5IY0A

Pfmcm n-terminal domain double hexamer
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double hexamer of the Pyrococcus furiosus minichromosome maintenance protein N-terminal domain.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication dna binding protein
molecule keywords Cell division control protein 21
total genus 72
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5iy0A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iy0A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 5iy0A01
2D0PA 4GKKQ 1C09A 3AYHB 2MS3A 1XMQQ 3BZKA 4DR4Q 4RMFA 2IX1A 4A76A 3F2DA 2ES2A 1G6PA 3KYHC 1UWVA 4NXNL 3H15A 1HH2P 1JJ2A 4YWLA 5LMUQ 4KHZA 1WYDA 1QVGA 4X64L 4H02A 2CQOA 1OXXK 1BBWA 2I0QA 5BR8Q 4JOIA 2UUCQ 2R93H 1ASYA 1HR0W 5JEAG 4JI5Q 1N33L 4QIWE 3UDGA 1XPUA 2AKWB 4QGUA 1XNQQ 4AYBE 4DNIA 2AWNA 4HJ9A 4A3KH 4WJ3M 1SR3A 1X54A 1K83H 1SLJA 1YZ6A 2EQSA 1QYBA 4DV4L 4PG3A 1HZ9A 4DR3L 1PYSB 2F3IA 3OW2A 1OTCA 4LF8Q 1NE3A 2V1CC 1VQ7A 1SMUA 1BBUA 4GS3A 1X9NA 4JI0Q 2K14A 2ASBA 4BY1H 1RB9A 1IBKL 4JI6Q 4XIGS 2PI2E 3HOUH 4DV0Q 5JJLA 4DV3Q 1Z47A 4JYAQ 1YJWA 4A3LH 3EIVA 2MNAA 2I5HA 5M5XH 1L2FA 4C2MH 3HKSA 4LNQA 2PMZE 2NN6G 1LTLA 2IY5B 1RDGA 3PIOA 3CC2A 3M4PA 1S2ZA 1KAWA 3PV0A 2N49A 2Z6KA 3B6YA 4DK6C 2OQKA 3GTLH 4ALPA 3HOWG 2VQEQ 2PYAA 1N34Q 4JI8Q 5FLMG 3KOJA 4IFDI 2R7ZG 5M3MH 4JI2L 1TXYA 2JA9A 2HIVA 3CC4A 1QVCA 2EXDA 2WFWA 1IROA 4NXMQ 1VQKA 2C35B 3A0JA 4JV5L 2R92H 4IFDG 1I6HH 2PQAB 4LUZA 1EUJA 4DR5Q 3OTOL 1CUKA 3TS0A 4X65Q 3KF6B 1PFSA 1PH2A 4KHPQ 1QVFA 5C0XI 3JC66 3F8TA 5H1SE 1K8GA 3J81i 1Q8KA 1VQLA 2WAQE 3I55A 4POGA 4P73A 5AI3A 4RG1A 2JA6G 2K2DA 3NBHB 4X62L 1QUQB 4DR4L 3JAMc 1JJCB 1LYLA 2ZTEA 3PO3G 4LF7Q 2K52A 3UDIA 1QCVA 4NXNQ 2XGTA 2E2IH 5M5YH 4GNXC 3T1YL 4X64Q 1CKOA 1S3OA 1HNZQ 1NJIC 1OXVA 1D8LA 3FP9A 2Q2HA 4R4OA 1IL2A 3L2PA 2VUMG 3CAMA 5C3EG 4YWMA 2VQFQ 3K8AA 3KJOA 2YTYA 1EQQA 2AMCB 1N36Q 4IJLA 4JC0A 2Q2UA 1B2OA 3Q8DA 4UP9A 2AWOA 3F1ZA 4PMWA 4EX5A 2UUAL 1XNQL 6RXNA 1LUZA 4C3JH 3M4OH 4HJ5A 5GADC 4K9FA 3RZDH 1YIJA 2B63G 4QQBX 2WB1G 3GTGH 3G71A 2B63H 2DGYA 1NBWA 4UP8A 4DR1Q 1XPRA 3S1QH 2ZJPA 4B3TQ 4TPUA 1KXLA 4PZ8A 1RYTA 1PH3A 5C3EH 1Y1VG 5LMNL 1R0FA 2K4KA 4DV3L 3CQZH 3A74A 3I4MH 1JB7A 1WCMG 1PH6A 1EIYB 1HNXQ 3H3VI 2E5LQ 3JC62 2YTXA 1H7VA 1B8AA 3CXCA 1IBML 5J3BA 3S2HH 2KENA 2L15A 3TREA 2ATWA 2OQ0A 3CF5A 4X6AH 3UDXA 4JBMA 4AH6A 4YY3L 4GNXA 4A3KG 1VQHA 5JEAJ 4GKJL 1I3QH 1L0WA 1PHJA 1FJGL 1VQCA 4LWCA 4AIMA 1B13A 2JA5G 1N32L 1SMMA 4BXXG 4DV5L 4TVAB 4AR6A 3PGZA 1YNXA 2BH8A 1T9HA 3RNUA 4A3EG 1ASZA 4APVA 3SGIA 4X65L 2R92G 4JI7Q 1Q1EA 5FLMH 3W5OA 1M90C 1O7IA 2JJQA 1SRUA 2N3SA 1GM5A 3KYVA 3PUZA 3QVDA 2MFIA 3PZAA 2GVBA 1QZHA 3GTOH 4QY7A 1EOVA 3CCVA 1X3EA 4DUYQ 3JAMi 1VQ4A 4Y52H 4DR2L 4A3BH 4DUZQ 1GO3E 3TS2A 3L0OA 3HKZE 2KBNA 1ZRPA 1YUZA 4A4IA 3GTMH 4JI3L 4LF9L 4ME3A 3J80c 4DV7Q 2UU9L 5GAEC 1NTGA 3PIPA 4A3DH 5JJKA 4YCUA 1E1TA 1HZCA 1IXRA 1B70B 1U5KA 3HOUG 4A3CG 1T9OA 1FHHA 5RXNA 2CWPA 3FHWA 4AQYQ 1PH7A 1GKHA 2MQHA 1IZ6A 4GOPC 4JI4L 4JBWA 4P72A 1Y1WH 4HIDA 4DR7Q 2R6GA 3STBC 1HNZL 3CCQA 1UE6A 4KI0A 1FGUA 2HR5A 5C0XJ 1Q82C 3PO3H 2E2HH 1VQ9A 3ULLA 5C4XH 4L5QA 4DR1L 4OX9L 2NZHA 2UUBL 1TWFH 2A19A 5M3FG 4B3TL 1OXSC 2GVAA 3F2CA 2M4YA 2LXKA 4BA1I 1LKOA 1R0IA 1Y14B 1RL2A 4A3CH 4GLAC 1CKNB 4IJHA 3G4SA 4P74A 4DV1Q 3KFUA 5IP7G 1Y1VH 4IO9A 1XMOL 1P8LA 2MO0A 3RR5A 3J7A5 2LXJA 2R93G 1VCIA 1YJNA 1VQ8A 1IBMQ 3I4NG 2OTJA 1K3RA 1VQNA 3BU2A 2CWAA 1XJVA 2DSXA 3CC7A 3NELA 1YHBA 1FHMA 2ZM6L 1S24A 3KYYA 2ALYB 2EIFA 4XTCS 1BFYA 3I4OA 4TQUS 5GQOA 3CW2C 4YY3Q 2Z0SA 4A3IG 2QEXA 2IT1A 3RZOH 2YYZA 4MTNA 4HJ8A 4GN5A 3CMEA 1I94L 4DR6Q 3GTKH 1SROA 4DV5Q 2Y0SG 1RDVA 1I50H 5DLQE 1EQRA 4A93H 2K5VA 1VCXA 1VQGA 1A63A 1T9PA 1XTDA 1C7YA 1CKMA 3UE1A 3OYYA 4AR3A 1PH9A 3M7NA 1SMWA 1CSPA 5FJ8G 1X3GA 1R0HA 1W2BA 3S14H 1VQMA 1KRTA 4DUZL 4A3GH 1XPOA 4L5RC 1D7QA 1IBLL 5FJ8H 4P75A 3ZJYC 3DLLA 4L5TA 4X66L 1HNWQ 2UXBL 4R4TA 1LKMA 2VL6A 4JI3Q 4A75A 3PUYA 2ZTCA 4JI1Q 3RZ6A 2F4VL 3HOYH 5AJ3L 2HHHQ 4R4QA 1PYBA 4LFBQ 4A93G 2JEBI 2UUCL 1K0RA 1L1OA 4C3IH 4LFAQ 1PVOA 3M4QA 4GN3B 4GLXA 4LF6Q 4GN4B 4DV2L 1PA6A 3HOVH 4YWKA 2OWOA 1H95A 3FKIG 1IRNA 4C3HH 1X56A 4HIKA 4A3MH 1SFOH 1SMXA 4B3RL 2GN5A 5LMNW 5C44H 2JEAI 1EYGA 2RHSB 1B71A 1JT8A 4B3ML 1X3FA 4UPAA 3I4NH 1YK5A 5AI2A 3AQQA 5ELOA 3PUWA 1NMGA 4YCVA 2WB1E 1B7YB 1IBKQ 3KYWA 3TEHB 2OCEA 1VQIA 2VY3A 2JA5H 1XNRL 2PQAA 2VS1A 1N9WA 4B3SQ 2NVYH 4IPCA 3LGJA 1S40A 4A3EH 1E8JA 5C4XG 1YVCA 4BA2I 1W3SA 4LUOA 3SS2A 2CKZB 4BBRH 5LMUL 1BQ9A 4LF4Q 3IRBA 1S30A 4JOIC 5C4JH 1TWGH 4OONA 1FL0A 4BBRG 1R0GA 3K80C 5BR8L 1YJ9A 4P71A 3GTJH 1KC8C 5IY0A 4JI5L 3W1BA 1VQDA 1DVBA 4DAMA 1PH1A 1N33Q 2KCMA 1G291 2K5HA 2XTIA 1K9MC 5FLXc 2WAQG 4GOPA 3M85A 1VQAA 4POFA 4LF5Q 1WJJA 1R9TH 3OTOQ 3RN2A 3PSIA 4DR3Q 4L5SA 4LF8L 2NZOA 1HR0Q 4LFCQ 3G48A 1DX8A 2NVQH 3BZCA 4A3IH 5IYDH 4JI0L 4IPDA 1VQ6A 1DGSA 4JG2A 2V3BB 2ZJQA 3H0GG 4X62Q 2ZTDA 3MPSA 4DV0L 1KIXA 4DK3C 1IBLQ 4IPHA 4JYAL 4AR5A 4GOPB 1V1QA 2VZAA 3CCLA 4JBKA 4LF7L 1AE2A 2BH2A 1VS0A 2VUMH 3M3YH 4BXXH 5HGQA 1OXUA 4JI1L 2JA7H 3J81j 2DUDA 4WJ4A 5AJ3Q 3CPFA 5IYCG 2ZJRA 2HHHL 3GTQH 4MZ9A 3HOYG 3ICEA 2I5LX 3CCSA 4BBSG 5GROA 2UXCL 1A8VA 2VQFL 3ER0A 1NY4A 3TQYA 2VQEL 1N36L 4HJ7A 3K81C 2JE6I 3E9HA 1IU6A 2B3GA 4DV2Q 4IOAA 1BQ8A 1A0IA 3MXNB 1V43A 2PI2A 1VQPA 1N34L 2UUAQ 4JI2Q 3EBEA 3KF8B 3PWFA 1TWAH 4UP7A 1E3PA 1WFQA 1HZBA 1E7ZA 4OXPA 2GMGA 1KHIA 1UE7A 4DV6Q 3K0XA 3E9IA 2KHJA 2BA1A 2N8NA 4B3MQ 4BBSH 1E22A 1VQEA 3K7AH 4DR5L 2VNUD 3I4MG 2Q2TA 4BY7H 2Q2IA 5IE8A 1B2JA 1X65A 2HQLA 1S72A 2B29A 1XNRQ 3HOXG 5LMNQ 4OO1I 2R7ZH 4R4IA 4B3SL 1A62A 2F52A 4A3DG 1JYBA 1HNXL 3E0EA 1KQSA 2E5LL 3G6EA 3HOWH 1Q86C 1E1OA 2UXDL 3RLOA 4K0KQ 2NVTH 1Q81C 3A5ZB 2H5XA 4LF4L 2QGQA 1YEZA 3DM3A 3KDFA 1E24A 5M3MG 3T1YQ 4OWWB 4A3BG 4IFDJ 4IPGA 4OO1G 3H3VH 1EFWA 3CCUA 1Q1BA 1AE3A 5EAYA 1UEBA 3HOXH 3U4ZA 1BRFA 5E7NA 4NB3A 3S17H 2CCZA 2K5NA 3AFPA 3GTPH 2CFMA 3T1HQ 4LF5L 4BY7G 1QUQA 3TRZA 2Y0SE 4DKAC 3S1NH 1HNWL 4LFCL 3L7ZC 1KD1C 1HR0L 4RXNA 1VQFA 1N8RC 3I7FA 1VQ5A 2LCQA 1RIPA 2I5MX 1CADA 4OWTB 4A3FG 3CPWA 4J15A 4JBJA 1YV1A 4A3JH 3RZTA 3UDFA 3GO5A 2NVXH 4PZ7A 2IHFA 4DR2Q 3RN5A 1JE5A 3AFQA 1RWDA 1T9QA 2RDVA 1J6QA 1HZAA 4YHHQ 2HIXA 1NMFA 2BA0A 3GD7A 1KRSA 2PVXA 1P16A 1PH8A 4LF9Q 4KLKA 4DV7L 2UU9Q 1MKHA 1BKBA 2N78A 2FXQA 8RXNA 5JJIA 3MEFA 1Z9FA 5IT9c 2JA7G 2JA8G 3JC63 4O0AA 3ULJA 2UXCQ 3CCRA 1J5EL 1YUXA 3KDFB 1C0AA 3NEMA 1R0JA 2Z6KC 1G51A 1V9PA 4YCWA 3CCJA 1YI2A 1UE1A 5K36G 4IOCA 4JI4Q 4GKJQ 1PV4A 3CD6A 3H0GH 2KN9A 3KJPA 1BE7A 3K7UC 3S24A 5IWAQ 1FJGQ 4DPGA 2E2JH 4DV6L 1N32Q 2QL0A 3S2DH 3I2ZA 2QA4A 5IYDG 1C9OA 1LM0A 4R1JA 3U58A 3S1RH 2JA8H 2UUBQ 4A3LG 5IP7H 3PCOB 3KF6A 1MJCA 2D62A 3HOVG 4JI7L 3PUVA 3S16H 4QL5A 1WI5A 4UY8C 1TWHH 1FVIA 3J80i 3WWVA 3RLNA 4DV1L 4DUYL 3A5UA 4GKKL 5M5WH 4GLVB 1XMQL 3CMAA 1LKPA 4BY1G 1WOCA 2OTLA 2YTVA 2UXDQ 3STBD 4K0KL 1KL9A 1X55A 2PVEA 2PNHA 5GAHC 3NENA 1L1OB 5IYCH 2VW9A 3S1MH 2KKDA 4FDBA 3J7ZC 3ULPA 3HOZG 3HKZG 1CSQA 4PZ6A 3U4VA 2K50A 3D0FA 2JK8A 4AQYL 2E8GA 1EWIA 3KYXA 1K8AC 4DR7L 5IYBH 3KYUA 4AR4A 2LSSA 3CP0A 1BVSA 3PUXA 4O2DA 4EQ5A 1I94Q 7RXNA 2RF4A 1UE5A 2A1AA 4DR6L 2MO1A 3T1HL 4LUVA 4JCVE 2ID0A 4DV4Q 1Q12A 2RHQB 3KLWA 2KHIA 3UE0A 5GAGC 4A3MG 1PH4A 4OX9Q 4NPSA 1GD7A 1I5FA 1VQBA 4HIMA 1Q7YC 4R4CA 1IYJB 1AH9A 1SN8A 2D0OA 4AYBG 1VQJA 2KCTA 1EIFA 4DAYB 4HJAA 1YITA 4JI6L 1U0LA 3FKIH 5IYBG 1YK4A 4LW1A 1CAAA 1MIUA 4Y7NH 5ELNA 1IU5A 3S15H 2WP8J 4YHHL 1JJGA 4X66Q 2UXBQ 1XMOQ 1MJEA 1NNQA 2NN6I 3AEVA 2RCNA 5IP9H 3RLFA 3CCEA 1HJPA 5C0XG 3PF5A 5M3FH 4HIOA 3CCMA 2F4VQ 3HOZH 4LFBL 1L1OC 4QJFA 4A3GG 2AHOB 4GNXB 3PF4A 2IHEA 1K73C 4LFAL 1J5EQ 1YBYA 3W1GA 3PO2G 2ZM6Q 4OWXB 3U50C 4A3JG 1YHQA 3F2BA 4LF6L 4A3FH 3PO2H 2A8VA 3BJUA 3A44A 3ERSX 1M1KC 1SE8A 2R7FA 3HFZB 4JI8L 2R7DA 4B3RQ 3GDEA 5IWAL 2JA6H 2IX0A 1OXTA 4MNOA 5IP9G 3I56A 1CKNA 4NXML 3J81c 3RYGA 4JV5Q 2JQOA 1WCMH 3M9BA 1Y1WG 2YV5A 1QZGA 1X6OA 1TWCH 2K75A 3VDYA 1PH5A 2HT1A 4KHPL 1JMCA 1GVPA 5HY6A 5C44G 3EN2A 3D31A 1YHAA 1VQOA 1Q46A 2YU9H
chains in the Genus database with same CATH superfamily
4FF4A 3AYHB 3BZKA 4Y7NB 4N9TA 2CKCA 1MBYA 2J0TD 5A2QE 2LY7A 1QVGA 3LWEA 4CHTB 1Y1WL 1BBWA 4K2KA 5BR8Q 2UUCQ 3GTKL 2EYHA 1ASYA 2C5CA 4E6IA 3TBIB 2OF1A 2AKWB 5T1GA 3BS1A 3MWYW 1XNQQ 2HCCA 1AFPA 2J4XA 4MTKA 4XT3B 4RFBA 1YZ6A 4TKOB 1BBXC 1PTOH 1DCZA 3OW2A 4LF8Q 5EKKA 1BBUA 5I2YA 1RB9A 4JI6Q 3OOCA 2R93B 1TS4A 2E74C 4XIGS 4DV0Q 2PQEA 3NXWA 4EGVA 1YJWA 3EIVA 2MNAA 5M5XH 3LWRB 4C2MH 5I4DA 4AI1A 3A7LA 2EYJA 3PO3B 3PIOA 5DAUA 2IY5B 4OL7A 3PV0A 3HKZB 1ML0D 2SDFA 4DK6C 1BQQT 3R93A 3R8BA 4X6AL 2K01A 1C4QA 1W6KA 1QNUA 3GQBA 2WFWA 4FP5D 4C3IG 1IROA 1VQKA 3PKIA 4C3JG 2R92H 2PQAB 3MVVA 2JA8L 1JE4A 4KY7A 5ELEA 1K8GA 1Q8KA 3CKIB 2K2DA 3NBHB 4C1NI 3RZOB 1QUQB 2B63L 2K5QA 5M5YH 4GNXC 2D5DA 1PXUA 1D8LA 3IU3I 3CAMA 5C3EG 4QMGA 4JVZA 3BDCA 2L12A 2NVYB 4A3FB 1EQQA 4FF1A 4UP9A 4EX5A 5D3IB 3NSWA 3E6ZX 4IUTA 5M5YL 1H9KA 4RCNA 2F0WA 5GADC 3EFXD 1MSHA 4A93B 2QF7A 2BOSA 3S1NL 3S1QH 1XXGA 1HRJA 3R2IA 2Q8RE 2NVXB 3S1MB 5DM61 3E3XA 1HNXQ 3P1HA 4BXXL 3JC62 2YTXA 1H7VA 4PNYA 3SK4A 2F0HA 4KD4A 4ZKBB 4GZYC 4AH6A 2AQ1B 1ENFA 2F0VA 2NYZD 1M4VA 2KUMA 1XYIA 1N32L 4DV5L 5M5XL 4AR6A 4A3EG 4JAEA 1QWYA 2R92G 4BBSL 1TWGB 4JI7Q 1Q1EA 1M90C 2XNAC 2JJQA 3PUZA 3PZAA 4QY7A 1HQRD 5FO9B 1X3EA 4DUYQ 4DUZQ 1GO3E 5IGDA 3L0OA 3HKZE 1SYDA 1I4GA 1YUZA 1LACA 3K58A 1ILQA 4N8X1 4KTAA 4LF9L 3ITPA 2UU9L 5GAEC 2OT2A 3PIPA 3A54A 5EKLA 1IXRA 3HOUG 1STYA 1EIHA 3FDTA 2SNMA 1IW7C 2RA4A 1JWSD 1GKHA 4G57A 2I07B 4KKTA 1QILA 4DR7Q 4HIDA 1A3UA 2AUSB 2XJUA 1UE6A 1A3TA 3GTLL 1Q82C 2WAQB 2R92B 1RTNA 3W2DA 4DR1L 4OX9L 2UUBL 1TWFH 5ELBA 4OIKA 2LXKA 3VR3A 1PZKD 2KCNA 1SNPA 2EDGA 3G4SA 3LX0A 4XT1B 3RR5A 3J7A5 3R3OA 3HOZB 1F77A 3I4NG 1GUGA 1G2SA 1K3RA 1D5ZC 2CWAA 2DSXA 3CC7A 1I6VC 2ALYB 2EIFA 2F0NA 1RCVD 4L5RC 5GQOA 1D2BA 4MTNA 1SAPA 4ODGA 1I94L 2R93L 3SK8A 5DLQE 2FINB 1ESFA 3OYYA 2XJSA 3Q23A 1R0HA 2QW7A 3SHLA 3IL8A 1GUOA 1RJTA 1VQMA 1KRTA 4IUVA 2YU9L 3H9BA 2B2YC 2UXBL 3NHHA 2B2WC 1LT6D 3PUYA 1B44D 5JOBA 1BXTA 2NTTA 4R4QA 5LHY1 4LFBQ 1S5DD 1K0RA 5BN5A 4C3IH 1PVOA 3M4QA 2XJVA 2JP1A 4DV2L 1EQTA 1RD9D 3HOVH 1IYVA 4A3MH 4HIKA 4B3RL 1B53A 4Q5VA 4OHJA 2RHSB 1JT8A 1X3FA 1G6ZA 2L4NA 1YK5A 2DNEA 2XRSD 4YCVA 2OCEA 2VY3A 3HKZP 4KKUA 3S15L 2L0ZA 1N9WA 2VS1A 3FKIL 2NVYH 2APOB 1B4OA 4C2MB 3PKJA 2R7ZB 4V196 1UAPA 4BBRH 5CORA 1W6JA 1BQ9A 4LF4Q 3IRBA 4CJ0B 1S30A 2F3VA 4JOIC 4KJOA 3WWNB 4OONA 3D6WA 5JJZA 1R0GA 2EPBA 4G7OC 1KC8C 5IY0A 4N9PA 2SEBD 5IYBL 1Y1VL 4KHVA 3W1BA 4BS9A 1K9MC 5JVH3 2H12A 1ET6A 3M85A 2F0DA 1TWFL 3P20A 3ZYYX 2NZOA 1EY0A 1HR0Q 4FF3A 5IYDH 2BDNA 2NVXL 3H3VC 4HMJA 1PFYA 1DGSA 2F0KA 4A3JL 4JG2A 3OIQA 1LTSD 1OO9B 2PW5A 5M5WL 1JR0D 1KIXA 4JYAL 4GOPB 3CCLA 2ENBA 2V4DA 1AE2A 3DWQA 2BH2A 1V1PB 1K83B 1SNCA 2L1BA 4K8IA 3I4ML 3ICEA 4BBSG 5GROA 1CHQD 3ER0A 4A3IB 3TQYA 3HS0C 2JE6I 1I4PA 1IU6A 2B3GA 4MIUA 3H0GL 1CZWA 1E2WA 4L63B 3R2TA 1DOLA 4RHRA 2NVTL 1E3PA 5IODA 4JK1C 1E7ZA 4OXPA 2GMGA 1MD2D 4H7BA 1JOQA 3TN2A 4CKEA 2IJ0A 5C4ZA 3F2UA 3DUZA 4QUFA 3HAXC 3HOXG 5LMNQ 3D4DA 3S14B 3VR6A 4A3DG 4CDCC 3HOWH 1EZ6A 3A5ZB 2H5XA 4OWWB 2LS01 3T1YQ 3J7Z1 1SNDA 4IALA 4IFDJ 3S2HL 1NXGA 3PIO1 2AQCA 5GAHc 1EFWA 4BY7B 1C8CA 1PRTF 3S17L 1YNJD 4NDXA 2WV6D 2XVSA 4IUQA 1U9RA 2ZXRA 4I7AA 2E2JB 5C5LA 2CCZA 2K5NA 2NYDA 4BY7G 1QUQA 3S1QL 2Y0SE 1O78A 4ZRZA 5M3ML 5L37A 3S1NH 3C3LA 1HR0L 2MUYA 4CKCA 3B0AB 2I5MX 4OWTB 4JBJA 5CV7A 4A3IL 3RN5A 1J6QA 1T9QA 1PH8A 2A69D 1SDFA 5I6WA 2UU9Q 1GHKA 1MKHA 3HOWB 1EY7A 3K5LA 5JJIA 5IT9c 3J80E 4O0AA 3RMHA 5FKAC 3CCRA 2RKSA 3KDFB 1YI2A 2Z6KC 2JA5B 1V9PA 1Y1WB 1UE1A 4IOCA 1PV4A 1CA6A 2KN9A 3KJPA 5IWAQ 3S24A 1D6EC 2A6ED 4DPGA 3I3CA 4PQXA 1C9OA 4U68A 5IT9L 2UUBQ 1J8IA 1PLFA 3HOVG 2D62A 5FO8B 3PUVA 1WI5A 4UY8C 3FVQA 2WKDA 1NR2A 3WWVA 1K3BC 3DWAA 3I90A 3CMAA 5COYA 4BY1G 3HG9A 5BN3A 1HFGA 4XYOA 2OTLA 4DK1A 2OEOA 2JSOA 1LTRD 2H1EA 3GTMB 2JA7B 2PNHA 5GADc 1JWUD 3HKZG 2QEJC 2LFNA 2M00A 4K14A 2PYKA 3KLSX 3KYXA 1Y69U 1AP0A 1WCML 3QQCE 4LHNA 2LSSA 4OEMB 1BVSA 1I94Q 3GTJL 7RXNA 2RF4A 2A1AA 5IGEA 3T1HL 4LUVA 2EXZA 2ID0A 2RHQB 2M2LA 5GAGC 2FJ2A 4A3GL 2KHIA 3QG1A 1B1ZA 4C3HG 1SE4A 2C6BA 4XYQA 1AH9A 1QOHA 1SN8A 2IWHA 4A3KL 1I3QB 2KCTA 4DXFA 4F8MA 5IGBA 1YITA 1U0LA 5IYBG 4LW1A 4HN7A 2WAQP 5KYLA 4JPBW 2WP8J 3J7AV 2UXBQ 2JA5L 2B2YA 3AEVA 2RCNA 3PF5A 3T53B 3OWEB 2G9DA 5EGTA 5M3FH 4LFBL 2A68D 3NUCA 1L1OC 4QJFA 4KK7A 3PIP1 1SJHD 4V0BA 1K73C 1RTOA 3PO2G 4LF6L 5E4WC 1TS3A 4HSPA 3F2BA 4A3FH 1DZ1A 2K32A 3ERSX 2BE5C 3HFZB 4CJ2C 2JA6H 2EOTA 5C0XH 3I56A 4LAAA 3HZXA 5CBAE 3SEBA 3HOYL 1CQFA 4B08A 1X6OA 2IX3A 3VDYA 1VF5C 2F0SA 3IKJA 4ZCKA 5C6AA 5I9OA 2DJFC 1KDBA 3VA5A 1VQOA 1Q46A 4DU9A 3T51B 4GKKQ 2MS3A 1H9JA 3ONAB 4RMFA 5NUCA 3F2DA 4A76A 2IX1A 4FXDA 1G6PA 1AZPA 2X69A 3OW7A 3LWPB 2X6LA 1TY2A 5TSSA 1ILPA 1PZXA 5M3FL 2I0QA 5KIXA 1OWCA 2Z4HA 3I4LA 4E6YA 4C2M1 4A3DL 2K05A 4HJ9A 4A3KH 3VPBE 1CQVA 3MEHA 2EYFA 3SK6A 2E2JL 2EQSA 5KNDA 1QYBA 1U4LA 1PYSB 2F3IA 4WFN3 2V1CC 4ZQ3A 4EQNA 3OSOA 4JI0Q 2K14A 1QNKA 1I4HA 2PI2E 5FLML 1WTHA 5JJLA 1Z92B 1UNSA 2NBFA 1SE2A 4LNQA 1TVXA 1BOSA 1KAWA 3UI2A 5IGFA 4EQOA 1IYUA 3Q22A 2OQKA 1QCBD 4JAGA 4ZN1B 2PYAA 2GA4B 2HVYC 1N34Q 1SJED 4IFDI 5M3MH 2RFKB 1SYGA 4NXMQ 3A0JA 1PRTC 4K6DA 4LUZA 1EUJA 4G7ZC 3OTOL 3TS0A 3KF6B 1PFSA 5C0XI 3JC66 3OWFA 3J81i 5IOCA 2WAQE 2JA6G 4RG1A 3I4MB 4X62L 1M8AA 5EBDA 1Y1VB 4DR4L 1JJCB 1LYLA 2B8FA 3KF8A 3MXUA 3T1YL 2XJQA 3K35A 2EY6A 1NJIC 1OXVA 3GV3A 2Q2HA 4R4OA 1IL2A 4A3JB 2VUMG 4YWMA 2WACA 1Q3LA 2Q2UA 4PMBA 1I3QL 4PMWA 4A3KB 5ELCA 3KLRA 1EEFD 3K7AL 1Y8NB 6RXNA 3M4OH 4C3JH 1YIJA 4QQBX 4K9FA 1RF2D 1A3VA 2Z8LA 3GP7A 2WB1G 3RZDH 1BNZA 3G71A 1E2VA 3GTGH 4IZ8A 3SDZA 3W3AA 3GTJB 1KNEA 1KXLA 3FPPA 1DOMA 5D3DA 3T4AC 3VYTA 2K4KA 4DV3L 2DY7A 3A74A 3VR2A 3I4MH 1JB7A 1WCMG 3U9OA 3TZUA 1BDOA 1JQYD 3H3VI 2CW0D 3CXCA 3C1FA 1IBML 5J3BA 4ZKCB 3S2HH 4TVMA 2Z3RB 2OQ0A 1ZYRC 3CF5A 1T5EA 4JBMA 2F0TA 1T5XD 3RZDL 4AI0A 4YY3L 4A3KG 3M4OL 4L6TB 1VZHA 1K8OA 1I3QH 1PHJA 1DONA 1VQCA 2Y0SP 4AIMA 1SMMA 1ESRA 1UEAB 1QE6A 1MSGA 1SYCA 4APVA 3NWSA 4IFDH 3J7AF 2JI1A 3HOUL 3W5OA 1SRUA 3V2TA 5M3FB 4ZLTF 2MFIA 3GTOH 1PRTD 1EOVA 1VQ4A 3JAMi 2Z4IA 4A3BH 4IUUA 3MXGA 4HR7B 1ZRPA 3MXNA 4A4IA 4JI3L 5C4XB 4ME3A 3J80c 1NTGA 5JJKA 4YCUA 1E1TA 3NTKA 1LT3D 1B70B 4WORA 2TSSA 1U5KA 1T9OA 3MQKB 2CWPA 5RXNA 1RODA 1PH7A 1K8MA 3VR4A 1IZ6A 4X3SA 2QKIC 3DEOA 4P72A 4HSVA 5C3XA 1PZID 2F0IA 1PFMA 2HR5A 3H97A 3ULLA 4ABNA 1EWHA 4DXGA 5M3FG 4B3TL 3LNNA 1KABA 1LKOA 2XN9C 4A3CH 4GLAC 2DJGC 4IJHA 4DV1Q 3KFUA 1Y1VH 4N8FA 4A3BB 2PO4A 3S2HB 1VCIA 2F0QA 4FO2A 2OTJA 1TWCB 2FMMA 1VQNA 4KJNA 1XJVA 1YHBA 1F9RA 3I4OA 4YY3Q 4TQUS 3CW2C 2Z0SA 2QEXA 2IT1A 4HJ8A 2FMCA 4GN5A 1SROA 1EQRA 2K5VA 1KNAA 5F2DA 4B8CD 1C7YA 1A63A 1FYCA 1SMWA 1CSPA 4AHYA 1VMPA 5C3EB 3NTHA 1GXDC 3S14H 1YNND 1JC7A 5GAEc 2O4XA 4L5TA 4R4TA 4C3IL 4JI1Q 2F4VL 1O7YA 2HHHQ 1PYBA 1L1OA 2F03A 4GN3B 2JA6L 5FJ8L 2AUKA 1CI3M 1LTID 2VB3X 4YWKA 2OWOA 1PMRA 1EOTA 1IRNA 4C3HH 1GUSA 1SMXA 1TIID 2GN5A 4QIWP 5C44H 2JEAI 1EYGA 4B3ML 4H44C 2B5ID 4A93L 5ELOA 1NMGA 2WB1E 1TWHL 1IBKQ 3TEHB 2JA5H 3IFDA 2B2UC 2E75C 4B3SQ 3NBIA 5ELFA 4IPCA 1E8JA 4BA2I 3S2DL 5LMUL 5ELDA 3BVGA 2F0MA 4BBRG 5BR8L 1ENAA 3S1QB 1PDQA 2KCMA 1G291 3PIO3 1NCVA 4A3MB 3LWUA 4GOPA 5M5YB 1WJJA 1S5CD 3RUZA 3J81E 3RN2A 4L5SA 3S17B 4LFCQ 4LF8L 5DM71 2E2HL 2G5DA 4FVMA 3NE5B 3H0GG 2ZTDA 2E76C 4DV0L 4DK3C 3SK5A 1IBLQ 4IPHA 2PSMC 1PFVA 1V1QA 4B9XA 3P8BA 1GJXA 2IW3A 3S16L 5HGQA 4JI1L 2JA7H 2KEDA 2DUDA 4WJ4A 4BBRB 3CPFA 5IYCG 5AJ3Q 2ZJRA 3H9CA 3CCSA 4RGTA 2YU9B 1A8VA 1ET9A 2XWBB 2NVQB 1R4PB 1NY4A 4HJ7A 1F9QA 2PI2A 2PPTA 2B39A 1B2TA 4JI2Q 3EBEA 1HZBA 3C1EA 1SYFA 1STNA 1FD7D 3K0XA 2CR8A 2KHJA 2BA1A 4BBSH 2ZXOA 3QWNA 1E22A 3A7AB 3K7AH 2I46A 5IE8A 1EFID 2HQLA 1S72A 2B29A 1XNRQ 5AN9H 2R7ZH 4R4IA 3MC0B 1A62A 1MI2A 1JYBA 1TWHB 3G6EA 4ZUJA 2C6AA 1NR4A 2EY4E 4K0KQ 1Q81C 1PRTB 3HOYB 2QGQA 3KDFA 1YNJC 4C1NK 4XDXA 4A3BG 1I4QA 1F9SA 3CCUA 4EQPA 1U4MA 1Q1BA 1TWFB 2R61A 2EZVA 3LWOB 2PW7A 3LNLA 5E7NA 4NB3A 3I91A 3AFPA 2CFMA 3A56A 4DKAC 3GTLB 1HNWL 3NBHA 4LFCL 2RCFA 1KD1C 5JVG1 4XQJA 1VQFA 1N8RC 1AZQA 1ONLA 5JAVA 1CADA 3K6OA 3CPWA 3T16A 4ZYSA 2D9UA 1SNMA 3NPPA 4HMIA 2F4IA 2IHFA 4DR2Q 2R3ZA 2R7ZL 1TKWB 2LMCB 2HIXA 1NMFA 2BA0A 3CQZB 3GD7A 3FKIB 3K0YA 2PVXA 3NK9A 2CHBD 4KLKA 1BKBA 8RXNA 1Z9FA 2E2IL 2UXCQ 1J5EL 1C0AA 3NEMA 1R0JA 3WWLA 4YCWA 3I8ZA 2F3WA 5K36G 4JI4Q 3LWVB 3HEJA 4JAFA 4DF7A 3CRKC 1FJGQ 4BBSB 2E2JH 2CKAA 3S2DH 2QA4A 5KGUA 1H9MA 2JA8H 4R1JA 3MFGA 1D1IA 3U58A 1BCPC 5CV9A 3KF6A 2JA7L 1MJCA 5FLXE 5C4JB 4V190 3S16H 1NXEA 1XWEA 1TWHH 2ZIXA 2WIIB 3J80i 2PCFB 4DV1L 1ICFB 3A5UA 1G8ZD 5M5WH 2MP1A 2K03A 2YTVA 3STBD 5A35A 4K0KL 1PTOC 2PVEA 5IYDL 3OHXC 3MA2B 5GAHC 3NENA 4C3HL 1L1OB 2KKDA 3DWPA 4PZ6A 1CSQA 3U4VA 4AI3A 2K50A 3D0FA 3L9AX 4FXGC 2E8GA 5M3MB 3CP0A 4O2DA 3S1NB 1UE5A 1U4RA 1EYAA 3KLWA 2VB2X 5MGNA 4A3MG 4NPSA 2DY8A 4BBRL 4HIMA 1IYJB 3E5SA 1GOZA 4DAYB 1VQJA 1WTPA 5J39A 5H1Sc 2NVYL 2IPKD 1YK4A 3FKIH 1CAAA 2CVRA 4CDDC 5ELNA 1JJGA 3OMGA 4LHLA 1XMOQ 3BYYB 5IGCA 1NNQA 5CV8A 1G2TA 3J81L 5IP9H 3RLFA 3VR5A 1HJPA 4GNXB 3QJYA 4AHWA 1J5EQ 5C44L 3W1GA 3TP5A 4A3JG 4PV1C 3A44A 1AW7A 1SE8A 2R7FA 3I72A 2R7DA 5C44B 2JA8B 4A3DB 3J81c 3RYGA 1MHWC 1EY9A 3GTGB 2LKVA 4JV5Q 2JQOA 2Z6BA 4X3UA 2NVTB 1WCMH 1Y1WG 1LTTD 2MPMA 3D31A 4H13C 2D0PA 1C09A 1CM9A 2ES2A 2ERJA 2PMZB 1UWVA 3KYHC 1X3QA 1JJ2A 5LMUQ 5MLC3 1PFUA 4X64L 4H02A 4R8IA 4RKBA 2CQOA 3A8JE 4K8JA 1FR3A 2R93H 1RHPA 1HR0W 1VDZA 1JCKB 4YIJA 4JI5Q 4QIWE 3UDGA 1XPUA 3H0GB 4QGUA 4I65A 4AYBE 4XQNA 4DNIA 2AWNA 2B2UA 1SR3A 2RQXA 2HUGA 3D3RA 1TY0A 4PG3A 1HZ9A 4DR3L 1OTCA 1NNXA 4ZN3B 1NE3A 1SMUA 4IQZA 1ODHA 2ASBA 2Z3QB 4BY1H 3HOUH 2IL8A 2A6EC 5M5WB 2CH4W 4FYDA 4A3LH 5EBCA 3HKSA 2PMZE 3CC2A 1QQTA 1DM0B 5D14A 2Z6KA 5EKIA 3B6YA 5FO7B 4G6BA 2F0LA 4ALPA 2M6PA 4IOAA 3PIP3 1CA5A 3BG3A 4JI8Q 3KOJA 2A69C 2R7ZG 2RDGA 4JI2L 1TXYA 1STEA 2EY5A 2HIVA 1QVCA 2JYOA 2ZT9C 4K5XA 2C35B 1BF4A 1PFWA 4JV5L 1I6HH 4K2LA 5G3LF 2L0CA 3S1RL 4X65Q 1PH2A 1EU3A 5M9OA 5C3EL 1QVFA 3F8TA 1VQLA 1K28A 3I55A 3L3OC 4P73A 5AI3A 1F9PA 4AHZA 3BDLA 2TMPA 3JAMc 3GV6A 3PO3G 2K52A 1MGSA 2XGTA 3QOJA 4C3JL 4ZAIA 4X64Q 2A74C 1S3OA 1SXTA 3SR1A 3MSUA 3KJOA 2YTYA 1B2OA 3Q8DA 1B9NA 2SOBA 3F1ZA 3KK7A 4MN3A 2UUAL 1XNQL 1LUZA 4HJ5A 2F0FA 4KN7C 2F0EA 4KY6A 1TWAL 3S9WA 2DGYA 4UP8A 4DR1Q 2ZJPA 4TPUA 3RD4A 3GTPL 1JOKA 2HDLA 5C3EH 5LMNL 1R0FA 4DAVA 1EIYB 2HDMA 2E5LQ 2FFKB 1B8AA 1DOKA 2KENA 1AN8A 1BO0A 1BUVT 2ATWA 1LTBD 1DXMA 1NSNS 3FPUB 4GNXA 4GKJL 2HD3A 4FF2A 4XGHA 2QDLA 2F0OA 1SFOB 1L0WA 1FJGL 2XIWA 1XX8A 5LL6X 1B13A 2JA5G 3M4OB 4BXXG 2FHTA 3RNUA 3HRZC 3RZDB 3GTPB 3SGIA 1O80A 3VYSA 4X65L 2EYMA 3P7JA 4DAYA 2N3SA 3KYVA 1X32A 3QVDA 2XSCA 3TS2A 2KBNA 1EZ8A 3GTMH 2AQ2B 5C5MA 4DV7Q 4A3EL 4KD3A 3NFPI 4A3DH 3GTQL 1I4XA 1HZCA 2R92L 3FHWA 2JXMB 4AQYQ 3TSSA 4K5WA 4GOPC 4JBWA 3H99A 1ZXTA 2R6GA 1WTQA 5CBEE 4KI0A 1I50B 5C0XJ 3V05A 1VQ9A 5C4XH 4L5QA 4DAPA 1R9TL 2A19A 2P5ZX 2GVAA 3F2CA 2M4YA 4RA8A 1R0IA 2RDFA 2C9OA 4PMCA 3A55A 3N6RA 1Y14B 3I70A 4P74A 4IO9A 1XMOL 1QG7A 4KKSA 2R93G 4J6HA 5FLXL 2H4OA 1VQ8A 2XWJB 3BU2A 4XXBB 3NELA 1FHMA 2ZM6L 1STAA 4XTCS 3MXPA 1SSOA 2JA6B 4BY1B 4RCOA 1Z6HA 4DR6Q 3GTKH 2BE5D 2KCCA 5EJWA 4DV5Q 1CTMA 2Y0SG 4DNRB 1Z7TA 4DA2A 3I4NL 1VCXA 2F0UA 1XTDA 4C3IB 4AR3A 2A68C 2K5DA 2QCPX 1X3GA 1W2BA 3IFTA 4DUZL 4A3GH 1XPOA 4P75A 3ZJYC 4X66L 2KJXA 1LKMA 2ZTCA 2B63B 3RZ6A 3HOYH 1HA6A 1SMYD 2UUCL 4LFAQ 1KAAA 4GLXA 4LF6Q 1H95A 3FKIG 4CJ1B 1SFOH 1F4LA 5LMNW 2Y0SB 2M4VA 3J80L 2J9UB 5DNFA 4OELB 3CRLC 1V8QA 3I4NH 5AI2A 1CT1D 1I50L 2B2TA 1VQIA 3O13A 4CDEC 2PQAA 1FNWA 1GUNA 3RZOL 5EQ0A 2Z1CA 1F2MA 2NB0A 5IT9E 5C4XG 1YVCA 3ZG6A 1JWMD 1W3SA 4LUOA 3GTQB 2XRQD 3JR7A 3K57A 1Y8OB 5CV5A 1FL0A 3K80C 1YJ9A 4P71A 3GTJH 1LT5D 4P2CB 1PTOD 1N33Q 1PH1A 5MFZA 4C3HB 1P7PA 1VQAA 4POFA 3NWTA 1ZKOA 5HURA 4LF5Q 1R9TH 3PSIA 3C2PA 1DX8A 2NZ1D 4JI0L 4IUPA 1PTOF 1BCPD 2V3BB 1L0XB 2DN8A 2K28A 2PMZP 3T13A 4AR5A 2EJMA 4BXXH 5MF6A 1VS0A 2VUMH 3M3YH 2RBMA 2V0EA 1KDCA 3J81j 4ZUIA 3Q24A 2E2DC 4UAIA 3BVMA 2VQEL 3K81C 2A6HD 4RGOS 4DV2Q 4I7ZC 1STBA 4DFAA 1TQOA 3QB3A 1A0IA 3MXNB 1V43A 5E4XA 4C3JB 1N34L 1QJOA 2UUAQ 4OGQC 3KF8B 3Q0AA 4TSSA 4UP7A 3DM1A 1WFQA 3HJYB 1HUMA 4ME5A 1KHIA 1UE7A 1VZGA 5CGKA 1VQEA 4DR5L 2VNUD 3MZ5A 2Q2IA 4KMUC 4IN3A 5LL6S 1B2JA 1X65A 4OO1I 3BDOA 3NTIA 1HPCA 1S5FD 1HNXL 2EYOA 3E0EA 1KQSA 2E5LL 1E1OA 2UXDL 5EPKA 4NP5A 3SXHA 4LF4L 5M3MG 1WCMB 2E2IB 1CZGA 4IPGA 4OO1G 2XJRA 3LPEB 3X3NA 3SVMA 2K1BA 3BYTB 3HOXL 3CU7A 3MHBA 1UEBA 2O5IC 1SBBB 1GUTA 3U4ZA 3S17H 1HTPA 3T1HQ 1PZJD 4LF5L 1JORA 2PZTA 1SNQA 4RXNA 1VQ5A 1A2UA 4KN4C 1RIPA 1EY5A 3HOWL 4A3JH 4EVOA 3RZTA 3UDFA 4KY5A 2ERSA 3AFQA 1B9MA 2RDVA 5J1ZA 1P16A 4LF9Q 4DV7L 2N78A 5EPJA 3MEFA 2JA7G 2JA8G 1Q8IA 1EIGA 3B08B 3AU7A 5EINC 3EQLC 1YUXA 3CD6A 3H0GH 4RGNA 2O2LD 5KEEA 3WOEA 1LM0A 3BZDB 4A3LG 4G7HC 5DM63 1I6HL 4XQQA 2MGSA 1WTRA 4XXEA 5E1FA 5I9PA 1WTVA 3RLNA 3NQTA 4GKKL 4GLVB 1GHJA 1XMQL 1VZIA 2X6GA 1WOCA 5IGGA 2UXDQ 3M3YB 2VUMB 1LABA 2NVQL 3PL5A 4A3ML 4M1UB 5CYUA 1ZEQX 2VW9A 1JB3A 3S1MH 3ULPA 4FDBA 1PFNA 1IKMA 1FNUA 3EVQA 2CW0C 3H91A 2ZXPA 3HJWB 1K8AC 5IYBH 3KYUA 5G3LD 3FDJA 1HNZQ 4DR6L 5BN4A 2MO1A 1TU2B 4JCVE 4DV4Q 1I6HB 1Q12A 3UE0A 1STGA 3WOFA 3S14L 1GD7A 1Q7YC 3PO2L 4R4CA 5C3WA 3HP3A 1B3QA 1EU4A 3H6MA 4AHXA 1MIUA 3S15H 1RKNA 1EQVA 1V1OA 1C48A 4X66Q 3VYRA 3KBGA 4HIOA 3CCMA 4F87A 5CC4A 3DMUA 2IHEA 4LFAL 1YBYA 3E0JA 4OWXB 2JI3A 2RVLA 1YHQA 2A8VA 3BJUA 1M1KC 2L11A 4B3RQ 4O1NA 5IWAL 5IIFA 2EY2A 2RDHA 4MNOA 5IP9G 1G91A 4NXML 3M9BA 4DK0A 4KHPL 4A3CL 5HY6A 1YHAA 5JVG3 2YU9H 3S1ML 1EY8A 2EE1A 1XMQQ 4DR4Q 3S15B 5GAGc 4NXNL 3H15A 1HH2P 1F2ZA 4YWLA 3K5MA 4JW0A 1WYDA 4KHZA 1OXXK 4JOIA 4F88A 3GTOB 5JEAG 1N33L 5IP7L 1SYEA 4ID6A 4Z9CB 2BDOA 4WJ3M 1X54A 3BVZA 1K83H 1SLJA 4DV4L 3K5NA 4OIJA 4A3BL 1VQ7A 4GS3A 1X9NA 1NAPA 1IBKL 1SE3A 2A5HA 1FGBD 1Z47A 4DV3Q 4JYAQ 2B8GA 3EROA 4S3SA 2I5HA 1L2FA 1S5BD 2JN4A 2NN6G 1LTLA 1JOOA 1RDGA 3M4PA 2PPBC 1S2ZA 2HCIA 2N49A 2O5JC 1F2LA 1WVLA 1GUWA 2HQEA 4B9WA 1OWBA 4QCLA 1IKLA 3GTLH 3KLSA 4RH6A 2VQEQ 3HOWG 1D1KA 5FLMG 2JA9A 3CC4A 1AEXA 2EXDA 2RSOA 2EVBA 5DM73 4F7XA 3TZDA 4IFDG 1LO5D 4DR5Q 1CUKA 3MTSA 3DXJC 4HAEA 4KHPQ 5H1SE 2JI2A 4POGA 5FK9C 2NTSA 3DEPA 4Y52L 3HOUB 4DN4M 1ENCA 2ZTEA 4LF7Q 3UDIA 4NXNQ 1QCVA 3VYUA 2E2IH 1CKOA 3FP9A 3IAYA 3FMCA 3L2PA 2VQFQ 3K8AA 1N36Q 2AMCB 2PZUA 4IJLA 4JC0A 1EYCA 3TP6A 4AYBB 2AWOA 2K5WA 4QIWB 3V96A 2B63G 2WKCA 1I4RA 2B63H 3K59A 2KHSA 1XPRA 1NBWA 2Q8TA 4WFN1 2B2TC 1HXYD 4K5VA 4B3TQ 3QOLA 5AFWA 1WD1A 1S4ZA 1LTAD 4PZ8A 1RYTA 3M4YA 4DGZA 5JPNC 1PH3A 1BR9A 1Y1VG 4AI2A 2KECA 4LK1C 3CQZH 1PH6A 2CH4A 3I73A 3QR8A 2L15A 3TREA 1EY6A 2DNCA 3S16B 1LLRD 1Y8PB 3QIAA 3UDXA 4X6AH 3WDNA 3URYA 5CV6A 1VQHA 5JEAJ 1PYWD 1U4PA 3D4RA 4LWCA 2L55A 2E2HB 2V0FA 3AMUA 4FXKC 4TVAB 3PGZA 1YNXA 2BH8A 1T9HA 3X3MA 1K0SA 2AYJA 2PZWA 1ASZA 1WD0A 1F2YA 1CFMA 5FLMH 4C56C 1O7IA 1HA5A 1GM5A 5CMDA 1LTGD 2GVBA 3PQIA 3OMCA 1QZHA 4ZK9B 3CCVA 2WB1P 1SYBA 1TWGL 4Y52H 4DR2L 4IUNA 2WINB 3P2AA 2KQ3A 3Q6SA 5M5XB 1ICWA 1EEID 4UDUC 2KVMA 5EIOC 5KYIA 1EL0A 4A3CG 2SNSA 1WTWA 1FHHA 3NQIA 2MQHA 3A8IE 2D2CC 4JI4L 1Y1WH 4FNFA 3JAML 3STBC 2F1MA 1HNZL 3CCQA 4Q0FA 1KLUD 4HCEA 3HOVB 1Q90A 4QF4A 1FGUA 3PO3H 3MFYA 2E2HH 1TT2A 2NZHA 1ZYRD 1OXSC 2QILA 4UY81 4BA1I 3EA6A 4G4KA 1RL2A 3CHBD 1SEBD 1CKNB 5CV4A 3MAQA 5IP7G 1P8LA 2MO0A 4J1MA 5JVH1 2LXJA 2NUCA 1YJNA 1IBMQ 1CHPD 1J9OA 2KA7A 1A15A 1HTLD 4L8JA 4A3FL 5C4HA 1S24A 3KYYA 1H9SA 1BFYA 2L5TA 3FEWX 4A3IG 1X3PA 3RZOH 3HGBA 1EYDA 2YYZA 2M6OA 1HUNA 1HCZA 3N52A 4O42A 3CMEA 1YNNC 3TP8A 2QDBA 3A8KE 4UHVA 1RDVA 1I50H 4A93H 1B3AA 1VQGA 1T9PA 1CKMA 3UE1A 3M7NA 1PH9A 2XJTA 4RGMA 1SMYC 5DEHA 5FJ8G 1DD2A 1SFOL 1XTCD 1DJRD 2B2WA 2EJFC 4TRDA 4A3EB 1D7QA 3U9SA 5FJ8H 1IBLL 3DLLA 2VL6A 4JI3Q 4A75A 1TWCL 1KDAA 5AJ3L 4A93G 2N55A 2JEBI 3QO2A 2K7VA 4NMZA 4GN4B 1PA6A 1X56A 5KRUA 5C4XL 3PO3L 1B71A 4AYBP 1HQMC 2EJGC 2L9HA 4UPAA 3FRPB 3AQQA 3HOZL 1RDPD 3PUWA 2O5JD 5D65A 1B7YB 3KYWA 3TMEA 4M8AA 1XNRL 4Y7NL 3LGJA 1S40A 4A3EH 1IHZA 2EYLA 3G6JB 1SNOA 3SS2A 2CKZB 5C4JH 4DNTB 1TWGH 3M7GA 4IURA 2KOLA 2ICIA 1BCPF 4JI5L 1O7LA 1VQDA 1DVBA 4DAMA 2RSNA 3KBXA 1TWAB 3OIPA 4R9WA 2K5HA 2XTIA 5FLXc 4BWGB 3J7Y1 2WAQG 1B50A 5J22A 4HEDA 4OO1H 5IYCL 3OTOQ 4DR3Q 1HNWQ 1PFBA 1II3A 3G48A 2NVQH 3BZCA 1RYQA 5A2QL 4A3IH 1R4QB 4IPDA 4QB4A 1VQ6A 4U673 2PNRC 5E3FA 5EPLA 2ZJQA 4X62Q 3MPSA 2NWGA 2MJ8A 4JBKA 1IL8A 2VZAA 3D8GA 3ND9A 5KNBA 4LF7L 3K7AB 1OXUA 2Q8IB 3H94A 2HHHL 3GTQH 3CQZL 3HOYG 4MZ9A 2I5LX 2UXCL 3KUPA 3GTML 2VQFL 5K5PA 5I6YA 3D4WA 1N36L 1EWCA 3E9HA 1BQ8A 2F0JA 2A73B 1VQPA 1FNVA 3PWFA 3GTOL 1TWAH 4CGYB 4DV6Q 1S5ED 3E9IA 4B3MQ 2N8NA 3I4MG 2Q2TA 4BY7H 4ILWA 1L0YB 2B2VC 4LJZC 4ULLA 2J7ZA 4B3SL 2F52A 5K2ME 1D5MC 1O7ZA 1TR5A 3EJIA 4NKLA 5K36H 2VXWA 1Q86C 4RKLA 3TP7A 3NP8A 1A2TA 3RLOA 1WTOA 2NVTH 4HCSA 1YEZA 3DM3A 1E24A 5KNCA 4JADA 3ND8A 3SE0A 3H3VH 2AQ3B 1VMCA 3PO2B 1AE3A 4KV6A 1V1PA 5EAYA 1KLGD 3HOXH 2F0PA 4LMQD 1WTXA 1BRFA 1CK1A 1R9TB 4J8QA 3GTPH 4RWSC 4WJWA 4MHEA 5I2XA 3TRZA 1UUPA 3L7ZC 3I7FA 2LCQA 3GTGL 3JAME 2Z9HA 3VA7A 4A3FG 4J15A 1YV1A 2OXPA 2G9HD 3D6CA 3G7LA 3GO5A 4PZ7A 2NVXH 1VF7A 1JE5A 1RWDA 1DYQA 1HZAA 3K5OA 4YHHQ 1KRSA 1IW7D 1STHA 2A6HC 4BY7L 5ISRA 2M9VA 4A3LL 2FXQA 1E2ZA 3JC63 3ULJA 1NUCA 3CCJA 1G51A 4GKJQ 2XJPA 1BE7A 3K7UC 4CBVA 1JICA 1K83L 3T56B 4DV6L 2QL0A 1N32Q 2K04A 3I2ZA 4H0LC 5IYDG 1LV9A 2N88A 1PTOB 1EY4A 3S1RH 3OPOA 3PMFA 3PCOB 4X3KA 5IP7H 4JI7L 5FOBB 2NN6H 2VUML 3M3YL 4QL5A 2MHVA 2CQAA 5MFPA 1FVIA 4DUYL 1QB5D 4R8NA 1LKPA 1D5XC 1BCPB 3H09A 1KL9A 1X55A 1HFNA 3S2DB 2EYPA 3C46A 1E0BA 2K6AA 5IYCH 3HOVL 3HOZG 3J7ZC 2KEEA 3I4NB 4RHSA 2JK8A 4K6LA 4AQYL 3J7YW 1EWIA 4CDFC 2F0GA 3DHQA 4DR7L 1TS2A 4AR4A 1HHVA 3PUXA 3GTKB 3P75A 4EQ5A 4U671 4BY1L 5CR3A 1KTKA 2BCOA 1A6XA 5C4JL 4CKBA 1PH4A 2B2VA 4OX9Q 3ERQA 4HTHA 1VQBA 1I5FA 4WRDA 4AYBG 2D0OA 1EIFA 4HJAA 4JI6L 4QUCA 4A3GB 4Y7NH 1IU5A 3H3VM 1H9RA 4YHHL 4NW2A 5IP9L 1MJEA 2NN6I 3AB9A 4GS7D 1TS5A 3CCEA 2F4VQ 3HOZH 4RAUC 2EY1A 5C0XG 2ICEC 4A3GG 2AHOB 3PF4A 1H9SB 3LWQB 2ZM6Q 3U50C 3PO2H 3TDQA 5HGTA 5T1IA 4JI8L 5JPMC 3GDEA 2AUJD 3HOXB 2IX0A 3S1RB 1OXTA 1CKNA 2WB1B 4X3TA 1WJVA 2YV5A 1LT4D 1QZGA 2K75A 1TWCH 2HT1A 1PH5A 5JEAH 1JMCA 1GVPA 2K33A 5C44G 3EN2A
chains in the Genus database with same CATH topology
2D0PA 4GKKQ 1C09A 3AYHB 2MS3A 1XMQQ 3BZKA 4DR4Q 4RMFA 2IX1A 4A76A 3F2DA 2ES2A 2ERJA 5GAGc 2CKCA 1UWVA 3KYHC 4NXNL 3H15A 1HH2P 1JJ2A 4YWLA 5LMUQ 5MLC3 4KHZA 1WYDA 1QVGA 4X64L 4H02A 2CQOA 1OXXK 1BBWA 2I0QA 5BR8Q 4JOIA 2UUCQ 1OWCA 2R93H 1ASYA 1HR0W 5JEAG 4JI5Q 1N33L 4QIWE 3UDGA 1XPUA 4E6YA 2AKWB 4QGUA 1XNQQ 4AYBE 4DNIA 2AWNA 4HJ9A 4A3KH 3VPBE 1SR3A 1X54A 4WJ3M 1K83H 1SLJA 1YZ6A 2EQSA 1QYBA 4DV4L 4PG3A 1HZ9A 4DR3L 1PYSB 2F3IA 3OW2A 1OTCA 4LF8Q 4ZN3B 1NE3A 2V1CC 1VQ7A 1SMUA 1BBUA 4GS3A 1X9NA 4JI0Q 1ODHA 2K14A 2ASBA 2Z3QB 4BY1H 1RB9A 1IBKL 4JI6Q 4XIGS 2PI2E 3HOUH 4DV0Q 5JJLA 1Z92B 4DV3Q 1Z47A 4JYAQ 1YJWA 4A3LH 3EIVA 2MNAA 2I5HA 5M5XH 1L2FA 4C2MH 3HKSA 4LNQA 2PMZE 2NN6G 1LTLA 4AI1A 2IY5B 1RDGA 3PIOA 3CC2A 3M4PA 1S2ZA 1KAWA 3PV0A 2N49A 2Z6KA 3B6YA 1OWBA 2OQKA 4G6BA 4DK6C 3GTLH 4ALPA 2M6PA 4JAGA 2VQEQ 4ZN1B 3HOWG 2PYAA 1N34Q 4JI8Q 5FLMG 3KOJA 4IFDI 2R7ZG 5M3MH 4JI2L 1TXYA 2JA9A 2HIVA 3CC4A 1QVCA 2EXDA 2WFWA 1IROA 4NXMQ 1VQKA 2C35B 3A0JA 4JV5L 3PKIA 2R92H 4IFDG 1I6HH 2PQAB 4LUZA 1EUJA 4DR5Q 3OTOL 1CUKA 3TS0A 4X65Q 3KF6B 1PFSA 1PH2A 4KHPQ 1QVFA 5C0XI 3JC66 3F8TA 5H1SE 1K8GA 3J81i 1Q8KA 1VQLA 2JI2A 2WAQE 3I55A 4POGA 4P73A 5AI3A 4RG1A 2JA6G 2K2DA 3NBHB 4AHZA 4X62L 1QUQB 4DR4L 3JAMc 1JJCB 1LYLA 2ZTEA 3PO3G 4LF7Q 2K52A 3UDIA 1QCVA 4NXNQ 2XGTA 2E2IH 5M5YH 4GNXC 3T1YL 2XJQA 3K35A 1CKOA 1S3OA 4X64Q 1HNZQ 1NJIC 1OXVA 1D8LA 3FP9A 2Q2HA 4R4OA 1IL2A 3MSUA 3IU3I 3L2PA 3CAMA 2VUMG 5C3EG 4YWMA 2VQFQ 3K8AA 3KJOA 2YTYA 1EQQA 2AMCB 1N36Q 4IJLA 4JC0A 2Q2UA 1B2OA 3Q8DA 4UP9A 2AWOA 3F1ZA 4PMWA 4EX5A 2UUAL 1XNQL 6RXNA 1LUZA 4C3JH 3M4OH 4HJ5A 5GADC 4K9FA 3RZDH 1YIJA 2B63G 4QQBX 2WB1G 3GTGH 3G71A 2B63H 2DGYA 1NBWA 4UP8A 4WFN1 4DR1Q 1XPRA 3S1QH 2ZJPA 4B3TQ 4TPUA 1KXLA 4PZ8A 1RYTA 1PH3A 5C3EH 5DM61 1Y1VG 5LMNL 1R0FA 4AI2A 2K4KA 4DV3L 3CQZH 3A74A 3I4MH 1JB7A 1WCMG 1PH6A 1EIYB 1HNXQ 3H3VI 2E5LQ 3JC62 2YTXA 1H7VA 1B8AA 3CXCA 1IBML 5J3BA 3S2HH 2KENA 2L15A 3TREA 2ATWA 4TVMA 2Z3RB 2OQ0A 3CF5A 4X6AH 3UDXA 4JBMA 4AH6A 4AI0A 4YY3L 4GNXA 4A3KG 1VQHA 5JEAJ 4GKJL 4XGHA 1VZHA 1I3QH 1L0WA 1PHJA 1FJGL 1VQCA 4LWCA 4AIMA 1B13A 2JA5G 1N32L 1SMMA 2V0FA 4BXXG 4DV5L 4TVAB 4AR6A 3PGZA 1YNXA 2BH8A 1T9HA 3RNUA 4A3EG 2AYJA 4JAEA 1ASZA 4APVA 3SGIA 4X65L 2R92G 4JI7Q 2JI1A 1Q1EA 5FLMH 3W5OA 1M90C 1O7IA 2JJQA 1SRUA 2N3SA 1GM5A 3KYVA 3PUZA 3QVDA 2MFIA 3PZAA 2GVBA 1QZHA 3GTOH 4QY7A 1EOVA 3CCVA 1X3EA 4DUYQ 3JAMi 1VQ4A 4Y52H 4DR2L 4A3BH 4DUZQ 1GO3E 3TS2A 3L0OA 3HKZE 2KBNA 1ZRPA 3P2AA 1YUZA 4A4IA 3GTMH 4JI3L 4LF9L 4ME3A 3J80c 4DV7Q 2UU9L 5GAEC 1NTGA 3PIPA 3NFPI 4A3DH 5JJKA 4YCUA 1E1TA 1HZCA 1IXRA 1B70B 5EIOC 1U5KA 3HOUG 4A3CG 1T9OA 1FHHA 5RXNA 2CWPA 3FHWA 4AQYQ 1PH7A 1GKHA 2MQHA 1IZ6A 4GOPC 4JI4L 4JBWA 4P72A 1Y1WH 4HIDA 4DR7Q 2R6GA 3STBC 1HNZL 2XJUA 3CCQA 1UE6A 4KI0A 1FGUA 2HR5A 5C0XJ 1Q82C 3PO3H 2E2HH 1VQ9A 3ULLA 5C4XH 4L5QA 4DR1L 4OX9L 2NZHA 2UUBL 1TWFH 2A19A 5M3FG 4B3TL 1OXSC 2GVAA 3F2CA 2M4YA 4UY81 2LXKA 4BA1I 1LKOA 1R0IA 1Y14B 1RL2A 4A3CH 4GLAC 1CKNB 4IJHA 3G4SA 4P74A 4DV1Q 3KFUA 5IP7G 1Y1VH 4IO9A 1XMOL 1P8LA 2MO0A 3RR5A 3J7A5 5JVH1 2LXJA 2R93G 1VCIA 1YJNA 1VQ8A 1IBMQ 3I4NG 2OTJA 1K3RA 1VQNA 3BU2A 2CWAA 4XXBB 2DSXA 3CC7A 1XJVA 3NELA 1YHBA 1FHMA 2ZM6L 1S24A 3KYYA 2ALYB 2EIFA 4XTCS 1BFYA 3I4OA 4TQUS 5GQOA 3CW2C 4YY3Q 2Z0SA 4A3IG 2QEXA 2IT1A 3RZOH 2YYZA 4MTNA 4HJ8A 2M6OA 4GN5A 3CMEA 1I94L 4DR6Q 3GTKH 2BE5D 1SROA 4DV5Q 2Y0SG 1RDVA 1I50H 5DLQE 1EQRA 4A93H 2K5VA 1VCXA 1VQGA 4B8CD 1T9PA 1XTDA 1C7YA 1A63A 1CKMA 3UE1A 3OYYA 4AR3A 2XJTA 1PH9A 3M7NA 2XJSA 1SMWA 1CSPA 5FJ8G 1X3GA 4AHYA 1R0HA 1W2BA 3S14H 1VQMA 1KRTA 4DUZL 4A3GH 1XPOA 4L5RC 1D7QA 1IBLL 5FJ8H 4P75A 3ZJYC 3DLLA 5GAEc 4L5TA 4X66L 1HNWQ 4R4TA 2UXBL 1LKMA 2VL6A 4JI3Q 4A75A 3PUYA 2ZTCA 4JI1Q 3RZ6A 2F4VL 3HOYH 5AJ3L 2HHHQ 4R4QA 1PYBA 4LFBQ 4A93G 2JEBI 2UUCL 1K0RA 1L1OA 4C3IH 4LFAQ 1PVOA 3M4QA 4GN3B 4GLXA 4LF6Q 2XJVA 4GN4B 4DV2L 1PA6A 3HOVH 4YWKA 2OWOA 1H95A 3FKIG 1IRNA 4C3HH 1X56A 4HIKA 4A3MH 1SFOH 1SMXA 4B3RL 2GN5A 5LMNW 5C44H 2M4VA 2JEAI 2J9UB 1EYGA 2RHSB 1B71A 1JT8A 4B3ML 1X3FA 4UPAA 3I4NH 1YK5A 5AI2A 2B5ID 3AQQA 5ELOA 3PUWA 1NMGA 2O5JD 2WB1E 4YCVA 1B7YB 1IBKQ 3KYWA 3TEHB 2OCEA 1VQIA 2VY3A 2JA5H 1XNRL 2PQAA 2L0ZA 1N9WA 2VS1A 4B3SQ 2NVYH 4IPCA 3LGJA 1S40A 4A3EH 1E8JA 3PKJA 5C4XG 1YVCA 3ZG6A 4V196 4BA2I 1W3SA 4LUOA 3SS2A 2CKZB 4BBRH 5LMUL 1BQ9A 4LF4Q 3IRBA 1S30A 4JOIC 3WWNB 5C4JH 1TWGH 4OONA 1FL0A 4BBRG 1R0GA 3K80C 5BR8L 1YJ9A 4P71A 3GTJH 1KC8C 5IY0A 4JI5L 3W1BA 1VQDA 1DVBA 4DAMA 1PH1A 1N33Q 2KCMA 1G291 2K5HA 2XTIA 5MFZA 1K9MC 5FLXc 3J7Y1 2WAQG 4GOPA 2H12A 3M85A 1VQAA 4POFA 4LF5Q 1WJJA 1R9TH 3OTOQ 3RN2A 3PSIA 4DR3Q 4L5SA 4LF8L 2NZOA 1HR0Q 4LFCQ 5DM71 3G48A 1DX8A 2NVQH 3BZCA 1RYQA 4A3IH 5IYDH 4JI0L 4IPDA 1VQ6A 1DGSA 4JG2A 2V3BB 2ZJQA 3H0GG 4X62Q 2ZTDA 3MPSA 4DV0L 1KIXA 4DK3C 1IBLQ 4IPHA 2PSMC 4AR5A 4GOPB 1V1QA 2VZAA 3P8BA 3CCLA 4JBKA 4LF7L 4JYAL 1AE2A 5MF6A 1VS0A 2BH2A 2VUMH 3M3YH 5HGQA 1OXUA 2V0EA 4JI1L 3J81j 2JA7H 2DUDA 4WJ4A 5AJ3Q 3CPFA 5IYCG 2ZJRA 2HHHL 3GTQH 4MZ9A 3HOYG 3ICEA 2I5LX 3CCSA 4BBSG 5GROA 2UXCL 1A8VA 2VQFL 3ER0A 1NY4A 3TQYA 2VQEL 1N36L 4HJ7A 3K81C 2JE6I 2A6HD 1IU6A 2B3GA 3E9HA 4DV2Q 4IOAA 1BQ8A 1A0IA 3MXNB 1V43A 2PPTA 2PI2A 1VQPA 1N34L 2UUAQ 4JI2Q 3EBEA 3KF8B 3PWFA 1TWAH 4UP7A 1E3PA 1HZBA 1WFQA 1E7ZA 4OXPA 2GMGA 1KHIA 1UE7A 4DV6Q 1VZGA 3K0XA 2CR8A 3E9IA 2KHJA 2BA1A 2N8NA 4B3MQ 4BBSH 1E22A 1VQEA 3K7AH 4DR5L 2VNUD 3I4MG 2Q2TA 4BY7H 2Q2IA 5IE8A 4DR6L 1B2JA 1X65A 2HQLA 1S72A 2B29A 1XNRQ 3HOXG 5LMNQ 4OO1I 5AN9H 2R7ZH 4R4IA 4B3SL 1A62A 2F52A 5K2ME 1JYBA 1HNXL 4A3DG 3E0EA 1KQSA 2E5LL 3G6EA 3HOWH 1Q86C 2C6AA 1E1OA 2UXDL 3RLOA 4K0KQ 2NVTH 1Q81C 3A5ZB 2H5XA 4LF4L 2QGQA 1YEZA 3DM3A 3KDFA 1E24A 5M3MG 3J7Z1 3T1YQ 4JADA 4OWWB 4IPGA 1NXGA 3PIO1 4A3BG 2XJRA 4OO1G 3H3VH 4IFDJ 3LPEB 5GAHc 1EFWA 3CCUA 1Q1BA 1AE3A 5EAYA 1UEBA 3HOXH 3LNLA 3U4ZA 1BRFA 5E7NA 4NB3A 3S17H 2CCZA 2K5NA 3AFPA 3GTPH 2NYDA 2CFMA 3T1HQ 4LF5L 4BY7G 1QUQA 3TRZA 2Y0SE 4DKAC 3S1NH 1HNWL 4LFCL 3L7ZC 1KD1C 5JVG1 4RXNA 1VQFA 1N8RC 3I7FA 1HR0L 1VQ5A 2LCQA 1RIPA 3B0AB 2I5MX 1CADA 4OWTB 4A3FG 3CPWA 4J15A 4JBJA 1YV1A 4A3JH 3RZTA 3UDFA 3GO5A 2NVXH 4PZ7A 2IHFA 4DR2Q 3RN5A 2ERSA 1JE5A 3AFQA 1RWDA 1T9QA 2RDVA 1J6QA 1HZAA 4YHHQ 2HIXA 1NMFA 2BA0A 3GD7A 1KRSA 2PVXA 2A69D 1P16A 1PH8A 4LF9Q 1IW7D 4KLKA 4DV7L 2UU9Q 1MKHA 1BKBA 2N78A 2FXQA 8RXNA 5JJIA 3MEFA 1Z9FA 5IT9c 2JA7G 2JA8G 3B08B 5EINC 4O0AA 3ULJA 2UXCQ 3JC63 3CCRA 1J5EL 1YUXA 3KDFB 1C0AA 3NEMA 1R0JA 2Z6KC 3WWLA 1G51A 1V9PA 4YCWA 3CCJA 1YI2A 1UE1A 5K36G 4IOCA 4JI4Q 4GKJQ 2XJPA 1PV4A 3CD6A 4JAFA 2KN9A 3H0GH 3KJPA 1BE7A 3K7UC 3S24A 5IWAQ 1FJGQ 2A6ED 4DPGA 2E2JH 4DV6L 1N32Q 2QL0A 2CKAA 3S2DH 3I2ZA 2QA4A 5IYDG 1G6PA 1C9OA 1LM0A 4R1JA 3U58A 3S1RH 2JA8H 2UUBQ 4A3LG 5IP7H 3PCOB 3KF6A 1MJCA 2D62A 3HOVG 4JI7L 3PUVA 3S16H 4QL5A 1NXEA 1WI5A 4UY8C 1TWHH 2ZIXA 5MFPA 1FVIA 3J80i 3RLNA 3WWVA 4DV1L 4DUYL 3A5UA 4GKKL 5M5WH 4GLVB 1XMQL 3CMAA 1LKPA 1VZIA 4BY1G 1WOCA 2OTLA 2YTVA 2UXDQ 3STBD 4K0KL 1KL9A 1X55A 2PVEA 2PNHA 5GAHC 3NENA 1L1OB 5IYCH 2VW9A 3S1MH 5GADc 2KKDA 4FDBA 3J7ZC 3ULPA 3HOZG 3HKZG 1CSQA 4PZ6A 4AI3A 3U4VA 2K50A 3D0FA 2JK8A 4AQYL 2E8GA 1EWIA 3KYXA 1K8AC 4DR7L 5IYBH 3QQCE 3KYUA 4LHNA 4AR4A 2LSSA 1BVSA 3CP0A 3PUXA 4O2DA 4U671 7RXNA 2RF4A 1UE5A 2A1AA 4EQ5A 1I94Q 2MO1A 3T1HL 4LUVA 4JCVE 2ID0A 4DV4Q 1Q12A 2RHQB 3KLWA 2KHIA 3UE0A 5GAGC 4A3MG 5MGNA 1PH4A 4OX9Q 4NPSA 1GD7A 1I5FA 1VQBA 2C6BA 4HIMA 1Q7YC 4R4CA 1IYJB 1AH9A 1SN8A 2D0OA 4AYBG 1VQJA 2KCTA 1EIFA 4DAYB 4HJAA 1YITA 4JI6L 5H1Sc 4AHXA 1U0LA 3FKIH 1YK4A 4LW1A 1CAAA 1MIUA 5IYBG 4Y7NH 5ELNA 1IU5A 3S15H 2WP8J 4YHHL 1JJGA 4X66Q 2UXBQ 4LHLA 1XMOQ 1MJEA 1NNQA 2NN6I 4GS7D 3AEVA 2RCNA 5IP9H 3RLFA 3CCEA 1HJPA 5C0XG 3PF5A 5M3FH 4HIOA 3CCMA 2F4VQ 3HOZH 2A68D 4LFBL 1L1OC 4QJFA 4A3GG 2AHOB 4GNXB 3PF4A 3PIP1 2IHEA 1K73C 4AHWA 4LFAL 1J5EQ 1YBYA 3W1GA 3PO2G 2ZM6Q 4OWXB 3U50C 2JI3A 4A3JG 3F2BA 1YHQA 4A3FH 4LF6L 2A8VA 3PO2H 3BJUA 3A44A 3ERSX 1M1KC 1SE8A 2R7FA 3HFZB 4JI8L 2R7DA 4B3RQ 3GDEA 5IWAL 2JA6H 2IX0A 1OXTA 4MNOA 5IP9G 3I56A 1CKNA 4NXML 3J81c 3RYGA 4BXXH 4JV5Q 2JQOA 1WCMH 3M9BA 1WJVA 2YV5A 1Y1WG 1QZGA 1X6OA 1TWCH 2K75A 3VDYA 1PH5A 2HT1A 4KHPL 1JMCA 1GVPA 5HY6A 5C44G 3EN2A 3D31A 1YHAA 1VQOA 1Q46A 2YU9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0P A;  4GKK Q;  1C09 A;  3AYH B;  2MS3 A;  1XMQ Q;  3BZK A;  4DR4 Q;  4RMF A;  2IX1 A;  4A76 A;  3F2D A;  2ES2 A;  1G6P A;  3KYH C;  1UWV A;  4NXN L;  3H15 A;  1HH2 P;  1JJ2 A;  4YWL A;  5LMU Q;  4KHZ A;  1WYD A;  1QVG A;  4X64 L;  4H02 A;  2CQO A;  1OXX K;  1BBW A;  2I0Q A;  5BR8 Q;  4JOI A;  2UUC Q;  2R93 H;  1ASY A;  1HR0 W;  5JEA G;  4JI5 Q;  1N33 L;  4QIW E;  3UDG A;  1XPU A;  2AKW B;  4QGU A;  1XNQ Q;  4AYB E;  4DNI A;  2AWN A;  4HJ9 A;  4A3K H;  4WJ3 M;  1SR3 A;  1X54 A;  1K83 H;  1SLJ A;  1YZ6 A;  2EQS A;  1QYB A;  4DV4 L;  4PG3 A;  1HZ9 A;  4DR3 L;  1PYS B;  2F3I A;  3OW2 A;  1OTC A;  4LF8 Q;  1NE3 A;  2V1C C;  1VQ7 A;  1SMU A;  1BBU A;  4GS3 A;  1X9N A;  4JI0 Q;  2K14 A;  2ASB A;  4BY1 H;  1RB9 A;  1IBK L;  4JI6 Q;  4XIG S;  2PI2 E;  3HOU H;  4DV0 Q;  5JJL A;  4DV3 Q;  1Z47 A;  4JYA Q;  1YJW A;  4A3L H;  3EIV A;  2MNA A;  2I5H A;  5M5X H;  1L2F A;  4C2M H;  3HKS A;  4LNQ A;  2PMZ E;  2NN6 G;  1LTL A;  2IY5 B;  1RDG A;  3PIO A;  3CC2 A;  3M4P A;  1S2Z A;  1KAW A;  3PV0 A;  2N49 A;  2Z6K A;  3B6Y A;  4DK6 C;  2OQK A;  3GTL H;  4ALP A;  3HOW G;  2VQE Q;  2PYA A;  1N34 Q;  4JI8 Q;  5FLM G;  3KOJ A;  4IFD I;  2R7Z G;  5M3M H;  4JI2 L;  1TXY A;  2JA9 A;  2HIV A;  3CC4 A;  1QVC A;  2EXD A;  2WFW A;  1IRO A;  4NXM Q;  1VQK A;  2C35 B;  3A0J A;  4JV5 L;  2R92 H;  4IFD G;  1I6H H;  2PQA B;  4LUZ A;  1EUJ A;  4DR5 Q;  3OTO L;  1CUK A;  3TS0 A;  4X65 Q;  3KF6 B;  1PFS A;  1PH2 A;  4KHP Q;  1QVF A;  5C0X I;  3JC6 6;  3F8T A;  5H1S E;  1K8G A;  3J81 i;  1Q8K A;  1VQL A;  2WAQ E;  3I55 A;  4POG A;  4P73 A;  5AI3 A;  4RG1 A;  2JA6 G;  2K2D A;  3NBH B;  4X62 L;  1QUQ B;  4DR4 L;  3JAM c;  1JJC B;  1LYL A;  2ZTE A;  3PO3 G;  4LF7 Q;  2K52 A;  3UDI A;  1QCV A;  4NXN Q;  2XGT A;  2E2I H;  5M5Y H;  4GNX C;  3T1Y L;  4X64 Q;  1CKO A;  1S3O A;  1HNZ Q;  1NJI C;  1OXV A;  1D8L A;  3FP9 A;  2Q2H A;  4R4O A;  1IL2 A;  3L2P A;  2VUM G;  3CAM A;  5C3E G;  4YWM A;  2VQF Q;  3K8A A;  3KJO A;  2YTY A;  1EQQ A;  2AMC B;  1N36 Q;  4IJL A;  4JC0 A;  2Q2U A;  1B2O A;  3Q8D A;  4UP9 A;  2AWO A;  3F1Z A;  4PMW A;  4EX5 A;  2UUA L;  1XNQ L;  6RXN A;  1LUZ A;  4C3J H;  3M4O H;  4HJ5 A;  5GAD C;  4K9F A;  3RZD H;  1YIJ A;  2B63 G;  4QQB X;  2WB1 G;  3GTG H;  3G71 A;  2B63 H;  2DGY A;  1NBW A;  4UP8 A;  4DR1 Q;  1XPR A;  3S1Q H;  2ZJP A;  4B3T Q;  4TPU A;  1KXL A;  4PZ8 A;  1RYT A;  1PH3 A;  5C3E H;  1Y1V G;  5LMN L;  1R0F A;  2K4K A;  4DV3 L;  3CQZ H;  3A74 A;  3I4M H;  1JB7 A;  1WCM G;  1PH6 A;  1EIY B;  1HNX Q;  3H3V I;  2E5L Q;  3JC6 2;  2YTX A;  1H7V A;  1B8A A;  3CXC A;  1IBM L;  5J3B A;  3S2H H;  2KEN A;  2L15 A;  3TRE A;  2ATW A;  2OQ0 A;  3CF5 A;  4X6A H;  3UDX A;  4JBM A;  4AH6 A;  4YY3 L;  4GNX A;  4A3K G;  1VQH A;  5JEA J;  4GKJ L;  1I3Q H;  1L0W A;  1PHJ A;  1FJG L;  1VQC A;  4LWC A;  4AIM A;  1B13 A;  2JA5 G;  1N32 L;  1SMM A;  4BXX G;  4DV5 L;  4TVA B;  4AR6 A;  3PGZ A;  1YNX A;  2BH8 A;  1T9H A;  3RNU A;  4A3E G;  1ASZ A;  4APV A;  3SGI A;  4X65 L;  2R92 G;  4JI7 Q;  1Q1E A;  5FLM H;  3W5O A;  1M90 C;  1O7I A;  2JJQ A;  1SRU A;  2N3S A;  1GM5 A;  3KYV A;  3PUZ A;  3QVD A;  2MFI A;  3PZA A;  2GVB A;  1QZH A;  3GTO H;  4QY7 A;  1EOV A;  3CCV A;  1X3E A;  4DUY Q;  3JAM i;  1VQ4 A;  4Y52 H;  4DR2 L;  4A3B H;  4DUZ Q;  1GO3 E;  3TS2 A;  3L0O A;  3HKZ E;  2KBN A;  1ZRP A;  1YUZ A;  4A4I A;  3GTM H;  4JI3 L;  4LF9 L;  4ME3 A;  3J80 c;  4DV7 Q;  2UU9 L;  5GAE C;  1NTG A;  3PIP A;  4A3D H;  5JJK A;  4YCU A;  1E1T A;  1HZC A;  1IXR A;  1B70 B;  1U5K A;  3HOU G;  4A3C G;  1T9O A;  1FHH A;  5RXN A;  2CWP A;  3FHW A;  4AQY Q;  1PH7 A;  1GKH A;  2MQH A;  1IZ6 A;  4GOP C;  4JI4 L;  4JBW A;  4P72 A;  1Y1W H;  4HID A;  4DR7 Q;  2R6G A;  3STB C;  1HNZ L;  3CCQ A;  1UE6 A;  4KI0 A;  1FGU A;  2HR5 A;  5C0X J;  1Q82 C;  3PO3 H;  2E2H H;  1VQ9 A;  3ULL A;  5C4X H;  4L5Q A;  4DR1 L;  4OX9 L;  2NZH A;  2UUB L;  1TWF H;  2A19 A;  5M3F G;  4B3T L;  1OXS C;  2GVA A;  3F2C A;  2M4Y A;  2LXK A;  4BA1 I;  1LKO A;  1R0I A;  1Y14 B;  1RL2 A;  4A3C H;  4GLA C;  1CKN B;  4IJH A;  3G4S A;  4P74 A;  4DV1 Q;  3KFU A;  5IP7 G;  1Y1V H;  4IO9 A;  1XMO L;  1P8L A;  2MO0 A;  3RR5 A;  3J7A 5;  2LXJ A;  2R93 G;  1VCI A;  1YJN A;  1VQ8 A;  1IBM Q;  3I4N G;  2OTJ A;  1K3R A;  1VQN A;  3BU2 A;  2CWA A;  1XJV A;  2DSX A;  3CC7 A;  3NEL A;  1YHB A;  1FHM A;  2ZM6 L;  1S24 A;  3KYY A;  2ALY B;  2EIF A;  4XTC S;  1BFY A;  3I4O A;  4TQU S;  5GQO A;  3CW2 C;  4YY3 Q;  2Z0S A;  4A3I G;  2QEX A;  2IT1 A;  3RZO H;  2YYZ A;  4MTN A;  4HJ8 A;  4GN5 A;  3CME A;  1I94 L;  4DR6 Q;  3GTK H;  1SRO A;  4DV5 Q;  2Y0S G;  1RDV A;  1I50 H;  5DLQ E;  1EQR A;  4A93 H;  2K5V A;  1VCX A;  1VQG A;  1A63 A;  1T9P A;  1XTD A;  1C7Y A;  1CKM A;  3UE1 A;  3OYY A;  4AR3 A;  1PH9 A;  3M7N A;  1SMW A;  1CSP A;  5FJ8 G;  1X3G A;  1R0H A;  1W2B A;  3S14 H;  1VQM A;  1KRT A;  4DUZ L;  4A3G H;  1XPO A;  4L5R C;  1D7Q A;  1IBL L;  5FJ8 H;  4P75 A;  3ZJY C;  3DLL A;  4L5T A;  4X66 L;  1HNW Q;  2UXB L;  4R4T A;  1LKM A;  2VL6 A;  4JI3 Q;  4A75 A;  3PUY A;  2ZTC A;  4JI1 Q;  3RZ6 A;  2F4V L;  3HOY H;  5AJ3 L;  2HHH Q;  4R4Q A;  1PYB A;  4LFB Q;  4A93 G;  2JEB I;  2UUC L;  1K0R A;  1L1O A;  4C3I H;  4LFA Q;  1PVO A;  3M4Q A;  4GN3 B;  4GLX A;  4LF6 Q;  4GN4 B;  4DV2 L;  1PA6 A;  3HOV H;  4YWK A;  2OWO A;  1H95 A;  3FKI G;  1IRN A;  4C3H H;  1X56 A;  4HIK A;  4A3M H;  1SFO H;  1SMX A;  4B3R L;  2GN5 A;  5LMN W;  5C44 H;  2JEA I;  1EYG A;  2RHS B;  1B71 A;  1JT8 A;  4B3M L;  1X3F A;  4UPA A;  3I4N H;  1YK5 A;  5AI2 A;  3AQQ A;  5ELO A;  3PUW A;  1NMG A;  4YCV A;  2WB1 E;  1B7Y B;  1IBK Q;  3KYW A;  3TEH B;  2OCE A;  1VQI A;  2VY3 A;  2JA5 H;  1XNR L;  2PQA A;  2VS1 A;  1N9W A;  4B3S Q;  2NVY H;  4IPC A;  3LGJ A;  1S40 A;  4A3E H;  1E8J A;  5C4X G;  1YVC A;  4BA2 I;  1W3S A;  4LUO A;  3SS2 A;  2CKZ B;  4BBR H;  5LMU L;  1BQ9 A;  4LF4 Q;  3IRB A;  1S30 A;  4JOI C;  5C4J H;  1TWG H;  4OON A;  1FL0 A;  4BBR G;  1R0G A;  3K80 C;  5BR8 L;  1YJ9 A;  4P71 A;  3GTJ H;  1KC8 C;  5IY0 A;  4JI5 L;  3W1B A;  1VQD A;  1DVB A;  4DAM A;  1PH1 A;  1N33 Q;  2KCM A;  1G29 1;  2K5H A;  2XTI A;  1K9M C;  5FLX c;  2WAQ G;  4GOP A;  3M85 A;  1VQA A;  4POF A;  4LF5 Q;  1WJJ A;  1R9T H;  3OTO Q;  3RN2 A;  3PSI A;  4DR3 Q;  4L5S A;  4LF8 L;  2NZO A;  1HR0 Q;  4LFC Q;  3G48 A;  1DX8 A;  2NVQ H;  3BZC A;  4A3I H;  5IYD H;  4JI0 L;  4IPD A;  1VQ6 A;  1DGS A;  4JG2 A;  2V3B B;  2ZJQ A;  3H0G G;  4X62 Q;  2ZTD A;  3MPS A;  4DV0 L;  1KIX A;  4DK3 C;  1IBL Q;  4IPH A;  4JYA L;  4AR5 A;  4GOP B;  1V1Q A;  2VZA A;  3CCL A;  4JBK A;  4LF7 L;  1AE2 A;  2BH2 A;  1VS0 A;  2VUM H;  3M3Y H;  4BXX H;  5HGQ A;  1OXU A;  4JI1 L;  2JA7 H;  3J81 j;  2DUD A;  4WJ4 A;  5AJ3 Q;  3CPF A;  5IYC G;  2ZJR A;  2HHH L;  3GTQ H;  4MZ9 A;  3HOY G;  3ICE A;  2I5L X;  3CCS A;  4BBS G;  5GRO A;  2UXC L;  1A8V A;  2VQF L;  3ER0 A;  1NY4 A;  3TQY A;  2VQE L;  1N36 L;  4HJ7 A;  3K81 C;  2JE6 I;  3E9H A;  1IU6 A;  2B3G A;  4DV2 Q;  4IOA A;  1BQ8 A;  1A0I A;  3MXN B;  1V43 A;  2PI2 A;  1VQP A;  1N34 L;  2UUA Q;  4JI2 Q;  3EBE A;  3KF8 B;  3PWF A;  1TWA H;  4UP7 A;  1E3P A;  1WFQ A;  1HZB A;  1E7Z A;  4OXP A;  2GMG A;  1KHI A;  1UE7 A;  4DV6 Q;  3K0X A;  3E9I A;  2KHJ A;  2BA1 A;  2N8N A;  4B3M Q;  4BBS H;  1E22 A;  1VQE A;  3K7A H;  4DR5 L;  2VNU D;  3I4M G;  2Q2T A;  4BY7 H;  2Q2I A;  5IE8 A;  1B2J A;  1X65 A;  2HQL A;  1S72 A;  2B29 A;  1XNR Q;  3HOX G;  5LMN Q;  4OO1 I;  2R7Z H;  4R4I A;  4B3S L;  1A62 A;  2F52 A;  4A3D G;  1JYB A;  1HNX L;  3E0E A;  1KQS A;  2E5L L;  3G6E A;  3HOW H;  1Q86 C;  1E1O A;  2UXD L;  3RLO A;  4K0K Q;  2NVT H;  1Q81 C;  3A5Z B;  2H5X A;  4LF4 L;  2QGQ A;  1YEZ A;  3DM3 A;  3KDF A;  1E24 A;  5M3M G;  3T1Y Q;  4OWW B;  4A3B G;  4IFD J;  4IPG A;  4OO1 G;  3H3V H;  1EFW A;  3CCU A;  1Q1B A;  1AE3 A;  5EAY A;  1UEB A;  3HOX H;  3U4Z A;  1BRF A;  5E7N A;  4NB3 A;  3S17 H;  2CCZ A;  2K5N A;  3AFP A;  3GTP H;  2CFM A;  3T1H Q;  4LF5 L;  4BY7 G;  1QUQ A;  3TRZ A;  2Y0S E;  4DKA C;  3S1N H;  1HNW L;  4LFC L;  3L7Z C;  1KD1 C;  1HR0 L;  4RXN A;  1VQF A;  1N8R C;  3I7F A;  1VQ5 A;  2LCQ A;  1RIP A;  2I5M X;  1CAD A;  4OWT B;  4A3F G;  3CPW A;  4J15 A;  4JBJ A;  1YV1 A;  4A3J H;  3RZT A;  3UDF A;  3GO5 A;  2NVX H;  4PZ7 A;  2IHF A;  4DR2 Q;  3RN5 A;  1JE5 A;  3AFQ A;  1RWD A;  1T9Q A;  2RDV A;  1J6Q A;  1HZA A;  4YHH Q;  2HIX A;  1NMF A;  2BA0 A;  3GD7 A;  1KRS A;  2PVX A;  1P16 A;  1PH8 A;  4LF9 Q;  4KLK A;  4DV7 L;  2UU9 Q;  1MKH A;  1BKB A;  2N78 A;  2FXQ A;  8RXN A;  5JJI A;  3MEF A;  1Z9F A;  5IT9 c;  2JA7 G;  2JA8 G;  3JC6 3;  4O0A A;  3ULJ A;  2UXC Q;  3CCR A;  1J5E L;  1YUX A;  3KDF B;  1C0A A;  3NEM A;  1R0J A;  2Z6K C;  1G51 A;  1V9P A;  4YCW A;  3CCJ A;  1YI2 A;  1UE1 A;  5K36 G;  4IOC A;  4JI4 Q;  4GKJ Q;  1PV4 A;  3CD6 A;  3H0G H;  2KN9 A;  3KJP A;  1BE7 A;  3K7U C;  3S24 A;  5IWA Q;  1FJG Q;  4DPG A;  2E2J H;  4DV6 L;  1N32 Q;  2QL0 A;  3S2D H;  3I2Z A;  2QA4 A;  5IYD G;  1C9O A;  1LM0 A;  4R1J A;  3U58 A;  3S1R H;  2JA8 H;  2UUB Q;  4A3L G;  5IP7 H;  3PCO B;  3KF6 A;  1MJC A;  2D62 A;  3HOV G;  4JI7 L;  3PUV A;  3S16 H;  4QL5 A;  1WI5 A;  4UY8 C;  1TWH H;  1FVI A;  3J80 i;  3WWV A;  3RLN A;  4DV1 L;  4DUY L;  3A5U A;  4GKK L;  5M5W H;  4GLV B;  1XMQ L;  3CMA A;  1LKP A;  4BY1 G;  1WOC A;  2OTL A;  2YTV A;  2UXD Q;  3STB D;  4K0K L;  1KL9 A;  1X55 A;  2PVE A;  2PNH A;  5GAH C;  3NEN A;  1L1O B;  5IYC H;  2VW9 A;  3S1M H;  2KKD A;  4FDB A;  3J7Z C;  3ULP A;  3HOZ G;  3HKZ G;  1CSQ A;  4PZ6 A;  3U4V A;  2K50 A;  3D0F A;  2JK8 A;  4AQY L;  2E8G A;  1EWI A;  3KYX A;  1K8A C;  4DR7 L;  5IYB H;  3KYU A;  4AR4 A;  2LSS A;  3CP0 A;  1BVS A;  3PUX A;  4O2D A;  4EQ5 A;  1I94 Q;  7RXN A;  2RF4 A;  1UE5 A;  2A1A A;  4DR6 L;  2MO1 A;  3T1H L;  4LUV A;  4JCV E;  2ID0 A;  4DV4 Q;  1Q12 A;  2RHQ B;  3KLW A;  2KHI A;  3UE0 A;  5GAG C;  4A3M G;  1PH4 A;  4OX9 Q;  4NPS A;  1GD7 A;  1I5F A;  1VQB A;  4HIM A;  1Q7Y C;  4R4C A;  1IYJ B;  1AH9 A;  1SN8 A;  2D0O A;  4AYB G;  1VQJ A;  2KCT A;  1EIF A;  4DAY B;  4HJA A;  1YIT A;  4JI6 L;  1U0L A;  3FKI H;  5IYB G;  1YK4 A;  4LW1 A;  1CAA A;  1MIU A;  4Y7N H;  5ELN A;  1IU5 A;  3S15 H;  2WP8 J;  4YHH L;  1JJG A;  4X66 Q;  2UXB Q;  1XMO Q;  1MJE A;  1NNQ A;  2NN6 I;  3AEV A;  2RCN A;  5IP9 H;  3RLF A;  3CCE A;  1HJP A;  5C0X G;  3PF5 A;  5M3F H;  4HIO A;  3CCM A;  2F4V Q;  3HOZ H;  4LFB L;  1L1O C;  4QJF A;  4A3G G;  2AHO B;  4GNX B;  3PF4 A;  2IHE A;  1K73 C;  4LFA L;  1J5E Q;  1YBY A;  3W1G A;  3PO2 G;  2ZM6 Q;  4OWX B;  3U50 C;  4A3J G;  1YHQ A;  3F2B A;  4LF6 L;  4A3F H;  3PO2 H;  2A8V A;  3BJU A;  3A44 A;  3ERS X;  1M1K C;  1SE8 A;  2R7F A;  3HFZ B;  4JI8 L;  2R7D A;  4B3R Q;  3GDE A;  5IWA L;  2JA6 H;  2IX0 A;  1OXT A;  4MNO A;  5IP9 G;  3I56 A;  1CKN A;  4NXM L;  3J81 c;  3RYG A;  4JV5 Q;  2JQO A;  1WCM H;  3M9B A;  1Y1W G;  2YV5 A;  1QZG A;  1X6O A;  1TWC H;  2K75 A;  3VDY A;  1PH5 A;  2HT1 A;  4KHP L;  1JMC A;  1GVP A;  5HY6 A;  5C44 G;  3EN2 A;  3D31 A;  1YHA A;  1VQO A;  1Q46 A;  2YU9 H; 
#chains in the Genus database with same CATH topology
 4FF4 A;  3AYH B;  3BZK A;  4Y7N B;  4N9T A;  2CKC A;  1MBY A;  2J0T D;  5A2Q E;  2LY7 A;  1QVG A;  3LWE A;  4CHT B;  1Y1W L;  1BBW A;  4K2K A;  5BR8 Q;  2UUC Q;  3GTK L;  2EYH A;  1ASY A;  2C5C A;  4E6I A;  3TBI B;  2OF1 A;  2AKW B;  5T1G A;  3BS1 A;  3MWY W;  1XNQ Q;  2HCC A;  1AFP A;  2J4X A;  4MTK A;  4XT3 B;  4RFB A;  1YZ6 A;  4TKO B;  1BBX C;  1PTO H;  1DCZ A;  3OW2 A;  4LF8 Q;  5EKK A;  1BBU A;  5I2Y A;  1RB9 A;  4JI6 Q;  3OOC A;  2R93 B;  1TS4 A;  2E74 C;  4XIG S;  4DV0 Q;  2PQE A;  3NXW A;  4EGV A;  1YJW A;  3EIV A;  2MNA A;  5M5X H;  3LWR B;  4C2M H;  5I4D A;  4AI1 A;  3A7L A;  2EYJ A;  3PO3 B;  3PIO A;  5DAU A;  2IY5 B;  4OL7 A;  3PV0 A;  3HKZ B;  1ML0 D;  2SDF A;  4DK6 C;  1BQQ T;  3R93 A;  3R8B A;  4X6A L;  2K01 A;  1C4Q A;  1W6K A;  1QNU A;  3GQB A;  2WFW A;  4FP5 D;  4C3I G;  1IRO A;  1VQK A;  3PKI A;  4C3J G;  2R92 H;  2PQA B;  3MVV A;  2JA8 L;  1JE4 A;  4KY7 A;  5ELE A;  1K8G A;  1Q8K A;  3CKI B;  2K2D A;  3NBH B;  4C1N I;  3RZO B;  1QUQ B;  2B63 L;  2K5Q A;  5M5Y H;  4GNX C;  2D5D A;  1PXU A;  1D8L A;  3IU3 I;  3CAM A;  5C3E G;  4QMG A;  4JVZ A;  3BDC A;  2L12 A;  2NVY B;  4A3F B;  1EQQ A;  4FF1 A;  4UP9 A;  4EX5 A;  5D3I B;  3NSW A;  3E6Z X;  4IUT A;  5M5Y L;  1H9K A;  4RCN A;  2F0W A;  5GAD C;  3EFX D;  1MSH A;  4A93 B;  2QF7 A;  2BOS A;  3S1N L;  3S1Q H;  1XXG A;  1HRJ A;  3R2I A;  2Q8R E;  2NVX B;  3S1M B;  5DM6 1;  3E3X A;  1HNX Q;  3P1H A;  4BXX L;  3JC6 2;  2YTX A;  1H7V A;  4PNY A;  3SK4 A;  2F0H A;  4KD4 A;  4ZKB B;  4GZY C;  4AH6 A;  2AQ1 B;  1ENF A;  2F0V A;  2NYZ D;  1M4V A;  2KUM A;  1XYI A;  1N32 L;  4DV5 L;  5M5X L;  4AR6 A;  4A3E G;  4JAE A;  1QWY A;  2R92 G;  4BBS L;  1TWG B;  4JI7 Q;  1Q1E A;  1M90 C;  2XNA C;  2JJQ A;  3PUZ A;  3PZA A;  4QY7 A;  1HQR D;  5FO9 B;  1X3E A;  4DUY Q;  4DUZ Q;  1GO3 E;  5IGD A;  3L0O A;  3HKZ E;  1SYD A;  1I4G A;  1YUZ A;  1LAC A;  3K58 A;  1ILQ A;  4N8X 1;  4KTA A;  4LF9 L;  3ITP A;  2UU9 L;  5GAE C;  2OT2 A;  3PIP A;  3A54 A;  5EKL A;  1IXR A;  3HOU G;  1STY A;  1EIH A;  3FDT A;  2SNM A;  1IW7 C;  2RA4 A;  1JWS D;  1GKH A;  4G57 A;  2I07 B;  4KKT A;  1QIL A;  4DR7 Q;  4HID A;  1A3U A;  2AUS B;  2XJU A;  1UE6 A;  1A3T A;  3GTL L;  1Q82 C;  2WAQ B;  2R92 B;  1RTN A;  3W2D A;  4DR1 L;  4OX9 L;  2UUB L;  1TWF H;  5ELB A;  4OIK A;  2LXK A;  3VR3 A;  1PZK D;  2KCN A;  1SNP A;  2EDG A;  3G4S A;  3LX0 A;  4XT1 B;  3RR5 A;  3J7A 5;  3R3O A;  3HOZ B;  1F77 A;  3I4N G;  1GUG A;  1G2S A;  1K3R A;  1D5Z C;  2CWA A;  2DSX A;  3CC7 A;  1I6V C;  2ALY B;  2EIF A;  2F0N A;  1RCV D;  4L5R C;  5GQO A;  1D2B A;  4MTN A;  1SAP A;  4ODG A;  1I94 L;  2R93 L;  3SK8 A;  5DLQ E;  2FIN B;  1ESF A;  3OYY A;  2XJS A;  3Q23 A;  1R0H A;  2QW7 A;  3SHL A;  3IL8 A;  1GUO A;  1RJT A;  1VQM A;  1KRT A;  4IUV A;  2YU9 L;  3H9B A;  2B2Y C;  2UXB L;  3NHH A;  2B2W C;  1LT6 D;  3PUY A;  1B44 D;  5JOB A;  1BXT A;  2NTT A;  4R4Q A;  5LHY 1;  4LFB Q;  1S5D D;  1K0R A;  5BN5 A;  4C3I H;  1PVO A;  3M4Q A;  2XJV A;  2JP1 A;  4DV2 L;  1EQT A;  1RD9 D;  3HOV H;  1IYV A;  4A3M H;  4HIK A;  4B3R L;  1B53 A;  4Q5V A;  4OHJ A;  2RHS B;  1JT8 A;  1X3F A;  1G6Z A;  2L4N A;  1YK5 A;  2DNE A;  2XRS D;  4YCV A;  2OCE A;  2VY3 A;  3HKZ P;  4KKU A;  3S15 L;  2L0Z A;  1N9W A;  2VS1 A;  3FKI L;  2NVY H;  2APO B;  1B4O A;  4C2M B;  3PKJ A;  2R7Z B;  4V19 6;  1UAP A;  4BBR H;  5COR A;  1W6J A;  1BQ9 A;  4LF4 Q;  3IRB A;  4CJ0 B;  1S30 A;  2F3V A;  4JOI C;  4KJO A;  3WWN B;  4OON A;  3D6W A;  5JJZ A;  1R0G A;  2EPB A;  4G7O C;  1KC8 C;  5IY0 A;  4N9P A;  2SEB D;  5IYB L;  1Y1V L;  4KHV A;  3W1B A;  4BS9 A;  1K9M C;  5JVH 3;  2H12 A;  1ET6 A;  3M85 A;  2F0D A;  1TWF L;  3P20 A;  3ZYY X;  2NZO A;  1EY0 A;  1HR0 Q;  4FF3 A;  5IYD H;  2BDN A;  2NVX L;  3H3V C;  4HMJ A;  1PFY A;  1DGS A;  2F0K A;  4A3J L;  4JG2 A;  3OIQ A;  1LTS D;  1OO9 B;  2PW5 A;  5M5W L;  1JR0 D;  1KIX A;  4JYA L;  4GOP B;  3CCL A;  2ENB A;  2V4D A;  1AE2 A;  3DWQ A;  2BH2 A;  1V1P B;  1K83 B;  1SNC A;  2L1B A;  4K8I A;  3I4M L;  3ICE A;  4BBS G;  5GRO A;  1CHQ D;  3ER0 A;  4A3I B;  3TQY A;  3HS0 C;  2JE6 I;  1I4P A;  1IU6 A;  2B3G A;  4MIU A;  3H0G L;  1CZW A;  1E2W A;  4L63 B;  3R2T A;  1DOL A;  4RHR A;  2NVT L;  1E3P A;  5IOD A;  4JK1 C;  1E7Z A;  4OXP A;  2GMG A;  1MD2 D;  4H7B A;  1JOQ A;  3TN2 A;  4CKE A;  2IJ0 A;  5C4Z A;  3F2U A;  3DUZ A;  4QUF A;  3HAX C;  3HOX G;  5LMN Q;  3D4D A;  3S14 B;  3VR6 A;  4A3D G;  4CDC C;  3HOW H;  1EZ6 A;  3A5Z B;  2H5X A;  4OWW B;  2LS0 1;  3T1Y Q;  3J7Z 1;  1SND A;  4IAL A;  4IFD J;  3S2H L;  1NXG A;  3PIO 1;  2AQC A;  5GAH c;  1EFW A;  4BY7 B;  1C8C A;  1PRT F;  3S17 L;  1YNJ D;  4NDX A;  2WV6 D;  2XVS A;  4IUQ A;  1U9R A;  2ZXR A;  4I7A A;  2E2J B;  5C5L A;  2CCZ A;  2K5N A;  2NYD A;  4BY7 G;  1QUQ A;  3S1Q L;  2Y0S E;  1O78 A;  4ZRZ A;  5M3M L;  5L37 A;  3S1N H;  3C3L A;  1HR0 L;  2MUY A;  4CKC A;  3B0A B;  2I5M X;  4OWT B;  4JBJ A;  5CV7 A;  4A3I L;  3RN5 A;  1J6Q A;  1T9Q A;  1PH8 A;  2A69 D;  1SDF A;  5I6W A;  2UU9 Q;  1GHK A;  1MKH A;  3HOW B;  1EY7 A;  3K5L A;  5JJI A;  5IT9 c;  3J80 E;  4O0A A;  3RMH A;  5FKA C;  3CCR A;  2RKS A;  3KDF B;  1YI2 A;  2Z6K C;  2JA5 B;  1V9P A;  1Y1W B;  1UE1 A;  4IOC A;  1PV4 A;  1CA6 A;  2KN9 A;  3KJP A;  5IWA Q;  3S24 A;  1D6E C;  2A6E D;  4DPG A;  3I3C A;  4PQX A;  1C9O A;  4U68 A;  5IT9 L;  2UUB Q;  1J8I A;  1PLF A;  3HOV G;  2D62 A;  5FO8 B;  3PUV A;  1WI5 A;  4UY8 C;  3FVQ A;  2WKD A;  1NR2 A;  3WWV A;  1K3B C;  3DWA A;  3I90 A;  3CMA A;  5COY A;  4BY1 G;  3HG9 A;  5BN3 A;  1HFG A;  4XYO A;  2OTL A;  4DK1 A;  2OEO A;  2JSO A;  1LTR D;  2H1E A;  3GTM B;  2JA7 B;  2PNH A;  5GAD c;  1JWU D;  3HKZ G;  2QEJ C;  2LFN A;  2M00 A;  4K14 A;  2PYK A;  3KLS X;  3KYX A;  1Y69 U;  1AP0 A;  1WCM L;  3QQC E;  4LHN A;  2LSS A;  4OEM B;  1BVS A;  1I94 Q;  3GTJ L;  7RXN A;  2RF4 A;  2A1A A;  5IGE A;  3T1H L;  4LUV A;  2EXZ A;  2ID0 A;  2RHQ B;  2M2L A;  5GAG C;  2FJ2 A;  4A3G L;  2KHI A;  3QG1 A;  1B1Z A;  4C3H G;  1SE4 A;  2C6B A;  4XYQ A;  1AH9 A;  1QOH A;  1SN8 A;  2IWH A;  4A3K L;  1I3Q B;  2KCT A;  4DXF A;  4F8M A;  5IGB A;  1YIT A;  1U0L A;  5IYB G;  4LW1 A;  4HN7 A;  2WAQ P;  5KYL A;  4JPB W;  2WP8 J;  3J7A V;  2UXB Q;  2JA5 L;  2B2Y A;  3AEV A;  2RCN A;  3PF5 A;  3T53 B;  3OWE B;  2G9D A;  5EGT A;  5M3F H;  4LFB L;  2A68 D;  3NUC A;  1L1O C;  4QJF A;  4KK7 A;  3PIP 1;  1SJH D;  4V0B A;  1K73 C;  1RTO A;  3PO2 G;  4LF6 L;  5E4W C;  1TS3 A;  4HSP A;  3F2B A;  4A3F H;  1DZ1 A;  2K32 A;  3ERS X;  2BE5 C;  3HFZ B;  4CJ2 C;  2JA6 H;  2EOT A;  5C0X H;  3I56 A;  4LAA A;  3HZX A;  5CBA E;  3SEB A;  3HOY L;  1CQF A;  4B08 A;  1X6O A;  2IX3 A;  3VDY A;  1VF5 C;  2F0S A;  3IKJ A;  4ZCK A;  5C6A A;  5I9O A;  2DJF C;  1KDB A;  3VA5 A;  1VQO A;  1Q46 A;  4DU9 A;  3T51 B;  4GKK Q;  2MS3 A;  1H9J A;  3ONA B;  4RMF A;  5NUC A;  3F2D A;  4A76 A;  2IX1 A;  4FXD A;  1G6P A;  1AZP A;  2X69 A;  3OW7 A;  3LWP B;  2X6L A;  1TY2 A;  5TSS A;  1ILP A;  1PZX A;  5M3F L;  2I0Q A;  5KIX A;  1OWC A;  2Z4H A;  3I4L A;  4E6Y A;  4C2M 1;  4A3D L;  2K05 A;  4HJ9 A;  4A3K H;  3VPB E;  1CQV A;  3MEH A;  2EYF A;  3SK6 A;  2E2J L;  2EQS A;  5KND A;  1QYB A;  1U4L A;  1PYS B;  2F3I A;  4WFN 3;  2V1C C;  4ZQ3 A;  4EQN A;  3OSO A;  4JI0 Q;  2K14 A;  1QNK A;  1I4H A;  2PI2 E;  5FLM L;  1WTH A;  5JJL A;  1Z92 B;  1UNS A;  2NBF A;  1SE2 A;  4LNQ A;  1TVX A;  1BOS A;  1KAW A;  3UI2 A;  5IGF A;  4EQO A;  1IYU A;  3Q22 A;  2OQK A;  1QCB D;  4JAG A;  4ZN1 B;  2PYA A;  2GA4 B;  2HVY C;  1N34 Q;  1SJE D;  4IFD I;  5M3M H;  2RFK B;  1SYG A;  4NXM Q;  3A0J A;  1PRT C;  4K6D A;  4LUZ A;  1EUJ A;  4G7Z C;  3OTO L;  3TS0 A;  3KF6 B;  1PFS A;  5C0X I;  3JC6 6;  3OWF A;  3J81 i;  5IOC A;  2WAQ E;  2JA6 G;  4RG1 A;  3I4M B;  4X62 L;  1M8A A;  5EBD A;  1Y1V B;  4DR4 L;  1JJC B;  1LYL A;  2B8F A;  3KF8 A;  3MXU A;  3T1Y L;  2XJQ A;  3K35 A;  2EY6 A;  1NJI C;  1OXV A;  3GV3 A;  2Q2H A;  4R4O A;  1IL2 A;  4A3J B;  2VUM G;  4YWM A;  2WAC A;  1Q3L A;  2Q2U A;  4PMB A;  1I3Q L;  4PMW A;  4A3K B;  5ELC A;  3KLR A;  1EEF D;  3K7A L;  1Y8N B;  6RXN A;  3M4O H;  4C3J H;  1YIJ A;  4QQB X;  4K9F A;  1RF2 D;  1A3V A;  2Z8L A;  3GP7 A;  2WB1 G;  3RZD H;  1BNZ A;  3G71 A;  1E2V A;  3GTG H;  4IZ8 A;  3SDZ A;  3W3A A;  3GTJ B;  1KNE A;  1KXL A;  3FPP A;  1DOM A;  5D3D A;  3T4A C;  3VYT A;  2K4K A;  4DV3 L;  2DY7 A;  3A74 A;  3VR2 A;  3I4M H;  1JB7 A;  1WCM G;  3U9O A;  3TZU A;  1BDO A;  1JQY D;  3H3V I;  2CW0 D;  3CXC A;  3C1F A;  1IBM L;  5J3B A;  4ZKC B;  3S2H H;  4TVM A;  2Z3R B;  2OQ0 A;  1ZYR C;  3CF5 A;  1T5E A;  4JBM A;  2F0T A;  1T5X D;  3RZD L;  4AI0 A;  4YY3 L;  4A3K G;  3M4O L;  4L6T B;  1VZH A;  1K8O A;  1I3Q H;  1PHJ A;  1DON A;  1VQC A;  2Y0S P;  4AIM A;  1SMM A;  1ESR A;  1UEA B;  1QE6 A;  1MSG A;  1SYC A;  4APV A;  3NWS A;  4IFD H;  3J7A F;  2JI1 A;  3HOU L;  3W5O A;  1SRU A;  3V2T A;  5M3F B;  4ZLT F;  2MFI A;  3GTO H;  1PRT D;  1EOV A;  1VQ4 A;  3JAM i;  2Z4I A;  4A3B H;  4IUU A;  3MXG A;  4HR7 B;  1ZRP A;  3MXN A;  4A4I A;  4JI3 L;  5C4X B;  4ME3 A;  3J80 c;  1NTG A;  5JJK A;  4YCU A;  1E1T A;  3NTK A;  1LT3 D;  1B70 B;  4WOR A;  2TSS A;  1U5K A;  1T9O A;  3MQK B;  2CWP A;  5RXN A;  1ROD A;  1PH7 A;  1K8M A;  3VR4 A;  1IZ6 A;  4X3S A;  2QKI C;  3DEO A;  4P72 A;  4HSV A;  5C3X A;  1PZI D;  2F0I A;  1PFM A;  2HR5 A;  3H97 A;  3ULL A;  4ABN A;  1EWH A;  4DXG A;  5M3F G;  4B3T L;  3LNN A;  1KAB A;  1LKO A;  2XN9 C;  4A3C H;  4GLA C;  2DJG C;  4IJH A;  4DV1 Q;  3KFU A;  1Y1V H;  4N8F A;  4A3B B;  2PO4 A;  3S2H B;  1VCI A;  2F0Q A;  4FO2 A;  2OTJ A;  1TWC B;  2FMM A;  1VQN A;  4KJN A;  1XJV A;  1YHB A;  1F9R A;  3I4O A;  4YY3 Q;  4TQU S;  3CW2 C;  2Z0S A;  2QEX A;  2IT1 A;  4HJ8 A;  2FMC A;  4GN5 A;  1SRO A;  1EQR A;  2K5V A;  1KNA A;  5F2D A;  4B8C D;  1C7Y A;  1A63 A;  1FYC A;  1SMW A;  1CSP A;  4AHY A;  1VMP A;  5C3E B;  3NTH A;  1GXD C;  3S14 H;  1YNN D;  1JC7 A;  5GAE c;  2O4X A;  4L5T A;  4R4T A;  4C3I L;  4JI1 Q;  2F4V L;  1O7Y A;  2HHH Q;  1PYB A;  1L1O A;  2F03 A;  4GN3 B;  2JA6 L;  5FJ8 L;  2AUK A;  1CI3 M;  1LTI D;  2VB3 X;  4YWK A;  2OWO A;  1PMR A;  1EOT A;  1IRN A;  4C3H H;  1GUS A;  1SMX A;  1TII D;  2GN5 A;  4QIW P;  5C44 H;  2JEA I;  1EYG A;  4B3M L;  4H44 C;  2B5I D;  4A93 L;  5ELO A;  1NMG A;  2WB1 E;  1TWH L;  1IBK Q;  3TEH B;  2JA5 H;  3IFD A;  2B2U C;  2E75 C;  4B3S Q;  3NBI A;  5ELF A;  4IPC A;  1E8J A;  4BA2 I;  3S2D L;  5LMU L;  5ELD A;  3BVG A;  2F0M A;  4BBR G;  5BR8 L;  1ENA A;  3S1Q B;  1PDQ A;  2KCM A;  1G29 1;  3PIO 3;  1NCV A;  4A3M B;  3LWU A;  4GOP A;  5M5Y B;  1WJJ A;  1S5C D;  3RUZ A;  3J81 E;  3RN2 A;  4L5S A;  3S17 B;  4LFC Q;  4LF8 L;  5DM7 1;  2E2H L;  2G5D A;  4FVM A;  3NE5 B;  3H0G G;  2ZTD A;  2E76 C;  4DV0 L;  4DK3 C;  3SK5 A;  1IBL Q;  4IPH A;  2PSM C;  1PFV A;  1V1Q A;  4B9X A;  3P8B A;  1GJX A;  2IW3 A;  3S16 L;  5HGQ A;  4JI1 L;  2JA7 H;  2KED A;  2DUD A;  4WJ4 A;  4BBR B;  3CPF A;  5IYC G;  5AJ3 Q;  2ZJR A;  3H9C A;  3CCS A;  4RGT A;  2YU9 B;  1A8V A;  1ET9 A;  2XWB B;  2NVQ B;  1R4P B;  1NY4 A;  4HJ7 A;  1F9Q A;  2PI2 A;  2PPT A;  2B39 A;  1B2T A;  4JI2 Q;  3EBE A;  1HZB A;  3C1E A;  1SYF A;  1STN A;  1FD7 D;  3K0X A;  2CR8 A;  2KHJ A;  2BA1 A;  4BBS H;  2ZXO A;  3QWN A;  1E22 A;  3A7A B;  3K7A H;  2I46 A;  5IE8 A;  1EFI D;  2HQL A;  1S72 A;  2B29 A;  1XNR Q;  5AN9 H;  2R7Z H;  4R4I A;  3MC0 B;  1A62 A;  1MI2 A;  1JYB A;  1TWH B;  3G6E A;  4ZUJ A;  2C6A A;  1NR4 A;  2EY4 E;  4K0K Q;  1Q81 C;  1PRT B;  3HOY B;  2QGQ A;  3KDF A;  1YNJ C;  4C1N K;  4XDX A;  4A3B G;  1I4Q A;  1F9S A;  3CCU A;  4EQP A;  1U4M A;  1Q1B A;  1TWF B;  2R61 A;  2EZV A;  3LWO B;  2PW7 A;  3LNL A;  5E7N A;  4NB3 A;  3I91 A;  3AFP A;  2CFM A;  3A56 A;  4DKA C;  3GTL B;  1HNW L;  3NBH A;  4LFC L;  2RCF A;  1KD1 C;  5JVG 1;  4XQJ A;  1VQF A;  1N8R C;  1AZQ A;  1ONL A;  5JAV A;  1CAD A;  3K6O A;  3CPW A;  3T16 A;  4ZYS A;  2D9U A;  1SNM A;  3NPP A;  4HMI A;  2F4I A;  2IHF A;  4DR2 Q;  2R3Z A;  2R7Z L;  1TKW B;  2LMC B;  2HIX A;  1NMF A;  2BA0 A;  3CQZ B;  3GD7 A;  3FKI B;  3K0Y A;  2PVX A;  3NK9 A;  2CHB D;  4KLK A;  1BKB A;  8RXN A;  1Z9F A;  2E2I L;  2UXC Q;  1J5E L;  1C0A A;  3NEM A;  1R0J A;  3WWL A;  4YCW A;  3I8Z A;  2F3W A;  5K36 G;  4JI4 Q;  3LWV B;  3HEJ A;  4JAF A;  4DF7 A;  3CRK C;  1FJG Q;  4BBS B;  2E2J H;  2CKA A;  3S2D H;  2QA4 A;  5KGU A;  1H9M A;  2JA8 H;  4R1J A;  3MFG A;  1D1I A;  3U58 A;  1BCP C;  5CV9 A;  3KF6 A;  2JA7 L;  1MJC A;  5FLX E;  5C4J B;  4V19 0;  3S16 H;  1NXE A;  1XWE A;  1TWH H;  2ZIX A;  2WII B;  3J80 i;  2PCF B;  4DV1 L;  1ICF B;  3A5U A;  1G8Z D;  5M5W H;  2MP1 A;  2K03 A;  2YTV A;  3STB D;  5A35 A;  4K0K L;  1PTO C;  2PVE A;  5IYD L;  3OHX C;  3MA2 B;  5GAH C;  3NEN A;  4C3H L;  1L1O B;  2KKD A;  3DWP A;  4PZ6 A;  1CSQ A;  3U4V A;  4AI3 A;  2K50 A;  3D0F A;  3L9A X;  4FXG C;  2E8G A;  5M3M B;  3CP0 A;  4O2D A;  3S1N B;  1UE5 A;  1U4R A;  1EYA A;  3KLW A;  2VB2 X;  5MGN A;  4A3M G;  4NPS A;  2DY8 A;  4BBR L;  4HIM A;  1IYJ B;  3E5S A;  1GOZ A;  4DAY B;  1VQJ A;  1WTP A;  5J39 A;  5H1S c;  2NVY L;  2IPK D;  1YK4 A;  3FKI H;  1CAA A;  2CVR A;  4CDD C;  5ELN A;  1JJG A;  3OMG A;  4LHL A;  1XMO Q;  3BYY B;  5IGC A;  1NNQ A;  5CV8 A;  1G2T A;  3J81 L;  5IP9 H;  3RLF A;  3VR5 A;  1HJP A;  4GNX B;  3QJY A;  4AHW A;  1J5E Q;  5C44 L;  3W1G A;  3TP5 A;  4A3J G;  4PV1 C;  3A44 A;  1AW7 A;  1SE8 A;  2R7F A;  3I72 A;  2R7D A;  5C44 B;  2JA8 B;  4A3D B;  3J81 c;  3RYG A;  1MHW C;  1EY9 A;  3GTG B;  2LKV A;  4JV5 Q;  2JQO A;  2Z6B A;  4X3U A;  2NVT B;  1WCM H;  1Y1W G;  1LTT D;  2MPM A;  3D31 A;  4H13 C;  2D0P A;  1C09 A;  1CM9 A;  2ES2 A;  2ERJ A;  2PMZ B;  1UWV A;  3KYH C;  1X3Q A;  1JJ2 A;  5LMU Q;  5MLC 3;  1PFU A;  4X64 L;  4H02 A;  4R8I A;  4RKB A;  2CQO A;  3A8J E;  4K8J A;  1FR3 A;  2R93 H;  1RHP A;  1HR0 W;  1VDZ A;  1JCK B;  4YIJ A;  4JI5 Q;  4QIW E;  3UDG A;  1XPU A;  3H0G B;  4QGU A;  4I65 A;  4AYB E;  4XQN A;  4DNI A;  2AWN A;  2B2U A;  1SR3 A;  2RQX A;  2HUG A;  3D3R A;  1TY0 A;  4PG3 A;  1HZ9 A;  4DR3 L;  1OTC A;  1NNX A;  4ZN3 B;  1NE3 A;  1SMU A;  4IQZ A;  1ODH A;  2ASB A;  2Z3Q B;  4BY1 H;  3HOU H;  2IL8 A;  2A6E C;  5M5W B;  2CH4 W;  4FYD A;  4A3L H;  5EBC A;  3HKS A;  2PMZ E;  3CC2 A;  1QQT A;  1DM0 B;  5D14 A;  2Z6K A;  5EKI A;  3B6Y A;  5FO7 B;  4G6B A;  2F0L A;  4ALP A;  2M6P A;  4IOA A;  3PIP 3;  1CA5 A;  3BG3 A;  4JI8 Q;  3KOJ A;  2A69 C;  2R7Z G;  2RDG A;  4JI2 L;  1TXY A;  1STE A;  2EY5 A;  2HIV A;  1QVC A;  2JYO A;  2ZT9 C;  4K5X A;  2C35 B;  1BF4 A;  1PFW A;  4JV5 L;  1I6H H;  4K2L A;  5G3L F;  2L0C A;  3S1R L;  4X65 Q;  1PH2 A;  1EU3 A;  5M9O A;  5C3E L;  1QVF A;  3F8T A;  1VQL A;  1K28 A;  3I55 A;  3L3O C;  4P73 A;  5AI3 A;  1F9P A;  4AHZ A;  3BDL A;  2TMP A;  3JAM c;  3GV6 A;  3PO3 G;  2K52 A;  1MGS A;  2XGT A;  3QOJ A;  4C3J L;  4ZAI A;  4X64 Q;  2A74 C;  1S3O A;  1SXT A;  3SR1 A;  3MSU A;  3KJO A;  2YTY A;  1B2O A;  3Q8D A;  1B9N A;  2SOB A;  3F1Z A;  3KK7 A;  4MN3 A;  2UUA L;  1XNQ L;  1LUZ A;  4HJ5 A;  2F0F A;  4KN7 C;  2F0E A;  4KY6 A;  1TWA L;  3S9W A;  2DGY A;  4UP8 A;  4DR1 Q;  2ZJP A;  4TPU A;  3RD4 A;  3GTP L;  1JOK A;  2HDL A;  5C3E H;  5LMN L;  1R0F A;  4DAV A;  1EIY B;  2HDM A;  2E5L Q;  2FFK B;  1B8A A;  1DOK A;  2KEN A;  1AN8 A;  1BO0 A;  1BUV T;  2ATW A;  1LTB D;  1DXM A;  1NSN S;  3FPU B;  4GNX A;  4GKJ L;  2HD3 A;  4FF2 A;  4XGH A;  2QDL A;  2F0O A;  1SFO B;  1L0W A;  1FJG L;  2XIW A;  1XX8 A;  5LL6 X;  1B13 A;  2JA5 G;  3M4O B;  4BXX G;  2FHT A;  3RNU A;  3HRZ C;  3RZD B;  3GTP B;  3SGI A;  1O80 A;  3VYS A;  4X65 L;  2EYM A;  3P7J A;  4DAY A;  2N3S A;  3KYV A;  1X32 A;  3QVD A;  2XSC A;  3TS2 A;  2KBN A;  1EZ8 A;  3GTM H;  2AQ2 B;  5C5M A;  4DV7 Q;  4A3E L;  4KD3 A;  3NFP I;  4A3D H;  3GTQ L;  1I4X A;  1HZC A;  2R92 L;  3FHW A;  2JXM B;  4AQY Q;  3TSS A;  4K5W A;  4GOP C;  4JBW A;  3H99 A;  1ZXT A;  2R6G A;  1WTQ A;  5CBE E;  4KI0 A;  1I50 B;  5C0X J;  3V05 A;  1VQ9 A;  5C4X H;  4L5Q A;  4DAP A;  1R9T L;  2A19 A;  2P5Z X;  2GVA A;  3F2C A;  2M4Y A;  4RA8 A;  1R0I A;  2RDF A;  2C9O A;  4PMC A;  3A55 A;  3N6R A;  1Y14 B;  3I70 A;  4P74 A;  4IO9 A;  1XMO L;  1QG7 A;  4KKS A;  2R93 G;  4J6H A;  5FLX L;  2H4O A;  1VQ8 A;  2XWJ B;  3BU2 A;  4XXB B;  3NEL A;  1FHM A;  2ZM6 L;  1STA A;  4XTC S;  3MXP A;  1SSO A;  2JA6 B;  4BY1 B;  4RCO A;  1Z6H A;  4DR6 Q;  3GTK H;  2BE5 D;  2KCC A;  5EJW A;  4DV5 Q;  1CTM A;  2Y0S G;  4DNR B;  1Z7T A;  4DA2 A;  3I4N L;  1VCX A;  2F0U A;  1XTD A;  4C3I B;  4AR3 A;  2A68 C;  2K5D A;  2QCP X;  1X3G A;  1W2B A;  3IFT A;  4DUZ L;  4A3G H;  1XPO A;  4P75 A;  3ZJY C;  4X66 L;  2KJX A;  1LKM A;  2ZTC A;  2B63 B;  3RZ6 A;  3HOY H;  1HA6 A;  1SMY D;  2UUC L;  4LFA Q;  1KAA A;  4GLX A;  4LF6 Q;  1H95 A;  3FKI G;  4CJ1 B;  1SFO H;  1F4L A;  5LMN W;  2Y0S B;  2M4V A;  3J80 L;  2J9U B;  5DNF A;  4OEL B;  3CRL C;  1V8Q A;  3I4N H;  5AI2 A;  1CT1 D;  1I50 L;  2B2T A;  1VQI A;  3O13 A;  4CDE C;  2PQA A;  1FNW A;  1GUN A;  3RZO L;  5EQ0 A;  2Z1C A;  1F2M A;  2NB0 A;  5IT9 E;  5C4X G;  1YVC A;  3ZG6 A;  1JWM D;  1W3S A;  4LUO A;  3GTQ B;  2XRQ D;  3JR7 A;  3K57 A;  1Y8O B;  5CV5 A;  1FL0 A;  3K80 C;  1YJ9 A;  4P71 A;  3GTJ H;  1LT5 D;  4P2C B;  1PTO D;  1N33 Q;  1PH1 A;  5MFZ A;  4C3H B;  1P7P A;  1VQA A;  4POF A;  3NWT A;  1ZKO A;  5HUR A;  4LF5 Q;  1R9T H;  3PSI A;  3C2P A;  1DX8 A;  2NZ1 D;  4JI0 L;  4IUP A;  1PTO F;  1BCP D;  2V3B B;  1L0X B;  2DN8 A;  2K28 A;  2PMZ P;  3T13 A;  4AR5 A;  2EJM A;  4BXX H;  5MF6 A;  1VS0 A;  2VUM H;  3M3Y H;  2RBM A;  2V0E A;  1KDC A;  3J81 j;  4ZUI A;  3Q24 A;  2E2D C;  4UAI A;  3BVM A;  2VQE L;  3K81 C;  2A6H D;  4RGO S;  4DV2 Q;  4I7Z C;  1STB A;  4DFA A;  1TQO A;  3QB3 A;  1A0I A;  3MXN B;  1V43 A;  5E4X A;  4C3J B;  1N34 L;  1QJO A;  2UUA Q;  4OGQ C;  3KF8 B;  3Q0A A;  4TSS A;  4UP7 A;  3DM1 A;  1WFQ A;  3HJY B;  1HUM A;  4ME5 A;  1KHI A;  1UE7 A;  1VZG A;  5CGK A;  1VQE A;  4DR5 L;  2VNU D;  3MZ5 A;  2Q2I A;  4KMU C;  4IN3 A;  5LL6 S;  1B2J A;  1X65 A;  4OO1 I;  3BDO A;  3NTI A;  1HPC A;  1S5F D;  1HNX L;  2EYO A;  3E0E A;  1KQS A;  2E5L L;  1E1O A;  2UXD L;  5EPK A;  4NP5 A;  3SXH A;  4LF4 L;  5M3M G;  1WCM B;  2E2I B;  1CZG A;  4IPG A;  4OO1 G;  2XJR A;  3LPE B;  3X3N A;  3SVM A;  2K1B A;  3BYT B;  3HOX L;  3CU7 A;  3MHB A;  1UEB A;  2O5I C;  1SBB B;  1GUT A;  3U4Z A;  3S17 H;  1HTP A;  3T1H Q;  1PZJ D;  4LF5 L;  1JOR A;  2PZT A;  1SNQ A;  4RXN A;  1VQ5 A;  1A2U A;  4KN4 C;  1RIP A;  1EY5 A;  3HOW L;  4A3J H;  4EVO A;  3RZT A;  3UDF A;  4KY5 A;  2ERS A;  3AFQ A;  1B9M A;  2RDV A;  5J1Z A;  1P16 A;  4LF9 Q;  4DV7 L;  2N78 A;  5EPJ A;  3MEF A;  2JA7 G;  2JA8 G;  1Q8I A;  1EIG A;  3B08 B;  3AU7 A;  5EIN C;  3EQL C;  1YUX A;  3CD6 A;  3H0G H;  4RGN A;  2O2L D;  5KEE A;  3WOE A;  1LM0 A;  3BZD B;  4A3L G;  4G7H C;  5DM6 3;  1I6H L;  4XQQ A;  2MGS A;  1WTR A;  4XXE A;  5E1F A;  5I9P A;  1WTV A;  3RLN A;  3NQT A;  4GKK L;  4GLV B;  1GHJ A;  1XMQ L;  1VZI A;  2X6G A;  1WOC A;  5IGG A;  2UXD Q;  3M3Y B;  2VUM B;  1LAB A;  2NVQ L;  3PL5 A;  4A3M L;  4M1U B;  5CYU A;  1ZEQ X;  2VW9 A;  1JB3 A;  3S1M H;  3ULP A;  4FDB A;  1PFN A;  1IKM A;  1FNU A;  3EVQ A;  2CW0 C;  3H91 A;  2ZXP A;  3HJW B;  1K8A C;  5IYB H;  3KYU A;  5G3L D;  3FDJ A;  1HNZ Q;  4DR6 L;  5BN4 A;  2MO1 A;  1TU2 B;  4JCV E;  4DV4 Q;  1I6H B;  1Q12 A;  3UE0 A;  1STG A;  3WOF A;  3S14 L;  1GD7 A;  1Q7Y C;  3PO2 L;  4R4C A;  5C3W A;  3HP3 A;  1B3Q A;  1EU4 A;  3H6M A;  4AHX A;  1MIU A;  3S15 H;  1RKN A;  1EQV A;  1V1O A;  1C48 A;  4X66 Q;  3VYR A;  3KBG A;  4HIO A;  3CCM A;  4F87 A;  5CC4 A;  3DMU A;  2IHE A;  4LFA L;  1YBY A;  3E0J A;  4OWX B;  2JI3 A;  2RVL A;  1YHQ A;  2A8V A;  3BJU A;  1M1K C;  2L11 A;  4B3R Q;  4O1N A;  5IWA L;  5IIF A;  2EY2 A;  2RDH A;  4MNO A;  5IP9 G;  1G91 A;  4NXM L;  3M9B A;  4DK0 A;  4KHP L;  4A3C L;  5HY6 A;  1YHA A;  5JVG 3;  2YU9 H;  3S1M L;  1EY8 A;  2EE1 A;  1XMQ Q;  4DR4 Q;  3S15 B;  5GAG c;  4NXN L;  3H15 A;  1HH2 P;  1F2Z A;  4YWL A;  3K5M A;  4JW0 A;  1WYD A;  4KHZ A;  1OXX K;  4JOI A;  4F88 A;  3GTO B;  5JEA G;  1N33 L;  5IP7 L;  1SYE A;  4ID6 A;  4Z9C B;  2BDO A;  4WJ3 M;  1X54 A;  3BVZ A;  1K83 H;  1SLJ A;  4DV4 L;  3K5N A;  4OIJ A;  4A3B L;  1VQ7 A;  4GS3 A;  1X9N A;  1NAP A;  1IBK L;  1SE3 A;  2A5H A;  1FGB D;  1Z47 A;  4DV3 Q;  4JYA Q;  2B8G A;  3ERO A;  4S3S A;  2I5H A;  1L2F A;  1S5B D;  2JN4 A;  2NN6 G;  1LTL A;  1JOO A;  1RDG A;  3M4P A;  2PPB C;  1S2Z A;  2HCI A;  2N49 A;  2O5J C;  1F2L A;  1WVL A;  1GUW A;  2HQE A;  4B9W A;  1OWB A;  4QCL A;  1IKL A;  3GTL H;  3KLS A;  4RH6 A;  2VQE Q;  3HOW G;  1D1K A;  5FLM G;  2JA9 A;  3CC4 A;  1AEX A;  2EXD A;  2RSO A;  2EVB A;  5DM7 3;  4F7X A;  3TZD A;  4IFD G;  1LO5 D;  4DR5 Q;  1CUK A;  3MTS A;  3DXJ C;  4HAE A;  4KHP Q;  5H1S E;  2JI2 A;  4POG A;  5FK9 C;  2NTS A;  3DEP A;  4Y52 L;  3HOU B;  4DN4 M;  1ENC A;  2ZTE A;  4LF7 Q;  3UDI A;  4NXN Q;  1QCV A;  3VYU A;  2E2I H;  1CKO A;  3FP9 A;  3IAY A;  3FMC A;  3L2P A;  2VQF Q;  3K8A A;  1N36 Q;  2AMC B;  2PZU A;  4IJL A;  4JC0 A;  1EYC A;  3TP6 A;  4AYB B;  2AWO A;  2K5W A;  4QIW B;  3V96 A;  2B63 G;  2WKC A;  1I4R A;  2B63 H;  3K59 A;  2KHS A;  1XPR A;  1NBW A;  2Q8T A;  4WFN 1;  2B2T C;  1HXY D;  4K5V A;  4B3T Q;  3QOL A;  5AFW A;  1WD1 A;  1S4Z A;  1LTA D;  4PZ8 A;  1RYT A;  3M4Y A;  4DGZ A;  5JPN C;  1PH3 A;  1BR9 A;  1Y1V G;  4AI2 A;  2KEC A;  4LK1 C;  3CQZ H;  1PH6 A;  2CH4 A;  3I73 A;  3QR8 A;  2L15 A;  3TRE A;  1EY6 A;  2DNC A;  3S16 B;  1LLR D;  1Y8P B;  3QIA A;  3UDX A;  4X6A H;  3WDN A;  3URY A;  5CV6 A;  1VQH A;  5JEA J;  1PYW D;  1U4P A;  3D4R A;  4LWC A;  2L55 A;  2E2H B;  2V0F A;  3AMU A;  4FXK C;  4TVA B;  3PGZ A;  1YNX A;  2BH8 A;  1T9H A;  3X3M A;  1K0S A;  2AYJ A;  2PZW A;  1ASZ A;  1WD0 A;  1F2Y A;  1CFM A;  5FLM H;  4C56 C;  1O7I A;  1HA5 A;  1GM5 A;  5CMD A;  1LTG D;  2GVB A;  3PQI A;  3OMC A;  1QZH A;  4ZK9 B;  3CCV A;  2WB1 P;  1SYB A;  1TWG L;  4Y52 H;  4DR2 L;  4IUN A;  2WIN B;  3P2A A;  2KQ3 A;  3Q6S A;  5M5X B;  1ICW A;  1EEI D;  4UDU C;  2KVM A;  5EIO C;  5KYI A;  1EL0 A;  4A3C G;  2SNS A;  1WTW A;  1FHH A;  3NQI A;  2MQH A;  3A8I E;  2D2C C;  4JI4 L;  1Y1W H;  4FNF A;  3JAM L;  3STB C;  2F1M A;  1HNZ L;  3CCQ A;  4Q0F A;  1KLU D;  4HCE A;  3HOV B;  1Q90 A;  4QF4 A;  1FGU A;  3PO3 H;  3MFY A;  2E2H H;  1TT2 A;  2NZH A;  1ZYR D;  1OXS C;  2QIL A;  4UY8 1;  4BA1 I;  3EA6 A;  4G4K A;  1RL2 A;  3CHB D;  1SEB D;  1CKN B;  5CV4 A;  3MAQ A;  5IP7 G;  1P8L A;  2MO0 A;  4J1M A;  5JVH 1;  2LXJ A;  2NUC A;  1YJN A;  1IBM Q;  1CHP D;  1J9O A;  2KA7 A;  1A15 A;  1HTL D;  4L8J A;  4A3F L;  5C4H A;  1S24 A;  3KYY A;  1H9S A;  1BFY A;  2L5T A;  3FEW X;  4A3I G;  1X3P A;  3RZO H;  3HGB A;  1EYD A;  2YYZ A;  2M6O A;  1HUN A;  1HCZ A;  3N52 A;  4O42 A;  3CME A;  1YNN C;  3TP8 A;  2QDB A;  3A8K E;  4UHV A;  1RDV A;  1I50 H;  4A93 H;  1B3A A;  1VQG A;  1T9P A;  1CKM A;  3UE1 A;  3M7N A;  1PH9 A;  2XJT A;  4RGM A;  1SMY C;  5DEH A;  5FJ8 G;  1DD2 A;  1SFO L;  1XTC D;  1DJR D;  2B2W A;  2EJF C;  4TRD A;  4A3E B;  1D7Q A;  3U9S A;  5FJ8 H;  1IBL L;  3DLL A;  2VL6 A;  4JI3 Q;  4A75 A;  1TWC L;  1KDA A;  5AJ3 L;  4A93 G;  2N55 A;  2JEB I;  3QO2 A;  2K7V A;  4NMZ A;  4GN4 B;  1PA6 A;  1X56 A;  5KRU A;  5C4X L;  3PO3 L;  1B71 A;  4AYB P;  1HQM C;  2EJG C;  2L9H A;  4UPA A;  3FRP B;  3AQQ A;  3HOZ L;  1RDP D;  3PUW A;  2O5J D;  5D65 A;  1B7Y B;  3KYW A;  3TME A;  4M8A A;  1XNR L;  4Y7N L;  3LGJ A;  1S40 A;  4A3E H;  1IHZ A;  2EYL A;  3G6J B;  1SNO A;  3SS2 A;  2CKZ B;  5C4J H;  4DNT B;  1TWG H;  3M7G A;  4IUR A;  2KOL A;  2ICI A;  1BCP F;  4JI5 L;  1O7L A;  1VQD A;  1DVB A;  4DAM A;  2RSN A;  3KBX A;  1TWA B;  3OIP A;  4R9W A;  2K5H A;  2XTI A;  5FLX c;  4BWG B;  3J7Y 1;  2WAQ G;  1B50 A;  5J22 A;  4HED A;  4OO1 H;  5IYC L;  3OTO Q;  4DR3 Q;  1HNW Q;  1PFB A;  1II3 A;  3G48 A;  2NVQ H;  3BZC A;  1RYQ A;  5A2Q L;  4A3I H;  1R4Q B;  4IPD A;  4QB4 A;  1VQ6 A;  4U67 3;  2PNR C;  5E3F A;  5EPL A;  2ZJQ A;  4X62 Q;  3MPS A;  2NWG A;  2MJ8 A;  4JBK A;  1IL8 A;  2VZA A;  3D8G A;  3ND9 A;  5KNB A;  4LF7 L;  3K7A B;  1OXU A;  2Q8I B;  3H94 A;  2HHH L;  3GTQ H;  3CQZ L;  3HOY G;  4MZ9 A;  2I5L X;  2UXC L;  3KUP A;  3GTM L;  2VQF L;  5K5P A;  5I6Y A;  3D4W A;  1N36 L;  1EWC A;  3E9H A;  1BQ8 A;  2F0J A;  2A73 B;  1VQP A;  1FNV A;  3PWF A;  3GTO L;  1TWA H;  4CGY B;  4DV6 Q;  1S5E D;  3E9I A;  4B3M Q;  2N8N A;  3I4M G;  2Q2T A;  4BY7 H;  4ILW A;  1L0Y B;  2B2V C;  4LJZ C;  4ULL A;  2J7Z A;  4B3S L;  2F52 A;  5K2M E;  1D5M C;  1O7Z A;  1TR5 A;  3EJI A;  4NKL A;  5K36 H;  2VXW A;  1Q86 C;  4RKL A;  3TP7 A;  3NP8 A;  1A2T A;  3RLO A;  1WTO A;  2NVT H;  4HCS A;  1YEZ A;  3DM3 A;  1E24 A;  5KNC A;  4JAD A;  3ND8 A;  3SE0 A;  3H3V H;  2AQ3 B;  1VMC A;  3PO2 B;  1AE3 A;  4KV6 A;  1V1P A;  5EAY A;  1KLG D;  3HOX H;  2F0P A;  4LMQ D;  1WTX A;  1BRF A;  1CK1 A;  1R9T B;  4J8Q A;  3GTP H;  4RWS C;  4WJW A;  4MHE A;  5I2X A;  3TRZ A;  1UUP A;  3L7Z C;  3I7F A;  2LCQ A;  3GTG L;  3JAM E;  2Z9H A;  3VA7 A;  4A3F G;  4J15 A;  1YV1 A;  2OXP A;  2G9H D;  3D6C A;  3G7L A;  3GO5 A;  4PZ7 A;  2NVX H;  1VF7 A;  1JE5 A;  1RWD A;  1DYQ A;  1HZA A;  3K5O A;  4YHH Q;  1KRS A;  1IW7 D;  1STH A;  2A6H C;  4BY7 L;  5ISR A;  2M9V A;  4A3L L;  2FXQ A;  1E2Z A;  3JC6 3;  3ULJ A;  1NUC A;  3CCJ A;  1G51 A;  4GKJ Q;  2XJP A;  1BE7 A;  3K7U C;  4CBV A;  1JIC A;  1K83 L;  3T56 B;  4DV6 L;  2QL0 A;  1N32 Q;  2K04 A;  3I2Z A;  4H0L C;  5IYD G;  1LV9 A;  2N88 A;  1PTO B;  1EY4 A;  3S1R H;  3OPO A;  3PMF A;  3PCO B;  4X3K A;  5IP7 H;  4JI7 L;  5FOB B;  2NN6 H;  2VUM L;  3M3Y L;  4QL5 A;  2MHV A;  2CQA A;  5MFP A;  1FVI A;  4DUY L;  1QB5 D;  4R8N A;  1LKP A;  1D5X C;  1BCP B;  3H09 A;  1KL9 A;  1X55 A;  1HFN A;  3S2D B;  2EYP A;  3C46 A;  1E0B A;  2K6A A;  5IYC H;  3HOV L;  3HOZ G;  3J7Z C;  2KEE A;  3I4N B;  4RHS A;  2JK8 A;  4K6L A;  4AQY L;  3J7Y W;  1EWI A;  4CDF C;  2F0G A;  3DHQ A;  4DR7 L;  1TS2 A;  4AR4 A;  1HHV A;  3PUX A;  3GTK B;  3P75 A;  4EQ5 A;  4U67 1;  4BY1 L;  5CR3 A;  1KTK A;  2BCO A;  1A6X A;  5C4J L;  4CKB A;  1PH4 A;  2B2V A;  4OX9 Q;  3ERQ A;  4HTH A;  1VQB A;  1I5F A;  4WRD A;  4AYB G;  2D0O A;  1EIF A;  4HJA A;  4JI6 L;  4QUC A;  4A3G B;  4Y7N H;  1IU5 A;  3H3V M;  1H9R A;  4YHH L;  4NW2 A;  5IP9 L;  1MJE A;  2NN6 I;  3AB9 A;  4GS7 D;  1TS5 A;  3CCE A;  2F4V Q;  3HOZ H;  4RAU C;  2EY1 A;  5C0X G;  2ICE C;  4A3G G;  2AHO B;  3PF4 A;  1H9S B;  3LWQ B;  2ZM6 Q;  3U50 C;  3PO2 H;  3TDQ A;  5HGT A;  5T1I A;  4JI8 L;  5JPM C;  3GDE A;  2AUJ D;  3HOX B;  2IX0 A;  3S1R B;  1OXT A;  1CKN A;  2WB1 B;  4X3T A;  1WJV A;  2YV5 A;  1LT4 D;  1QZG A;  2K75 A;  1TWC H;  2HT1 A;  1PH5 A;  5JEA H;  1JMC A;  1GVP A;  2K33 A;  5C44 G;  3EN2 A; 
#chains in the Genus database with same CATH homology
 2D0P A;  4GKK Q;  1C09 A;  3AYH B;  2MS3 A;  1XMQ Q;  3BZK A;  4DR4 Q;  4RMF A;  2IX1 A;  4A76 A;  3F2D A;  2ES2 A;  2ERJ A;  5GAG c;  2CKC A;  1UWV A;  3KYH C;  4NXN L;  3H15 A;  1HH2 P;  1JJ2 A;  4YWL A;  5LMU Q;  5MLC 3;  4KHZ A;  1WYD A;  1QVG A;  4X64 L;  4H02 A;  2CQO A;  1OXX K;  1BBW A;  2I0Q A;  5BR8 Q;  4JOI A;  2UUC Q;  1OWC A;  2R93 H;  1ASY A;  1HR0 W;  5JEA G;  4JI5 Q;  1N33 L;  4QIW E;  3UDG A;  1XPU A;  4E6Y A;  2AKW B;  4QGU A;  1XNQ Q;  4AYB E;  4DNI A;  2AWN A;  4HJ9 A;  4A3K H;  3VPB E;  1SR3 A;  1X54 A;  4WJ3 M;  1K83 H;  1SLJ A;  1YZ6 A;  2EQS A;  1QYB A;  4DV4 L;  4PG3 A;  1HZ9 A;  4DR3 L;  1PYS B;  2F3I A;  3OW2 A;  1OTC A;  4LF8 Q;  4ZN3 B;  1NE3 A;  2V1C C;  1VQ7 A;  1SMU A;  1BBU A;  4GS3 A;  1X9N A;  4JI0 Q;  1ODH A;  2K14 A;  2ASB A;  2Z3Q B;  4BY1 H;  1RB9 A;  1IBK L;  4JI6 Q;  4XIG S;  2PI2 E;  3HOU H;  4DV0 Q;  5JJL A;  1Z92 B;  4DV3 Q;  1Z47 A;  4JYA Q;  1YJW A;  4A3L H;  3EIV A;  2MNA A;  2I5H A;  5M5X H;  1L2F A;  4C2M H;  3HKS A;  4LNQ A;  2PMZ E;  2NN6 G;  1LTL A;  4AI1 A;  2IY5 B;  1RDG A;  3PIO A;  3CC2 A;  3M4P A;  1S2Z A;  1KAW A;  3PV0 A;  2N49 A;  2Z6K A;  3B6Y A;  1OWB A;  2OQK A;  4G6B A;  4DK6 C;  3GTL H;  4ALP A;  2M6P A;  4JAG A;  2VQE Q;  4ZN1 B;  3HOW G;  2PYA A;  1N34 Q;  4JI8 Q;  5FLM G;  3KOJ A;  4IFD I;  2R7Z G;  5M3M H;  4JI2 L;  1TXY A;  2JA9 A;  2HIV A;  3CC4 A;  1QVC A;  2EXD A;  2WFW A;  1IRO A;  4NXM Q;  1VQK A;  2C35 B;  3A0J A;  4JV5 L;  3PKI A;  2R92 H;  4IFD G;  1I6H H;  2PQA B;  4LUZ A;  1EUJ A;  4DR5 Q;  3OTO L;  1CUK A;  3TS0 A;  4X65 Q;  3KF6 B;  1PFS A;  1PH2 A;  4KHP Q;  1QVF A;  5C0X I;  3JC6 6;  3F8T A;  5H1S E;  1K8G A;  3J81 i;  1Q8K A;  1VQL A;  2JI2 A;  2WAQ E;  3I55 A;  4POG A;  4P73 A;  5AI3 A;  4RG1 A;  2JA6 G;  2K2D A;  3NBH B;  4AHZ A;  4X62 L;  1QUQ B;  4DR4 L;  3JAM c;  1JJC B;  1LYL A;  2ZTE A;  3PO3 G;  4LF7 Q;  2K52 A;  3UDI A;  1QCV A;  4NXN Q;  2XGT A;  2E2I H;  5M5Y H;  4GNX C;  3T1Y L;  2XJQ A;  3K35 A;  1CKO A;  1S3O A;  4X64 Q;  1HNZ Q;  1NJI C;  1OXV A;  1D8L A;  3FP9 A;  2Q2H A;  4R4O A;  1IL2 A;  3MSU A;  3IU3 I;  3L2P A;  3CAM A;  2VUM G;  5C3E G;  4YWM A;  2VQF Q;  3K8A A;  3KJO A;  2YTY A;  1EQQ A;  2AMC B;  1N36 Q;  4IJL A;  4JC0 A;  2Q2U A;  1B2O A;  3Q8D A;  4UP9 A;  2AWO A;  3F1Z A;  4PMW A;  4EX5 A;  2UUA L;  1XNQ L;  6RXN A;  1LUZ A;  4C3J H;  3M4O H;  4HJ5 A;  5GAD C;  4K9F A;  3RZD H;  1YIJ A;  2B63 G;  4QQB X;  2WB1 G;  3GTG H;  3G71 A;  2B63 H;  2DGY A;  1NBW A;  4UP8 A;  4WFN 1;  4DR1 Q;  1XPR A;  3S1Q H;  2ZJP A;  4B3T Q;  4TPU A;  1KXL A;  4PZ8 A;  1RYT A;  1PH3 A;  5C3E H;  5DM6 1;  1Y1V G;  5LMN L;  1R0F A;  4AI2 A;  2K4K A;  4DV3 L;  3CQZ H;  3A74 A;  3I4M H;  1JB7 A;  1WCM G;  1PH6 A;  1EIY B;  1HNX Q;  3H3V I;  2E5L Q;  3JC6 2;  2YTX A;  1H7V A;  1B8A A;  3CXC A;  1IBM L;  5J3B A;  3S2H H;  2KEN A;  2L15 A;  3TRE A;  2ATW A;  4TVM A;  2Z3R B;  2OQ0 A;  3CF5 A;  4X6A H;  3UDX A;  4JBM A;  4AH6 A;  4AI0 A;  4YY3 L;  4GNX A;  4A3K G;  1VQH A;  5JEA J;  4GKJ L;  4XGH A;  1VZH A;  1I3Q H;  1L0W A;  1PHJ A;  1FJG L;  1VQC A;  4LWC A;  4AIM A;  1B13 A;  2JA5 G;  1N32 L;  1SMM A;  2V0F A;  4BXX G;  4DV5 L;  4TVA B;  4AR6 A;  3PGZ A;  1YNX A;  2BH8 A;  1T9H A;  3RNU A;  4A3E G;  2AYJ A;  4JAE A;  1ASZ A;  4APV A;  3SGI A;  4X65 L;  2R92 G;  4JI7 Q;  2JI1 A;  1Q1E A;  5FLM H;  3W5O A;  1M90 C;  1O7I A;  2JJQ A;  1SRU A;  2N3S A;  1GM5 A;  3KYV A;  3PUZ A;  3QVD A;  2MFI A;  3PZA A;  2GVB A;  1QZH A;  3GTO H;  4QY7 A;  1EOV A;  3CCV A;  1X3E A;  4DUY Q;  3JAM i;  1VQ4 A;  4Y52 H;  4DR2 L;  4A3B H;  4DUZ Q;  1GO3 E;  3TS2 A;  3L0O A;  3HKZ E;  2KBN A;  1ZRP A;  3P2A A;  1YUZ A;  4A4I A;  3GTM H;  4JI3 L;  4LF9 L;  4ME3 A;  3J80 c;  4DV7 Q;  2UU9 L;  5GAE C;  1NTG A;  3PIP A;  3NFP I;  4A3D H;  5JJK A;  4YCU A;  1E1T A;  1HZC A;  1IXR A;  1B70 B;  5EIO C;  1U5K A;  3HOU G;  4A3C G;  1T9O A;  1FHH A;  5RXN A;  2CWP A;  3FHW A;  4AQY Q;  1PH7 A;  1GKH A;  2MQH A;  1IZ6 A;  4GOP C;  4JI4 L;  4JBW A;  4P72 A;  1Y1W H;  4HID A;  4DR7 Q;  2R6G A;  3STB C;  1HNZ L;  2XJU A;  3CCQ A;  1UE6 A;  4KI0 A;  1FGU A;  2HR5 A;  5C0X J;  1Q82 C;  3PO3 H;  2E2H H;  1VQ9 A;  3ULL A;  5C4X H;  4L5Q A;  4DR1 L;  4OX9 L;  2NZH A;  2UUB L;  1TWF H;  2A19 A;  5M3F G;  4B3T L;  1OXS C;  2GVA A;  3F2C A;  2M4Y A;  4UY8 1;  2LXK A;  4BA1 I;  1LKO A;  1R0I A;  1Y14 B;  1RL2 A;  4A3C H;  4GLA C;  1CKN B;  4IJH A;  3G4S A;  4P74 A;  4DV1 Q;  3KFU A;  5IP7 G;  1Y1V H;  4IO9 A;  1XMO L;  1P8L A;  2MO0 A;  3RR5 A;  3J7A 5;  5JVH 1;  2LXJ A;  2R93 G;  1VCI A;  1YJN A;  1VQ8 A;  1IBM Q;  3I4N G;  2OTJ A;  1K3R A;  1VQN A;  3BU2 A;  2CWA A;  4XXB B;  2DSX A;  3CC7 A;  1XJV A;  3NEL A;  1YHB A;  1FHM A;  2ZM6 L;  1S24 A;  3KYY A;  2ALY B;  2EIF A;  4XTC S;  1BFY A;  3I4O A;  4TQU S;  5GQO A;  3CW2 C;  4YY3 Q;  2Z0S A;  4A3I G;  2QEX A;  2IT1 A;  3RZO H;  2YYZ A;  4MTN A;  4HJ8 A;  2M6O A;  4GN5 A;  3CME A;  1I94 L;  4DR6 Q;  3GTK H;  2BE5 D;  1SRO A;  4DV5 Q;  2Y0S G;  1RDV A;  1I50 H;  5DLQ E;  1EQR A;  4A93 H;  2K5V A;  1VCX A;  1VQG A;  4B8C D;  1T9P A;  1XTD A;  1C7Y A;  1A63 A;  1CKM A;  3UE1 A;  3OYY A;  4AR3 A;  2XJT A;  1PH9 A;  3M7N A;  2XJS A;  1SMW A;  1CSP A;  5FJ8 G;  1X3G A;  4AHY A;  1R0H A;  1W2B A;  3S14 H;  1VQM A;  1KRT A;  4DUZ L;  4A3G H;  1XPO A;  4L5R C;  1D7Q A;  1IBL L;  5FJ8 H;  4P75 A;  3ZJY C;  3DLL A;  5GAE c;  4L5T A;  4X66 L;  1HNW Q;  4R4T A;  2UXB L;  1LKM A;  2VL6 A;  4JI3 Q;  4A75 A;  3PUY A;  2ZTC A;  4JI1 Q;  3RZ6 A;  2F4V L;  3HOY H;  5AJ3 L;  2HHH Q;  4R4Q A;  1PYB A;  4LFB Q;  4A93 G;  2JEB I;  2UUC L;  1K0R A;  1L1O A;  4C3I H;  4LFA Q;  1PVO A;  3M4Q A;  4GN3 B;  4GLX A;  4LF6 Q;  2XJV A;  4GN4 B;  4DV2 L;  1PA6 A;  3HOV H;  4YWK A;  2OWO A;  1H95 A;  3FKI G;  1IRN A;  4C3H H;  1X56 A;  4HIK A;  4A3M H;  1SFO H;  1SMX A;  4B3R L;  2GN5 A;  5LMN W;  5C44 H;  2M4V A;  2JEA I;  2J9U B;  1EYG A;  2RHS B;  1B71 A;  1JT8 A;  4B3M L;  1X3F A;  4UPA A;  3I4N H;  1YK5 A;  5AI2 A;  2B5I D;  3AQQ A;  5ELO A;  3PUW A;  1NMG A;  2O5J D;  2WB1 E;  4YCV A;  1B7Y B;  1IBK Q;  3KYW A;  3TEH B;  2OCE A;  1VQI A;  2VY3 A;  2JA5 H;  1XNR L;  2PQA A;  2L0Z A;  1N9W A;  2VS1 A;  4B3S Q;  2NVY H;  4IPC A;  3LGJ A;  1S40 A;  4A3E H;  1E8J A;  3PKJ A;  5C4X G;  1YVC A;  3ZG6 A;  4V19 6;  4BA2 I;  1W3S A;  4LUO A;  3SS2 A;  2CKZ B;  4BBR H;  5LMU L;  1BQ9 A;  4LF4 Q;  3IRB A;  1S30 A;  4JOI C;  3WWN B;  5C4J H;  1TWG H;  4OON A;  1FL0 A;  4BBR G;  1R0G A;  3K80 C;  5BR8 L;  1YJ9 A;  4P71 A;  3GTJ H;  1KC8 C;  5IY0 A;  4JI5 L;  3W1B A;  1VQD A;  1DVB A;  4DAM A;  1PH1 A;  1N33 Q;  2KCM A;  1G29 1;  2K5H A;  2XTI A;  5MFZ A;  1K9M C;  5FLX c;  3J7Y 1;  2WAQ G;  4GOP A;  2H12 A;  3M85 A;  1VQA A;  4POF A;  4LF5 Q;  1WJJ A;  1R9T H;  3OTO Q;  3RN2 A;  3PSI A;  4DR3 Q;  4L5S A;  4LF8 L;  2NZO A;  1HR0 Q;  4LFC Q;  5DM7 1;  3G48 A;  1DX8 A;  2NVQ H;  3BZC A;  1RYQ A;  4A3I H;  5IYD H;  4JI0 L;  4IPD A;  1VQ6 A;  1DGS A;  4JG2 A;  2V3B B;  2ZJQ A;  3H0G G;  4X62 Q;  2ZTD A;  3MPS A;  4DV0 L;  1KIX A;  4DK3 C;  1IBL Q;  4IPH A;  2PSM C;  4AR5 A;  4GOP B;  1V1Q A;  2VZA A;  3P8B A;  3CCL A;  4JBK A;  4LF7 L;  4JYA L;  1AE2 A;  5MF6 A;  1VS0 A;  2BH2 A;  2VUM H;  3M3Y H;  5HGQ A;  1OXU A;  2V0E A;  4JI1 L;  3J81 j;  2JA7 H;  2DUD A;  4WJ4 A;  5AJ3 Q;  3CPF A;  5IYC G;  2ZJR A;  2HHH L;  3GTQ H;  4MZ9 A;  3HOY G;  3ICE A;  2I5L X;  3CCS A;  4BBS G;  5GRO A;  2UXC L;  1A8V A;  2VQF L;  3ER0 A;  1NY4 A;  3TQY A;  2VQE L;  1N36 L;  4HJ7 A;  3K81 C;  2JE6 I;  2A6H D;  1IU6 A;  2B3G A;  3E9H A;  4DV2 Q;  4IOA A;  1BQ8 A;  1A0I A;  3MXN B;  1V43 A;  2PPT A;  2PI2 A;  1VQP A;  1N34 L;  2UUA Q;  4JI2 Q;  3EBE A;  3KF8 B;  3PWF A;  1TWA H;  4UP7 A;  1E3P A;  1HZB A;  1WFQ A;  1E7Z A;  4OXP A;  2GMG A;  1KHI A;  1UE7 A;  4DV6 Q;  1VZG A;  3K0X A;  2CR8 A;  3E9I A;  2KHJ A;  2BA1 A;  2N8N A;  4B3M Q;  4BBS H;  1E22 A;  1VQE A;  3K7A H;  4DR5 L;  2VNU D;  3I4M G;  2Q2T A;  4BY7 H;  2Q2I A;  5IE8 A;  4DR6 L;  1B2J A;  1X65 A;  2HQL A;  1S72 A;  2B29 A;  1XNR Q;  3HOX G;  5LMN Q;  4OO1 I;  5AN9 H;  2R7Z H;  4R4I A;  4B3S L;  1A62 A;  2F52 A;  5K2M E;  1JYB A;  1HNX L;  4A3D G;  3E0E A;  1KQS A;  2E5L L;  3G6E A;  3HOW H;  1Q86 C;  2C6A A;  1E1O A;  2UXD L;  3RLO A;  4K0K Q;  2NVT H;  1Q81 C;  3A5Z B;  2H5X A;  4LF4 L;  2QGQ A;  1YEZ A;  3DM3 A;  3KDF A;  1E24 A;  5M3M G;  3J7Z 1;  3T1Y Q;  4JAD A;  4OWW B;  4IPG A;  1NXG A;  3PIO 1;  4A3B G;  2XJR A;  4OO1 G;  3H3V H;  4IFD J;  3LPE B;  5GAH c;  1EFW A;  3CCU A;  1Q1B A;  1AE3 A;  5EAY A;  1UEB A;  3HOX H;  3LNL A;  3U4Z A;  1BRF A;  5E7N A;  4NB3 A;  3S17 H;  2CCZ A;  2K5N A;  3AFP A;  3GTP H;  2NYD A;  2CFM A;  3T1H Q;  4LF5 L;  4BY7 G;  1QUQ A;  3TRZ A;  2Y0S E;  4DKA C;  3S1N H;  1HNW L;  4LFC L;  3L7Z C;  1KD1 C;  5JVG 1;  4RXN A;  1VQF A;  1N8R C;  3I7F A;  1HR0 L;  1VQ5 A;  2LCQ A;  1RIP A;  3B0A B;  2I5M X;  1CAD A;  4OWT B;  4A3F G;  3CPW A;  4J15 A;  4JBJ A;  1YV1 A;  4A3J H;  3RZT A;  3UDF A;  3GO5 A;  2NVX H;  4PZ7 A;  2IHF A;  4DR2 Q;  3RN5 A;  2ERS A;  1JE5 A;  3AFQ A;  1RWD A;  1T9Q A;  2RDV A;  1J6Q A;  1HZA A;  4YHH Q;  2HIX A;  1NMF A;  2BA0 A;  3GD7 A;  1KRS A;  2PVX A;  2A69 D;  1P16 A;  1PH8 A;  4LF9 Q;  1IW7 D;  4KLK A;  4DV7 L;  2UU9 Q;  1MKH A;  1BKB A;  2N78 A;  2FXQ A;  8RXN A;  5JJI A;  3MEF A;  1Z9F A;  5IT9 c;  2JA7 G;  2JA8 G;  3B08 B;  5EIN C;  4O0A A;  3ULJ A;  2UXC Q;  3JC6 3;  3CCR A;  1J5E L;  1YUX A;  3KDF B;  1C0A A;  3NEM A;  1R0J A;  2Z6K C;  3WWL A;  1G51 A;  1V9P A;  4YCW A;  3CCJ A;  1YI2 A;  1UE1 A;  5K36 G;  4IOC A;  4JI4 Q;  4GKJ Q;  2XJP A;  1PV4 A;  3CD6 A;  4JAF A;  2KN9 A;  3H0G H;  3KJP A;  1BE7 A;  3K7U C;  3S24 A;  5IWA Q;  1FJG Q;  2A6E D;  4DPG A;  2E2J H;  4DV6 L;  1N32 Q;  2QL0 A;  2CKA A;  3S2D H;  3I2Z A;  2QA4 A;  5IYD G;  1G6P A;  1C9O A;  1LM0 A;  4R1J A;  3U58 A;  3S1R H;  2JA8 H;  2UUB Q;  4A3L G;  5IP7 H;  3PCO B;  3KF6 A;  1MJC A;  2D62 A;  3HOV G;  4JI7 L;  3PUV A;  3S16 H;  4QL5 A;  1NXE A;  1WI5 A;  4UY8 C;  1TWH H;  2ZIX A;  5MFP A;  1FVI A;  3J80 i;  3RLN A;  3WWV A;  4DV1 L;  4DUY L;  3A5U A;  4GKK L;  5M5W H;  4GLV B;  1XMQ L;  3CMA A;  1LKP A;  1VZI A;  4BY1 G;  1WOC A;  2OTL A;  2YTV A;  2UXD Q;  3STB D;  4K0K L;  1KL9 A;  1X55 A;  2PVE A;  2PNH A;  5GAH C;  3NEN A;  1L1O B;  5IYC H;  2VW9 A;  3S1M H;  5GAD c;  2KKD A;  4FDB A;  3J7Z C;  3ULP A;  3HOZ G;  3HKZ G;  1CSQ A;  4PZ6 A;  4AI3 A;  3U4V A;  2K50 A;  3D0F A;  2JK8 A;  4AQY L;  2E8G A;  1EWI A;  3KYX A;  1K8A C;  4DR7 L;  5IYB H;  3QQC E;  3KYU A;  4LHN A;  4AR4 A;  2LSS A;  1BVS A;  3CP0 A;  3PUX A;  4O2D A;  4U67 1;  7RXN A;  2RF4 A;  1UE5 A;  2A1A A;  4EQ5 A;  1I94 Q;  2MO1 A;  3T1H L;  4LUV A;  4JCV E;  2ID0 A;  4DV4 Q;  1Q12 A;  2RHQ B;  3KLW A;  2KHI A;  3UE0 A;  5GAG C;  4A3M G;  5MGN A;  1PH4 A;  4OX9 Q;  4NPS A;  1GD7 A;  1I5F A;  1VQB A;  2C6B A;  4HIM A;  1Q7Y C;  4R4C A;  1IYJ B;  1AH9 A;  1SN8 A;  2D0O A;  4AYB G;  1VQJ A;  2KCT A;  1EIF A;  4DAY B;  4HJA A;  1YIT A;  4JI6 L;  5H1S c;  4AHX A;  1U0L A;  3FKI H;  1YK4 A;  4LW1 A;  1CAA A;  1MIU A;  5IYB G;  4Y7N H;  5ELN A;  1IU5 A;  3S15 H;  2WP8 J;  4YHH L;  1JJG A;  4X66 Q;  2UXB Q;  4LHL A;  1XMO Q;  1MJE A;  1NNQ A;  2NN6 I;  4GS7 D;  3AEV A;  2RCN A;  5IP9 H;  3RLF A;  3CCE A;  1HJP A;  5C0X G;  3PF5 A;  5M3F H;  4HIO A;  3CCM A;  2F4V Q;  3HOZ H;  2A68 D;  4LFB L;  1L1O C;  4QJF A;  4A3G G;  2AHO B;  4GNX B;  3PF4 A;  3PIP 1;  2IHE A;  1K73 C;  4AHW A;  4LFA L;  1J5E Q;  1YBY A;  3W1G A;  3PO2 G;  2ZM6 Q;  4OWX B;  3U50 C;  2JI3 A;  4A3J G;  3F2B A;  1YHQ A;  4A3F H;  4LF6 L;  2A8V A;  3PO2 H;  3BJU A;  3A44 A;  3ERS X;  1M1K C;  1SE8 A;  2R7F A;  3HFZ B;  4JI8 L;  2R7D A;  4B3R Q;  3GDE A;  5IWA L;  2JA6 H;  2IX0 A;  1OXT A;  4MNO A;  5IP9 G;  3I56 A;  1CKN A;  4NXM L;  3J81 c;  3RYG A;  4BXX H;  4JV5 Q;  2JQO A;  1WCM H;  3M9B A;  1WJV A;  2YV5 A;  1Y1W G;  1QZG A;  1X6O A;  1TWC H;  2K75 A;  3VDY A;  1PH5 A;  2HT1 A;  4KHP L;  1JMC A;  1GVP A;  5HY6 A;  5C44 G;  3EN2 A;  3D31 A;  1YHA A;  1VQO A;  1Q46 A;  2YU9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...