 3I4NG 4IFDJ 4LFAQ 3AEVA 4DUZL 1K9MC 2YYZA 1G51A 2JA7H 2Q2HA 1QCVA 1WI5A 2Y0SG 4DR6L 3IRBA 3TRZA 5GQOA 1K0RA 2IT1A 2UXCL 3AFPA 2JA5G 4YWLA 1VS0A 2KCMA 3W1BA 4B8CD 4DR4Q 4O2DA 3QVDA 1HH2P 1AH9A 4DK3C 4UY8C 5IP9H 1FHHA 3KF8B 1LTLA 1X56A 2R93H 1U5KA 1MIUA 2OTJA 3JAMi 3PUWA 3J80c 4X64L 2JK8A 2JA6H 4LF7Q 4GNXA 1Y1WH 4OWTB 2CKCA 4BY7H 3PIOA 1JJGA 8RXNA 4A76A 3E9HA 3GTGH 1HNWQ 3K8AA 4PMWA 1BKBA 1Q46A 2ID0A 2CCZA 4X62L 2MO0A 1EQRA 2RHSB 4NPSA 1NMFA 3GTQH 3J81j 1FGUA 2VQEQ 1OXTA 4DK6C 1FVIA 3T1YL 5IYDH 2UUBQ 1JJCB 3KF6A 5HGQA 1P16A 2BA1A 3A5UA 1XTDA 4A3JG 2A69D 4JAFA 1M1KC 3IU3I 2NZOA 1H95A 3PF5A 4TVAB 4K0KQ 2K5NA 1KHIA 2ZM6Q 3F1ZA 1O7IA 5EINC 3KYXA 1Q86C 3M3YH 1NBWA 2C35B 4IPGA 1PH4A 5M3FH 4YWKA 4YCWA 2MNAA 2PI2A 4DR1L 4AHXA 1IBLQ 4GKKL 2AMCB 1KC8C 1IU6A 1TWFH 4DV5L 1QUQB 4DV1L 5AJ3Q 2WP8J 2MO1A 4KLKA 1VQ4A 2N78A 1EIFA 4DV6L 1N36Q 1HNXQ 2VS1A 3BZCA 1J5EQ 2F4VL 4DR5L 1Y14B 4C3HH 1X55A 2UUCQ 1JT8A 4GOPC 3CXCA 4LF9L 3RZ6A 3J81i 3TEHB 4JI2L 1B13A 1Q12A 4A3EH 1KIXA 2RDVA 3CC4A 4LF8Q 4JBMA 3JC66 2IHFA 1Y1VG 1ASYA 4JI6L 2M6PA 4DV0L 4BA2I 1XNRL 1MJEA 3HOUH 3BZKA 2H5XA 1X3GA 3K7UC 3E9IA 4LUVA 4HIMA 2VQFQ 2I5LX 1VCXA 1JJ2A 4YCVA 3I55A 1EOVA 1WOCA 4JADA 3PIP1 4QJFA 1G291 5FLMG 4B3RQ 1WYDA 3CCUA 2NVXH 3AQQA 1KQSA 3P8BA 5C0XG 3S15H 2N3SA 5GAEc 1CSPA 4DV7Q 3F2CA 4AR5A 3H0GG 4IPCA 4POGA 3RZDH 4LWCA 3WWVA 1Q1EA 1K8GA 4R1JA 5IWAL 4A3KH 1VZIA 4GLAC 1S24A 1UWVA 1MKHA 4DUZQ 4MZ9A 4GS7D 6RXNA 1VQ9A 5GROA 4DR6Q 1NY4A 2NN6I 3CAMA 3LGJA 1EFWA 3CCQA 3S1RH 2UXCQ 4GLXA 1HR0W 2XJSA 5C3EG 4QY7A 5IY0A 2JE6I 1GVPA 4A3MG 7RXNA 1B71A 1SR3A 5C44H 4O0AA 1YBYA 1YUZA 4AI0A 3CCJA 2JA8H 4P74A 3MXNB 3ULPA 4B3SQ 3FKIG 3RNUA 3HOYG 5M5YH 4X64Q 5MLC3 4Y52H 5K2ME 3M4QA 3TQYA 3OW2A 4GNXB 4PZ7A 4A3BG 3ZJYC 2VNUD 3CCLA 1BQ9A 3U58A 1A0IA 5IYBH 2XJTA 2KHJA 3A5ZB 4A3DG 3PO3H 4KHZA 4X62Q 1XMQL 1XMOQ 2RHQB 2H12A 3I4NH 4NXML 5DM71 3TS2A 1I3QH 3KYUA 3PO2G 4UP8A 4GKJL 3T1YQ 5ELOA 1BFYA 3RLFA 4AR6A 3PUVA 2CWAA 3TS0A 3GD7A 1RWDA 3KF6B 1ZRPA 2JA5H 2Z3QB 4FDBA 4WJ3M 2E2HH 2UXDL 2F52A 1SMMA 5DM61 1XNQL 1TWHH 3GDEA 1MJCA 1Q82C 3K80C 1T9OA 1E1OA 2YV5A 1VQPA 3CPFA 1BE7A 1U0LA 4LF6L 4UPAA 5GAEC 3NBHB 4GKKQ 1X3EA 4DV5Q 4DV1Q 3S14H 3JC62 4HIOA 1VCIA 3CF5A 2M4VA 1YHAA 2XJUA 2CR8A 2DSXA 5MGNA 1PV4A 2LCQA 1IBML 3P2AA 2IX0A 1G6PA 2F4VQ 4DV2L 4DR5Q 4RXNA 1CSQA 3PGZA 2IX1A 4AHWA 2NZHA 4LF9Q 1QYBA 4JI2Q 4Y7NH 1HNZL 3HOZG 4JI6Q 1T9HA 1JE5A 4DV0Q 1XNRQ 4A3JH 2UUAL 4YWMA 2NYDA 2EIFA 5EAYA 1HZBA 3J7Y1 4GN5A 3CCEA 3MSUA 3QQCE 1I94Q 3KJPA 4L5SA 3RZOH 3B08B 2XJRA 4NB3A 1OWCA 5MFPA 1WCMG 5IWAQ 5C4XG 1K3RA 3SGIA 3RZTA 2A68D 4GOPA 2NVQH 1NNQA 2V0EA 2Z6KC 3D0FA 3ICEA 1KXLA 4DKAC 4A3GG 2ES2A 4GLVB 4WJ4A 2V3BB 5MF6A 4IFDG 1BBUA 3TREA 1Y1VH 4UP9A 4XXBB 1OXUA 3KJOA 1NJIC 4QQBX 3HOVG 3GTLH 1WJJA 4JYAL 3RN2A 1VQEA 1DX8A 4BBRG 4JI1L 3KLWA 1PA6A 4PZ8A 2BH8A 5FLMH 1N34L 4OWXB 4IOCA 2Q2IA 4JI7Q 3HKZE 1S40A 3H0GH 5GAGc 1IBKL 2K5VA 2E2JH 5GADc 1XMQQ 1B2JA 1GD7A 2NVYH 4YCUA 1Q7YC 4NXMQ 2K5HA 2R92G 3G6EA 1B2OA 3VDYA 1VQOA 4GKJQ 1IROA 1YI2A 1SLJA 1N33L 4QGUA 1PH7A 4JAEA 1BQ8A 4AR3A 4IPDA 1GKHA 2QA4A 2UXDQ 3PKIA 5C3EH 1XNQQ 2M4YA 1VQAA 5LMNW 4A3MH 1PH3A 3PF4A 3CQZH 1VQ6A 1SMXA 1PYSB 3HKZG 2R7FA 4AR4A 2JA9A 2Q2TA 5C0XI 3STBC 1QZGA 4LF6Q 3ZG6A 3UDIA 3FKIH 3HOYH 2D0OA 1JB7A 1OXSC 1R0HA 3I4MG 4AHZA 3E0EA 1PHJA 3M7NA 1FHMA 1OXXK 3S17H 4DR7L 1R0JA 4A3BH 1YK4A 2WAQE 1IBMQ 4A3DH 4DV2Q 1TXYA 4J15A 4DPGA 4RMFA 4C3JH 4IPHA 1ODHA 3CC2A 3PO2H 1FJGQ 3PUYA 3G4SA 1HNZQ 4L5RC 4YHHL 1GO3E 2HIVA 2CWPA 4R4CA 3CMAA 4PG3A 2EXDA 5JJKA 2N8NA 1CADA 1UE6A 5M5WH 3GO5A 2CKZB 2WAQG 1EWIA 2UUAQ 1X9NA 2PNHA 1E7ZA 4GS3A 1YEZA 3UDGA 1KAWA 3BJUA 1PH5A 1WJVA 3KYYA 4JBJA 1KD1C 3D31A 2MQHA 4LUZA 2O5JD 5GAGC 2CFMA 4MTNA 2RF4A 3I4OA 1YHQA 3GTKH 1B7YB 5JVH1 2ZTDA 4X6AH 2HR5A 2HIXA 5AN9H 4UP7A 2XJQA 1EUJA 1VQGA 1EQQA 3PKJA 3F2DA 4GOPB 4KHPL 5JEAJ 3M9BA 1E8JA 5BR8L 4LFBL 4LHNA 3KYVA 3HOZH 2PI2E 4HIKA 4WFN1 1W2BA 2I0QA 4GN4B 4A3FG 3K0XA 1OTCA 4XIGS 1LUZA 1YJWA 1Z9FA 1UEBA 4X65L 1R9TH 1FL0A 2OWOA 1V9PA 3U50C 4X66L 2OQ0A 1WFQA 2UU9L 2EQSA 3LPEB 3EIVA 2E2IH 4JI1Q 3I2ZA 4HJ7A 4KI0A 3JAMc 1N34Q 1K83H 1X6OA 2I5HA 2GVAA 2A19A 1A8VA 4C3IH 2AKWB 1L2FA 1IBKQ 1L1OC 4B3TL 1WCMH 2Z6KA 2N49A 5C4XH 2VUMG 2B63G 2XTIA 4DR4L 4JBWA 1R0FA 4MNOA 3W1GA 1IZ6A 4A3GH 1PH8A 1RYTA 1N33Q 4JOIC 5J3BA 4ZN3B 1AE2A 4HJ8A 2BE5D 5IP7G 4ME3A 4TVMA 2ZIXA 2JEBI 3PUZA 1HZAA 4JI4L 3J7Z1 2ALYB 2OTLA 2YTXA 3HOVH 1I50H 1SFOH 4IJLA 3NELA 2K4KA 3KOJA 3VPBE 4DV4L 1YIJA 4XTCS 1IRNA 2I5MX 3KYHC 1V1QA 1JMCA 2RCNA 4BBRH 2AWOA 2YTYA 1ASZA 2KN9A 4DR7Q 2OQKA 3GTMH 3F2BA 1IXRA 3EN2A 4V196 4DR1Q 4LHLA 1N9WA 2PVEA 2ATWA 3RR5A 4R4QA 4BA1I 3ER0A 3CCRA 3PIPA 1XPRA 3KDFB 5IYCG 1Z92B 3K81C 2FXQA 4BXXG 5H1SE 4A3IG 4H02A 4DV6Q 1CKNB 2R92H 2D62A 2NN6G 1IW7D 1YK5A 4DUYL 4GN3B 4YHHQ 1S3OA 1VZGA 4XGHA 4AH6A 4A3LG 3J81c 1UE5A 2AYJA 2F3IA 3FP9A 3PIO1 1HR0L 1SROA 1TWAH 2K50A 1E24A 1S30A 4LF5L 1HZ9A 3PV0A 3M85A 4IJHA 4A93G 1Q8KA 5AJ3L 4JI8L 4EX5A 1A63A 1NE3A 1PH2A 3K35A 3Q8DA 1J5EL 4ZN1B 1VZHA 1BRFA 2QEXA 3I4MH 1I6HH 4IO9A 3JC63 4P71A 1BVSA 3HFZB 5M3MG 4JV5L 1VQJA 3M4PA 5DLQE 2PSMC 3ULJA 4C2MH 3T1HL 4EQ5A 1GM5A 1RYQA 2C6AA 3KFUA 1VQMA 5E7NA 1X54A 3HOWG 3S16H 3OTOL 4KHPQ 2C6BA 4DNIA 5BR8Q 4PZ6A 2WFWA 4LFBQ 1OWBA 4AI2A 2YTVA 4L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI H;  4POG A;  3HOY H;  4A3E G;  3RZD H;  2NVT H;  2D0O A;  3AYH B;  2PYA A;  1OXS C;  3OYY A;  1R0H A;  1X3F A;  4LWC A;  3WWV A;  5LMU Q;  1JB7 A;  2UUB L;  1D7Q A;  1Q1E A;  1K8G A;  3I4M G;  4R1J A;  5AI3 A;  4BY1 G;  3E0E A;  5IWA L;  4A3K H;  2BA0 A;  1PHJ A;  3M7N A;  4A3C G;  1FHM A;  1OXX K;  1R0I A;  1Q1B A;  3S17 H;  1YNX A;  2AWN A;  1S24 A;  1UWV A;  4GLA C;  2R7Z G;  4DR7 L;  1MKH A;  3GTP H;  4DUZ Q;  1VQB A;  1AE3 A;  3HOU G;  4OXP A;  5IE8 A;  4MZ9 A;  3CD6 A;  1NMG A;  1R0J A;  6RXN A;  4X66 Q;  4A3B H;  4IFD I;  3EBE A;  1VQ9 A;  2UU9 Q;  2A8V A;  1VQL A;  1H7V A;  1YK4 A;  5GRO A;  2WAQ E;  2HHH Q;  1RDG A;  4DR6 Q;  1NY4 A;  4LFC L;  4B3M L;  2NN6 I;  1IBM Q;  4K0K L;  1CAA A;  2CQO A;  3CAM A;  5FJ8 H;  3LGJ A;  1C7Y A;  1SN8 A;  1EFW A;  4A3D H;  3CCQ A;  2ZM6 L;  4DV2 Q;  3PWF A;  1L0W A;  3S1R H;  3GTO H;  1TXY A;  2UXC Q;  4GLX A;  1HR0 W;  4J15 A;  2WB1 E;  4NXN L;  1YV1 A;  4DPG A;  4HJ5 A;  3I7F A;  2ZJP A;  2MFI A;  1VQ5 A;  4RMF A;  4C3J H;  5C3E G;  3U4V A;  4QY7 A;  4IPH A;  5IY0 A;  2JE6 I;  1LKP A;  4HJ9 A;  1QUQ A;  3CC2 A;  1GVP A;  4A3M G;  3S1N H;  4AQY Q;  2BH2 A;  7RXN A;  1B71 A;  1SR3 A;  1IBL L;  5C44 H;  1FJG Q;  3PO2 H;  3PUY A;  2PQA A;  4HJA A;  4O0A A;  1YBY A;  3G4S A;  1HNZ Q;  4P75 A;  1LKO A;  1HZC A;  1W3S A;  4B3T Q;  1YUZ A;  3H15 A;  2ZJR A;  3CCJ A;  2JA8 H;  1V43 A;  5FLX c;  4L5R C;  4YHH L;  3S2H H;  3S1Q H;  4P72 A;  4P74 A;  1GO3 E;  3MXN B;  4DR2 Q;  2HIV A;  2CWP A;  3CW2 C;  1VQC A;  1A62 A;  4R4C A;  3CMA A;  3ULP A;  4B3S Q;  3RYG A;  3FKI G;  3RNU A;  3HOY G;  4LNQ A;  4PG3 A;  5M5Y H;  1N36 L;  1HNX L;  4X64 Q;  2EXD A;  1LM0 A;  4LF4 L;  1T9Q A;  4Y52 H;  5JJK A;  2N8N A;  3M4Q A;  3UE1 A;  1FJG L;  3TQY A;  4A3K G;  2E5L Q;  3RN5 A;  1CAD A;  4OX9 L;  4A75 A;  4IOA A;  1Q81 C;  1UE6 A;  5M5W H;  3GO5 A;  2IHE A;  3BU2 A;  3STB D;  4TQU S;  3GTJ H;  4GNX B;  3OW2 A;  4A93 G;  2CKZ B;  2WAQ G;  3CCV A;  1EWI A;  4LUO A;  4PZ7 A;  2UUA Q;  2UUC L;  4A3B G;  4JI5 L;  4OO1 G;  1VQI A;  2DUD A;  2UXB L;  4B3S L;  3S2D H;  1X9N A;  2PNH A;  3ZJY C;  1E7Z A;  2VNU D;  3CCL A;  2YU9 H;  4GS3 A;  1BQ9 A;  1C09 A;  4OO1 I;  4JI0 L;  1YEZ A;  2WB1 G;  3U58 A;  1A0I A;  5IYB H;  1NTG A;  3UDG A;  2KHJ A;  1KAW A;  4DR3 Q;  3BJU A;  1PH5 A;  5FJ8 G;  4WJ4 A;  2KBN A;  5IT9 c;  3A5Z B;  4DV3 L;  4A3D G;  1XPO A;  4A3F H;  3PO3 H;  3KYY A;  4JI4 Q;  2D0P A;  4JBJ A;  1T9P A;  1Z47 A;  4KHZ A;  1KD1 C;  1IYJ B;  3D31 A;  2MQH A;  4LF8 L;  4LUZ A;  3UDX A;  4X62 Q;  1XMQ L;  3PCO B;  5GAG C;  1XMO Q;  2CFM A;  2RHQ B;  4MTN A;  2RF4 A;  3I4O A;  3RLO A;  3I4N H;  1YHQ A;  4NXM L;  3GTK H;  4BBS H;  3TS2 A;  1I3Q H;  1B7Y B;  3KYU A;  3PO2 G;  4DV4 Q;  5C44 G;  4YY3 Q;  4UP8 A;  2PVX A;  2LXJ A;  2ZTD A;  4GKJ L;  4X6A H;  2B3G A;  1QVF A;  1RB9 A;  2HR5 A;  2HIX A;  1QVG A;  3CCM A;  3T1Y Q;  2JA8 G;  5ELO A;  1BFY A;  1C9O A;  3RLF A;  4AR6 A;  3PUV A;  3JC6 3;  2VQF L;  2GN5 A;  4OWW B;  1SMU A;  2CWA A;  3UDF A;  4TPU A;  1PYB A;  2KKD A;  3L0O A;  1XMO L;  3TS0 A;  3GD7 A;  1SMW A;  4UP7 A;  3DLL A;  2Y0S E;  1EUJ A;  1RWD A;  3KF6 B;  2JQO A;  1ZRP A;  1JYB A;  1J6Q A;  1VQG A;  2JA5 H;  3H3V H;  4FDB A;  5LMN Q;  3MPS A;  1OXV A;  4R4T A;  1EQQ A;  4WJ3 M;  2E2H H;  2UXD L;  3F2D A;  2K75 A;  4GOP B;  3CC7 A;  1N8R C;  1L1O A;  2F52 A;  1VQ7 A;  4DAY B;  1SMM A;  4KHP L;  5JEA J;  1XNQ L;  3M9B A;  1PH9 A;  1K73 C;  1VQK A;  1TWH H;  3GDE A;  3HOX H;  1MJC A;  1E8J A;  5BR8 L;  2HQL A;  5GAH C;  1I5F A;  4R4I A;  2QL0 A;  4B3R L;  1Q82 C;  4OON A;  3K80 C;  4X65 Q;  1T9O A;  4BA2 I;  4LFB L;  1E1O A;  2QGQ A;  2VW9 A;  2YV5 A;  1VQH A;  3KYV A;  4L5T A;  1E1T A;  3CPF A;  4JG2 A;  3W5O A;  1VQP A;  4DV7 L;  1BE7 A;  1M90 C;  1DVB A;  3HOZ H;  1UE7 A;  4JCV E;  5IYB G;  2VUM H;  1U0L A;  2B63 H;  2ZJQ A;  4LF6 L;  4JI3 Q;  4UPA A;  2PI2 E;  4R4O A;  1X65 A;  2OCE A;  5GAE C;  4HIK A;  1W2B A;  4GN4 B;  2I0Q A;  4A3F G;  3K0X A;  3MEF A;  3KDF A;  3NBH B;  1YIT A;  4POF A;  3PO3 G;  1OTC A;  4XIG S;  1LUZ A;  5M5X H;  1YJW A;  4GKK Q;  1X3E A;  1B8A A;  4JOI A;  5LMU L;  1XJV A;  1BBW A;  1UEB A;  1Z9F A;  4DV5 Q;  1N32 Q;  4DV1 Q;  3S14 H;  3JC6 2;  4HIO A;  2ASB A;  4DUY Q;  2Z0S A;  4X65 L;  1R9T H;  3I4N G;  4IFD J;  1VCI A;  5JJI A;  2KCT A;  3CF5 A;  1FL0 A;  1CKN A;  4LFA Q;  3AEV A;  4BBS G;  1VQD A;  2OWO A;  1YHA A;  4DUZ L;  1V9P A;  2AHO B;  1K9M C;  3L7Z C;  3U50 C;  1E3P A;  4X66 L;  2DSX A;  2OQ0 A;  1WFQ A;  2YYZ A;  1G51 A;  2EQS A;  2UU9 L;  2JA7 H;  5IP7 H;  2Q2H A;  1QCV A;  1WI5 A;  1HR0 Q;  2Y0S G;  3A74 A;  3EIV A;  3F8T A;  2LCQ A;  1PV4 A;  2E2I H;  2HHH L;  4DR6 L;  3IRB A;  4JI1 Q;  1IBM L;  4LF5 Q;  3TRZ A;  5GQO A;  2IX0 A;  1G6P A;  1K0R A;  2IT1 A;  3I2Z A;  4DV2 L;  2F4V Q;  3M4O H;  4HJ7 A;  2UXC L;  4DR5 Q;  3AFP A;  1YJN A;  4KI0 A;  4YWL A;  4RXN A;  3JAM c;  1N34 Q;  2JA5 G;  1CSQ A;  3PGZ A;  1VS0 A;  2KCM A;  4JI8 Q;  3W1B A;  2IX1 A;  1K83 H;  1X6O A;  4DR4 Q;  3H3V I;  2I5H A;  2GVA A;  1QVC A;  4O2D A;  3QVD A;  1A8V A;  2A19 A;  4C3I H;  1HH2 P;  2NZH A;  1CKO A;  1PVO A;  2AKW B;  3HOX G;  1PFS A;  1L2F A;  4LF9 Q;  1QYB A;  4AQY L;  1AH9 A;  4DK3 C;  4JI2 Q;  1IBK Q;  4UY8 C;  3AFQ A;  4Y7N H;  5IP9 H;  1UE1 A;  1HNZ L;  1L1O C;  1VQF A;  4B3T L;  1FHH A;  1WCM H;  2Z6K A;  3KF8 B;  1LTL A;  2N49 A;  1X56 A;  3HOZ G;  2Q2U A;  4RG1 A;  5C4X H;  2R93 H;  4DR2 L;  4JBK A;  4JI6 Q;  2VUM G;  2B63 G;  1YHB A;  4K9F A;  1T9H A;  1JE5 A;  1U5K A;  2XTI A;  4DV0 Q;  1MIU A;  1EYG A;  1XNR Q;  4DR4 L;  2OTJ A;  4JBW A;  3JAM i;  3PUW A;  3J80 c;  4A3J H;  2VL6 A;  4X64 L;  2JK8 A;  2JA6 H;  3J7Z C;  4JV5 Q;  4LF7 Q;  2K52 A;  1R0F A;  4GNX A;  4MNO A;  2E5L L;  1Y1W H;  3W1G A;  4OWT B;  2XGT A;  1IU5 A;  1IZ6 A;  3T1H Q;  4BY7 H;  5HY6 A;  3PIO A;  1PH8 A;  4A3G H;  1RYT A;  1JJG A;  3K7A H;  1N33 Q;  8RXN A;  3A0J A;  2KEN A;  4JOI C;  5J3B A;  4A76 A;  3E9H A;  2UUA L;  1AE2 A;  4HJ8 A;  4YWM A;  5IYC H;  5GAD C;  3GTG H;  2JA7 G;  5IP7 G;  2JEA I;  1HNW Q;  2EIF A;  5EAY A;  3CPW A;  4ME3 A;  4BXX H;  3K8A A;  1HZB A;  1YVC A;  2V1C C;  3OTO Q;  4A3I H;  4DR3 L;  4GN5 A;  3FHW A;  2LSS A;  2JEB I;  3L2P A;  3CCE A;  1YJ9 A;  4PMW A;  1BKB A;  3PUZ A;  1HZA A;  4JI4 L;  3PZA A;  1Q46 A;  3PUX A;  4QIW E;  2ID0 A;  3DM3 A;  1KL9 A;  2CCZ A;  1I94 Q;  2B29 A;  4X62 L;  2MO0 A;  3KJP A;  2ALY B;  2OTL A;  2IY5 B;  2YTX A;  3HOV H;  1EQR A;  4L5S A;  1I50 H;  2RHS B;  5C4J H;  3NEM A;  3RZO H;  1SFO H;  4IJL A;  3J7A 5;  3NEL A;  4NPS A;  1NMF A;  3GTQ H;  3J81 j;  1FGU A;  2K4K A;  3KOJ A;  4NB3 A;  2VQE Q;  4DV4 L;  1YIJ A;  4YY3 L;  4XTC S;  4A3L H;  1IRN A;  2I5M X;  5IP9 G;  1OXT A;  3KYH C;  4DK6 C;  1FVI A;  1V1Q A;  1JMC A;  2RCN A;  3T1Y L;  1PH1 A;  5IYD H;  2UUB Q;  1JJC B;  5JEA G;  1WCM G;  1LYL A;  4BBR H;  3KF6 A;  2AWO A;  5IWA Q;  2YTY A;  2HT1 A;  5C0X J;  5HGQ A;  1I94 L;  2R93 G;  1P16 A;  2BA1 A;  1K3R A;  1CUK A;  1ASZ A;  2KN9 A;  3RZT A;  3RLN A;  1XTD A;  3SGI A;  3A5U A;  4DR7 Q;  4DAM A;  4GOP A;  2NVQ H;  1TWC H;  1NNQ A;  2R6G A;  2E8G A;  4A93 H;  5RXN A;  2OQK A;  1RL2 A;  4A3J G;  3GTM H;  1S72 A;  2JA6 G;  2Z6K C;  5LMN L;  3F2B A;  1M1K C;  3D0F A;  1IXR A;  3EN2 A;  3ICE A;  1KXL A;  1Y1W G;  3B6Y A;  4DR1 Q;  4DKA C;  4APV A;  1N9W A;  4A3G G;  2ES2 A;  4BY7 G;  2NZO A;  1H95 A;  2PVE A;  4TVA B;  3PF5 A;  2ATW A;  4LFC Q;  4B3M Q;  4K0K Q;  3RR5 A;  4GLV B;  4R4Q A;  2K5N A;  1KHI A;  4BA1 I;  1DGS A;  1QZH A;  3ER0 A;  2V3B B;  3CCR A;  3PIP A;  2ZM6 Q;  3F1Z A;  3KDF B;  2K14 A;  4GNX C;  1LKM A;  1XPR A;  4AIM A;  5IYC G;  2LXK A;  3K81 C;  4NXN Q;  2FXQ A;  1O7I A;  4IFD G;  1Q86 C;  3KYX A;  3M3Y H;  4JYA Q;  1NBW A;  1BBU A;  3TRE A;  2C35 B;  1SRU A;  1Y1V H;  4IPG A;  4UP9 A;  3I56 A;  1PH4 A;  5H1S E;  4BXX G;  4A3I G;  4H02 A;  5M3F H;  4HID A;  4YWK A;  4DV6 Q;  4JI3 L;  4YCW A;  4AYB E;  1CKN B;  2PI2 A;  2MNA A;  2D62 A;  2NN6 G;  2R92 H;  4DR1 L;  3G71 A;  1IBL Q;  1OXU A;  2PMZ E;  3KJO A;  1NJI C;  4GKK L;  2AMC B;  5M3M H;  1KC8 C;  4LW1 A;  5ELN A;  1IU6 A;  1TWF H;  3PSI A;  4DV5 L;  4QQB X;  1N32 L;  1QUQ B;  4DV1 L;  1YK5 A;  3HOV G;  4DUY L;  2JJQ A;  4GN3 B;  1YUX A;  4YHH Q;  3GTL H;  5AJ3 Q;  4LFA L;  2PQA B;  2WP8 J;  1WJJ A;  1S3O A;  2MO1 A;  4JYA L;  4KLK A;  3ERS X;  1VQ4 A;  1PH6 A;  2N78 A;  1EIF A;  4AH6 A;  2GMG A;  3J81 c;  1UE5 A;  1VQE A;  3RN2 A;  4A3L G;  4DV6 L;  1DX8 A;  1N36 Q;  3A44 A;  2F3I A;  3FP9 A;  1HNX Q;  5IYD G;  4LF4 Q;  3HOW H;  1VQ8 A;  2VS1 A;  4BBR G;  1HR0 L;  3BZC A;  1SRO A;  1TWA H;  2A1A A;  2K50 A;  1E24 A;  4QL5 A;  1S30 A;  4JI1 L;  4OX9 Q;  4LF5 L;  1J5E Q;  3KLW A;  1PA6 A;  1HZ9 A;  4PZ8 A;  2F4V L;  1HJP A;  2DGY A;  2BH8 A;  3G48 A;  3PV0 A;  4IJH A;  1Q8K A;  2ZTC A;  1Y14 B;  5FLM H;  3M85 A;  4C3H H;  5AJ3 L;  4DR5 L;  1P8L A;  1N34 L;  1CKM A;  1EIY B;  1X55 A;  4JI8 L;  2UUC Q;  4JI5 Q;  3UE0 A;  4OWX B;  4EX5 A;  1JT8 A;  2UXB Q;  4IOC A;  1A63 A;  4GOP C;  4JI0 Q;  2Q2I A;  3CXC A;  4P73 A;  4JI7 Q;  4LF9 L;  3HKZ E;  5JJL A;  1NE3 A;  3RZ6 A;  1S2Z A;  1S40 A;  3H0G H;  3J81 i;  4DV3 Q;  3TEH B;  1PH2 A;  1E22 A;  1B13 A;  4JI2 L;  1IBK L;  1Q12 A;  2K5V A;  4A3E H;  1KIX A;  2RDV A;  3Q8D A;  3S24 A;  1J5E L;  3CC4 A;  1D8L A;  2E2J H;  1BRF A;  4LF8 Q;  4AYB G;  4JBM A;  1XMQ Q;  1B2J A;  1GD7 A;  3CP0 A;  3JC6 6;  2NVY H;  4YCU A;  3U4Z A;  2IHF A;  2QEX A;  1Y1V G;  1Q7Y C;  4BY1 H;  3I4M H;  1I6H H;  1ASY A;  2L15 A;  4A3C H;  5M3F G;  4JI6 L;  3SS2 A;  4NXM Q;  2KHI A;  4DV0 L;  4IO9 A;  1B70 B;  2K5H A;  1XNR L;  4P71 A;  1KRT A;  3G6E A;  2R92 G;  2R7Z H;  1BVS A;  1B2O A;  2ZTE A;  2VQE L;  3HFZ B;  2K2D A;  3VDY A;  1MJE A;  3HOU H;  3BZK A;  4JC0 A;  1VQO A;  5M3M G;  4GKJ Q;  2H5X A;  1X3G A;  3K7U C;  4JV5 L;  4JI7 L;  1YZ6 A;  4LF7 L;  1VQJ A;  3E9I A;  1IRO A;  3M4P A;  5DLQ E;  4LUV A;  1YI2 A;  3ULJ A;  4HIM A;  3J80 i;  4C2M H;  1SLJ A;  1IL2 A;  3T1H L;  3S1M H;  4EQ5 A;  2VQF Q;  1GM5 A;  1SE8 A;  1N33 L;  1RDV A;  4QGU A;  1VQN A;  2I5L X;  1R0G A;  1PH7 A;  1VCX A;  3KFU A;  1VQM A;  1JJ2 A;  3HKS A;  2VY3 A;  1XPU A;  1BQ8 A;  4AR3 A;  5E7N A;  1TWG H;  4IPD A;  1GKH A;  1X54 A;  2VZA A;  4A4I A;  3HOW G;  4YCV A;  1HNW L;  2QA4 A;  2UXD Q;  3I55 A;  1KRS A;  3S16 H;  5C3E H;  1EOV A;  5AI2 A;  1WOC A;  3OTO L;  4KHP Q;  1C0A A;  1XNQ Q;  4QJF A;  4DNI A;  1G29 1;  2M4Y A;  4ALP A;  2MS3 A;  1VQA A;  5LMN W;  4A3M H;  1K8A C;  5BR8 Q;  1PH3 A;  5K36 G;  3PF4 A;  5FLM G;  4B3R Q;  4PZ6 A;  3KYW A;  1WYD A;  1L1O B;  5C4X G;  3CQZ H;  3CCU A;  2R7D A;  3AQQ A;  2GVB A;  1SMX A;  2WFW A;  1KQS A;  2NVX H;  1VQ6 A;  4LFB Q;  1PYS B;  3HKZ G;  3ULL A;  5C0X G;  2R7F A;  4AR4 A;  3NEN A;  3S15 H;  2N3S A;  2JA9 A;  1CSP A;  4DV7 Q;  2YTV A;  3F2C A;  3CME A;  3CCS A;  2Q2T A;  4AR5 A;  5C0X I;  3STB C;  1QZG A;  4LF6 Q;  3H0G G;  4L5Q A;  1RIP A;  3UDI A;  4IPC A; 
#chains in the Genus database with same CATH topology
 2NVT H;  2O5I C;  2JP1 A;  1V1P A;  1EL0 A;  2NVX B;  1D7Q A;  3P7J A;  1SXT A;  1EWC A;  5AI3 A;  1S5F D;  4BY1 G;  3EA6 A;  3S15 B;  4A3C G;  1Q1B A;  1PZX A;  2R7Z G;  3HOU L;  2ERJ A;  3GTP H;  1BNZ A;  1VQB A;  1AE3 A;  1UUP A;  4NDX A;  4OXP A;  1WD0 A;  3CD6 A;  4X66 Q;  3RZD B;  3SXH A;  2UU9 Q;  3WDN A;  2A8V A;  3WWL A;  1VQL A;  5IT9 E;  4RAU C;  1A2T A;  4LFC L;  3D6C A;  4B3M L;  1CAA A;  2CQO A;  2ERS A;  4CGY B;  2XVS A;  3Q24 A;  1SN8 A;  4K8I A;  1L0W A;  1LTT D;  4ZUJ A;  4NXN L;  1YV1 A;  1DOL A;  4DK0 A;  2ZJP A;  2MFI A;  1VQ5 A;  1NR2 A;  4OEM B;  2J7Z A;  2QW7 A;  1DXM A;  1G2S A;  3U4V A;  4CDF C;  1HHV A;  1GUO A;  1K0S A;  2A6E D;  2WB1 B;  2KQ3 A;  1SSO A;  1O7L A;  2NVX L;  1ZXT A;  2BH2 A;  1HFN A;  2OT2 A;  2PQA A;  4HJA A;  3S1R B;  3S15 L;  3TSS A;  3TME A;  1Z7T A;  4P75 A;  1W3S A;  3G6J B;  4B3T Q;  3H15 A;  1ICF B;  2RSN A;  1ENA A;  3S1Q H;  3CW2 C;  1A62 A;  3RZD L;  3NSW A;  1SJE D;  3T4A C;  1FNU A;  1SNQ A;  1TY2 A;  4LNQ A;  2F0F A;  5C44 B;  4E6I A;  1LM0 A;  3IFT A;  1T9Q A;  4LF4 L;  4EQN A;  1O80 A;  2G9H D;  3UE1 A;  3RN5 A;  4H7B A;  2JA8 B;  4OX9 L;  4A75 A;  4IOA A;  1Q81 C;  1I6V C;  1PXU A;  2JXM B;  2IHE A;  3BU2 A;  3GTJ H;  4LUO A;  4U67 1;  5L37 A;  4JI5 L;  4OO1 G;  1VQI A;  5M5Y B;  1SDF A;  2DUD A;  3O13 A;  4LAA A;  4B3S L;  2UXB L;  3S2D H;  5CV9 A;  2CW0 D;  2YU9 H;  1C09 A;  2PO4 A;  4JI0 L;  1NTG A;  3S1R L;  5FJ8 G;  2KBN A;  4X3S A;  5MFZ A;  4DV3 L;  4A3F H;  4JI4 Q;  2D0P A;  1T9P A;  3PQI A;  3UDX A;  2KVM A;  1KNE A;  2R7Z B;  5F2D A;  3RLO A;  2PW5 A;  3NQI A;  5C44 L;  2K6A A;  4DV4 Q;  2PVX A;  2LXJ A;  3PO3 B;  2CH4 A;  1QVF A;  1RB9 A;  2JA8 L;  1QVG A;  1BBX C;  3CCM A;  1B3Q A;  1CHP D;  1DM0 B;  1C9O A;  4K14 A;  1JOQ A;  3OW7 A;  4N8F A;  3NFP I;  2SNM A;  5KEE A;  2XJP A;  3QWN A;  5KIX A;  1SMU A;  4OWW B;  3I4N B;  2NUC A;  4TPU A;  5JPM C;  2KKD A;  5M5Y L;  1TWG B;  2B2Y C;  3L0O A;  1SMW A;  4UHV A;  1XMO L;  2IWH A;  4Y52 L;  2XJV A;  1J6Q A;  1L0Y B;  3MA2 B;  4CDD C;  3H3V H;  5DNF A;  2EPB A;  1QIL A;  4RCO A;  1JWU D;  2K75 A;  3CC7 A;  1N8R C;  1L1O A;  4RWS C;  1TVX A;  3OHX C;  1HA5 A;  2JN4 A;  2Q8R E;  1NAP A;  1I5F A;  4WJW A;  2QL0 A;  4ZCK A;  1VF7 A;  5J22 A;  1II3 A;  3A7A B;  1JQY D;  2JA5 B;  3BDL A;  1FNV A;  1VQH A;  4JG2 A;  5IYB L;  2E2H B;  1EZ6 A;  4JCV E;  4U67 3;  2VUM H;  1PTO F;  3PO3 L;  3J80 E;  2B63 H;  1TT2 A;  2OCE A;  1TWH B;  3E3X A;  3MEF A;  3KDF A;  3OMG A;  4FF3 A;  5M5X H;  2A6H D;  1B8A A;  4IUT A;  4JOI A;  5LMU L;  1OO9 B;  2XNA C;  5E1F A;  3I4N L;  2B2W C;  1TWG L;  4DA2 A;  4DUY Q;  2Z0S A;  2ASB A;  4E6Y A;  5JJI A;  1H9M A;  4J6H A;  2KCT A;  4BBS G;  1CKN A;  4IUV A;  1VQD A;  4BS9 A;  1QNK A;  2AHO B;  2CKA A;  3LWO B;  3L7Z C;  1E3P A;  1EQV A;  5IP7 H;  4R8N A;  1EU4 A;  1HR0 Q;  2KOL A;  3A74 A;  4JW0 A;  3F8T A;  5KNC A;  2HHH L;  5HUR A;  4ILW A;  4LF5 Q;  3V96 A;  2JA5 L;  4HSV A;  2F0G A;  3M4O H;  1G6Z A;  1YJN A;  2E2H L;  5LL6 S;  4JI8 Q;  1I4P A;  1M4V A;  1HA6 A;  3H3V I;  1TWH L;  1QVC A;  1EQT A;  2K32 A;  2OEO A;  1PVO A;  1CKO A;  3HOX G;  1PFS A;  4AQY L;  2M6O A;  4K5X A;  4NKL A;  5J1Z A;  4QB4 A;  1EY4 A;  3AFQ A;  1UE1 A;  1F2Y A;  1SYE A;  3EVQ A;  4Z9C B;  1VQF A;  2F0J A;  2QIL A;  2EJM A;  1V1O A;  2Q2U A;  3BVZ A;  4RG1 A;  1QB5 D;  4EGV A;  5I2X A;  4DR2 L;  4JBK A;  1YHB A;  4K9F A;  1EYG A;  1EY7 A;  1DON A;  4MTK A;  1LT3 D;  2VL6 A;  1EY9 A;  3S14 L;  3J7Z C;  4JV5 Q;  2K52 A;  3BVG A;  3LWQ B;  5ELE A;  2E5L L;  5EBD A;  4NW2 A;  2XGT A;  5J39 A;  1IU5 A;  3T1H Q;  5HY6 A;  3K7A H;  3A0J A;  3QG1 A;  4AI1 A;  2K1B A;  2KEN A;  4ZRZ A;  4QUF A;  4UY8 1;  4IUR A;  2MUY A;  2L0Z A;  4KY7 A;  2EZV A;  5IYC H;  5GAD C;  2JA7 G;  4RGM A;  4P2C B;  2JEA I;  3CPW A;  2PCF B;  4BXX H;  2JI2 A;  4A3I H;  1YVC A;  2V1C C;  3OTO Q;  4DR3 L;  3FHW A;  2LSS A;  4DGZ A;  1NR4 A;  3L2P A;  1YJ9 A;  3HJW B;  2NN6 H;  1PZJ D;  1HUN A;  3PZA A;  3PUX A;  4QIW E;  2ICE C;  3DM3 A;  1KL9 A;  3SDZ A;  2F0P A;  2B29 A;  2AQC A;  2VB2 X;  2IY5 B;  2JYO A;  5C4J H;  3NEM A;  3J7A 5;  1CQF A;  5BN5 A;  2OXP A;  3LNL A;  2LS0 1;  3B0A B;  4Y7N L;  4ZQ3 A;  4YY3 L;  2EY6 A;  2PPT A;  2J9U B;  4A3L H;  1QOH A;  5IP9 G;  4B9X A;  2SEB D;  3BG3 A;  5COY A;  1PH1 A;  4G6B A;  4HMI A;  5JEA G;  1PFU A;  2JI1 A;  1LYL A;  1SMY D;  2HT1 A;  5C0X J;  1I94 L;  2R93 G;  1ZEQ X;  1CUK A;  3RLN A;  1V1P B;  2EXZ A;  4DAM A;  1TWC H;  4A3J L;  2XWB B;  2R6G A;  2E8G A;  4A93 H;  5RXN A;  1RL2 A;  4B08 A;  1S72 A;  2JA6 G;  5LMN L;  5JVG 1;  3CU7 A;  4R9W A;  1Y8N B;  1Y1W G;  3B6Y A;  2X6L A;  4FP5 D;  1LTI D;  4APV A;  4BY7 G;  3QJY A;  5I6W A;  4LFC Q;  4B3M Q;  4Q0F A;  3SK6 A;  4XT1 B;  1QZH A;  2NVQ B;  1DGS A;  2Z1C A;  2K14 A;  4GNX C;  1LKM A;  4AIM A;  3NBI A;  2LXK A;  4NXN Q;  4JYA Q;  4ULL A;  3I56 A;  1SRU A;  4I7A A;  4KK7 A;  4HID A;  4JI3 L;  3URY A;  4AYB E;  4XDX A;  1TR5 A;  3OIP A;  2V0F A;  3V05 A;  3G71 A;  2PMZ E;  1EIH A;  2F0K A;  5M3M H;  4H0L C;  4LW1 A;  1CK1 A;  5ELN A;  5E3F A;  3PSI A;  3RZO L;  1N32 L;  3MXU A;  2JJQ A;  1YUX A;  1Y1V B;  4LFA L;  4AHY A;  2PQA B;  2NTT A;  3ERS X;  3SK4 A;  3TP5 A;  1PH6 A;  2GMG A;  5KYI A;  3A44 A;  5IYD G;  2KEE A;  4LF4 Q;  3HOW H;  1VQ8 A;  1B50 A;  4QL5 A;  2A1A A;  2NVQ L;  3GV3 A;  4OX9 Q;  3GTL B;  1HJP A;  2DGY A;  3G48 A;  1ESR A;  2AQ2 B;  2ZTC A;  3LWP B;  1PZK D;  2SNS A;  1EIY B;  3D6W A;  1P8L A;  1CKM A;  3FPU B;  4JAG A;  1PRT D;  2QEJ C;  4JI5 Q;  3UE0 A;  2UXB Q;  3BDC A;  3WWN B;  3TDQ A;  1WTV A;  4JI0 Q;  5LL6 X;  5JVG 3;  4P73 A;  5JJL A;  1MSG A;  3R2T A;  1S2Z A;  1BF4 A;  4FVM A;  4DV3 Q;  1E22 A;  3QOL A;  1NXE A;  3S24 A;  4K2K A;  1D8L A;  1Y1V L;  4AYB G;  4EQP A;  3U4Z A;  3CP0 A;  3H3V C;  3X3N A;  4BY1 H;  1KDC A;  1MHW C;  2L15 A;  4A3C H;  5M3F G;  3SS2 A;  1XWE A;  3NTK A;  2KHI A;  2R7Z H;  1B70 B;  2SDF A;  1KRT A;  2ZTE A;  5H1S c;  2K2D A;  3H0G B;  4JC0 A;  1Y1W B;  3U9O A;  4JI7 L;  1YZ6 A;  3VYS A;  4LF7 L;  3GTL L;  4R8I A;  3J80 i;  1IL2 A;  3S1M H;  2NVY B;  1SE8 A;  1RDV A;  4V19 0;  1VQN A;  1R0G A;  2E75 C;  2K01 A;  3GTG B;  2F0Q A;  1SE3 A;  2F4I A;  3HKS A;  2F0T A;  2VY3 A;  1XPU A;  4QIW B;  1QNU A;  1TWG H;  2VZA A;  4A4I A;  1HNW L;  1KRS A;  5IP9 L;  1ILQ A;  1U4P A;  3A8I E;  3BYY B;  5AI2 A;  5GAH c;  3TP6 A;  1C0A A;  1E0B A;  3QOJ A;  5FLM L;  3I90 A;  4ALP A;  1FNW A;  2MS3 A;  1ESF A;  1K8A C;  2LY7 A;  1PFB A;  1CA5 A;  5K36 G;  4C3H G;  1Y69 U;  3KYW A;  1L1O B;  4AI3 A;  2R7D A;  2GVB A;  5I4D A;  2N88 A;  3ULL A;  3R2I A;  5JOB A;  3NEN A;  1GUW A;  2AQ3 B;  1O78 A;  2F0E A;  2IX3 A;  3CME A;  3CCS A;  3H0G L;  5C3E B;  3DWQ A;  1SYG A;  4K6D A;  1RIP A;  2VQE L;  3HJY B;  4A3M B;  4KHV A;  4A3E G;  2L0C A;  3AYH B;  2NVY L;  2PYA A;  3V2T A;  3OYY A;  1X3F A;  5I9O A;  5LMU Q;  2UUB L;  3Q0A A;  2BA0 A;  5EBC A;  1R0I A;  1YNX A;  2AWN A;  1S5D D;  3ITP A;  1LV9 A;  2F3W A;  3HOU G;  5IE8 A;  3FKI B;  2O5J C;  1NMG A;  3BVM A;  4IFD I;  4OO1 H;  3EBE A;  1XTC D;  3I73 A;  3UI2 A;  1H7V A;  2HHH Q;  2DNC A;  1RDG A;  2LMC B;  3S17 B;  4K0K L;  5FJ8 H;  1C7Y A;  3DWA A;  2ZM6 L;  3PWF A;  3GTO H;  2EY5 A;  2FHT A;  2WB1 E;  4HJ5 A;  3I7F A;  5C3E L;  4A3B B;  1C8C A;  3LNN A;  3W2D A;  1A3U A;  5EIO C;  4A3M L;  4HJ9 A;  1LKP A;  1QUQ A;  3P75 A;  1PFM A;  3S1N H;  5EQ0 A;  3CQZ L;  4AQY Q;  3VA7 A;  1IBL L;  2WII B;  4A3D B;  5T1G A;  2B2Y A;  1LKO A;  1DCZ A;  1HZC A;  2ZJR A;  1V43 A;  5FLX c;  4C3J B;  3S2H H;  1IHZ A;  4P72 A;  4DR2 Q;  3FKI L;  1VQC A;  3RYG A;  3HRZ C;  3PO2 B;  2O4X A;  1N36 L;  1HNX L;  3H91 A;  1RJT A;  3S17 L;  1Q8I A;  1FJG L;  4A3K G;  2E5L Q;  3LWR B;  2EYL A;  3P20 A;  5D65 A;  3STB D;  4TQU S;  4A3B L;  2JI3 A;  1MD2 D;  2L1B A;  3CCV A;  1GUG A;  3DXJ C;  2UUC L;  2Z3R B;  5C4Z A;  4X3U A;  4CJ1 B;  1GOZ A;  4OO1 I;  5E4X A;  2HVY C;  2WB1 G;  4A3D L;  2B2W A;  4CKC A;  3K5O A;  2E74 C;  4DR3 Q;  5IT9 c;  3IKJ A;  1XPO A;  5M5W B;  1Z47 A;  1A3T A;  1J8I A;  4C3J L;  1IYJ B;  5IGE A;  1B53 A;  3NP8 A;  4LF8 L;  3PCO B;  2B2U C;  4DU9 A;  3CRK C;  2B2T C;  4ZKC B;  4BBS H;  3PO2 L;  4QIW P;  5D14 A;  5C44 G;  4YY3 Q;  2B3G A;  3ERO A;  1ZYR C;  4K5W A;  5EKK A;  5CC4 A;  2WKC A;  2JA8 G;  3MFG A;  2D5D A;  2VQF L;  2GN5 A;  1HQR D;  3UDF A;  5CMD A;  1PYB A;  2ZXP A;  1H9J A;  3DLL A;  1RCV D;  2Y0S E;  2JQO A;  3FDT A;  1JYB A;  1AZQ A;  2Z4H A;  3DEP A;  1EY8 A;  1SE2 A;  5LMN Q;  3MPS A;  1OXV A;  4R4T A;  3KLS X;  1YNJ C;  1STB A;  1PRT C;  1VQ7 A;  1KAB A;  4DAY B;  5M5W L;  1PH9 A;  1K73 C;  1VQK A;  1GHK A;  3HOX H;  1FGB D;  2HQL A;  1FR3 A;  1PRT F;  4R4I A;  5GAH C;  4B3R L;  4OON A;  2XN9 C;  4X65 Q;  5CV5 A;  3H09 A;  2B5I D;  4IN3 A;  5CV4 A;  2QGQ A;  2VW9 A;  3TP8 A;  4L5T A;  3W5O A;  3K59 A;  1E1T A;  2MPM A;  1WTP A;  4DV7 L;  1M90 C;  1DVB A;  3KLS A;  1UE7 A;  4ZAI A;  5IYB G;  1TU2 B;  2D2C C;  2ZJQ A;  1NXG A;  1JWM D;  4JI3 Q;  4R4O A;  1X65 A;  3MXG A;  1SEB D;  3PO3 G;  1YIT A;  4POF A;  2BE5 C;  4A3K B;  1XJV A;  2EJF C;  1BBW A;  2F0M A;  1N32 Q;  1PYW D;  5FK9 C;  2RDG A;  3I4N G;  4IFD J;  4AYB P;  3HOZ B;  4LFA Q;  3AEV A;  3H94 A;  4IUN A;  4X6A L;  1I4H A;  2PMZ P;  1SJH D;  5DAU A;  4DUZ L;  1JOK A;  3JAM L;  2F0I A;  1K9M C;  1BCP B;  1F9S A;  4HSP A;  1PFY A;  2YYZ A;  1G51 A;  4I7Z C;  1I4X A;  1SYF A;  5CR3 A;  2JA7 H;  2Q2H A;  1QCV A;  1WI5 A;  2Y0S G;  4DR6 L;  3IRB A;  1HRJ A;  3TRZ A;  5GQO A;  1RDP D;  1K0R A;  2IT1 A;  3ND8 A;  2MJ8 A;  2UXC L;  2J0T D;  3AFP A;  2JA5 G;  4YWL A;  4HED A;  1VS0 A;  2KCM A;  4V0B A;  2WIN B;  3W1B A;  4B8C D;  2RCF A;  4DR4 Q;  1A2U A;  5C3X A;  2EDG A;  4O2D A;  3QVD A;  4OGQ C;  2E2I B;  1HH2 P;  4CJ0 B;  1SBB B;  3FDJ A;  4A3K L;  2PPB C;  1AH9 A;  2NB0 A;  4DK3 C;  4UY8 C;  1JIC A;  5IP9 H;  4ODG A;  1L0X B;  3C1F A;  3HOZ L;  1FHH A;  1F2M A;  5EPJ A;  5JEA H;  3KF8 B;  1LTL A;  1X56 A;  1K83 B;  4J1M A;  3E5S A;  2R93 H;  4C3I B;  3LWV B;  1U5K A;  1DJR D;  1MIU A;  2OTJ A;  4ME5 A;  4C56 C;  3JAM i;  3A8K E;  1I4Q A;  3PUW A;  3J80 c;  4X64 L;  2JK8 A;  2JA6 H;  4LF7 Q;  4GNX A;  1Y1W H;  4OWT B;  3IL8 A;  2CKC A;  4BY7 H;  3PIO A;  1JJG A;  3I4L A;  8RXN A;  1IW7 C;  3RD4 A;  4A76 A;  1MGS A;  3E9H A;  4KD3 A;  2E2I L;  3GTG H;  1HNW Q;  1UEA B;  1B4O A;  3IFD A;  3K8A A;  4A3G B;  1QG7 A;  2F1M A;  4PMW A;  1BKB A;  4WRD A;  1Q46 A;  3N52 A;  3EQL C;  2ID0 A;  2CCZ A;  1K83 L;  4X62 L;  1CA6 A;  2MO0 A;  3ONA B;  4C3I L;  1EQR A;  1DOM A;  1RKN A;  2I46 A;  5EPL A;  3HAX C;  1I3Q B;  2RHS B;  1LAC A;  3N6R A;  2N55 A;  4NPS A;  1X3Q A;  1NMF A;  2KED A;  3H6M A;  1NUC A;  3GTQ H;  3BDO A;  3J81 j;  1FGU A;  2VQE Q;  3MQK B;  1OXT A;  2Y0S B;  4N9T A;  1FVI A;  4DK6 C;  2E2D C;  3T1Y L;  5IYD H;  2UUB Q;  1JJC B;  3TBI B;  3KF6 A;  3HOV B;  4KD4 A;  4ZKB B;  5HGQ A;  1P16 A;  2BA1 A;  1DZ1 A;  4KV6 A;  1SFO B;  1PTO C;  4PV1 C;  1XTD A;  3A5U A;  4JPB W;  4K5V A;  4A3J G;  4C1N I;  2A69 D;  1ENC A;  4JAF A;  4CDC C;  1M1K C;  2APO B;  1LT4 D;  4A3G L;  3D4W A;  1WTO A;  4BBR B;  3IU3 I;  2NZO A;  1H95 A;  3PF5 A;  4TVA B;  3K5N A;  4K0K Q;  2EVB A;  2K5N A;  1KHI A;  1H9S B;  3F1Z A;  1LTG D;  4EVO A;  2ZM6 Q;  1I3Q L;  1FYC A;  3R3O A;  3GTM B;  1O7I A;  5EIN C;  3KYX A;  3NBH A;  1Q86 C;  3M3Y H;  1G8Z D;  1NBW A;  1JC7 A;  2C35 B;  4IPG A;  1PH4 A;  3NPP A;  1TS3 A;  5M3F H;  4RCN A;  1W6J A;  4YWK A;  4YCW A;  2MNA A;  2PI2 A;  1SE4 A;  2M2L A;  4DR1 L;  3J81 L;  4AHX A;  2WB1 P;  1IBL Q;  4GKK L;  3S14 B;  2AMC B;  4DN4 M;  3HOV L;  1KC8 C;  1IU6 A;  1TWF H;  4DV5 L;  1SFO L;  1QUQ B;  4DV1 L;  3LWU A;  1BQQ T;  3R93 A;  2P5Z X;  5AJ3 Q;  2WP8 J;  2MO1 A;  2PZU A;  1C4Q A;  4KLK A;  1VQ4 A;  2R92 B;  2N78 A;  1EIF A;  1XXG A;  1EZ8 A;  4DV6 L;  4BBR L;  1N36 Q;  1HNX Q;  1C48 A;  2VS1 A;  3BZC A;  5ELC A;  1F9R A;  3H9B A;  1J5E Q;  5FO7 B;  3GTM L;  1VF5 C;  4RGN A;  2F4V L;  5K36 H;  4DR5 L;  1Y14 B;  1ET6 A;  3HZX A;  1PTO B;  4C3H H;  5D3I B;  1X55 A;  2UUC Q;  1JT8 A;  4N9P A;  1IKL A;  1SNP A;  4GOP C;  1TWA B;  1DD2 A;  3TP7 A;  3CXC A;  1FD7 D;  3BYT B;  5CV7 A;  4Y7N B;  4LF9 L;  3RZ6 A;  3A7L A;  3J81 i;  3AB9 A;  3TEH B;  4JI2 L;  1B13 A;  2KUM A;  5HGT A;  1Q12 A;  1XYI A;  4HCS A;  4A3E H;  1KIX A;  2RDV A;  3ERQ A;  3CC4 A;  4PQX A;  4LF8 Q;  4JBM A;  5CYU A;  3JC6 6;  3VR5 A;  1A6X A;  1XX8 A;  2IHF A;  2KHS A;  1Y1V G;  3HKZ B;  1I4G A;  1ASY A;  2R92 L;  4JI6 L;  2M6P A;  4DV0 L;  4A3J B;  1LT5 D;  4BA2 I;  1XNR L;  1F2Z A;  1MJE A;  3HOU H;  3BZK A;  2K03 A;  2H5X A;  1X3G A;  3K7U C;  1D2B A;  4DFA A;  3E9I A;  4LUV A;  5LHY 1;  4KKS A;  4HIM A;  5EKL A;  3I4M B;  1IKM A;  2A6E C;  2VQF Q;  1B9M A;  3SR1 A;  2I5L X;  1Q90 A;  2BDN A;  2EYJ A;  1VCX A;  1JJ2 A;  2Z8L A;  1TWA L;  4LMQ D;  3VR4 A;  1PMR A;  4YCV A;  3I55 A;  4IQZ A;  4WOR A;  2WV6 D;  5C5M A;  1S5C D;  1EOV A;  4C2M B;  1WOC A;  4JAD A;  3PIP 1;  4QJF A;  1B2T A;  1G29 1;  2KCC A;  2Y0S P;  1RHP A;  1VDZ A;  1X3P A;  2EY1 A;  5FLM G;  4B3R Q;  1WYD A;  3ZYY X;  3CCU A;  2NVX H;  3AQQ A;  1KQS A;  3RZO B;  3P8B A;  2KJX A;  4FF2 A;  5C0X G;  1D1I A;  3FEW X;  3S15 H;  3H9C A;  2N3S A;  4DAY A;  5GAE c;  1CSP A;  2V4D A;  4DV7 Q;  3F2C A;  3S16 B;  3SEB A;  4AR5 A;  1EIG A;  1TS5 A;  3H0G G;  5FO9 B;  4IPC A;  4POG A;  3RZD H;  1U4L A;  2DN8 A;  1STG A;  3I4M L;  2CW0 C;  4LWC A;  3WWV A;  4PMB A;  1Q1E A;  1K8G A;  4O42 A;  4R1J A;  3NHH A;  5IWA L;  4A3K H;  1R4Q B;  2RSO A;  1VZI A;  1TKW B;  1R4P B;  1S24 A;  1UWV A;  4GLA C;  1MKH A;  4DUZ Q;  2CHB D;  1WTQ A;  2FJ2 A;  4MZ9 A;  4GS7 D;  6RXN A;  2NVT B;  1E2Z A;  4FF4 A;  4ZUI A;  1VQ9 A;  5GRO A;  4DR6 Q;  1NY4 A;  2B2U A;  4DNT B;  2NN6 I;  3CAM A;  3LGJ A;  4CDE C;  2RDF A;  1EFW A;  2B2T A;  5FKA C;  5CBA E;  3CCQ A;  3S1R H;  2K5Q A;  3GTP B;  3PL5 A;  2UXC Q;  4GLX A;  4PMC A;  1TQO A;  1HR0 W;  2WAQ B;  3S16 L;  2XJS A;  3MTS A;  5KND A;  5C3E G;  4QY7 A;  1WTR A;  5IY0 A;  2JE6 I;  1GVP A;  2K7V A;  4A3M G;  3D8G A;  7RXN A;  1B71 A;  1SR3 A;  1U4R A;  5C44 H;  2B2V C;  4O0A A;  1YBY A;  3PIP 3;  5C5L A;  1YNN D;  1GHJ A;  2ICI A;  2AUJ D;  1YUZ A;  4AI0 A;  3CCJ A;  2JA8 H;  2K33 A;  4ID6 A;  2PZW A;  1KTK A;  1DOK A;  4P74 A;  3MXN B;  3SK8 A;  3ULP A;  2NVT L;  4B3S Q;  3M4Y A;  1LLR D;  3FKI G;  3RNU A;  3HOY G;  3VA5 A;  5M5Y H;  1AW7 A;  5BN4 A;  4X64 Q;  5MLC 3;  4Y52 H;  3KF8 A;  5K2M E;  3M4Q A;  3TQY A;  1QE6 A;  3WOF A;  3GTP L;  5C3W A;  1K8O A;  4F7X A;  3T53 B;  2DJF C;  3DHQ A;  4S3S A;  1I4R A;  3C46 A;  3OW2 A;  3C1E A;  4GNX B;  2A6H C;  4NMZ A;  4QUC A;  4PZ7 A;  4A3B G;  1CHQ D;  2K05 A;  3ZJY C;  2VNU D;  3CCL A;  1BQ9 A;  2I07 B;  2B8G A;  2HCC A;  2MHV A;  1A0I A;  1B9N A;  5IYB H;  3U58 A;  3AMU A;  2XJT A;  2KHJ A;  2E2J B;  1D1K A;  3A5Z B;  4A3D G;  3PO3 H;  4FF1 A;  1HXY D;  3GTJ B;  4KHZ A;  2OF1 A;  4X62 Q;  3PMF A;  1XMQ L;  2MP1 A;  2R61 A;  4C3J G;  1XMO Q;  2RHQ B;  2H12 A;  2XIW A;  2YU9 B;  3I4N H;  5T1I A;  4NXM L;  5JAV A;  3NWS A;  4TKO B;  3MEH A;  5DM7 1;  3TS2 A;  1I3Q H;  1J9O A;  3KYU A;  3PO2 G;  1GUT A;  4UP8 A;  4GKJ L;  3A55 A;  3S1Q L;  3T1Y Q;  5ELO A;  1BFY A;  5AFW A;  3RLF A;  4AR6 A;  3PUV A;  1CFM A;  2HDM A;  3JAM E;  2CWA A;  2QDL A;  5G3L D;  3TS0 A;  3GD7 A;  5D3D A;  1AZP A;  1RWD A;  1UAP A;  3KF6 B;  1ZRP A;  2JA5 H;  3T56 B;  1JB3 A;  2Z3Q B;  1H9R A;  4FDB A;  2QDB A;  4WJ3 M;  1ILP A;  2E2H H;  2UXD L;  4CKE A;  2E2J L;  2F52 A;  1SMM A;  1SNM A;  1B3A A;  5DM6 1;  1XNQ L;  3GTJ L;  4L8J A;  1TWH H;  3GDE A;  5KRU A;  1MJC A;  3CQZ B;  4B9W A;  3TN2 A;  1B44 D;  1Q82 C;  1EU3 A;  3K5L A;  3S2D L;  1GXD C;  3K80 C;  1T9O A;  4FYD A;  1E1O A;  2YU9 L;  2YV5 A;  1VQP A;  3CPF A;  3J7A F;  1BE7 A;  1SYB A;  3D3R A;  3HOY B;  1U0L A;  2C9O A;  4LF6 L;  4UPA A;  5GAE C;  3K6O A;  1H9S A;  3L3O C;  1M8A A;  1CZW A;  3NBH B;  4KKU A;  4GKK Q;  1X3E A;  3DWP A;  1O7Y A;  4DV5 Q;  4DV1 Q;  4KTA A;  3QB3 A;  3S14 H;  3JC6 2;  4HIO A;  2HDL A;  4KY6 A;  1VCI A;  2DY8 A;  4L63 B;  3CF5 A;  1CTM A;  2M4V A;  3VR6 A;  1YHA A;  1WTW A;  1VMP A;  2EYP A;  2XJU A;  2F0V A;  5CV6 A;  4KMU C;  4XQJ A;  2CR8 A;  2QCP X;  2DSX A;  5DM7 3;  5MGN A;  2IL8 A;  1BDO A;  1PV4 A;  1AEX A;  2LCQ A;  4RFB A;  1IBM L;  3P2A A;  2M00 A;  2IX0 A;  1G6P A;  3DM1 A;  2F4V Q;  4DV2 L;  2DJG C;  2WKD A;  1Z6H A;  4KKT A;  4DR5 Q;  4IAL A;  4RXN A;  1CSQ A;  3PGZ A;  1SMY C;  3HOY L;  1RTO A;  2IX1 A;  4AHW A;  2AUS B;  2L9H A;  2NZH A;  2NTS A;  4LF9 Q;  1QYB A;  4GZY C;  1MI2 A;  4JI2 Q;  3M4O B;  4Y7N H;  5DM6 3;  1HNZ L;  2EYF A;  2XRS D;  3T13 A;  2AUK A;  2HUG A;  3HGB A;  3HOZ G;  5IOD A;  4JI6 Q;  1GUS A;  1T9H A;  1JE5 A;  4DV0 Q;  1XNR Q;  4H13 C;  3NK9 A;  4A3J H;  4FXG C;  1PFN A;  2NWG A;  2H1E A;  2K5W A;  3MFY A;  4TSS A;  4F88 A;  2G5D A;  2UUA L;  3D4R A;  5IP7 L;  3F2U A;  4YWM A;  2NYD A;  5TSS A;  3VR2 A;  2EIF A;  3K57 A;  5EAY A;  1HZB A;  1PDQ A;  2RDH A;  3J7Y 1;  3M4O L;  2NZ1 D;  4GN5 A;  3CCE A;  1NSN S;  3K7A B;  2G9D A;  1BR9 A;  3G7L A;  3MSU A;  1T5X D;  3QQC E;  1D5X C;  1I94 Q;  1AN8 A;  2L12 A;  3KJP A;  3GTK B;  1LTA D;  3K0Y A;  1WVL A;  4L5S A;  1PFV A;  3RZO H;  4CHT B;  4C3I G;  3J81 E;  3B08 B;  4A3I B;  4XYQ A;  2XJR A;  4NB3 A;  3GV6 A;  2CQA A;  1TII D;  5A2Q L;  3H99 A;  1OWC A;  5MFP A;  2RVL A;  1WCM G;  5JJZ A;  3D4D A;  5IWA Q;  5C4X G;  3VR3 A;  5C4J B;  1K3R A;  2BOS A;  3SGI A;  3RZT A;  2A68 D;  4GOP A;  2NVQ H;  1NNQ A;  2V0E A;  2XWJ B;  1LT6 D;  1S5E D;  4LJZ C;  2Z6K C;  3T51 B;  4G7O C;  3NXW A;  3D0F A;  1PZI D;  3RUZ A;  3ICE A;  1KXL A;  3K7A L;  3QIA A;  4DKA C;  2F0S A;  4A3G G;  2ES2 A;  2BDO A;  1K8M A;  4GLV B;  4WJ4 A;  3GTK L;  5IYC L;  2V3B B;  1TWC B;  4TRD A;  4A93 B;  4X3T A;  1S5B D;  1WD1 A;  4BXX L;  5MF6 A;  3FRP B;  3NWT A;  5NUC A;  4IFD G;  4A3I L;  1BBU A;  1IYV A;  3TRE A;  4KJO A;  1Y1V H;  4UP9 A;  3OOC A;  3IAY A;  2HQE A;  2E76 C;  2LFN A;  4XXB B;  4IUQ A;  5COR A;  2ZXO A;  1OXU A;  4X3K A;  3GQB A;  3KJO A;  1NJI C;  1WTH A;  4DXG A;  2EY4 E;  1R9T B;  2M9V A;  3C3L A;  5C4J L;  4QQB X;  1E2W A;  3HOV G;  3R8B A;  4CBV A;  2PZT A;  3GTL H;  5CGK A;  1WJJ A;  4JYA L;  4A3L L;  2DNE A;  2EJG C;  4KN4 C;  1BOS A;  1VQE A;  3RN2 A;  3LX0 A;  1DX8 A;  5M3M B;  1ICW A;  1PRT B;  4BBR G;  2EE1 A;  3J7A V;  2LKV A;  1TWC L;  3MXN A;  2EOT A;  5G3L F;  4JI1 L;  3KLW A;  4A93 L;  5IGG A;  1PA6 A;  4PZ8 A;  4OHJ A;  1F9P A;  2BH8 A;  2QKI C;  3A54 A;  5FLM H;  1N34 L;  1D6E C;  1HQM C;  4OWX B;  5C0X H;  4IOC A;  2PW7 A;  3HOW B;  3I70 A;  3OWF A;  1KAA A;  2Q2I A;  3SVM A;  4JI7 Q;  3HKZ E;  1R9T L;  1S40 A;  3H0G H;  1STH A;  5GAG c;  1ONL A;  1IBK L;  2K5V A;  1WCM B;  2VXW A;  4OEL B;  2E2J H;  4OL7 A;  5C4X B;  5GAD c;  1XMQ Q;  1B2J A;  1GD7 A;  2NVY H;  3MHB A;  4YCU A;  1Q7Y C;  3L9A X;  4NXM Q;  2K5H A;  2KA7 A;  2EYH A;  3G6E A;  2R92 G;  1RTN A;  5M3M L;  1B2O A;  5IGD A;  3VDY A;  1VQO A;  4GKJ Q;  1LAB A;  2GA4 B;  5M9O A;  1IRO A;  1YI2 A;  4RHS A;  4LK1 C;  1SLJ A;  4BY1 B;  1N33 L;  4QGU A;  4F87 A;  2A74 C;  4RKB A;  1PH7 A;  3OPO A;  4JAE A;  3HOW L;  1BQ8 A;  4AR3 A;  4IPD A;  1GKH A;  2B2V A;  2WAC A;  2QA4 A;  2UXD Q;  3PKI A;  2RKS A;  4DNR B;  5C3E H;  3FVQ A;  1SYC A;  3S1M B;  1WCM L;  1XNQ Q;  1GUN A;  1QCB D;  3MWY W;  2M4Y A;  1VQA A;  5LMN W;  4A3M H;  5C4X L;  1PH3 A;  3PF4 A;  1I50 B;  3CQZ H;  1VQ6 A;  2C5C A;  1SMX A;  1PYS B;  3HKZ G;  2R7F A;  4AR4 A;  2JA9 A;  5I9P A;  2Q2T A;  4QMG A;  5C0X I;  3STB C;  1P7P A;  1QZG A;  5DEH A;  1ROD A;  4LF6 Q;  3ZG6 A;  3UDI A;  3FKI H;  3HOY H;  2D0O A;  4XT3 B;  5I6Y A;  2Q8T A;  5FO8 B;  1OXS C;  1JB7 A;  1R0H A;  4BY1 L;  4A3C L;  3I3C A;  3I4M G;  3CKI B;  4AHZ A;  3E0E A;  1PHJ A;  2R7Z L;  4DF7 A;  3M7N A;  1FHM A;  1OXX K;  3S17 H;  4DR7 L;  1Y8O B;  4HAE A;  5K5P A;  3K5M A;  1BO0 A;  1DYQ A;  4YIJ A;  1SYD A;  1AFP A;  2RA4 A;  1EEF D;  4UDU C;  1R0J A;  4A3B H;  3S1M L;  1EY0 A;  3I72 A;  1IYU A;  1EYD A;  1D5Z C;  1YK4 A;  2F0D A;  2WAQ E;  1I50 L;  1IBM Q;  3CRL C;  4A3D H;  3Q22 A;  4DV2 Q;  3BS1 A;  1TXY A;  3JR7 A;  4J15 A;  3NTH A;  4DPG A;  4M8A A;  1MSH A;  1EWH A;  2X6G A;  2F3V A;  5FLX L;  1CQV A;  2XRQ D;  4RMF A;  4C3J H;  4F8M A;  2EY2 A;  1KDB A;  4IPH A;  1STN A;  1ODH A;  3CC2 A;  3U9S A;  2FMM A;  3X3M A;  1FJG Q;  3PO2 H;  4FNF A;  3PUY A;  5IGC A;  2FFK B;  1F9Q A;  3GTO B;  3G4S A;  1HNZ Q;  2PYK A;  5CV8 A;  1H9K A;  4L5R C;  4YHH L;  1U9R A;  4RKL A;  1GO3 E;  3MVV A;  2HIV A;  2CWP A;  4R4C A;  3CMA A;  3S1N B;  1IL8 A;  4PG3 A;  2A68 C;  1CT1 D;  2EXD A;  4XYO A;  1D5M C;  5EGT A;  5JJK A;  2N8N A;  4NP5 A;  1GJX A;  1CAD A;  3S2H B;  1EYA A;  3QR8 A;  5IT9 L;  1UE6 A;  2TMP A;  4FXD A;  5M5W H;  1ENF A;  4OIJ A;  3GO5 A;  1NCV A;  2PNR C;  2CKZ B;  2WAQ G;  1EYC A;  1EWI A;  4H44 C;  2UUA Q;  1X32 A;  1X9N A;  2PNH A;  3VYU A;  1E7Z A;  4GS3 A;  2L5T A;  1EY6 A;  1WTX A;  1EFI D;  5FJ8 L;  1YEZ A;  3UDG A;  1SND A;  1KAW A;  1Q3L A;  3GTO L;  3BJU A;  1PH5 A;  2PQE A;  1WJV A;  4HN7 A;  1A15 A;  3KYY A;  3EFX D;  2F0H A;  4JBJ A;  1I6H B;  1KD1 C;  2F0O A;  3D31 A;  2MQH A;  4LUZ A;  5EPK A;  4ABN A;  1JE4 A;  5BN3 A;  2O5J D;  1KLU D;  5GAG C;  2CFM A;  2EYM A;  3SK5 A;  4MTN A;  2RF4 A;  3I4O A;  3HEJ A;  3S1N L;  1YHQ A;  3GTK H;  1ZKO A;  5EKI A;  3KLR A;  1B7Y B;  1STA A;  1U4M A;  5ELF A;  5JVH 1;  4M1U B;  2ZTD A;  2RQX A;  4X6A H;  3ND9 A;  2HR5 A;  2HIX A;  4G57 A;  4JVZ A;  1BXT A;  3S2H L;  1LO5 D;  5AN9 H;  1G2T A;  1SNC A;  1VMC A;  5EJW A;  3FMC A;  1JWS D;  4EQO A;  4BBS B;  2Z4I A;  4RGO S;  4UP7 A;  2RBM A;  1TS2 A;  2XJQ A;  3TZU A;  1EUJ A;  2CH4 W;  1VQG A;  4PNY A;  1T5E A;  2K04 A;  5KGU A;  1EQQ A;  2A73 B;  3PKJ A;  1SAP A;  2EYO A;  3F2D A;  4GOP B;  5C6A A;  2BCO A;  1NNX A;  3K58 A;  2L11 A;  5JEA J;  4KHP L;  3M9B A;  5KNB A;  1I6H L;  2B8F A;  4MIU A;  2B39 A;  1E8J A;  2IW3 A;  4FO2 A;  5BR8 L;  2ZT9 C;  3SHL A;  1HUM A;  3OMC A;  4LFB L;  2DY7 A;  1K28 A;  2J4X A;  4LHN A;  3KYV A;  2NYZ D;  4K8J A;  4HCE A;  3HOZ H;  1QJO A;  1AP0 A;  2PI2 E;  2X69 A;  4WFN 1;  4HIK A;  1W2B A;  2I0Q A;  3H3V M;  4GN4 B;  4A3F G;  3K0X A;  3HOX B;  1JOO A;  3A8J E;  1RF2 D;  3J7Y W;  1OTC A;  4XIG S;  1LUZ A;  1YJW A;  4K2L A;  1Z9F A;  1UEB A;  3HP3 A;  3I91 A;  1B1Z A;  4BBS L;  5IOC A;  4X65 L;  1R9T H;  1FL0 A;  1PFW A;  1JR0 D;  3DUZ A;  2OWO A;  5I2Y A;  1V9P A;  3Q6S A;  3U50 C;  2Z6B A;  4X66 L;  3SE0 A;  2OQ0 A;  1WFQ A;  4DAV A;  2EQS A;  2UU9 L;  1W6K A;  3LPE B;  5JVH 3;  1SNO A;  3EIV A;  2E2I H;  3VYT A;  3E0J A;  4N8X 1;  4JI1 Q;  4IZ8 A;  3I2Z A;  3GP7 A;  1BCP D;  4HJ7 A;  4C1N K;  2TSS A;  4KI0 A;  3JAM c;  1N34 Q;  5ELD A;  1ZYR D;  1K83 H;  1X6O A;  4DAP A;  2JA7 B;  4QF4 A;  4K6L A;  3HOX L;  2I5H A;  1BUV T;  2GVA A;  2RFK B;  3HG9 A;  3KBG A;  2A19 A;  1A8V A;  4C3I H;  3LWE A;  2AKW B;  5IGF A;  4G7Z C;  4G7H C;  1L2F A;  4L6T B;  2L4N A;  1KDA A;  3J80 L;  2A69 C;  1IBK Q;  3KBX A;  3MXP A;  1L1O C;  3S1Q B;  4B3T L;  5ELB A;  1WCM H;  2Z6K A;  1ET9 A;  2N49 A;  1HTP A;  1YNJ D;  1STY A;  5JPN C;  5C4X H;  3HKZ P;  2VUM G;  2B63 G;  2XTI A;  4DR4 L;  3E6Z X;  4JBW A;  4BWG B;  3BZD B;  4KY5 A;  5A2Q E;  1EY5 A;  4ZYS A;  4RA8 A;  5C4H A;  1R0F A;  4WFN 3;  4MNO A;  3W1G A;  1IZ6 A;  4HR7 B;  4A3G H;  1PH8 A;  4C2M 1;  1RYT A;  3A56 A;  3OIQ A;  1N33 Q;  2R93 B;  4Q5V A;  1ML0 D;  5A35 A;  4JOI C;  5J3B A;  4ZN3 B;  3S2D B;  4JK1 C;  2JA7 L;  1AE2 A;  4HJ8 A;  2BE5 D;  1QWY A;  4CJ2 C;  3DMU A;  2JA6 B;  5IP7 G;  2F0U A;  4IFD H;  4HTH A;  3S9W A;  1K3B C;  3NTI A;  4ME3 A;  5ISR A;  4TVM A;  4A3F B;  4U68 A;  4BY7 B;  2ZIX A;  1EEI D;  2JEB I;  4DK1 A;  4RGT A;  3PUZ A;  1HZA A;  4JI4 L;  3Q23 A;  2MGS A;  1CM9 A;  3J7Z 1;  2F0N A;  1HCZ A;  2ALY B;  1TS4 A;  2OTL A;  2YTX A;  4ZLT F;  3HS0 C;  3HOV H;  3OWE B;  1I50 H;  1SFO H;  4IJL A;  2IPK D;  3NEL A;  4FXK C;  2XSC A;  1G91 A;  2CVR A;  2K4K A;  3KOJ A;  3VPB E;  4DV4 L;  1YIJ A;  3WOE A;  4RH6 A;  2Z9H A;  4XTC S;  2F03 A;  3NE5 B;  1IRN A;  2I5M X;  2NBF A;  3T16 A;  3KYH C;  1V1Q A;  1JMC A;  1EOT A;  2RCN A;  4UAI A;  2R93 L;  3FPP A;  4BBR H;  2AWO A;  2YTY A;  4IUU A;  1ASZ A;  4J8Q A;  2KN9 A;  4DR7 Q;  4G4K A;  2O2L D;  3GTQ B;  2JA6 L;  2OQK A;  1RD9 D;  3GTM H;  3F2B A;  1Y1W L;  4A3F L;  3RMH A;  1IXR A;  3EN2 A;  4BY7 L;  2SOB A;  4V19 6;  4DR1 Q;  1KLG D;  3AU7 A;  4LHL A;  1N9W A;  4ZK9 B;  1TY0 A;  2PVE A;  2ATW A;  1O7Z A;  4O1N A;  2K5D A;  3RR5 A;  4R4Q A;  4BA1 I;  3ER0 A;  3CCR A;  3GTG L;  3PIP A;  1XPR A;  3KDF B;  3MC0 B;  3H97 A;  5IIF A;  1HFG A;  5IYC G;  1Z92 B;  1S4Z A;  3K81 C;  4DXF A;  3KUP A;  2FXQ A;  2VUM B;  2B63 B;  5KYL A;  2WAQ P;  1HPC A;  4XQN A;  4BXX G;  4HMJ A;  5H1S E;  4A3I G;  4H02 A;  4XXE A;  4DV6 Q;  5M5X B;  2L55 A;  2KEC A;  1CKN B;  2R92 H;  2D62 A;  2NN6 G;  4XQQ A;  1CZG A;  1IW7 D;  1Y8P B;  2K28 A;  4IUP A;  1CI3 M;  1HTL D;  3DEO A;  1UNS A;  1YK5 A;  3TZD A;  4AYB B;  4DUY L;  3NUC A;  3M3Y B;  4GN3 B;  3GTQ L;  4YHH Q;  2PMZ B;  1S3O A;  5M3F B;  1PTO H;  4I65 A;  1VZG A;  4XGH A;  4AH6 A;  4A3L G;  3J81 c;  5IYD L;  1UE5 A;  2AYJ A;  2F3I A;  3FP9 A;  3P1H A;  2HD3 A;  3PIO 1;  2R3Z A;  1TWF B;  3NQT A;  5E4W C;  1HR0 L;  1SRO A;  1TWA H;  2K50 A;  1E24 A;  3CHB D;  1S30 A;  2FIN B;  4LF5 L;  1HZ9 A;  3OSO A;  1STE A;  3PV0 A;  3M85 A;  2VUM L;  4IJH A;  1Q8K A;  4A93 G;  2B63 L;  5AJ3 L;  3MAQ A;  2F0W A;  3VYR A;  4JI8 L;  4EX5 A;  4CKB A;  5M5X L;  2H4O A;  1KNA A;  4QCL A;  1LTS D;  3EJI A;  1A63 A;  3I8Z A;  4MN3 A;  1NE3 A;  1PTO D;  1PH2 A;  1MBY A;  3K35 A;  4MHE A;  3Q8D A;  3M3Y L;  4ZN1 B;  2ENB A;  4C3H B;  1J5E L;  1VZH A;  1BRF A;  3W3A A;  2QEX A;  5M3F L;  3I4M H;  1I6H H;  5IGB A;  2QF7 A;  2HCI A;  3KK7 A;  4KJN A;  4IO9 A;  3JC6 3;  1F2L A;  4P71 A;  2ZXR A;  1BVS A;  3HFZ B;  1TWF L;  5M3M G;  4A3E B;  4JV5 L;  1JOR A;  1VQJ A;  1LTB D;  3M4P A;  5DLQ E;  2PSM C;  3ULJ A;  1PLF A;  4C2M H;  3T1H L;  1V8Q A;  4EQ5 A;  1E2V A;  1GM5 A;  3M7G A;  1RYQ A;  4OIK A;  2C6A A;  2F0L A;  1YNN C;  3KFU A;  1VQM A;  3HOU B;  2AQ1 B;  5E7N A;  2D9U A;  1BCP C;  1X54 A;  2FMC A;  3HOW G;  1LTR D;  4RHR A;  3S16 H;  5CBE E;  5FOB B;  3OTO L;  4KHP Q;  1A3V A;  2C6B A;  2IJ0 A;  4DNI A;  1BCP F;  3PIO 3;  4C3H L;  1F77 A;  5BR8 Q;  1QQT A;  2KCN A;  3QO2 A;  4PZ6 A;  5FLX E;  1JCK B;  2WFW A;  4LFB Q;  1OWB A;  4AI2 A;  3MZ5 A;  2YTV A;  4KN7 C;  3C2P A;  2VB3 X;  2A5H A;  4A3E L;  2Q8I B;  1F4L A;  2JSO A;  4L5Q A; 
#chains in the Genus database with same CATH homology
 2NVT H;  1D7Q A;  5AI3 A;  4BY1 G;  4A3C G;  1Q1B A;  2R7Z G;  2ERJ A;  3GTP H;  1VQB A;  1AE3 A;  4OXP A;  3CD6 A;  4X66 Q;  2UU9 Q;  2A8V A;  3WWL A;  1VQL A;  4LFC L;  4B3M L;  1CAA A;  2CQO A;  2ERS A;  1SN8 A;  1L0W A;  4NXN L;  1YV1 A;  2ZJP A;  2MFI A;  1VQ5 A;  3U4V A;  2A6E D;  2BH2 A;  2PQA A;  4HJA A;  4P75 A;  1W3S A;  4B3T Q;  3H15 A;  3S1Q H;  3CW2 C;  1A62 A;  4LNQ A;  1LM0 A;  4LF4 L;  1T9Q A;  3UE1 A;  3RN5 A;  4OX9 L;  4A75 A;  4IOA A;  1Q81 C;  2IHE A;  3BU2 A;  3GTJ H;  4LUO A;  4U67 1;  4JI5 L;  4OO1 G;  1VQI A;  2DUD A;  2UXB L;  4B3S L;  3S2D H;  2YU9 H;  1C09 A;  4JI0 L;  1NTG A;  5FJ8 G;  2KBN A;  5MFZ A;  4DV3 L;  4A3F H;  4JI4 Q;  2D0P A;  1T9P A;  3UDX A;  3RLO A;  4DV4 Q;  2PVX A;  2LXJ A;  1QVF A;  1RB9 A;  1QVG A;  3CCM A;  1C9O A;  3NFP I;  2XJP A;  4OWW B;  1SMU A;  4TPU A;  1XMO L;  2KKD A;  3L0O A;  1SMW A;  2XJV A;  1J6Q A;  3H3V H;  2K75 A;  3CC7 A;  1N8R C;  1L1O A;  1I5F A;  2QL0 A;  1VQH A;  4JG2 A;  4JCV E;  2VUM H;  2B63 H;  2OCE A;  3MEF A;  3KDF A;  5M5X H;  2A6H D;  1B8A A;  4JOI A;  5LMU L;  2ASB A;  4DUY Q;  2Z0S A;  4E6Y A;  5JJI A;  2KCT A;  4BBS G;  1CKN A;  1VQD A;  2AHO B;  2CKA A;  3L7Z C;  1E3P A;  5IP7 H;  1HR0 Q;  3A74 A;  3F8T A;  2HHH L;  4LF5 Q;  3M4O H;  1YJN A;  4JI8 Q;  3H3V I;  1QVC A;  1PVO A;  1CKO A;  3HOX G;  1PFS A;  4AQY L;  2M6O A;  3AFQ A;  1UE1 A;  1VQF A;  2Q2U A;  4RG1 A;  4DR2 L;  4JBK A;  1YHB A;  4K9F A;  1EYG A;  2VL6 A;  3J7Z C;  4JV5 Q;  2K52 A;  2E5L L;  2XGT A;  1IU5 A;  3T1H Q;  5HY6 A;  3K7A H;  3A0J A;  4AI1 A;  2KEN A;  4UY8 1;  2L0Z A;  5IYC H;  5GAD C;  2JA7 G;  2JEA I;  3CPW A;  4BXX H;  2JI2 A;  4A3I H;  1YVC A;  2V1C C;  3OTO Q;  4DR3 L;  3FHW A;  2LSS A;  3L2P A;  1YJ9 A;  3PZA A;  3PUX A;  4QIW E;  3DM3 A;  1KL9 A;  2B29 A;  2IY5 B;  5C4J H;  3NEM A;  3J7A 5;  3LNL A;  3B0A B;  4YY3 L;  2PPT A;  2J9U B;  4A3L H;  5IP9 G;  1PH1 A;  4G6B A;  5JEA G;  2JI1 A;  1LYL A;  2HT1 A;  5C0X J;  1I94 L;  2R93 G;  1CUK A;  3RLN A;  4DAM A;  1TWC H;  2R6G A;  2E8G A;  4A93 H;  5RXN A;  1RL2 A;  1S72 A;  2JA6 G;  5LMN L;  5JVG 1;  1Y1W G;  3B6Y A;  4APV A;  4BY7 G;  4LFC Q;  4B3M Q;  1QZH A;  1DGS A;  2K14 A;  4GNX C;  1LKM A;  4AIM A;  4NXN Q;  2LXK A;  4JYA Q;  3I56 A;  1SRU A;  4HID A;  4JI3 L;  4AYB E;  2V0F A;  3G71 A;  2PMZ E;  5M3M H;  4LW1 A;  5ELN A;  3PSI A;  1N32 L;  2JJQ A;  1YUX A;  4LFA L;  4AHY A;  2PQA B;  3ERS X;  1PH6 A;  2GMG A;  3A44 A;  5IYD G;  4LF4 Q;  3HOW H;  1VQ8 A;  4QL5 A;  2A1A A;  4OX9 Q;  1HJP A;  2DGY A;  3G48 A;  2ZTC A;  1EIY B;  1P8L A;  1CKM A;  4JAG A;  4JI5 Q;  3UE0 A;  2UXB Q;  3WWN B;  4JI0 Q;  4P73 A;  5JJL A;  1S2Z A;  4DV3 Q;  1E22 A;  1NXE A;  3S24 A;  1D8L A;  4AYB G;  3U4Z A;  3CP0 A;  4BY1 H;  2L15 A;  4A3C H;  5M3F G;  3SS2 A;  2KHI A;  2R7Z H;  1B70 B;  1KRT A;  2ZTE A;  5H1S c;  2K2D A;  4JC0 A;  4JI7 L;  1YZ6 A;  4LF7 L;  3J80 i;  1IL2 A;  3S1M H;  1SE8 A;  1RDV A;  1VQN A;  1R0G A;  3HKS A;  2VY3 A;  1XPU A;  1TWG H;  2VZA A;  4A4I A;  1HNW L;  1KRS A;  5AI2 A;  5GAH c;  1C0A A;  4ALP A;  2MS3 A;  5K36 G;  1K8A C;  3KYW A;  1L1O B;  4AI3 A;  2R7D A;  2GVB A;  3ULL A;  3NEN A;  3CME A;  3CCS A;  2VQE L;  1RIP A;  4A3E G;  3AYH B;  2PYA A;  3OYY A;  1X3F A;  5LMU Q;  2UUB L;  2BA0 A;  1R0I A;  1YNX A;  2AWN A;  3HOU G;  5IE8 A;  1NMG A;  4IFD I;  3EBE A;  1H7V A;  2HHH Q;  1RDG A;  4K0K L;  5FJ8 H;  1C7Y A;  2ZM6 L;  3PWF A;  3GTO H;  2WB1 E;  4HJ5 A;  3I7F A;  5EIO C;  4HJ9 A;  1LKP A;  1QUQ A;  3S1N H;  4AQY Q;  1IBL L;  1LKO A;  1HZC A;  2ZJR A;  1V43 A;  5FLX c;  3S2H H;  4P72 A;  4DR2 Q;  1VQC A;  3RYG A;  1N36 L;  1HNX L;  1FJG L;  4A3K G;  2E5L Q;  3STB D;  4TQU S;  2JI3 A;  3CCV A;  2UUC L;  2Z3R B;  4OO1 I;  2WB1 G;  4DR3 Q;  5IT9 c;  1XPO A;  1Z47 A;  1IYJ B;  4LF8 L;  3PCO B;  4BBS H;  5C44 G;  4YY3 Q;  2B3G A;  2JA8 G;  2VQF L;  2GN5 A;  3UDF A;  1PYB A;  3DLL A;  2Y0S E;  2JQO A;  1JYB A;  5LMN Q;  3MPS A;  1OXV A;  4R4T A;  1VQ7 A;  4DAY B;  1PH9 A;  1K73 C;  1VQK A;  3HOX H;  2HQL A;  5GAH C;  4R4I A;  4B3R L;  4OON A;  4X65 Q;  2B5I D;  2QGQ A;  2VW9 A;  4L5T A;  3W5O A;  1E1T A;  4DV7 L;  1M90 C;  1DVB A;  1UE7 A;  5IYB G;  2ZJQ A;  1NXG A;  4JI3 Q;  4R4O A;  1X65 A;  3PO3 G;  1YIT A;  4POF A;  1XJV A;  1BBW A;  1N32 Q;  3I4N G;  4IFD J;  4LFA Q;  3AEV A;  4DUZ L;  1K9M C;  2YYZ A;  1G51 A;  2JA7 H;  2Q2H A;  1QCV A;  1WI5 A;  2Y0S G;  4DR6 L;  3IRB A;  3TRZ A;  5GQO A;  1K0R A;  2IT1 A;  2UXC L;  3AFP A;  2JA5 G;  4YWL A;  1VS0 A;  2KCM A;  3W1B A;  4B8C D;  4DR4 Q;  4O2D A;  3QVD A;  1HH2 P;  1AH9 A;  4DK3 C;  4UY8 C;  5IP9 H;  1FHH A;  3KF8 B;  1LTL A;  1X56 A;  2R93 H;  1U5K A;  1MIU A;  2OTJ A;  3JAM i;  3PUW A;  3J80 c;  4X64 L;  2JK8 A;  2JA6 H;  4LF7 Q;  4GNX A;  1Y1W H;  4OWT B;  2CKC A;  4BY7 H;  3PIO A;  1JJG A;  8RXN A;  4A76 A;  3E9H A;  3GTG H;  1HNW Q;  3K8A A;  4PMW A;  1BKB A;  1Q46 A;  2ID0 A;  2CCZ A;  4X62 L;  2MO0 A;  1EQR A;  2RHS B;  4NPS A;  1NMF A;  3GTQ H;  3J81 j;  1FGU A;  2VQE Q;  1OXT A;  4DK6 C;  1FVI A;  3T1Y L;  5IYD H;  2UUB Q;  1JJC B;  3KF6 A;  5HGQ A;  1P16 A;  2BA1 A;  3A5U A;  1XTD A;  4A3J G;  2A69 D;  4JAF A;  1M1K C;  3IU3 I;  2NZO A;  1H95 A;  3PF5 A;  4TVA B;  4K0K Q;  2K5N A;  1KHI A;  2ZM6 Q;  3F1Z A;  1O7I A;  5EIN C;  3KYX A;  1Q86 C;  3M3Y H;  1NBW A;  2C35 B;  4IPG A;  1PH4 A;  5M3F H;  4YWK A;  4YCW A;  2MNA A;  2PI2 A;  4DR1 L;  4AHX A;  1IBL Q;  4GKK L;  2AMC B;  1KC8 C;  1IU6 A;  1TWF H;  4DV5 L;  1QUQ B;  4DV1 L;  5AJ3 Q;  2WP8 J;  2MO1 A;  4KLK A;  1VQ4 A;  2N78 A;  1EIF A;  4DV6 L;  1N36 Q;  1HNX Q;  2VS1 A;  3BZC A;  1J5E Q;  2F4V L;  4DR5 L;  1Y14 B;  4C3H H;  1X55 A;  2UUC Q;  1JT8 A;  4GOP C;  3CXC A;  4LF9 L;  3RZ6 A;  3J81 i;  3TEH B;  4JI2 L;  1B13 A;  1Q12 A;  4A3E H;  1KIX A;  2RDV A;  3CC4 A;  4LF8 Q;  4JBM A;  3JC6 6;  2IHF A;  1Y1V G;  1ASY A;  4JI6 L;  2M6P A;  4DV0 L;  4BA2 I;  1XNR L;  1MJE A;  3HOU H;  3BZK A;  2H5X A;  1X3G A;  3K7U C;  3E9I A;  4LUV A;  4HIM A;  2VQF Q;  2I5L X;  1VCX A;  1JJ2 A;  4YCV A;  3I55 A;  1EOV A;  1WOC A;  4JAD A;  3PIP 1;  4QJF A;  1G29 1;  5FLM G;  4B3R Q;  1WYD A;  3CCU A;  2NVX H;  3AQQ A;  1KQS A;  3P8B A;  5C0X G;  3S15 H;  2N3S A;  5GAE c;  1CSP A;  4DV7 Q;  3F2C A;  4AR5 A;  3H0G G;  4IPC A;  4POG A;  3RZD H;  4LWC A;  3WWV A;  1Q1E A;  1K8G A;  4R1J A;  5IWA L;  4A3K H;  1VZI A;  4GLA C;  1S24 A;  1UWV A;  1MKH A;  4DUZ Q;  4MZ9 A;  4GS7 D;  6RXN A;  1VQ9 A;  5GRO A;  4DR6 Q;  1NY4 A;  2NN6 I;  3CAM A;  3LGJ A;  1EFW A;  3CCQ A;  3S1R H;  2UXC Q;  4GLX A;  1HR0 W;  2XJS A;  5C3E G;  4QY7 A;  5IY0 A;  2JE6 I;  1GVP A;  4A3M G;  7RXN A;  1B71 A;  1SR3 A;  5C44 H;  4O0A A;  1YBY A;  1YUZ A;  4AI0 A;  3CCJ A;  2JA8 H;  4P74 A;  3MXN B;  3ULP A;  4B3S Q;  3FKI G;  3RNU A;  3HOY G;  5M5Y H;  4X64 Q;  5MLC 3;  4Y52 H;  5K2M E;  3M4Q A;  3TQY A;  3OW2 A;  4GNX B;  4PZ7 A;  4A3B G;  3ZJY C;  2VNU D;  3CCL A;  1BQ9 A;  3U58 A;  1A0I A;  5IYB H;  2XJT A;  2KHJ A;  3A5Z B;  4A3D G;  3PO3 H;  4KHZ A;  4X62 Q;  1XMQ L;  1XMO Q;  2RHQ B;  2H12 A;  3I4N H;  4NXM L;  5DM7 1;  3TS2 A;  1I3Q H;  3KYU A;  3PO2 G;  4UP8 A;  4GKJ L;  3T1Y Q;  5ELO A;  1BFY A;  3RLF A;  4AR6 A;  3PUV A;  2CWA A;  3TS0 A;  3GD7 A;  1RWD A;  3KF6 B;  1ZRP A;  2JA5 H;  2Z3Q B;  4FDB A;  4WJ3 M;  2E2H H;  2UXD L;  2F52 A;  1SMM A;  5DM6 1;  1XNQ L;  1TWH H;  3GDE A;  1MJC A;  1Q82 C;  3K80 C;  1T9O A;  1E1O A;  2YV5 A;  1VQP A;  3CPF A;  1BE7 A;  1U0L A;  4LF6 L;  4UPA A;  5GAE C;  3NBH B;  4GKK Q;  1X3E A;  4DV5 Q;  4DV1 Q;  3S14 H;  3JC6 2;  4HIO A;  1VCI A;  3CF5 A;  2M4V A;  1YHA A;  2XJU A;  2CR8 A;  2DSX A;  5MGN A;  1PV4 A;  2LCQ A;  1IBM L;  3P2A A;  2IX0 A;  1G6P A;  2F4V Q;  4DV2 L;  4DR5 Q;  4RXN A;  1CSQ A;  3PGZ A;  2IX1 A;  4AHW A;  2NZH A;  4LF9 Q;  1QYB A;  4JI2 Q;  4Y7N H;  1HNZ L;  3HOZ G;  4JI6 Q;  1T9H A;  1JE5 A;  4DV0 Q;  1XNR Q;  4A3J H;  2UUA L;  4YWM A;  2NYD A;  2EIF A;  5EAY A;  1HZB A;  3J7Y 1;  4GN5 A;  3CCE A;  3MSU A;  3QQC E;  1I94 Q;  3KJP A;  4L5S A;  3RZO H;  3B08 B;  2XJR A;  4NB3 A;  1OWC A;  5MFP A;  1WCM G;  5IWA Q;  5C4X G;  1K3R A;  3SGI A;  3RZT A;  2A68 D;  4GOP A;  2NVQ H;  1NNQ A;  2V0E A;  2Z6K C;  3D0F A;  3ICE A;  1KXL A;  4DKA C;  4A3G G;  2ES2 A;  4GLV B;  4WJ4 A;  2V3B B;  5MF6 A;  4IFD G;  1BBU A;  3TRE A;  1Y1V H;  4UP9 A;  4XXB B;  1OXU A;  3KJO A;  1NJI C;  4QQB X;  3HOV G;  3GTL H;  1WJJ A;  4JYA L;  3RN2 A;  1VQE A;  1DX8 A;  4BBR G;  4JI1 L;  3KLW A;  1PA6 A;  4PZ8 A;  2BH8 A;  5FLM H;  1N34 L;  4OWX B;  4IOC A;  2Q2I A;  4JI7 Q;  3HKZ E;  1S40 A;  3H0G H;  5GAG c;  1IBK L;  2K5V A;  2E2J H;  5GAD c;  1XMQ Q;  1B2J A;  1GD7 A;  2NVY H;  4YCU A;  1Q7Y C;  4NXM Q;  2K5H A;  2R92 G;  3G6E A;  1B2O A;  3VDY A;  1VQO A;  4GKJ Q;  1IRO A;  1YI2 A;  1SLJ A;  1N33 L;  4QGU A;  1PH7 A;  4JAE A;  1BQ8 A;  4AR3 A;  4IPD A;  1GKH A;  2QA4 A;  2UXD Q;  3PKI A;  5C3E H;  1XNQ Q;  2M4Y A;  1VQA A;  5LMN W;  4A3M H;  1PH3 A;  3PF4 A;  3CQZ H;  1VQ6 A;  1SMX A;  1PYS B;  3HKZ G;  2R7F A;  4AR4 A;  2JA9 A;  2Q2T A;  5C0X I;  3STB C;  1QZG A;  4LF6 Q;  3ZG6 A;  3UDI A;  3FKI H;  3HOY H;  2D0O A;  1JB7 A;  1OXS C;  1R0H A;  3I4M G;  4AHZ A;  3E0E A;  1PHJ A;  3M7N A;  1FHM A;  1OXX K;  3S17 H;  4DR7 L;  1R0J A;  4A3B H;  1YK4 A;  2WAQ E;  1IBM Q;  4A3D H;  4DV2 Q;  1TXY A;  4J15 A;  4DPG A;  4RMF A;  4C3J H;  4IPH A;  1ODH A;  3CC2 A;  3PO2 H;  1FJG Q;  3PUY A;  3G4S A;  1HNZ Q;  4L5R C;  4YHH L;  1GO3 E;  2HIV A;  2CWP A;  4R4C A;  3CMA A;  4PG3 A;  2EXD A;  5JJK A;  2N8N A;  1CAD A;  1UE6 A;  5M5W H;  3GO5 A;  2CKZ B;  2WAQ G;  1EWI A;  2UUA Q;  1X9N A;  2PNH A;  1E7Z A;  4GS3 A;  1YEZ A;  3UDG A;  1KAW A;  3BJU A;  1PH5 A;  1WJV A;  3KYY A;  4JBJ A;  1KD1 C;  3D31 A;  2MQH A;  4LUZ A;  2O5J D;  5GAG C;  2CFM A;  4MTN A;  2RF4 A;  3I4O A;  1YHQ A;  3GTK H;  1B7Y B;  5JVH 1;  2ZTD A;  4X6A H;  2HR5 A;  2HIX A;  5AN9 H;  4UP7 A;  2XJQ A;  1EUJ A;  1VQG A;  1EQQ A;  3PKJ A;  3F2D A;  4GOP B;  4KHP L;  5JEA J;  3M9B A;  1E8J A;  5BR8 L;  4LFB L;  4LHN A;  3KYV A;  3HOZ H;  2PI2 E;  4HIK A;  4WFN 1;  1W2B A;  2I0Q A;  4GN4 B;  4A3F G;  3K0X A;  1OTC A;  4XIG S;  1LUZ A;  1YJW A;  1Z9F A;  1UEB A;  4X65 L;  1R9T H;  1FL0 A;  2OWO A;  1V9P A;  3U50 C;  4X66 L;  2OQ0 A;  1WFQ A;  2UU9 L;  2EQS A;  3LPE B;  3EIV A;  2E2I H;  4JI1 Q;  3I2Z A;  4HJ7 A;  4KI0 A;  3JAM c;  1N34 Q;  1K83 H;  1X6O A;  2I5H A;  2GVA A;  2A19 A;  1A8V A;  4C3I H;  2AKW B;  1L2F A;  1IBK Q;  1L1O C;  4B3T L;  1WCM H;  2Z6K A;  2N49 A;  5C4X H;  2VUM G;  2B63 G;  2XTI A;  4DR4 L;  4JBW A;  1R0F A;  4MNO A;  3W1G A;  1IZ6 A;  4A3G H;  1PH8 A;  1RYT A;  1N33 Q;  4JOI C;  5J3B A;  4ZN3 B;  1AE2 A;  4HJ8 A;  2BE5 D;  5IP7 G;  4ME3 A;  4TVM A;  2ZIX A;  2JEB I;  3PUZ A;  1HZA A;  4JI4 L;  3J7Z 1;  2ALY B;  2OTL A;  2YTX A;  3HOV H;  1I50 H;  1SFO H;  4IJL A;  3NEL A;  2K4K A;  3KOJ A;  3VPB E;  4DV4 L;  1YIJ A;  4XTC S;  1IRN A;  2I5M X;  3KYH C;  1V1Q A;  1JMC A;  2RCN A;  4BBR H;  2AWO A;  2YTY A;  1ASZ A;  2KN9 A;  4DR7 Q;  2OQK A;  3GTM H;  3F2B A;  1IXR A;  3EN2 A;  4V19 6;  4DR1 Q;  4LHL A;  1N9W A;  2PVE A;  2ATW A;  3RR5 A;  4R4Q A;  4BA1 I;  3ER0 A;  3CCR A;  3PIP A;  1XPR A;  3KDF B;  5IYC G;  1Z92 B;  3K81 C;  2FXQ A;  4BXX G;  5H1S E;  4A3I G;  4H02 A;  4DV6 Q;  1CKN B;  2R92 H;  2D62 A;  2NN6 G;  1IW7 D;  1YK5 A;  4DUY L;  4GN3 B;  4YHH Q;  1S3O A;  1VZG A;  4XGH A;  4AH6 A;  4A3L G;  3J81 c;  1UE5 A;  2AYJ A;  2F3I A;  3FP9 A;  3PIO 1;  1HR0 L;  1SRO A;  1TWA H;  2K50 A;  1E24 A;  1S30 A;  4LF5 L;  1HZ9 A;  3PV0 A;  3M85 A;  4IJH A;  4A93 G;  1Q8K A;  5AJ3 L;  4JI8 L;  4EX5 A;  1A63 A;  1NE3 A;  1PH2 A;  3K35 A;  3Q8D A;  1J5E L;  4ZN1 B;  1VZH A;  1BRF A;  2QEX A;  3I4M H;  1I6H H;  4IO9 A;  3JC6 3;  4P71 A;  1BVS A;  3HFZ B;  5M3M G;  4JV5 L;  1VQJ A;  3M4P A;  5DLQ E;  2PSM C;  3ULJ A;  4C2M H;  3T1H L;  4EQ5 A;  1GM5 A;  1RYQ A;  2C6A A;  3KFU A;  1VQM A;  5E7N A;  1X54 A;  3HOW G;  3S16 H;  3OTO L;  4KHP Q;  2C6B A;  4DNI A;  5BR8 Q;  4PZ6 A;  2WFW A;  4LFB Q;  1OWB A;  4AI2 A;  2YTV A;  4L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...