5IY0A

Pfmcm n-terminal domain double hexamer
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
253
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication dna binding protein
molecule keywords Cell division control protein 21
publication title Structure of a double hexamer of the Pyrococcus furiosus minichromosome maintenance protein N-terminal domain.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 72
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5iy0A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iy0A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 5iy0A01
3KYXA 1Q8KA 3M4QA 4R4CA 1JT8A 4R1JA 3UDIA 1TWAH 1CKMA 4JI6Q 3U4VA 2ZTEA 3NEMA 1E1TA 4L5TA 2M4YA 4O2DA 1IBML 4DV2L 1J5EQ 2R93G 2KCMA 3IRBA 1E7ZA 2E2JH 3HOZH 1YIJA 1PH1A 1SFOH 4K0KQ 4P73A 1VQ6A 2KHIA 4A4IA 4BY7H 4JI3L 4A3IG 4BA2I 4JI8L 2UXCL 1EQQA 1HNWQ 4LNQA 2JA6G 4GLAC 3GDEA 1X3FA 1YVCA 3RLFA 3D31A 5C3EG 2XTIA 4A3CH 1DX8A 3L2PA 2OTLA 1LKOA 3KF6A 1YK4A 4OO1G 2XGTA 1JJ2A 4JYAL 4DV0L 1K8AC 3GTOH 2JA8G 3M4PA 1C09A 2AWNA 1WCMG 1TWHH 4WJ4A 4AR4A 5AI3A 4HJ7A 5HY6A 2E8GA 1NNQA 5IYBH 2PVXA 1V1QA 2ZM6L 4QJFA 1HR0W 1K73C 3E9IA 4UP8A 2RDVA 1YHQA 4L5RC 3H0GH 3CCUA 4OXPA 4A3MG 4JI4Q 4JV5Q 4DV6Q 2GN5A 2OQ0A 4GN4B 1S72A 4NXNQ 4JBJA 1ZRPA 3PSIA 3GTKH 2NN6G 4A3DH 3KDFA 1UE1A 5EAYA 4A3BH 1J6QA 5IYCH 1PFSA 1CSPA 1XNQQ 5FLMH 1SE8A 1CADA 2B3GA 1OXVA 4GNXB 4B3SQ 1GVPA 3FHWA 4DK6C 2HIVA 5LMNW 4JI5L 3I55A 1L1OC 2VY3A 1HNXL 1SMWA 1OXUA 1PHJA 1VQ7A 1A8VA 1LKMA 1S30A 2Y0SG 5JEAJ 1XNRQ 2R92H 1GO3E 4P71A 1B8AA 4XIGS 1RL2A 2AWOA 4B3TL 1O7IA 4UPAA 5IP7H 3DLLA 1K9MC 1UE6A 3L0OA 4L5QA 1T9QA 5JEAG 4JI2L 4A93H 1WOCA 2GVAA 4B3RQ 1N34Q 1L1OA 2R93H 1QUQB 1N8RC 1FL0A 4R4QA 3CAMA 1Q1EA 4BY7G 5GROA 3PZAA 2MQHA 4IJLA 2D62A 3NENA 4KHZA 5C0XG 3F2CA 3S1QH 4DV1L 1N32L 4P74A 1CKNA 4LF4Q 1EIFA 2BH2A 2PVEA 2F4VQ 4LUZA 4A3CG 2VQEL 3FP9A 1X55A 1HNZQ 3SGIA 1PH8A 3A44A 4GOPB 3AYHB 1VQMA 1E3PA 2ALYB 2BH8A 2NVYH 3JC63 1UE7A 1IBKL 4DNIA 1PH6A 3EN2A 4LW1A 1YV1A 3BZCA 3STBC 5M5XH 4YHHQ 2UXCQ 3HKSA 1NBWA 4A3EG 1EQRA 1YZ6A 3A5ZB 2ZJRA 2UUAQ 4IFDJ 5DLQE 3G4SA 1GD7A 2K52A 1HZ9A 3ERSX 5IYBG 3HOXH 1RDVA 3S2HH 4POFA 1HZCA 3PUXA 3M85A 4DR7Q 3HOYH 1I50H 3STBD 1U0LA 3H0GG 4J15A 3S14H 3CCLA 1PYBA 3GD7A 4A76A 1YUXA 3A74A 5C4XH 2NVXH 1FHHA 4LF7Q 1PVOA 3CD6A 3RLOA 1IZ6A 4X66Q 4YCVA 4A3DG 2ES2A 1GKHA 1QVCA 3JC62 1VQ5A 3KYHC 5K36G 3F8TA 2V3BB 5FLMG 3CXCA 4DV3L 2CWPA 1RDGA 2MO0A 3I4MG 1VQDA 1Z47A 3CQZH 3CCQA 4JBMA 5RXNA 3D0FA 4JI0Q 4DV4L 5C4JH 2R92G 2LCQA 3UE1A 3TS0A 2ID0A 4PG3A 3CP0A 4YCUA 1Q81C 4LUVA 2ASBA 4MZ9A 4LF5L 5IP7G 1S40A 4JOIA 2BA0A 1CKNB 4ALPA 4YWKA 4DR5L 4A93G 1T9HA 3TQYA 3K7UC 1M1KC 4X65Q 4P72A 4B3MQ 4LF8L 2HHHL 4BBRG 2R6GA 1A0IA 2IHFA 1XPRA 2N78A 4X64L 3S1RH 1KHIA 1SMMA 4JI5Q 1KQSA 3AQQA 3J81c 4LF6Q 2UXDQ 4X6AH 2ZTDA 3U58A 1KD1C 4IO9A 2OTJA 2DGYA 2UUCL 4TQUS 1QVFA 4AYBE 3G71A 1NJIC 5IT9c 3NBHB 5BR8Q 1NMFA 1VQOA 2QGQA 1Q7YC 4LFAL 3K81C 1VQKA 4DR1Q 3S24A 4A3LH 5ELNA 3ULPA 2H5XA 3F1ZA 2WP8J 4HJ9A 4NXMQ 3GTLH 4YCWA 1FJGQ 4A3KH 2D0PA 2MO1A 1X3EA 4EQ5A 4EX5A 4YY3L 2AKWB 1NTGA 1TWFH 2K14A 3PUWA 4AH6A 1K0RA 4DV1Q 1PH4A 1HR0L 4BXXH 4QQBX 1VS0A 1H95A 1WI5A 4HIOA 3PIOA 1C7YA 1I6HH 5GQOA 1Q46A 2L15A 1VQ8A 3HOXG 2PQAA 4OWTB 4LFBL 1DGSA 2MNAA 1B13A 4DAMA 4DV5L 1R0JA 4AQYL 1XJVA 3HOYG 4LF9L 3RN5A 3RR5A 4GKJQ 3HOUH 1ASZA 1I94L 2NZHA 5LMUL 4WJ3M 1QCVA 1XMOQ 1B2JA 1V43A 3E9HA 1T9PA 5GAGC 3LGJA 1SR3A 3EIVA 5LMNL 1YJNA 1G51A 3MEFA 4DUYQ 2E2HH 1EFWA 3ULJA 4L5SA 1BE7A 4BBSH 4OO1I 4APVA 4HIKA 1KAWA 3W1BA 1VCIA 3G6EA 8RXNA 2N8NA 1MKHA 1OXSC 1TWCH 4JCVE 5IWAL 1VQ4A 2YTVA 1KL9A 1KIXA 4JI1Q 3K7AH 1VQAA 2EXDA 1CAAA 3TS2A 3S16H 5FJ8G 4GOPC 1KXLA 1Y1WH 2E5LL 1YUZA 1L2FA 1S3OA 4TVAB 3ULLA 3S15H 4DV3Q 2OCEA 1LM0A 2F52A 5M3FH 1IU6A 2HR5A 2OQKA 4A3GH 4MNOA 3W5OA 4DV7Q 1XTDA 1E8JA 3GO5A 2UUBQ 2UXBL 1C0AA 3GTQH 1B7YB 1IYJB 3BU2A 3RN2A 3CPFA 3KF8B 4GN3B 1DVBA 3RNUA 3HOWH 2EQSA 2NN6I 1IBLQ 4DK3C 4HJ8A 2R7FA 1TWGH 4PZ8A 1MJEA 1PYSB 4DKAC 3UDXA 1BQ9A 1OTCA 2HHHQ 4ME3A 3T1HQ 1M90C 4GKKQ 1JMCA 1EOVA 2BA1A 4X64Q 4OX9Q 3M7NA 1NY4A 1A63A 4DR2Q 5IY0A 4UP7A 4Y7NH 4A3KG 3GTMH 4DUZQ 1VQPA 2VL6A 2JA7G 1XPUA 3ICEA 4BXXG 4HJAA 4LFCL 3KF6B 4OONA 1XMQQ 3U50C 4GS3A 1X9NA 1N36L 2IHEA 4IPCA 2HT1A 3JAMc 4DR6Q 2EIFA 2I5HA 3CMEA 3I4MH 2NZOA 3GTJH 3CPWA 3PWFA 2WAQE 2YTYA 4IOAA 1PH2A 3PO2H 4NB3A 1IROA 1IBMQ 4DV2Q 5AJ3L 4BY1H 1EWIA 4JI7L 4YY3Q 3K8AA 4KHPL 5C0XI 4AYBG 2HQLA 5GAHC 3CMAA 2UU9L 4JI3Q 4IOCA 4JI8Q 3JC66 1K3RA 4UY8C 1R0IA 3GTPH 2YTXA 4LUOA 3RLNA 3RYGA 2Z0SA 3F2DA 1YJWA 2IX0A 1FHMA 2LSSA 4JI6L 1D7QA 4LF9Q 4BBSG 1HJPA 2A1AA 3AFQA 3KDFB 2QA4A 1J5EL 1S2ZA 3PF4A 5JJKA 3UE0A 3J7ZC 4IFDG 3HFZB 4PZ6A 4JYAQ 4K0KL 4DV0Q 3PUYA 3T1YL 3HOVH 1X56A 1NE3A 3SS2A 3KFUA 1QZGA 3G48A 1Y1WG 2ZJQA 5E7NA 4BA1I 4FDBA 3H3VI 1X6OA 4A3BG 1T9OA 5IYCG 5M3MH 2ZM6Q 1AE3A 4A3GG 1D8LA 1B71A 4TPUA 2CQOA 1JJCB 4DAYB 4OWXB 2Z6KC 1UE5A 2KENA 1RYTA 1Q12A 3OTOL 1PH9A 1JB7A 1L1OB 1VQHA 4QGUA 3CC4A 1YJ9A 1NMGA 2MS3A 3S2DH 4PMWA 2VQFQ 2CWAA 3ER0A 2A8VA 3I4OA 3KYVA 3E0EA 4JV5L 2UXBQ 2B63H 1KRTA 4OWWB 5JJLA 1SROA 2HIXA 1PH7A 2DUDA 1R0FA 1WCMH 4DV6L 1HNXQ 2I0QA 1QYBA 4NXNL 3KJOA 5M5WH 5J3BA 4JBWA 1SN8A 4PZ7A 1S24A 1JE5A 2JQOA 2KBNA 4RG1A 2JA5H 1AE2A 1VQFA 2CFMA 1P16A 3K0XA 1A62A 3JAMi 4C3IH 2CKZB 4P75A 4B3TQ 3PO2G 1XNQL 2RHSB 4AR5A 4MTNA 1QZHA 1HZBA 1CSQA 4JG2A 4JI2Q 4A3FH 4B3SL 4H02A 1RIPA 4DR3L 4BY1G 3PV0A 3J7A5 1LYLA 2K50A 3PO3H 4LFCQ 4GLVB 2VUMH 5IP9H 1XNRL 4Y52H 1L0WA 1N36Q 1N33L 1BFYA 3PF5A 1N32Q 1Y1VH 2AHOB 3ZJYC 3UDFA 2RF4A 5IYDH 1JJGA 1WYDA 4GNXC 1AH9A 3DM3A 2VQEQ 4B3RL 2GVBA 3PIPA 1KRSA 1CUKA 1BBWA 1YHAA 2JEBI 3TEHB 1N34L 2VW9A 2IX1A 2VS1A 1LTLA 1IBKQ 2OWOA 2IT1A 4POGA 3CCMA 3HOVG 5C4XG 1CKOA 1X65A 2CCZA 4X62L 3VDYA 4LF4L 2WAQG 4LWCA 2F4VL 3RZOH 1LKPA 4GNXA 1V9PA 1VQCA 2K4KA 3NELA 4KLKA 1HNZL 2R7DA 1VQLA 5M3MG 3KYWA 3MXNB 1K83H 2QL0A 1JYBA 3PUVA 2QEXA 4A3JH 2YYZA 3T1YQ 4YHHL 1I5FA 3J81j 2UUAL 1YNXA 5GAEC 4YWLA 1OXXK 1BKBA 1VQIA 1MJCA 3CC2A 2WB1E 2ZTCA 1H7VA 3BJUA 2ZJPA 4DR7L 1QUQA 2WFWA 1FVIA 3EBEA 2B63G 1X3GA 1TXYA 3HKZE 1YI2A 3KOJA 1G291 3CCJA 3I4NH 3PUZA 4LF7L 4A3EH 4DR4L 2VNUD 3OTOQ 3A5UA 5FLXc 4DV4Q 2JA7H 1UEBA 1WFQA 1EUJA 1VQBA 2LXKA 4X66L 4JBKA 2JA5G 2PMZE 3J81i 4LF5Q 3K80C 4AR6A 4GOPA 3H3VH 1R0GA 2D0OA 3FKIH 3OYYA 3HOZG 1K8GA 4A3FG 3KLWA 3CF5A 2K75A 4DR5Q 4DPGA 4LF8Q 1YHBA 4RMFA 4C2MH 4A3LG 3KYYA 3OW2A 1VQJA 2PQAB 3PO3G 1W2BA 4JI0L 2VUMG 3CCVA 4QIWE 5IP9G 4A75A 1N9WA 2Q2IA 1YBYA 1SMXA 1IL2A 3PCOB 1SRUA 1Y1VG 2UUCQ 1YK5A 3J80c 1Z9FA 5IYDG 1PH5A 2N49A 1C9OA 3I7FA 2AMCB 4LFAQ 1ASYA 4B3ML 4X65L 1VQNA 4DR3Q 1BVSA 5C44H 2NVTH 3CCEA 2KKDA 2JJQA 1MIUA 5GADC 4O0AA 2PNHA 3CC7A 2F3IA 2Q2TA 1VCXA 2I5LX 4HJ5A 3HOUG 4LF6L 1EIYB 3H15A 1N33Q 2UXDL 5H1SE 1HR0Q 3L7ZC 3KJPA 2DSXA 3UDGA 3S1MH 1OXTA 5BR8L 2Q2HA 1PA6A 5C0XJ 2C35B 1BRFA 1SLJA 2LXJA 4DR1L 4DR6L 4LFBQ 4DV5Q 3BZKA 5AI2A 3B6YA 4BBRH 4AQYQ 1GM5A 2K2DA 6RXNA 4C3HH 4NXML 2R7ZH 4A3JG 1LUZA 2JK8A 1BQ8A 1R9TH 1WJJA 2VQFL 1FJGL 1I94Q 5IE8A 4HIMA 1W3SA 2KHJA 5LMUQ 1SMUA 1E24A 3TRZA 4X62Q 1G6PA 3AFPA 2FXQA 1HNWL 1IU5A 5LMNQ 3S1NH 4XTCS 1Y14B 2PI2E 5JJIA 4QY7A 3GTGH 1HZAA 3WWVA 4GN5A 4IPHA 1P8LA 3KYUA 4GKJL 4AR3A 5M3FG 3RZ6A 3TREA 4IFDI 3I4NG 2RHQB 1QVGA 3F2BA 5IWAQ 1XMOL 1Q82C 3CW2C 4A3IH 3RZTA 4C3JH 2JA6H 2PYAA 4R4IA 3CCSA 3FKIG 4DUYL 1BBUA 5C3EH 3U4ZA 2E5LQ 1YITA 4JC0A 4RXNA 1PH3A 2IY5B 1HH2P 1YEZA 4QL5A 2RCNA 2MFIA 2YU9H 1I3QH 1R0HA 4IPDA 4R4TA 4JI4L 4DR4Q 3QVDA 2JA8H 2K5VA 4JI1L 1B70B 1IXRA 1FGUA 1Q1BA 2Z6KA 2WB1G 4IJHA 3I56A 2Y0SE 1Q86C 1X54A 4JOIC 1E1OA 2PI2A 1PV4A 4K9FA 3J80i 2JEAI 5M5YH 3HKZG 3Q8DA 3M4OH 3CCRA 1XPOA 2N3SA 5C44G 3S17H 2YV5A 1VQEA 2K5HA 4DV7L 2UUBL 1U5KA 3M3YH 3HOWG 2NVQH 4A3MH 1E22A 1VQGA 3W1GA 4NPSA 4GLXA 2GMGA 4YWMA 2KCTA 3I2ZA 2Q2UA 4UP9A 2VZAA 3M9BA 5FJ8H 3RZDH 1IBLL 1KC8C 3AEVA 2A19A 4IPGA 1UWVA 1B2OA 2JE6I 2K5NA 4R4OA 2KN9A 7RXNA 2B29A 1EYGA 3MPSA 3T1HL 4GKKL 5ELOA 2E2IH 2I5MX 2V1CC 4HIDA 4OX9L 1IRNA 2JA9A 4DR2L 2R7ZG 4DUZL 3PGZA 4KI0A 5AJ3Q 4JI7Q 1RWDA 5HGQA 1RB9A 3A0JA 1XMQL 1VQ9A 2ATWA 4KHPQ 2UU9Q 4AIMA
chains in the Genus database with same CATH superfamily
1Q8KA 3M4QA 4R4CA 4U673 4R1JA 3UDIA 4RCOA 4OHJA 4O2DA 4XQQA 4DV2L 4G7OC 3Q24A 1E7ZA 3TSSA 1YIJA 2H1EA 4P73A 4A4IA 1EQQA 2B63B 1HNWQ 1KLUD 3RLFA 1YVCA 4A3CH 1STGA 1DX8A 1EYAA 2KVMA 3FRPB 2F03A 2O2LD 3MC0B 5AN9H 2MPMA 3OWEB 4JYAL 1K8AC 1Y8PB 2RFKB 3Q6SA 4WJ4A 4E6IA 4XQNA 3PO3B 2VUMB 2VB2X 3A56A 1V1QA 4QJFA 4KJNA 1GUOA 3E9IA 2E2DC 4L5RC 3H0GH 3Q0AA 4V190 4IURA 4DV6Q 2YU9L 2GN5A 2OQ0A 1S72A 4JBJA 2G5DA 2F0PA 4ABNA 4A3DH 2QDLA 3KDFA 3LNLA 2D9UA 1UNSA 4FYDA 1Q3LA 5K36H 1SE8A 5M5YL 1Q8IA 4B3SQ 1GVPA 3FHWA 4DK6C 4KHVA 3D3RA 2L55A 3EA6A 2VY3A 1BDOA 4FXKC 4L6TB 1PHJA 2E2HB 1GO3E 1JQYD 3MWYW 3D4DA 1MSHA 4K2LA 1UE6A 2F0TA 1T9QA 1LV9A 3VYUA 4LMQD 2XJTA 1QCBD 1N34Q 5E3FA 3URYA 4XQJA 1RF2D 3CAMA 1PFMA 4AYBP 5MFZA 3NK9A 5M3FB 2NWGA 4LUZA 2VXWA 3FPPA 3GTQB 5HGTA 1SYGA 3L3OC 4V0BA 1VQMA 4GOPB 3AYHB 5J1ZA 1SSOA 2NVYH 4DNIA 1YV1A 3BZCA 4OIKA 2E2JL 4KMUC 1NBWA 2QILA 1EEFD 3A5ZB 1B3AA 4C2MB 4M8AA 2OXPA 2XJQA 5KIXA 1RKNA 4IFDJ 5JPNC 1KNEA 1GD7A 1JC7A 4TVMA 2JP1A 1STHA 4HMIA 1PTOB 1LT6D 3ERSX 4DR7Q 3HOYH 1I50H 5IGBA 1HA5A 1QQTA 1I4QA 1U0LA 2A74C 3CCLA 1EFID 1PYBA 3GD7A 3A74A 3HAXC 3G7LA 2NVXH 3HKZB 3GTOL 5C44B 1D1KA 4X66Q 3J80L 5BN5A 2N88A 4N8FA 3S9WA 5FLMG 2PMZB 3W2DA 1K3BC 2HD3A 2F0IA 2CWPA 3SDZA 5RXNA 3U9SA 4CJ1B 5G3LF 4RKLA 1SJED 2R7ZB 4MZ9A 4QIWB 1O7YA 1S40A 1EWHA 3CRLC 4F88A 4A93G 1KABA 4A3BL 4X65Q 1EEID 5DM73 5IYCL 1L0YB 2HHHL 3NWSA 2IHFA 4JI5Q 4X64L 3S1RH 5H1Sc 2RA4A 4JADA 1TU2B 1ZYRC 3U58A 1WTVA 4IO9A 1Z6HA 2P5ZX 3SXHA 2B39A 1EIHA 2XRQD 2O5JD 3J80E 2QGQA 1EY7A 5EQ0A 4A3LH 2H5XA 4C3JB 2WP8J 2JA6B 1EY5A 3GTML 4A3KH 2D0PA 5C3EB 4YY3L 1HCZA 2R93L 2AKWB 1PH4A 4BXXH 4AH6A 4DV1Q 5CV6A 1H95A 1LTSD 1WI5A 3HOXG 2JA8B 2PQAA 1B13A 4DAMA 5C4ZA 1R0JA 5CV8A 3KUPA 3HOUH 3NTHA 3NP8A 5IGEA 3X3NA 2K05A 1B2JA 1SR3A 1PRTD 3EIVA 1K8OA 1G51A 2LY7A 2EY4E 1ENAA 4APVA 4FO2A 3W1BA 1VCIA 5I6WA 1BCPF 1D5XC 3S14L 4IFDH 5IWAL 1TWCH 1VQ4A 2Q8RE 4IUNA 5C4XL 3K7AH 2EXDA 3TS2A 3SEBA 4KTAA 1GUTA 3M7GA 2CR8A 2PW7A 1M8AA 4TVAB 1S3OA 3ULLA 1ICFB 4DV3Q 2Y0SB 2UXBL 4AHYA 1ML0D 3KF8B 1DVBA 2A68C 2B2UA 2RCFA 1IBLQ 3AMUA 4K2KA 1MJEA 1GHKA 3TMEA 1S5FD 1JORA 1OTCA 1STNA 1BQ9A 3UDXA 1CTMA 4ME3A 3T1HQ 1M90C 4OX9Q 5IY0A 4UP7A 4Y7NH 4DUZQ 2VL6A 3ICEA 4LFCL 4OONA 3KK7A 3U50C 2BDNA 4IPCA 5MLC3 2JA5L 3CMEA 2JI3A 1YNJC 3HZXA 3PWFA 5EBDA 2YTYA 2PO4A 4NB3A 4A3EB 4A3FL 1EQTA 3MSUA 1IROA 2ZIXA 1IBMQ 4JI7L 3E0JA 4AYBG 2HQLA 5GAHC 4JI3Q 4UY8C 5FLXL 1PFWA 4IOCA 3JC66 4UY81 1TWFL 2YTXA 1F2ZA 3RYGA 4JI6L 1D7QA 4LF9Q 4BBSG 1J5EL 3AFQA 2Z3QB 1A2TA 1SJHD 3J7ZC 3J7Z1 1JCKB 1QB5D 3G48A 3RZOL 1JB3A 4BA1I 2R92B 3BS1A 1T9OA 2PCFB 2F0MA 1NR4A 1HPCA 3KLSX 5GADc 2A73B 4DAYB 5CV7A 3S15H 1UE5A 1RYTA 3LWVB 3LWQB 3OTOL 1CHPD 1NAPA 1VQHA 4QGUA 3CC4A 3J7AV 1YJ9A 5FLXE 2MS3A 3N6RA 3LPEB 4PMWA 4DXFA 1I4PA 5I4DA 3ERQA 1KRTA 2Z4IA 4A3GL 3I4NL 1HNXQ 5CYUA 5M5WH 5J3BA 4JBWA 4RG1A 1S24A 3I4MG 1VQFA 3R93A 4ME5A 1A62A 4C3IH 1XNQL 4JG2A 4H02A 1RIPA 3J7A5 1LYLA 4TKOB 1WTQA 4Y52H 3PL5A 2CQAA 1N36Q 4R9WA 1N32Q 5C5MA 2AHOB 1BBXC 3H09A 1JJGA 2Q8IB 2B2VA 2VQEQ 4G4KA 2F0LA 2GVBA 3PIPA 2JEBI 3TEHB 2VS1A 1SNDA 3HOVG 4WFN3 4F8MA 1QG7A 2L4NA 5CBEE 4X62L 1LKPA 4ZN1B 1VQCA 4KLKA 1HNZL 1X32A 3KYWA 2B8GA 2CW0D 4DAVA 3H3VM 3GV3A 1K0SA 1EY0A 2C9OA 4YHHL 2DY7A 3D4WA 5CBAE 1YNXA 5ISRA 5GAEC 2QCPX 1H7VA 3T53B 2B2TC 3K57A 3H3VC 2RKSA 4AHXA 4LF7L 1CQFA 5KEEA 4DR4L 3TDQA 4DV4Q 1UEAB 4A3IL 1VQBA 2PW5A 1VF5C 1PTOC 4DK1A 2B2WC 1BR9A 2JI1A 3J81i 3K80C 4AR6A 2B2TA 4GOPA 4LF5Q 3OYYA 2E2JB 4DR5Q 1T5EA 4DPGA 4A3LG 2B63L 4N9PA 3NUCA 3QR8A 2Q2IA 1SMXA 1WCML 1Y1VG 1YK5A 4FVMA 4QUFA 1Z9FA 1PH5A 1C9OA 3I7FA 5IODA 4LFAQ 1ASYA 2FMMA 4UAIA 4O0AA 2PNHA 3HOUG 2I5LX 2UXDL 4OL7A 2D5DA 3L7ZC 5BR8L 2A6HD 3FPUB 3HRZC 3QOLA 1ILPA 4DR1L 4DV5Q 3BZKA 4BBRH 5IYDL 4AQYQ 2E2IL 4C3HH 4A3JG 1FJGL 1BQ8A 2SOBA 4HIMA 4A3BB 2F0QA 5LMUQ 3L9AX 3U9OA 3IAYA 2XRSD 3AFPA 3QG1A 3S1NH 5CR3A 5JJIA 4QY7A 1TT2A 2K5QA 3GTGH 4GN5A 4IPHA 4JAGA 2EOTA 3OMCA 3KYUA 4GKJL 1EYDA 2RDFA 4UDUC 4ULLA 1QVGA 1IHZA 1D6EC 1SNMA 3F2BA 1Q82C 1CA6A 2BCOA 3C3LA 2LMCB 3CCSA 2WB1P 3GTMB 2E5LQ 1BBUA 4G57A 2F0DA 4ZYSA 1KDBA 2RCNA 3H9BA 1I3QH 4JI4L 3PO2B 2XJUA 1B70B 1FGUA 2O4XA 1Q1BA 2NZ1D 1PFVA 3I56A 4BY1B 1S5CD 1Q86C 1F77A 3M4OH 3Q8DA 2KECA 3D6WA 4QMGA 3VR5A 3S17H 3K5MA 3H0GL 3M3YH 1E22A 3V2TA 2KCTA 4B9XA 2Z1CA 1UWVA 4A3DL 1B2OA 3DM1A 4R4OA 3S14B 4QUCA 4GKKL 5C4XB 1A3VA 1IRNA 4DR2L 1IYVA 4ZUIA 3VYRA 2NVTL 5C44L 3OIPA 5AJ3Q 2I46A 1SBBB 2ATWA 1VQ9A 5M3MB 3KYXA 1JT8A 1TWAH 1CKMA 1ODHA 3U4VA 2M4YA 2CH4A 3FVQA 3IRBA 2QKIC 4AHZA 2R7ZL 1GOZA 2KHIA 1ZXTA 4OELB 2HCCA 4JI8L 2UXCL 4LNQA 2AQ3B 3H91A 5A2QL 2XTIA 1XXGA 4B8CD 2DNEA 3L2PA 2OTLA 2EDGA 1LKOA 4MTKA 4FF2A 2XGTA 2JA5B 1U4LA 2NVYL 3LWRB 1D2BA 2KCNA 3HOZB 5JAVA 1TY2A 2AWNA 4A3FB 1TWHH 3GTLB 4C3JL 4ZLTF 2ZM6L 4UP8A 1QNUA 3OOCA 1A6XA 3H94A 3BYYB 5A2QE 3ZG6A 1PFSA 1CSPA 5D65A 4RHSA 2OF1A 5FLMH 3RZOB 2HIVA 5LMNW 1HUMA 4DFAA 3I55A 3MAQA 1SMWA 1VQ7A 2NVQL 1A8VA 1XNRQ 1TS2A 1ILQA 1K83B 5GAGc 2QDBA 4XIGS 5IGGA 1RL2A 5FJ8L 4B3TL 1O7IA 1K9MC 1DOKA 3L0OA 3MZ5A 4DAYA 5JEAG 4JI2L 4A93H 4R8IA 1WOCA 2L0CA 3GV6A 4B3RQ 3S1RL 1N8RC 1FL0A 4R4QA 1S5DD 4C1NK 1Q1EA 4BY7G 3S1QH 3OPOA 4KHZA 3H99A 1CKNA 2TSSA 4A3GB 3I4NB 4PQXA 4O42A 2L1BA 3FP9A 1RTOA 3SGIA 3A44A 3P7JA 2ALYB 2BH8A 3JC63 3FKIB 4LW1A 1GUGA 5M5XH 4BXXL 1XYIA 1SFOL 3G4SA 2EYMA 5LHY1 4IN3A 2DN8A 3HOXH 1RDVA 4POFA 2E76C 2F0EA 3MTSA 4J15A 3TZUA 1RODA 1H9JA 1FHHA 1PVOA 3RLOA 1IZ6A 2F0FA 1L0XB 2E74C 1LACA 3MFGA 2KJXA 5IYBL 1FNUA 3S1MB 1VQDA 1Z47A 3D0FA 4H44C 5C4JH 1TWCL 4FP5D 1ET6A 4EVOA 3TS0A 3K7AL 4CHTB 1EY9A 5IP7G 3K35A 3GTKL 4IQZA 4ALPA 3TQYA 1B50A 3LX0A 4LF8L 4BBRG 1R4QB 1A0IA 1XPRA 2R93G 2N78A 1KHIA 1EZ8A 2WIIB 2AQ2B 4XXBB 4JW0A 3G71A 1NMFA 2V4DA 3K81C 4A3IB 3S24A 5KNBA 2FJ2A 1BXTA 4NXMQ 5D3IB 2VQFQ 1X3EA 4EQ5A 4EX5A 3PUWA 3TRZA 3Q22A 4G6BA 1C7YA 2NUCA 1VQ8A 1VF7A 4OWTB 4LFBL 4RAUC 2Z8LA 1WCMB 3H9CA 2EVBA 2MP1A 4EQNA 3RN5A 1B1ZA 4LHLA 1PYWD 1I94L 3T56B 5E4XA 2R61A 1XMOQ 1LTTD 1MD2D 3E9HA 5LMNL 4A3MB 1LT5D 1CQVA 3MEFA 4DUYQ 4ZCKA 1EFWA 2E2HH 1K28A 4X3UA 5T1IA 4BBSH 4ODGA 3WOEA 3S2HL 1KAWA 3G6EA 3K6OA 3GQBA 2M4VA 2YTVA 2E2IB 1VQAA 4F7XA 1CAAA 3GP7A 1YUZA 2XIWA 5G3LD 1VZIA 5M3FH 1IU6A 1C0AA 5FO9B 2UUBQ 3GTQH 1B7YB 3RN2A 3I72A 3CPFA 4RGNA 3CQZL 3S15L 4GN3B 4CGYB 5T1GA 2EQSA 2L11A 1TWGH 4PZ8A 3T13A 4KKUA 1HQRD 3BDCA 4WRDA 2HHHQ 1JOOA 4X64Q 2RQXA 3M7NA 2JA7G 2A68D 4ZK9B 4HJAA 3KF6B 5A35A 2APOB 2IHEA 4DR6Q 5ELEA 1EL0A 2EIFA 2I5HA 3I4MH 4J6HA 3AB9A 4C3IL 2WAQE 4NDXA 1KDCA 4YY3Q 4KHPL 3GTLL 4XGHA 2UU9L 3GTPH 3H0GB 3RLNA 1U4RA 3K5NA 1SDFA 1HJPA 2QA4A 1S2ZA 4CKBA 4A3DB 3LWPB 3HFZB 4DV0Q 1E2VA 3PUYA 3T1YL 1D1IA 3HOVH 1NE3A 2N55A 1Y1WG 1BCPD 5E7NA 4JVZA 2NVTB 3MQKB 5C5LA 2M6OA 1AE3A 4A3GG 1D8LA 3W3AA 1B71A 3VPBE 3T4AC 2A69C 3MHBA 4OWXB 2ERSA 4JAFA 1QE6A 2KENA 1IW7D 2Z6KC 4RA8A 5EGTA 1PH9A 1L1OB 3VR3A 4J1MA 2ZXPA 3S2DH 4B9WA 1I6VC 1JWUD 3ER0A 2EE1A 2A8VA 2UXBQ 3OIQA 4OWWB 2HIXA 3RD4A 1PH7A 2DUDA 1R0FA 4DV6L 2I0QA 2PMZP 5DNFA 1RJTA 4X3TA 1SN8A 4PZ7A 1JE5A 2NVYB 3K58A 4EQPA 1IKMA 2CFMA 1F2LA 1SE4A 2RHSB 4AR5A 1QZHA 4FF4A 2B8FA 3SHLA 4B3SL 4QIWP 2K50A 2M6PA 3F2UA 4GLVB 4LFCQ 3K0YA 1L0WA 1N33L 3HOYB 1I50B 3P75A 5CORA 5EPJA 1Y1VH 3ZJYC 3QWNA 1V1OA 2H4OA 2AUKA 1WYDA 1SE3A 3GTJL 2HDMA 1KRSA 1CUKA 3PO2L 1LT3D 2SDFA 1N34L 2IX1A 1F9RA 1IBKQ 3VR2A 2IT1A 4POGA 2EPBA 4BY1L 1SYFA 1CKOA 2X6LA 2CCZA 3VDYA 4LWCA 2RSNA 4MHEA 1V9PA 2NVQB 1XTCD 1VQLA 3MXNB 4KKSA 1U9RA 3FDTA 4C3HL 2QL0A 1STEA 4A3JH 2YYZA 1DOMA 5C0XH 1HHVA 5CV5A 1H9MA 2WINB 1BKBA 3S1RB 2WB1E 2ZTCA 3QIAA 4DR7L 4B08A 1TS4A 2EYHA 2ICEC 2WFWA 3CRKC 3EBEA 3HEJA 2B63G 1X3GA 2L5TA 3KOJA 1G291 5M3ML 1UUPA 3PUZA 4A3EH 2VNUD 3OTOQ 4ZUJA 3A5UA 5FLXc 1UEBA 4CBVA 4X66L 4A3KB 1I4RA 1WTRA 4M1UB 3CF5A 2K75A 1SFOB 2OT2A 3SR1A 4RFBA 4RMFA 3KYYA 2F4IA 3DUZA 3PO3G 2VUMG 3CCVA 5IP9G 1PTOD 4MIUA 2Y0SP 1YBYA 1IL2A 3PCOB 3QOJA 4DU9A 1U4PA 2BOSA 3NE5B 2M9VA 5MGNA 2UUCQ 2F0NA 3SK8A 3J7YW 5IYDG 2AMCB 3M4OL 2EJFC 4X65L 3VR6A 3HOZL 1MIUA 5GADC 3H15A 5H1SE 4ZN3B 1HR0Q 1LT4D 2Q2HA 3HP3A 1TWCB 1WTXA 1BRFA 1SLJA 1DYQA 2LXJA 1BF4A 3C2PA 3K7AB 1GM5A 3TBIB 2K2DA 6RXNA 4IZ8A 1LUZA 2JK8A 4RHRA 1R9TH 3GTKB 1D5ZC 4N9TA 3J7Y1 1LTGD 3BYTB 3A8KE 4X62Q 3FMCA 1RYQA 3LWOB 1Y14B 2PI2E 1TWAL 2IPKD 1HZAA 3WWVA 2ZXRA 5M3FG 4F87A 3I90A 5IGCA 1K83L 1I4XA 2RHQB 5EJWA 2EYOA 4K5VA 2EYFA 3CW2C 4WJWA 3O13A 4Y7NB 1CZWA 4ZRZA 3WWLA 1CFMA 2IY5B 2YU9H 4IPDA 4DR4Q 3QVDA 3UI2A 2K5VA 1TWHL 1LABA 4C56C 4JOIC 1PV4A 5M5YH 3HKZG 4HR7B 3PKJA 3FKIL 2N3SA 5C44G 4FXDA 2YV5A 2K5HA 1PTOF 3IFTA 4CJ2C 1VQGA 4GLXA 3VYSA 3I70A 2VZAA 3RZDH 2EY6A 1IBLL 2PZWA 3S2HB 1B2TA 2E75C 2JE6I 3OHXC 2AQ1B 4RWSC 3E5SA 1EYGA 3MPSA 2O5JC 3T1HL 4OX9L 2V1CC 2R7ZG 2JA9A 4V196 2WAQB 4DUZL 3PGZA 3KBGA 1RB9A 5C4HA 3R8BA 4AIMA 5DAUA 1MSGA 4CKEA 3VA5A 3S1ML 1PFBA 2K5WA 3CQZB 3NQIA 4C1NI 3S15B 4A93L 3NEMA 1E1TA 5JEAH 1IBML 2FFKB 2F0OA 4CJ0B 2E2JH 2SNSA 4K0KQ 4BY7H 4JI3L 5CV4A 2KEEA 3CHBD 4C3JG 4Q5VA 2CVRA 2JA6G 4GLAC 5K2ME 1TS3A 4YIJA 5C3EG 2QEJC 3TN2A 1BNZA 4CDEC 3KF6A 1YK4A 5D3DA 4OO1G 3AU7A 2JSOA 4C3IB 3GTOH 2JA8G 3M4PA 1C09A 1B9NA 1WJVA 3J81L 1GHJA 1JOQA 4KV6A 5IT9L 1NNQA 4TSSA 2PVXA 3HOXL 2BE5D 3E3XA 1PFYA 1YHQA 2RDVA 4JV5Q 4JI4Q 4OXPA 2OEOA 5FOBB 3G6JB 4GN4B 4H7BA 5CC4A 3K59A 4NXNQ 3PSIA 1A2UA 1WVLA 1Q90A 2NN6G 2B2WA 1UE1A 5EAYA 4A3BH 2L9HA 1QOHA 5IYCH 1PZID 1W6JA 1RD9D 4QF4A 1DJRD 3A54A 1OXVA 2PNRC 1CM9A 3R3OA 4GNXB 2DJGC 4N8X1 3P8BA 1L1OC 1HNXL 1G6ZA 1OXUA 1J8IA 5C4JL 2Y0SG 1LKMA 4A3ML 4K5WA 3A7AB 2TMPA 4P71A 3J81E 2K28A 1B8AA 2AWOA 2CKAA 4UPAA 5IP7H 3DLLA 3R2IA 4L5QA 4ZKBB 5IT9E 1H9RA 1L1OA 2R93H 1XX8A 3WDNA 5GAEc 5GROA 2MQHA 5C0XG 3NENA 3F2CA 4J8QA 1N32L 4P74A 4LF4Q 1EIFA 2PVEA 2F4VQ 2MUYA 3A8JE 2VQEL 1X55A 1M4VA 3B08B 3EJIA 5BN4A 2WKDA 2PZTA 3LWEA 1UE7A 3NTKA 1PH6A 3STBC 5LL6S 2UXCQ 4A3EG 2UUAQ 1SAPA 3VYTA 1HZ9A 5IYBG 5KGUA 1ENCA 1HZCA 4A3CL 4L63B 5JPMC 2WB1B 1F9PA 3S14H 1PZJD 4K8IA 5C4XH 3GTJB 1ZKOA 4NP5A 2O5IC 3EROA 4YCVA 4ID6A 3JAML 2A6EC 1QVCA 2EY5A 4XYQA 4OIJA 1NCVA 2JYOA 3CXCA 4BBSL 3DWQA 1RDGA 1EY4A 3KBXA 1AW7A 1F2YA 2XVSA 3CCQA 3VR4A 4RGTA 4JI0Q 4DV4L 1EY8A 2R92G 3UE1A 2ID0A 2ASBA 4LUVA 4C3HB 2GA4B 5L37A 2KEDA 4LF5L 1FYCA 4YWKA 4TRDA 1HTLD 4DR5L 2M2LA 4B3MQ 4P72A 1II3A 3S1NB 3MFYA 4LHNA 3Q23A 1KQSA 1F2MA 1Z92B 3NTIA 5EKKA 4LF6Q 2EYLA 4X6AH 1KD1C 1DONA 4TQUS 2RVLA 4AYBE 5I6YA 1DD2A 4HTHA 3NBHB 1TWGL 4LFAL 2PZUA 3JAME 3D4RA 1VQKA 3EVQA 5JVG1 3ULPA 2QF7A 5KRUA 4HJ9A 2K1BA 3KF8A 2MO1A 2JA7H 1NTGA 1TWFH 2K14A 4FXGC 4QQBX 3J7AF 3MXUA 3QJYA 1I6HH 3I4ML 5GQOA 2L15A 4P2CB 3A55A 5EPKA 1DGSA 2MNAA 4DV5L 4AQYL 1XJVA 1IL8A 2CW0C 3NXWA 5I2YA 4FF1A 3M4OB 5LMUL 3QB3A 4WJ3M 3N52A 2EYJA 3PKIA 1A3UA 1V43A 1T9PA 5GAGC 3NHHA 3I8ZA 3M3YB 2QW7A 1YJNA 1EY6A 2DY8A 3NFPI 3ULJA 2B5ID 4OO1I 1J9OA 2KA7A 2EJGC 3HOYL 1I50L 1RDPD 1NUCA 2JI2A 1FNVA 1EZ6A 2N8NA 1MKHA 4I65A 3HOVL 4JI1Q 2NVXL 1F9QA 3S16H 1Y1WH 2NBFA 2E5LL 1BO0A 1KNAA 1SEBD 2M00A 2OCEA 5C3XA 2F52A 2HR5A 4A3GH 1D5MC 4MNOA 3W5OA 4DV7Q 1E8JA 1TWAB 3MA2B 1IYJB 3BU2A 2KQ3A 1SYCA 3RNUA 4OEMB 3HOWH 3C46A 2NN6I 4DK3C 3S2DL 2MGSA 4DKAC 5I9OA 1JMCA 1EOVA 1NY4A 2NTTA 1VQPA 2JXMB 1XMQQ 5EKLA 1AZQA 4G7ZC 1WTHA 1ONLA 2ENBA 5JVG3 1KTKA 1PH2A 1LO5D 1UAPA 1TWHB 3CKIB 4DV2Q 4A3LL 2EYPA 5AJ3L 2H12A 1EYCA 1QJOA 1OWCA 3K8AA 5C0XI 2XJVA 4A3KL 4IUVA 1R0IA 2HVYC 1Y1VL 4WORA 1ET9A 2WKCA 2AYJA 1S4ZA 2LSSA 4LK1C 3PF4A 2FHTA 4PNYA 1TY0A 4BS9A 4PZ6A 4JYAQ 3HOUL 1YNNC 4DA2A 2ZJQA 2Z9HA 1CI3M 5EPLA 3I4LA 4FDBA 4A3BG 3SK6A 5IYCG 1G2TA 4TPUA 2CQOA 4A93B 2J7ZA 1Q12A 4PV1C 5I9PA 3QO2A 4PMBA 1NMGA 1DOLA 3WWNB 1SYDA 2CWAA 1B3QA 1LTBD 3S1QB 3I4OA 3H6MA 3E0EA 1CZGA 5IGFA 2B63H 1NSNS 2G9DA 1SROA 4I7ZC 1WCMH 1QYBA 1Z7TA 5CV9A 3KJOA 3V05A 4LAAA 2JQOA 4HJ8A 1ESRA 2CKZB 5M5XB 3PO2G 1JWMD 2K03A 1HZBA 4DR3L 4BY1G 1SMYC 4DN4M 3QQCE 1SNCA 3PO3H 1ZYRD 4HEDA 4RGOS 3HOXB 2VUMH 5IP9H 4Y7NL 1STYA 1XNRL 2KHSA 1BFYA 2F3WA 3H97A 3PF5A 2SNMA 1OO9B 3UDFA 5IYDH 1A15A 4GNXC 1AH9A 2MHVA 4DAPA 1CT1D 4B3RL 1YHAA 1BBWA 2IL8A 2VW9A 1LTLA 2NYZD 3CCMA 3ZYYX 5C4XG 1NXEA 2EXZA 1X65A 4UHVA 1JR0D 2Z3RB 4GNXA 2K4KA 5C4JB 2R7DA 1MI2A 5ELBA 5M3MG 1K8MA 3ONAB 5EIOC 1JYBA 3PUVA 1R9TL 3T1YQ 1I5FA 4IUTA 4YWLA 1ESFA 1MJCA 1WTOA 3CC2A 2EZVA 4DF7A 1GJXA 3A7LA 4ZAIA 2X6GA 5FKAC 4ZKCB 5FO8B 1TQOA 5C3WA 2IX3A 3CCJA 1EUJA 1T5XD 1S5BD 3EFXD 2JA5G 1DM0B 2L0ZA 3H3VH 2D0OA 3DWAA 3HOZG 3C1FA 4A3FG 3KLWA 1AZPA 5HURA 1PFNA 4U68A 1YHBA 4C2MH 1IYUA 1VQJA 1HTPA 4KKTA 1E2WA 4A75A 1N9WA 1PTOH 1LTAD 1PDQA 4KD3A 1V1PB 1KAAA 3HJWB 5M5WL 3J80c 2DNCA 2EY2A 2DJFC 4AYBB 1P7PA 1WTPA 4KJOA 2NVTH 5C44H 3CCEA 2JJQA 1PRTB 5DM71 2C6AA 2XJPA 5JJZA 2F3IA 1ICWA 1VCXA 1LTID 3CC7A 4BA2I 1EIYB 1N33Q 4BBSB 3RZDL 3KJPA 4NMZA 4Y52L 2DSXA 3UDGA 1YNJD 5C0XJ 3HS0C 3B6YA 4NXML 1PXUA 5KYLA 2R7ZH 1FD7D 1EIGA 1WJJA 2VQFL 4K8JA 1MBYA 4XT3B 1SMUA 1E24A 1WD0A 1JICA 2Q8TA 1G6PA 2FXQA 1HNWL 1IU5A 1NNXA 1KDAA 2L12A 4FNFA 1P8LA 2F0WA 4AR3A 3KLSA 3RZ6A 3DEPA 3I4NG 1TWGB 4DNRB 3BG3A 3NBHA 5IWAQ 1XMOL 4BY7L 3RMHA 4C3JH 2JA6H 5DM61 2B2YC 4R4IA 1PZKD 1GXDC 3FKIG 4DUYL 5C3EH 3U4ZA 1YITA 5BN3A 1PH3A 3HKZP 1HH2P 4QL5A 4OO1H 3I4MB 1CA5A 1R0HA 4R4TA 4HSPA 2JA8H 1SNPA 1SNQA 1O78A 2Z6KA 2CHBD 5TSSA 4L8JA 2B2YA 4XXEA 5MF6A 4K6LA 2EY1A 1X54A 4OGQC 1E1OA 2PI2A 3J80i 4GZYC 4CKCA 5CGKA 2K5DA 1F9SA 3GTPB 1VQEA 2UUBL 3D6CA 1C48A 3HOWG 2NVQH 3DMUA 3W1GA 1AFPA 1H9SB 3NWTA 2GMGA 1HA6A 3I2ZA 2LKVA 3ND8A 2Q2UA 4UP9A 3RUZA 3M9BA 5FJ8H 3AEVA 2A19A 4IPGA 2NN6H 2F1MA 3HOVB 2NVXB 2I5MX 1LTRD 3K5OA 1G8ZD 4KI0A 4JI7Q 5HGQA 3A0JA 1TKWB 3MVVA 1X3QA 2F0GA 3I73A 4DR6L 5IP7L 4DGZA 4JI6Q 1G91A 2ZTEA 4L5TA 1J5EQ 2KCMA 5E1FA 3S2DB 4H0LC 3P2AA 4BBRL 2HUGA 3KLRA 1PH1A 5IGDA 1SFOH 1VQ6A 2C5CA 4A3IG 3WOFA 3GDEA 1X3FA 4HCSA 1B53A 3D31A 5FK9C 3S1NL 2F0VA 3GTGL 5J39A 1JJ2A 4CDCC 4CDFC 4DV0L 4HAEA 1OWBA 5DM63 1WCMG 1HRJA 4RKBA 4AR4A 5AI3A 4HJ7A 5E4WC 2E8GA 5HY6A 1CHQD 5IYBH 1HR0W 1K73C 1HUNA 4RGMA 1SXTA 3CCUA 1AN8A 1Y1VB 1E0BA 4A3MG 1LLRD 1JOKA 2Z4HA 2A5HA 1I3QL 1ZRPA 1QWYA 2B2UC 5ELCA 3GTKH 1HXYD 3HOUB 1J6QA 1WTWA 1XNQQ 1XWEA 1CADA 2B3GA 1O80A 3S17L 4ZQ3A 4JI5L 3M3YL 2R92H 1S30A 5JEAJ 3IU3I 5KNDA 3OSOA 2R3ZA 4A3JB 2G9HD 3TZDA 2GVAA 2BDOA 4RH6A 3T51B 3FDJA 1QUQB 3P20A 3PZAA 4IJLA 4X6AL 2D62A 4DV1L 4DXGA 3PQIA 2BH2A 4A3CG 1NR2A 1HNZQ 5JVH1 4E6YA 1PH8A 2X69A 1E3PA 1IBKL 3EN2A 3D8GA 2JA7L 4YHHQ 4AI2A 3HKSA 2XWBB 2CKCA 1EQRA 1YZ6A 2ZJRA 4WFN1 5LL6X 4AI0A 1EOTA 5DLQE 2K52A 1QNKA 1I6HL 1BCPC 3V96A 1FR3A 4K5XA 3S2HH 3M85A 3PUXA 3STBD 3BDLA 4ILWA 3H0GG 4A76A 1PRTF 1YUXA 2K7VA 3SE0A 4LF7Q 4IALA 1RCVD 3CD6A 1IW7C 4BWGB 4A3DG 3IL8A 2KOLA 1GKHA 2ES2A 3JC62 1VQ5A 1W6KA 3KYHC 3PMFA 3F8TA 2V3BB 5K36G 5IOCA 4DV3L 2MO0A 3CQZH 4JAEA 4JBMA 1AP0A 1FGBD 1R4PB 2LCQA 2A6ED 5GAHc 1Q81C 4PG3A 1ZEQX 3CP0A 4YCUA 1SNOA 4XT1B 5C6AA 3S16L 1R9TB 5EKIA 1Y1WL 4JOIA 4MN3A 2BA0A 1CKNB 3TP8A 4KD4A 1T9HA 1B9MA 3K7UC 1M1KC 1BQQT 1F4LA 2R6GA 5FLML 1SMMA 2AUJD 3AQQA 3J81c 2UXDQ 5D14A 2ZTDA 3HOWL 2OTJA 1MGSA 1VZGA 2DGYA 2UUCL 1QVFA 1NJIC 4NW2A 5IT9c 5BR8Q 1VQOA 1Q7YC 2B2VC 3PIO1 4DR1Q 5ELNA 1PLFA 3F1ZA 3PIP1 3GTLH 2Z6BA 4YCWA 2HQEA 5JOBA 4HCEA 3T16A 1FJGQ 4IUUA 1HR0L 1K0RA 1VS0A 3S1QL 2WAQP 1NXGA 4HIOA 5JVH3 3PIOA 2YU9B 1Q46A 1PRTC 3HOYG 4LF9L 2AUSB 3RR5A 4GKJQ 5M5WB 1A3TA 1V1PA 3P1HA 4HMJA 1ASZA 1GUNA 2NZHA 5M5YB 1QCVA 2HCIA 4EQOA 5M5XL 3LGJA 4DK0A 4L5SA 3A8IE 3RZDB 1BE7A 3OMGA 4RCNA 4HIKA 2RDGA 2F0SA 2Q2TA 8RXNA 1DZ1A 1OXSC 4JCVE 4G7HC 2PPBC 1O7ZA 1KIXA 1KL9A 1HFNA 5FJ8G 4GOPC 1KXLA 3BZDB 1L2FA 1LM0A 3SK5A 5AFWA 2OQKA 1Y8OB 1XTDA 2NYDA 1MHWC 3GO5A 4C2M1 5DEHA 4NKLA 2KCCA 2XNAC 4S3SA 2IW3A 5IIFA 2R7FA 1PYSB 2XJRA 4BY7B 4GKKQ 2BA1A 1TS5A 1TR5A 4DR2Q 4A3KG 3GTMH 2K01A 2ERJA 4KN4C 1VMPA 1B4OA 1XPUA 4BXXG 2V0EA 4GS3A 1X9NA 1N36L 1FNWA 3JAMc 4X3SA 3PIO3 2HT1A 1JWSD 2J9UB 1HFGA 2NZOA 3GTOB 3GTJH 3CPWA 2C6BA 3PIP3 4IOAA 2AQCA 5J22A 3PO2H 2EJMA 3NBIA 3TP7A 4BY1H 1EWIA 1AEXA 3PO3L 2VUML 5IP9L 3SK4A 1KLGD 3CMAA 4JI8Q 1K3RA 1SE2A 2PPTA 4LUOA 2RSOA 2IJ0A 4CDDC 1DXMA 2Z0SA 2ICIA 3F2DA 2IX0A 1FHMA 1YJWA 1H9SA 2A1AA 3KDFB 1EQVA 3DHQA 3OW7A 5JJKA 3UE0A 5M9OA 4IFDG 4K0KL 4FF3A 5EBCA 1I4GA 1X56A 3SS2A 3KFUA 1QZGA 3H3VI 1ENFA 1X6OA 5M3MH 2ZM6Q 5F2DA 2E2HL 3B0AB 1IKLA 2I07B 4AI1A 5CMDA 1STBA 2LS01 1JJCB 3LNNA 1YNND 4JK1C 1JB7A 3NSWA 3X3MA 4BBRB 2R93B 5EINC 3MXNA 1VZHA 3KYVA 3R2TA 1WD1A 4JV5L 5JJLA 5M3FL 4I7AA 4R8NA 4AHWA 2D2CC 4NXNL 3GTQL 1QILA 3GTGB 1BOSA 2CH4W 2K32A 1A63A 2KBNA 3HGBA 2JA5H 1AE2A 2WACA 3K0XA 1P16A 1EU4A 1PFUA 3JAMi 4B3TQ 4P75A 1EU3A 1JE4A 5COYA 3HOZH 4MTNA 4A3FH 1CSQA 4JI2Q 4KY6A 1TIID 4DNTB 4K6DA 3PV0A 4KN7C 5FO7B 2LFNA 1B44D 1GUSA 3BDOA 2NB0A 1PMRA 2RF4A 1X3PA 1I3QB 1SMYD 3DM3A 1TVXA 1VDZA 1DCZA 2OWOA 3I91A 5MFPA 2PYKA 2K6AA 4LF4L 3RZOH 3DXJC 2WAQG 4H13C 2F4VL 3S17B 3GTPL 3NELA 5I2XA 1K83H 3DEOA 2IWHA 1RTNA 1V8QA 2QEXA 3DWPA 3J81j 2UUAL 1EWCA 1OXXK 1VQIA 5ELDA 3MXGA 1I4HA 1RHPA 2RDHA 3BJUA 2ZJPA 1QUQA 1FVIA 1VMCA 3NPPA 4KK7A 1TXYA 2BE5C 3HKZE 1YI2A 4Z9CB 4KY5A 3I4NH 2FINB 2ZXOA 2F0JA 3E6ZX 1WFQA 2LXKA 5NUCA 4JBKA 2PMZE 2JA6L 4C3IG 1R0GA 5KYIA 3FKIH 2JA7B 5C3EL 3CU7A 1TWFB 1K8GA 2K04A 4O1NA 4LF8Q 2VB3X 2F0HA 3OW2A 1I6HB 2PQAB 3ITPA 3BVMA 1W2BA 4JI0L 4QIWE 2JA8L 3IKJA 1SRUA 4LJZC 1STAA 2JN4A 2PSMC 2N49A 1H9KA 3MXPA 4B3ML 1VQNA 4DR3Q 2A6HC 4X3KA 1BVSA 2ZT9C 2KKDA 4XYOA 4HSVA 4IUQA 4HJ5A 4LF6L 1Y69U 3TP6A 3M4YA 2V0FA 5ELFA 1C4QA 4IUPA 3S1MH 1OXTA 3C1EA 1PA6A 1SYEA 2C35B 3LWUA 3OWFA 3VA7A 4U671 4LFBQ 3I3CA 5AI2A 3S16B 1Y1WB 1I94Q 5IE8A 1W3SA 3HG9A 2KHJA 1E2ZA 2J4XA 1U4MA 5LMNQ 3SVMA 2SEBD 4XTCS 2KUMA 2XJSA 3IFDA 4GS7D 4K14A 3HOWB 3MEHA 1G2SA 4Q0FA 2NTSA 2XN9C 3FEWX 4QCLA 3TREA 4IFDI 4QB4A 2FMCA 4A3JL 4A3IH 3RZTA 3K5LA 1GUWA 2PYAA 4XDXA 1BUVT 4JC0A 4RXNA 2J0TD 1C8CA 1YEZA 2MFIA 2A69D 2RBMA 4JI1L 1CK1A 1IXRA 2WV6D 4A3EL 2WB1G 4IJHA 2Y0SE 3BVGA 4AI3A 1S5ED 3TP5A 4K9FA 2PQEA 1HQMC 3ND9A 3EQLC 4EGVA 2JEAI 2F3VA 3CCRA 1Y8NB 2XSCA 1XPOA 4DV7L 2K33A 2F0KA 1U5KA 4A3MH 3NQTA 4NPSA 4YWMA 1PZXA 2F0UA 1O7LA 2HDLA 3JR7A 1KC8C 2K5NA 2KN9A 5K5PA 7RXNA 2B29A 4KY7A 5ELOA 1SYBA 4C3HG 2E2IH 3HJYB 2MJ8A 4HIDA 4JPBW 5KNCA 1BCPB 4HN7A 1RWDA 4PMCA 1XMQL 3BVZA 4KHPQ 2R92L 2UU9Q 2XWJB
chains in the Genus database with same CATH topology
1Q8KA 3M4QA 4R4CA 4R1JA 3UDIA 4O2DA 4DV2L 1E7ZA 1YIJA 4P73A 4A4IA 1EQQA 1HNWQ 3RLFA 1YVCA 4A3CH 1DX8A 5AN9H 4JYAL 1K8AC 4WJ4A 1V1QA 4QJFA 3E9IA 4L5RC 3H0GH 4DV6Q 2GN5A 2OQ0A 1S72A 4JBJA 4A3DH 3KDFA 3LNLA 1SE8A 4B3SQ 1GVPA 3FHWA 4DK6C 2VY3A 1PHJA 1GO3E 1UE6A 1T9QA 2XJTA 1N34Q 3CAMA 5MFZA 4LUZA 1VQMA 4GOPB 3AYHB 2NVYH 4DNIA 1YV1A 3BZCA 1NBWA 3A5ZB 4IFDJ 2XJQA 1GD7A 4TVMA 3ERSX 4DR7Q 3HOYH 1I50H 1U0LA 3CCLA 1PYBA 3GD7A 3A74A 2NVXH 4X66Q 5FLMG 2CWPA 5RXNA 4MZ9A 1S40A 4A93G 4X65Q 2HHHL 2IHFA 4JI5Q 4X64L 3S1RH 5H1Sc 4JADA 3U58A 4IO9A 2O5JD 2QGQA 4A3LH 2H5XA 2WP8J 4A3KH 2D0PA 4YY3L 2AKWB 1PH4A 4BXXH 4AH6A 4DV1Q 1H95A 1WI5A 3HOXG 2PQAA 1B13A 4DAMA 1R0JA 3HOUH 1B2JA 1SR3A 3EIVA 1G51A 4APVA 3W1BA 1VCIA 5IWAL 1TWCH 1VQ4A 3K7AH 2EXDA 3TS2A 2CR8A 4TVAB 1S3OA 3ULLA 4DV3Q 2UXBL 4AHYA 3KF8B 1DVBA 1IBLQ 1MJEA 1OTCA 3UDXA 1BQ9A 4ME3A 3T1HQ 1M90C 4OX9Q 5IY0A 4UP7A 4Y7NH 4DUZQ 2VL6A 3ICEA 4LFCL 4OONA 3U50C 4IPCA 5MLC3 3CMEA 2JI3A 3PWFA 2YTYA 4NB3A 3MSUA 1IROA 2ZIXA 1IBMQ 4JI7L 4AYBG 2HQLA 5GAHC 4UY8C 4JI3Q 4IOCA 3JC66 4UY81 2YTXA 3RYGA 4JI6L 1D7QA 4LF9Q 4BBSG 1J5EL 3AFQA 2Z3QB 3J7ZC 3J7Z1 3G48A 4BA1I 1T9OA 5GADc 4DAYB 3S15H 1UE5A 1RYTA 3OTOL 3CC4A 1VQHA 4QGUA 1YJ9A 2MS3A 3LPEB 4PMWA 1KRTA 1HNXQ 5M5WH 5J3BA 4JBWA 4RG1A 1S24A 3I4MG 1VQFA 1A62A 4C3IH 1XNQL 4JG2A 4H02A 1RIPA 3J7A5 1LYLA 4Y52H 1N36Q 1N32Q 2AHOB 1JJGA 2VQEQ 2GVBA 3PIPA 2JEBI 3TEHB 2VS1A 3HOVG 4X62L 1LKPA 4ZN1B 1VQCA 4KLKA 1HNZL 3KYWA 4YHHL 1YNXA 5GAEC 1H7VA 4AHXA 4LF7L 4DR4L 4DV4Q 1VQBA 3J81i 2JI1A 4LF5Q 3K80C 4AR6A 4GOPA 3OYYA 4DR5Q 4DPGA 4A3LG 2Q2IA 1SMXA 1Y1VG 1YK5A 1Z9FA 1PH5A 1C9OA 3I7FA 4LFAQ 1ASYA 4O0AA 2PNHA 3HOUG 2I5LX 2UXDL 3L7ZC 5BR8L 2A6HD 4DR1L 4DV5Q 3BZKA 4BBRH 4AQYQ 4C3HH 4A3JG 1FJGL 1BQ8A 4HIMA 5LMUQ 3AFPA 3S1NH 5JJIA 4QY7A 3GTGH 4GN5A 4IPHA 4JAGA 4GKJL 3KYUA 1QVGA 3F2BA 1Q82C 3CCSA 2E5LQ 1BBUA 2RCNA 1I3QH 4JI4L 2XJUA 1B70B 1FGUA 1Q1BA 3I56A 1Q86C 3M4OH 3Q8DA 3S17H 3M3YH 1E22A 2KCTA 1UWVA 1B2OA 4R4OA 4GKKL 1IRNA 4DR2L 5AJ3Q 2ATWA 1VQ9A 3KYXA 1JT8A 1TWAH 1CKMA 1ODHA 3U4VA 2M4YA 3IRBA 4AHZA 2KHIA 2UXCL 4JI8L 4LNQA 2XTIA 4B8CD 3L2PA 2OTLA 1LKOA 2XGTA 2AWNA 1TWHH 2ZM6L 4UP8A 3ZG6A 1PFSA 1CSPA 5FLMH 2HIVA 5LMNW 3I55A 1SMWA 1VQ7A 1A8VA 1XNRQ 5GAGc 4XIGS 1RL2A 4B3TL 1O7IA 1K9MC 3L0OA 5JEAG 4JI2L 4A93H 1WOCA 4B3RQ 1N8RC 1FL0A 4R4QA 1Q1EA 4BY7G 3S1QH 4KHZA 1CKNA 3FP9A 3SGIA 3A44A 2ALYB 2BH8A 3JC63 4LW1A 5M5XH 3G4SA 3HOXH 1RDVA 4POFA 4J15A 1FHHA 1PVOA 3RLOA 1IZ6A 1VQDA 1Z47A 3D0FA 5C4JH 3TS0A 5IP7G 3K35A 4ALPA 3TQYA 4LF8L 4BBRG 2R93G 1A0IA 1XPRA 2N78A 1KHIA 4XXBB 3G71A 1NMFA 3K81C 3S24A 4NXMQ 2VQFQ 1X3EA 4EQ5A 4EX5A 3PUWA 3TRZA 4G6BA 1C7YA 1VQ8A 4OWTB 4LFBL 3RN5A 4LHLA 1I94L 1XMOQ 3E9HA 5LMNL 3MEFA 4DUYQ 2E2HH 1EFWA 4BBSH 1KAWA 3G6EA 2M4VA 2YTVA 1VQAA 1CAAA 1YUZA 1VZIA 5M3FH 1IU6A 1C0AA 2UUBQ 3GTQH 1B7YB 3RN2A 3CPFA 4GN3B 2EQSA 1TWGH 4PZ8A 2HHHQ 4X64Q 3M7NA 2JA7G 2A68D 4HJAA 3KF6B 2IHEA 4DR6Q 2EIFA 2I5HA 3I4MH 2WAQE 4YY3Q 4KHPL 4XGHA 2UU9L 3GTPH 3RLNA 1HJPA 2QA4A 1S2ZA 3HFZB 4DV0Q 3PUYA 3T1YL 3HOVH 1NE3A 1Y1WG 5E7NA 2M6OA 1AE3A 4A3GG 1D8LA 1B71A 3VPBE 4OWXB 2ERSA 4JAFA 1PH9A 2KENA 1IW7D 2Z6KC 3HOWG 1L1OB 3S2DH 3ER0A 2A8VA 2UXBQ 4OWWB 2HIXA 1PH7A 2DUDA 1R0FA 4DV6L 2I0QA 1SN8A 4PZ7A 1JE5A 2CFMA 2RHSB 4AR5A 1QZHA 4B3SL 2K50A 2M6PA 4LFCQ 4GLVB 1L0WA 1N33L 1Y1VH 3ZJYC 1WYDA 1KRSA 1CUKA 1N34L 2IX1A 1IBKQ 2IT1A 4POGA 1CKOA 2CCZA 3VDYA 4LWCA 1V9PA 1VQLA 3MXNB 2QL0A 4A3JH 2YYZA 1BKBA 2WB1E 2ZTCA 4DR7L 2WFWA 3EBEA 2B63G 1X3GA 3KOJA 1G291 3PUZA 4A3EH 2VNUD 3OTOQ 3A5UA 5FLXc 1UEBA 4X66L 3CF5A 2K75A 4RMFA 3KYYA 3PO3G 2VUMG 3CCVA 5IP9G 1YBYA 1IL2A 3PCOB 5MGNA 2UUCQ 5IYDG 2AMCB 4X65L 1MIUA 5GADC 3H15A 5H1SE 4ZN3B 1HR0Q 2Q2HA 1BRFA 1SLJA 2LXJA 1GM5A 2K2DA 6RXNA 1LUZA 2JK8A 1R9TH 3J7Y1 4X62Q 1RYQA 1Y14B 2PI2E 1HZAA 3WWVA 5M3FG 2RHQB 3CW2C 3WWLA 2IY5B 2YU9H 4IPDA 4DR4Q 3QVDA 2K5VA 4JOIC 1PV4A 5M5YH 3HKZG 3PKJA 2N3SA 5C44G 2YV5A 2K5HA 1VQGA 4GLXA 2VZAA 3RZDH 1IBLL 2JE6I 1EYGA 3MPSA 3T1HL 4OX9L 2V1CC 2R7ZG 2JA9A 4V196 4DUZL 3PGZA 1RB9A 4AIMA 3NEMA 1E1TA 1IBML 2E2JH 4K0KQ 4BY7H 4JI3L 2JA6G 4GLAC 5K2ME 5C3EG 3KF6A 1YK4A 4OO1G 3GTOH 2JA8G 3M4PA 1C09A 1WJVA 1NNQA 2PVXA 2BE5D 1YHQA 4JV5Q 2RDVA 4JI4Q 4OXPA 4GN4B 4NXNQ 3PSIA 2NN6G 1UE1A 5EAYA 4A3BH 5IYCH 1OXVA 4GNXB 3P8BA 1L1OC 1HNXL 1OXUA 2Y0SG 1LKMA 4P71A 1B8AA 2AWOA 2CKAA 4UPAA 5IP7H 3DLLA 4L5QA 1L1OA 2R93H 5GAEc 5GROA 2MQHA 5C0XG 3NENA 3F2CA 1N32L 4P74A 4LF4Q 1EIFA 2PVEA 2F4VQ 2VQEL 1X55A 3B08B 1UE7A 1PH6A 3STBC 2UXCQ 4A3EG 2UUAQ 1HZ9A 5IYBG 1HZCA 3S14H 5C4XH 4YCVA 1QVCA 3CXCA 1RDGA 3CCQA 2R92G 4JI0Q 4DV4L 3UE1A 2ID0A 2ASBA 4LUVA 4LF5L 4YWKA 4DR5L 4B3MQ 4P72A 4LHNA 1KQSA 1Z92B 4LF6Q 4X6AH 1KD1C 4TQUS 4AYBE 3NBHB 4LFAL 1VQKA 5JVG1 3ULPA 4HJ9A 2MO1A 2JA7H 1NTGA 1TWFH 2K14A 4QQBX 1I6HH 5GQOA 2L15A 1DGSA 2MNAA 4DV5L 4AQYL 1XJVA 5LMUL 4WJ3M 3PKIA 1V43A 5GAGC 1T9PA 1YJNA 3NFPI 3ULJA 2B5ID 4OO1I 2JI2A 2N8NA 1MKHA 4JI1Q 3S16H 1Y1WH 2E5LL 2OCEA 2F52A 2HR5A 4A3GH 4MNOA 3W5OA 4DV7Q 1E8JA 1IYJB 3BU2A 3RNUA 3HOWH 2NN6I 4DK3C 4DKAC 1JMCA 1EOVA 1NY4A 1VQPA 1XMQQ 1PH2A 4DV2Q 5AJ3L 2H12A 1OWCA 3K8AA 5C0XI 2XJVA 1R0IA 2AYJA 2LSSA 3PF4A 4PZ6A 4JYAQ 2ZJQA 4FDBA 4A3BG 5IYCG 4TPUA 2CQOA 1Q12A 1NMGA 3WWNB 2CWAA 3I4OA 3E0EA 2B63H 1SROA 1WCMH 1QYBA 3KJOA 2JQOA 4HJ8A 2CKZB 3PO2G 1HZBA 4DR3L 4BY1G 3QQCE 3PO3H 2VUMH 5IP9H 1XNRL 1BFYA 3PF5A 3UDFA 5IYDH 4GNXC 1AH9A 4B3RL 1YHAA 1BBWA 2VW9A 1LTLA 3CCMA 5C4XG 1NXEA 1X65A 2Z3RB 4GNXA 2K4KA 2R7DA 5M3MG 5EIOC 1JYBA 3PUVA 3T1YQ 1I5FA 4YWLA 1MJCA 3CC2A 3CCJA 1EUJA 2JA5G 2L0ZA 3H3VH 2D0OA 3HOZG 4A3FG 3KLWA 1YHBA 4C2MH 1VQJA 4A75A 1N9WA 3J80c 2NVTH 5C44H 3CCEA 2Q2TA 2JJQA 4BA2I 5DM71 2C6AA 2XJPA 2F3IA 3CC7A 1VCXA 1EIYB 1N33Q 3KJPA 2DSXA 3UDGA 5C0XJ 3B6YA 4NXML 2R7ZH 1WJJA 2VQFL 1SMUA 1E24A 1G6PA 2FXQA 1HNWL 1IU5A 1P8LA 4AR3A 3RZ6A 3I4NG 1XMOL 5IWAQ 4C3JH 2JA6H 5DM61 4R4IA 3FKIG 4DUYL 5C3EH 3U4ZA 1YITA 1PH3A 1HH2P 4QL5A 1R0HA 4R4TA 2JA8H 2Z6KA 5MF6A 1X54A 1E1OA 2PI2A 3J80i 1VQEA 2UUBL 2NVQH 3W1GA 2GMGA 3I2ZA 2Q2UA 4UP9A 3M9BA 5FJ8H 3AEVA 2A19A 4IPGA 2I5MX 4KI0A 4JI7Q 5HGQA 3A0JA 4DR6L 4JI6Q 2ZTEA 4L5TA 1J5EQ 2KCMA 3P2AA 1PH1A 1SFOH 1VQ6A 4A3IG 3GDEA 1X3FA 3D31A 1JJ2A 4DV0L 1OWBA 1WCMG 4AR4A 5AI3A 4HJ7A 5HY6A 2E8GA 5IYBH 1HR0W 1K73C 3CCUA 4A3MG 1ZRPA 3GTKH 1J6QA 1XNQQ 1CADA 2B3GA 4JI5L 2R92H 1S30A 5JEAJ 3IU3I 2GVAA 1QUQB 3PZAA 4IJLA 2D62A 4DV1L 2BH2A 4A3CG 1HNZQ 5JVH1 4E6YA 1PH8A 1E3PA 1IBKL 3EN2A 4YHHQ 4AI2A 3HKSA 2CKCA 1EQRA 1YZ6A 2ZJRA 4WFN1 4AI0A 5DLQE 2K52A 3S2HH 3M85A 3PUXA 3STBD 3H0GG 4A76A 1YUXA 4LF7Q 3CD6A 4A3DG 2ES2A 1GKHA 3JC62 1VQ5A 3KYHC 5K36G 3F8TA 2V3BB 4DV3L 2MO0A 3CQZH 4JAEA 4JBMA 2LCQA 2A6ED 5GAHc 1Q81C 4PG3A 3CP0A 4YCUA 4JOIA 2BA0A 1CKNB 1T9HA 3K7UC 1M1KC 2R6GA 1SMMA 3AQQA 3J81c 2UXDQ 2ZTDA 2OTJA 2DGYA 1VZGA 2UUCL 1QVFA 1NJIC 5IT9c 5BR8Q 1VQOA 1Q7YC 3PIO1 4DR1Q 5ELNA 3F1ZA 3PIP1 3GTLH 4YCWA 1FJGQ 1HR0L 1K0RA 1VS0A 1NXGA 4HIOA 3PIOA 1Q46A 3HOYG 4LF9L 3RR5A 4GKJQ 1ASZA 2NZHA 1QCVA 3LGJA 4L5SA 1BE7A 4HIKA 8RXNA 1OXSC 4JCVE 1KIXA 1KL9A 5FJ8G 4GOPC 1KXLA 1L2FA 1LM0A 2OQKA 1XTDA 2NYDA 3GO5A 2R7FA 1PYSB 2XJRA 4GKKQ 2BA1A 4DR2Q 3GTMH 4A3KG 2ERJA 1XPUA 4BXXG 2V0EA 4GS3A 1X9NA 1N36L 2HT1A 3JAMc 2J9UB 2NZOA 3GTJH 3CPWA 2C6BA 4IOAA 3PO2H 4BY1H 1EWIA 3CMAA 4JI8Q 1K3RA 2PPTA 4LUOA 2Z0SA 3F2DA 1YJWA 2IX0A 1FHMA 2A1AA 3KDFB 5JJKA 3UE0A 4IFDG 4K0KL 1X56A 3KFUA 3SS2A 1QZGA 3H3VI 1X6OA 5M3MH 2ZM6Q 3B0AB 4AI1A 1JJCB 1JB7A 5EINC 1VZHA 3KYVA 4JV5L 5JJLA 4AHWA 4NXNL 1A63A 2KBNA 2JA5H 1AE2A 3K0XA 1P16A 3JAMi 4B3TQ 4P75A 3HOZH 4MTNA 4A3FH 1CSQA 4JI2Q 3PV0A 2RF4A 3DM3A 2OWOA 5MFPA 4LF4L 3RZOH 2WAQG 2F4VL 3NELA 1K83H 2QEXA 3J81j 2UUAL 1OXXK 1VQIA 2ZJPA 3BJUA 1QUQA 1FVIA 1TXYA 3HKZE 1YI2A 3I4NH 1WFQA 2LXKA 4JBKA 2PMZE 1R0GA 3FKIH 1K8GA 4LF8Q 3OW2A 2PQAB 1W2BA 4JI0L 4QIWE 1SRUA 2PSMC 2N49A 4B3ML 1VQNA 4DR3Q 1BVSA 2KKDA 4HJ5A 4LF6L 2V0FA 3S1MH 1OXTA 1PA6A 2C35B 4U671 4LFBQ 5AI2A 1I94Q 5IE8A 1W3SA 2KHJA 5LMNQ 4XTCS 2XJSA 4GS7D 3TREA 4IFDI 4A3IH 3RZTA 2PYAA 4JC0A 4RXNA 1YEZA 2MFIA 2A69D 4JI1L 1IXRA 2WB1G 4IJHA 2Y0SE 4AI3A 4K9FA 2JEAI 3CCRA 1XPOA 4DV7L 1U5KA 4A3MH 4NPSA 4YWMA 1KC8C 2K5NA 2KN9A 7RXNA 2B29A 5ELOA 2E2IH 4HIDA 1RWDA 1XMQL 4KHPQ 2UU9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYX A;  1Q8K A;  3M4Q A;  4R4C A;  1JT8 A;  4R1J A;  3UDI A;  1TWA H;  1CKM A;  4JI6 Q;  3U4V A;  2ZTE A;  3NEM A;  1E1T A;  4L5T A;  2M4Y A;  4O2D A;  1IBM L;  4DV2 L;  1J5E Q;  2R93 G;  2KCM A;  3IRB A;  1E7Z A;  2E2J H;  3HOZ H;  1YIJ A;  1PH1 A;  1SFO H;  4K0K Q;  4P73 A;  1VQ6 A;  2KHI A;  4A4I A;  4BY7 H;  4JI3 L;  4A3I G;  4BA2 I;  4JI8 L;  2UXC L;  1EQQ A;  1HNW Q;  4LNQ A;  2JA6 G;  4GLA C;  3GDE A;  1X3F A;  1YVC A;  3RLF A;  3D31 A;  5C3E G;  2XTI A;  4A3C H;  1DX8 A;  3L2P A;  2OTL A;  1LKO A;  3KF6 A;  1YK4 A;  4OO1 G;  2XGT A;  1JJ2 A;  4JYA L;  4DV0 L;  1K8A C;  3GTO H;  2JA8 G;  3M4P A;  1C09 A;  2AWN A;  1WCM G;  1TWH H;  4WJ4 A;  4AR4 A;  5AI3 A;  4HJ7 A;  5HY6 A;  2E8G A;  1NNQ A;  5IYB H;  2PVX A;  1V1Q A;  2ZM6 L;  4QJF A;  1HR0 W;  1K73 C;  3E9I A;  4UP8 A;  2RDV A;  1YHQ A;  4L5R C;  3H0G H;  3CCU A;  4OXP A;  4A3M G;  4JI4 Q;  4JV5 Q;  4DV6 Q;  2GN5 A;  2OQ0 A;  4GN4 B;  1S72 A;  4NXN Q;  4JBJ A;  1ZRP A;  3PSI A;  3GTK H;  2NN6 G;  4A3D H;  3KDF A;  1UE1 A;  5EAY A;  4A3B H;  1J6Q A;  5IYC H;  1PFS A;  1CSP A;  1XNQ Q;  5FLM H;  1SE8 A;  1CAD A;  2B3G A;  1OXV A;  4GNX B;  4B3S Q;  1GVP A;  3FHW A;  4DK6 C;  2HIV A;  5LMN W;  4JI5 L;  3I55 A;  1L1O C;  2VY3 A;  1HNX L;  1SMW A;  1OXU A;  1PHJ A;  1VQ7 A;  1A8V A;  1LKM A;  1S30 A;  2Y0S G;  5JEA J;  1XNR Q;  2R92 H;  1GO3 E;  4P71 A;  1B8A A;  4XIG S;  1RL2 A;  2AWO A;  4B3T L;  1O7I A;  4UPA A;  5IP7 H;  3DLL A;  1K9M C;  1UE6 A;  3L0O A;  4L5Q A;  1T9Q A;  5JEA G;  4JI2 L;  4A93 H;  1WOC A;  2GVA A;  4B3R Q;  1N34 Q;  1L1O A;  2R93 H;  1QUQ B;  1N8R C;  1FL0 A;  4R4Q A;  3CAM A;  1Q1E A;  4BY7 G;  5GRO A;  3PZA A;  2MQH A;  4IJL A;  2D62 A;  3NEN A;  4KHZ A;  5C0X G;  3F2C A;  3S1Q H;  4DV1 L;  1N32 L;  4P74 A;  1CKN A;  4LF4 Q;  1EIF A;  2BH2 A;  2PVE A;  2F4V Q;  4LUZ A;  4A3C G;  2VQE L;  3FP9 A;  1X55 A;  1HNZ Q;  3SGI A;  1PH8 A;  3A44 A;  4GOP B;  3AYH B;  1VQM A;  1E3P A;  2ALY B;  2BH8 A;  2NVY H;  3JC6 3;  1UE7 A;  1IBK L;  4DNI A;  1PH6 A;  3EN2 A;  4LW1 A;  1YV1 A;  3BZC A;  3STB C;  5M5X H;  4YHH Q;  2UXC Q;  3HKS A;  1NBW A;  4A3E G;  1EQR A;  1YZ6 A;  3A5Z B;  2ZJR A;  2UUA Q;  4IFD J;  5DLQ E;  3G4S A;  1GD7 A;  2K52 A;  1HZ9 A;  3ERS X;  5IYB G;  3HOX H;  1RDV A;  3S2H H;  4POF A;  1HZC A;  3PUX A;  3M85 A;  4DR7 Q;  3HOY H;  1I50 H;  3STB D;  1U0L A;  3H0G G;  4J15 A;  3S14 H;  3CCL A;  1PYB A;  3GD7 A;  4A76 A;  1YUX A;  3A74 A;  5C4X H;  2NVX H;  1FHH A;  4LF7 Q;  1PVO A;  3CD6 A;  3RLO A;  1IZ6 A;  4X66 Q;  4YCV A;  4A3D G;  2ES2 A;  1GKH A;  1QVC A;  3JC6 2;  1VQ5 A;  3KYH C;  5K36 G;  3F8T A;  2V3B B;  5FLM G;  3CXC A;  4DV3 L;  2CWP A;  1RDG A;  2MO0 A;  3I4M G;  1VQD A;  1Z47 A;  3CQZ H;  3CCQ A;  4JBM A;  5RXN A;  3D0F A;  4JI0 Q;  4DV4 L;  5C4J H;  2R92 G;  2LCQ A;  3UE1 A;  3TS0 A;  2ID0 A;  4PG3 A;  3CP0 A;  4YCU A;  1Q81 C;  4LUV A;  2ASB A;  4MZ9 A;  4LF5 L;  5IP7 G;  1S40 A;  4JOI A;  2BA0 A;  1CKN B;  4ALP A;  4YWK A;  4DR5 L;  4A93 G;  1T9H A;  3TQY A;  3K7U C;  1M1K C;  4X65 Q;  4P72 A;  4B3M Q;  4LF8 L;  2HHH L;  4BBR G;  2R6G A;  1A0I A;  2IHF A;  1XPR A;  2N78 A;  4X64 L;  3S1R H;  1KHI A;  1SMM A;  4JI5 Q;  1KQS A;  3AQQ A;  3J81 c;  4LF6 Q;  2UXD Q;  4X6A H;  2ZTD A;  3U58 A;  1KD1 C;  4IO9 A;  2OTJ A;  2DGY A;  2UUC L;  4TQU S;  1QVF A;  4AYB E;  3G71 A;  1NJI C;  5IT9 c;  3NBH B;  5BR8 Q;  1NMF A;  1VQO A;  2QGQ A;  1Q7Y C;  4LFA L;  3K81 C;  1VQK A;  4DR1 Q;  3S24 A;  4A3L H;  5ELN A;  3ULP A;  2H5X A;  3F1Z A;  2WP8 J;  4HJ9 A;  4NXM Q;  3GTL H;  4YCW A;  1FJG Q;  4A3K H;  2D0P A;  2MO1 A;  1X3E A;  4EQ5 A;  4EX5 A;  4YY3 L;  2AKW B;  1NTG A;  1TWF H;  2K14 A;  3PUW A;  4AH6 A;  1K0R A;  4DV1 Q;  1PH4 A;  1HR0 L;  4BXX H;  4QQB X;  1VS0 A;  1H95 A;  1WI5 A;  4HIO A;  3PIO A;  1C7Y A;  1I6H H;  5GQO A;  1Q46 A;  2L15 A;  1VQ8 A;  3HOX G;  2PQA A;  4OWT B;  4LFB L;  1DGS A;  2MNA A;  1B13 A;  4DAM A;  4DV5 L;  1R0J A;  4AQY L;  1XJV A;  3HOY G;  4LF9 L;  3RN5 A;  3RR5 A;  4GKJ Q;  3HOU H;  1ASZ A;  1I94 L;  2NZH A;  5LMU L;  4WJ3 M;  1QCV A;  1XMO Q;  1B2J A;  1V43 A;  3E9H A;  1T9P A;  5GAG C;  3LGJ A;  1SR3 A;  3EIV A;  5LMN L;  1YJN A;  1G51 A;  3MEF A;  4DUY Q;  2E2H H;  1EFW A;  3ULJ A;  4L5S A;  1BE7 A;  4BBS H;  4OO1 I;  4APV A;  4HIK A;  1KAW A;  3W1B A;  1VCI A;  3G6E A;  8RXN A;  2N8N A;  1MKH A;  1OXS C;  1TWC H;  4JCV E;  5IWA L;  1VQ4 A;  2YTV A;  1KL9 A;  1KIX A;  4JI1 Q;  3K7A H;  1VQA A;  2EXD A;  1CAA A;  3TS2 A;  3S16 H;  5FJ8 G;  4GOP C;  1KXL A;  1Y1W H;  2E5L L;  1YUZ A;  1L2F A;  1S3O A;  4TVA B;  3ULL A;  3S15 H;  4DV3 Q;  2OCE A;  1LM0 A;  2F52 A;  5M3F H;  1IU6 A;  2HR5 A;  2OQK A;  4A3G H;  4MNO A;  3W5O A;  4DV7 Q;  1XTD A;  1E8J A;  3GO5 A;  2UUB Q;  2UXB L;  1C0A A;  3GTQ H;  1B7Y B;  1IYJ B;  3BU2 A;  3RN2 A;  3CPF A;  3KF8 B;  4GN3 B;  1DVB A;  3RNU A;  3HOW H;  2EQS A;  2NN6 I;  1IBL Q;  4DK3 C;  4HJ8 A;  2R7F A;  1TWG H;  4PZ8 A;  1MJE A;  1PYS B;  4DKA C;  3UDX A;  1BQ9 A;  1OTC A;  2HHH Q;  4ME3 A;  3T1H Q;  1M90 C;  4GKK Q;  1JMC A;  1EOV A;  2BA1 A;  4X64 Q;  4OX9 Q;  3M7N A;  1NY4 A;  1A63 A;  4DR2 Q;  5IY0 A;  4UP7 A;  4Y7N H;  4A3K G;  3GTM H;  4DUZ Q;  1VQP A;  2VL6 A;  2JA7 G;  1XPU A;  3ICE A;  4BXX G;  4HJA A;  4LFC L;  3KF6 B;  4OON A;  1XMQ Q;  3U50 C;  4GS3 A;  1X9N A;  1N36 L;  2IHE A;  4IPC A;  2HT1 A;  3JAM c;  4DR6 Q;  2EIF A;  2I5H A;  3CME A;  3I4M H;  2NZO A;  3GTJ H;  3CPW A;  3PWF A;  2WAQ E;  2YTY A;  4IOA A;  1PH2 A;  3PO2 H;  4NB3 A;  1IRO A;  1IBM Q;  4DV2 Q;  5AJ3 L;  4BY1 H;  1EWI A;  4JI7 L;  4YY3 Q;  3K8A A;  4KHP L;  5C0X I;  4AYB G;  2HQL A;  5GAH C;  3CMA A;  2UU9 L;  4JI3 Q;  4IOC A;  4JI8 Q;  3JC6 6;  1K3R A;  4UY8 C;  1R0I A;  3GTP H;  2YTX A;  4LUO A;  3RLN A;  3RYG A;  2Z0S A;  3F2D A;  1YJW A;  2IX0 A;  1FHM A;  2LSS A;  4JI6 L;  1D7Q A;  4LF9 Q;  4BBS G;  1HJP A;  2A1A A;  3AFQ A;  3KDF B;  2QA4 A;  1J5E L;  1S2Z A;  3PF4 A;  5JJK A;  3UE0 A;  3J7Z C;  4IFD G;  3HFZ B;  4PZ6 A;  4JYA Q;  4K0K L;  4DV0 Q;  3PUY A;  3T1Y L;  3HOV H;  1X56 A;  1NE3 A;  3SS2 A;  3KFU A;  1QZG A;  3G48 A;  1Y1W G;  2ZJQ A;  5E7N A;  4BA1 I;  4FDB A;  3H3V I;  1X6O A;  4A3B G;  1T9O A;  5IYC G;  5M3M H;  2ZM6 Q;  1AE3 A;  4A3G G;  1D8L A;  1B71 A;  4TPU A;  2CQO A;  1JJC B;  4DAY B;  4OWX B;  2Z6K C;  1UE5 A;  2KEN A;  1RYT A;  1Q12 A;  3OTO L;  1PH9 A;  1JB7 A;  1L1O B;  1VQH A;  4QGU A;  3CC4 A;  1YJ9 A;  1NMG A;  2MS3 A;  3S2D H;  4PMW A;  2VQF Q;  2CWA A;  3ER0 A;  2A8V A;  3I4O A;  3KYV A;  3E0E A;  4JV5 L;  2UXB Q;  2B63 H;  1KRT A;  4OWW B;  5JJL A;  1SRO A;  2HIX A;  1PH7 A;  2DUD A;  1R0F A;  1WCM H;  4DV6 L;  1HNX Q;  2I0Q A;  1QYB A;  4NXN L;  3KJO A;  5M5W H;  5J3B A;  4JBW A;  1SN8 A;  4PZ7 A;  1S24 A;  1JE5 A;  2JQO A;  2KBN A;  4RG1 A;  2JA5 H;  1AE2 A;  1VQF A;  2CFM A;  1P16 A;  3K0X A;  1A62 A;  3JAM i;  4C3I H;  2CKZ B;  4P75 A;  4B3T Q;  3PO2 G;  1XNQ L;  2RHS B;  4AR5 A;  4MTN A;  1QZH A;  1HZB A;  1CSQ A;  4JG2 A;  4JI2 Q;  4A3F H;  4B3S L;  4H02 A;  1RIP A;  4DR3 L;  4BY1 G;  3PV0 A;  3J7A 5;  1LYL A;  2K50 A;  3PO3 H;  4LFC Q;  4GLV B;  2VUM H;  5IP9 H;  1XNR L;  4Y52 H;  1L0W A;  1N36 Q;  1N33 L;  1BFY A;  3PF5 A;  1N32 Q;  1Y1V H;  2AHO B;  3ZJY C;  3UDF A;  2RF4 A;  5IYD H;  1JJG A;  1WYD A;  4GNX C;  1AH9 A;  3DM3 A;  2VQE Q;  4B3R L;  2GVB A;  3PIP A;  1KRS A;  1CUK A;  1BBW A;  1YHA A;  2JEB I;  3TEH B;  1N34 L;  2VW9 A;  2IX1 A;  2VS1 A;  1LTL A;  1IBK Q;  2OWO A;  2IT1 A;  4POG A;  3CCM A;  3HOV G;  5C4X G;  1CKO A;  1X65 A;  2CCZ A;  4X62 L;  3VDY A;  4LF4 L;  2WAQ G;  4LWC A;  2F4V L;  3RZO H;  1LKP A;  4GNX A;  1V9P A;  1VQC A;  2K4K A;  3NEL A;  4KLK A;  1HNZ L;  2R7D A;  1VQL A;  5M3M G;  3KYW A;  3MXN B;  1K83 H;  2QL0 A;  1JYB A;  3PUV A;  2QEX A;  4A3J H;  2YYZ A;  3T1Y Q;  4YHH L;  1I5F A;  3J81 j;  2UUA L;  1YNX A;  5GAE C;  4YWL A;  1OXX K;  1BKB A;  1VQI A;  1MJC A;  3CC2 A;  2WB1 E;  2ZTC A;  1H7V A;  3BJU A;  2ZJP A;  4DR7 L;  1QUQ A;  2WFW A;  1FVI A;  3EBE A;  2B63 G;  1X3G A;  1TXY A;  3HKZ E;  1YI2 A;  3KOJ A;  1G29 1;  3CCJ A;  3I4N H;  3PUZ A;  4LF7 L;  4A3E H;  4DR4 L;  2VNU D;  3OTO Q;  3A5U A;  5FLX c;  4DV4 Q;  2JA7 H;  1UEB A;  1WFQ A;  1EUJ A;  1VQB A;  2LXK A;  4X66 L;  4JBK A;  2JA5 G;  2PMZ E;  3J81 i;  4LF5 Q;  3K80 C;  4AR6 A;  4GOP A;  3H3V H;  1R0G A;  2D0O A;  3FKI H;  3OYY A;  3HOZ G;  1K8G A;  4A3F G;  3KLW A;  3CF5 A;  2K75 A;  4DR5 Q;  4DPG A;  4LF8 Q;  1YHB A;  4RMF A;  4C2M H;  4A3L G;  3KYY A;  3OW2 A;  1VQJ A;  2PQA B;  3PO3 G;  1W2B A;  4JI0 L;  2VUM G;  3CCV A;  4QIW E;  5IP9 G;  4A75 A;  1N9W A;  2Q2I A;  1YBY A;  1SMX A;  1IL2 A;  3PCO B;  1SRU A;  1Y1V G;  2UUC Q;  1YK5 A;  3J80 c;  1Z9F A;  5IYD G;  1PH5 A;  2N49 A;  1C9O A;  3I7F A;  2AMC B;  4LFA Q;  1ASY A;  4B3M L;  4X65 L;  1VQN A;  4DR3 Q;  1BVS A;  5C44 H;  2NVT H;  3CCE A;  2KKD A;  2JJQ A;  1MIU A;  5GAD C;  4O0A A;  2PNH A;  3CC7 A;  2F3I A;  2Q2T A;  1VCX A;  2I5L X;  4HJ5 A;  3HOU G;  4LF6 L;  1EIY B;  3H15 A;  1N33 Q;  2UXD L;  5H1S E;  1HR0 Q;  3L7Z C;  3KJP A;  2DSX A;  3UDG A;  3S1M H;  1OXT A;  5BR8 L;  2Q2H A;  1PA6 A;  5C0X J;  2C35 B;  1BRF A;  1SLJ A;  2LXJ A;  4DR1 L;  4DR6 L;  4LFB Q;  4DV5 Q;  3BZK A;  5AI2 A;  3B6Y A;  4BBR H;  4AQY Q;  1GM5 A;  2K2D A;  6RXN A;  4C3H H;  4NXM L;  2R7Z H;  4A3J G;  1LUZ A;  2JK8 A;  1BQ8 A;  1R9T H;  1WJJ A;  2VQF L;  1FJG L;  1I94 Q;  5IE8 A;  4HIM A;  1W3S A;  2KHJ A;  5LMU Q;  1SMU A;  1E24 A;  3TRZ A;  4X62 Q;  1G6P A;  3AFP A;  2FXQ A;  1HNW L;  1IU5 A;  5LMN Q;  3S1N H;  4XTC S;  1Y14 B;  2PI2 E;  5JJI A;  4QY7 A;  3GTG H;  1HZA A;  3WWV A;  4GN5 A;  4IPH A;  1P8L A;  3KYU A;  4GKJ L;  4AR3 A;  5M3F G;  3RZ6 A;  3TRE A;  4IFD I;  3I4N G;  2RHQ B;  1QVG A;  3F2B A;  5IWA Q;  1XMO L;  1Q82 C;  3CW2 C;  4A3I H;  3RZT A;  4C3J H;  2JA6 H;  2PYA A;  4R4I A;  3CCS A;  3FKI G;  4DUY L;  1BBU A;  5C3E H;  3U4Z A;  2E5L Q;  1YIT A;  4JC0 A;  4RXN A;  1PH3 A;  2IY5 B;  1HH2 P;  1YEZ A;  4QL5 A;  2RCN A;  2MFI A;  2YU9 H;  1I3Q H;  1R0H A;  4IPD A;  4R4T A;  4JI4 L;  4DR4 Q;  3QVD A;  2JA8 H;  2K5V A;  4JI1 L;  1B70 B;  1IXR A;  1FGU A;  1Q1B A;  2Z6K A;  2WB1 G;  4IJH A;  3I56 A;  2Y0S E;  1Q86 C;  1X54 A;  4JOI C;  1E1O A;  2PI2 A;  1PV4 A;  4K9F A;  3J80 i;  2JEA I;  5M5Y H;  3HKZ G;  3Q8D A;  3M4O H;  3CCR A;  1XPO A;  2N3S A;  5C44 G;  3S17 H;  2YV5 A;  1VQE A;  2K5H A;  4DV7 L;  2UUB L;  1U5K A;  3M3Y H;  3HOW G;  2NVQ H;  4A3M H;  1E22 A;  1VQG A;  3W1G A;  4NPS A;  4GLX A;  2GMG A;  4YWM A;  2KCT A;  3I2Z A;  2Q2U A;  4UP9 A;  2VZA A;  3M9B A;  5FJ8 H;  3RZD H;  1IBL L;  1KC8 C;  3AEV A;  2A19 A;  4IPG A;  1UWV A;  1B2O A;  2JE6 I;  2K5N A;  4R4O A;  2KN9 A;  7RXN A;  2B29 A;  1EYG A;  3MPS A;  3T1H L;  4GKK L;  5ELO A;  2E2I H;  2I5M X;  2V1C C;  4HID A;  4OX9 L;  1IRN A;  2JA9 A;  4DR2 L;  2R7Z G;  4DUZ L;  3PGZ A;  4KI0 A;  5AJ3 Q;  4JI7 Q;  1RWD A;  5HGQ A;  1RB9 A;  3A0J A;  1XMQ L;  1VQ9 A;  2ATW A;  4KHP Q;  2UU9 Q;  4AIM A; 
#chains in the Genus database with same CATH topology
 1Q8K A;  3M4Q A;  4R4C A;  4U67 3;  4R1J A;  3UDI A;  4RCO A;  4OHJ A;  4O2D A;  4XQQ A;  4DV2 L;  4G7O C;  3Q24 A;  1E7Z A;  3TSS A;  1YIJ A;  2H1E A;  4P73 A;  4A4I A;  1EQQ A;  2B63 B;  1HNW Q;  1KLU D;  3RLF A;  1YVC A;  4A3C H;  1STG A;  1DX8 A;  1EYA A;  2KVM A;  3FRP B;  2F03 A;  2O2L D;  3MC0 B;  5AN9 H;  2MPM A;  3OWE B;  4JYA L;  1K8A C;  1Y8P B;  2RFK B;  3Q6S A;  4WJ4 A;  4E6I A;  4XQN A;  3PO3 B;  2VUM B;  2VB2 X;  3A56 A;  1V1Q A;  4QJF A;  4KJN A;  1GUO A;  3E9I A;  2E2D C;  4L5R C;  3H0G H;  3Q0A A;  4V19 0;  4IUR A;  4DV6 Q;  2YU9 L;  2GN5 A;  2OQ0 A;  1S72 A;  4JBJ A;  2G5D A;  2F0P A;  4ABN A;  4A3D H;  2QDL A;  3KDF A;  3LNL A;  2D9U A;  1UNS A;  4FYD A;  1Q3L A;  5K36 H;  1SE8 A;  5M5Y L;  1Q8I A;  4B3S Q;  1GVP A;  3FHW A;  4DK6 C;  4KHV A;  3D3R A;  2L55 A;  3EA6 A;  2VY3 A;  1BDO A;  4FXK C;  4L6T B;  1PHJ A;  2E2H B;  1GO3 E;  1JQY D;  3MWY W;  3D4D A;  1MSH A;  4K2L A;  1UE6 A;  2F0T A;  1T9Q A;  1LV9 A;  3VYU A;  4LMQ D;  2XJT A;  1QCB D;  1N34 Q;  5E3F A;  3URY A;  4XQJ A;  1RF2 D;  3CAM A;  1PFM A;  4AYB P;  5MFZ A;  3NK9 A;  5M3F B;  2NWG A;  4LUZ A;  2VXW A;  3FPP A;  3GTQ B;  5HGT A;  1SYG A;  3L3O C;  4V0B A;  1VQM A;  4GOP B;  3AYH B;  5J1Z A;  1SSO A;  2NVY H;  4DNI A;  1YV1 A;  3BZC A;  4OIK A;  2E2J L;  4KMU C;  1NBW A;  2QIL A;  1EEF D;  3A5Z B;  1B3A A;  4C2M B;  4M8A A;  2OXP A;  2XJQ A;  5KIX A;  1RKN A;  4IFD J;  5JPN C;  1KNE A;  1GD7 A;  1JC7 A;  4TVM A;  2JP1 A;  1STH A;  4HMI A;  1PTO B;  1LT6 D;  3ERS X;  4DR7 Q;  3HOY H;  1I50 H;  5IGB A;  1HA5 A;  1QQT A;  1I4Q A;  1U0L A;  2A74 C;  3CCL A;  1EFI D;  1PYB A;  3GD7 A;  3A74 A;  3HAX C;  3G7L A;  2NVX H;  3HKZ B;  3GTO L;  5C44 B;  1D1K A;  4X66 Q;  3J80 L;  5BN5 A;  2N88 A;  4N8F A;  3S9W A;  5FLM G;  2PMZ B;  3W2D A;  1K3B C;  2HD3 A;  2F0I A;  2CWP A;  3SDZ A;  5RXN A;  3U9S A;  4CJ1 B;  5G3L F;  4RKL A;  1SJE D;  2R7Z B;  4MZ9 A;  4QIW B;  1O7Y A;  1S40 A;  1EWH A;  3CRL C;  4F88 A;  4A93 G;  1KAB A;  4A3B L;  4X65 Q;  1EEI D;  5DM7 3;  5IYC L;  1L0Y B;  2HHH L;  3NWS A;  2IHF A;  4JI5 Q;  4X64 L;  3S1R H;  5H1S c;  2RA4 A;  4JAD A;  1TU2 B;  1ZYR C;  3U58 A;  1WTV A;  4IO9 A;  1Z6H A;  2P5Z X;  3SXH A;  2B39 A;  1EIH A;  2XRQ D;  2O5J D;  3J80 E;  2QGQ A;  1EY7 A;  5EQ0 A;  4A3L H;  2H5X A;  4C3J B;  2WP8 J;  2JA6 B;  1EY5 A;  3GTM L;  4A3K H;  2D0P A;  5C3E B;  4YY3 L;  1HCZ A;  2R93 L;  2AKW B;  1PH4 A;  4BXX H;  4AH6 A;  4DV1 Q;  5CV6 A;  1H95 A;  1LTS D;  1WI5 A;  3HOX G;  2JA8 B;  2PQA A;  1B13 A;  4DAM A;  5C4Z A;  1R0J A;  5CV8 A;  3KUP A;  3HOU H;  3NTH A;  3NP8 A;  5IGE A;  3X3N A;  2K05 A;  1B2J A;  1SR3 A;  1PRT D;  3EIV A;  1K8O A;  1G51 A;  2LY7 A;  2EY4 E;  1ENA A;  4APV A;  4FO2 A;  3W1B A;  1VCI A;  5I6W A;  1BCP F;  1D5X C;  3S14 L;  4IFD H;  5IWA L;  1TWC H;  1VQ4 A;  2Q8R E;  4IUN A;  5C4X L;  3K7A H;  2EXD A;  3TS2 A;  3SEB A;  4KTA A;  1GUT A;  3M7G A;  2CR8 A;  2PW7 A;  1M8A A;  4TVA B;  1S3O A;  3ULL A;  1ICF B;  4DV3 Q;  2Y0S B;  2UXB L;  4AHY A;  1ML0 D;  3KF8 B;  1DVB A;  2A68 C;  2B2U A;  2RCF A;  1IBL Q;  3AMU A;  4K2K A;  1MJE A;  1GHK A;  3TME A;  1S5F D;  1JOR A;  1OTC A;  1STN A;  1BQ9 A;  3UDX A;  1CTM A;  4ME3 A;  3T1H Q;  1M90 C;  4OX9 Q;  5IY0 A;  4UP7 A;  4Y7N H;  4DUZ Q;  2VL6 A;  3ICE A;  4LFC L;  4OON A;  3KK7 A;  3U50 C;  2BDN A;  4IPC A;  5MLC 3;  2JA5 L;  3CME A;  2JI3 A;  1YNJ C;  3HZX A;  3PWF A;  5EBD A;  2YTY A;  2PO4 A;  4NB3 A;  4A3E B;  4A3F L;  1EQT A;  3MSU A;  1IRO A;  2ZIX A;  1IBM Q;  4JI7 L;  3E0J A;  4AYB G;  2HQL A;  5GAH C;  4JI3 Q;  4UY8 C;  5FLX L;  1PFW A;  4IOC A;  3JC6 6;  4UY8 1;  1TWF L;  2YTX A;  1F2Z A;  3RYG A;  4JI6 L;  1D7Q A;  4LF9 Q;  4BBS G;  1J5E L;  3AFQ A;  2Z3Q B;  1A2T A;  1SJH D;  3J7Z C;  3J7Z 1;  1JCK B;  1QB5 D;  3G48 A;  3RZO L;  1JB3 A;  4BA1 I;  2R92 B;  3BS1 A;  1T9O A;  2PCF B;  2F0M A;  1NR4 A;  1HPC A;  3KLS X;  5GAD c;  2A73 B;  4DAY B;  5CV7 A;  3S15 H;  1UE5 A;  1RYT A;  3LWV B;  3LWQ B;  3OTO L;  1CHP D;  1NAP A;  1VQH A;  4QGU A;  3CC4 A;  3J7A V;  1YJ9 A;  5FLX E;  2MS3 A;  3N6R A;  3LPE B;  4PMW A;  4DXF A;  1I4P A;  5I4D A;  3ERQ A;  1KRT A;  2Z4I A;  4A3G L;  3I4N L;  1HNX Q;  5CYU A;  5M5W H;  5J3B A;  4JBW A;  4RG1 A;  1S24 A;  3I4M G;  1VQF A;  3R93 A;  4ME5 A;  1A62 A;  4C3I H;  1XNQ L;  4JG2 A;  4H02 A;  1RIP A;  3J7A 5;  1LYL A;  4TKO B;  1WTQ A;  4Y52 H;  3PL5 A;  2CQA A;  1N36 Q;  4R9W A;  1N32 Q;  5C5M A;  2AHO B;  1BBX C;  3H09 A;  1JJG A;  2Q8I B;  2B2V A;  2VQE Q;  4G4K A;  2F0L A;  2GVB A;  3PIP A;  2JEB I;  3TEH B;  2VS1 A;  1SND A;  3HOV G;  4WFN 3;  4F8M A;  1QG7 A;  2L4N A;  5CBE E;  4X62 L;  1LKP A;  4ZN1 B;  1VQC A;  4KLK A;  1HNZ L;  1X32 A;  3KYW A;  2B8G A;  2CW0 D;  4DAV A;  3H3V M;  3GV3 A;  1K0S A;  1EY0 A;  2C9O A;  4YHH L;  2DY7 A;  3D4W A;  5CBA E;  1YNX A;  5ISR A;  5GAE C;  2QCP X;  1H7V A;  3T53 B;  2B2T C;  3K57 A;  3H3V C;  2RKS A;  4AHX A;  4LF7 L;  1CQF A;  5KEE A;  4DR4 L;  3TDQ A;  4DV4 Q;  1UEA B;  4A3I L;  1VQB A;  2PW5 A;  1VF5 C;  1PTO C;  4DK1 A;  2B2W C;  1BR9 A;  2JI1 A;  3J81 i;  3K80 C;  4AR6 A;  2B2T A;  4GOP A;  4LF5 Q;  3OYY A;  2E2J B;  4DR5 Q;  1T5E A;  4DPG A;  4A3L G;  2B63 L;  4N9P A;  3NUC A;  3QR8 A;  2Q2I A;  1SMX A;  1WCM L;  1Y1V G;  1YK5 A;  4FVM A;  4QUF A;  1Z9F A;  1PH5 A;  1C9O A;  3I7F A;  5IOD A;  4LFA Q;  1ASY A;  2FMM A;  4UAI A;  4O0A A;  2PNH A;  3HOU G;  2I5L X;  2UXD L;  4OL7 A;  2D5D A;  3L7Z C;  5BR8 L;  2A6H D;  3FPU B;  3HRZ C;  3QOL A;  1ILP A;  4DR1 L;  4DV5 Q;  3BZK A;  4BBR H;  5IYD L;  4AQY Q;  2E2I L;  4C3H H;  4A3J G;  1FJG L;  1BQ8 A;  2SOB A;  4HIM A;  4A3B B;  2F0Q A;  5LMU Q;  3L9A X;  3U9O A;  3IAY A;  2XRS D;  3AFP A;  3QG1 A;  3S1N H;  5CR3 A;  5JJI A;  4QY7 A;  1TT2 A;  2K5Q A;  3GTG H;  4GN5 A;  4IPH A;  4JAG A;  2EOT A;  3OMC A;  3KYU A;  4GKJ L;  1EYD A;  2RDF A;  4UDU C;  4ULL A;  1QVG A;  1IHZ A;  1D6E C;  1SNM A;  3F2B A;  1Q82 C;  1CA6 A;  2BCO A;  3C3L A;  2LMC B;  3CCS A;  2WB1 P;  3GTM B;  2E5L Q;  1BBU A;  4G57 A;  2F0D A;  4ZYS A;  1KDB A;  2RCN A;  3H9B A;  1I3Q H;  4JI4 L;  3PO2 B;  2XJU A;  1B70 B;  1FGU A;  2O4X A;  1Q1B A;  2NZ1 D;  1PFV A;  3I56 A;  4BY1 B;  1S5C D;  1Q86 C;  1F77 A;  3M4O H;  3Q8D A;  2KEC A;  3D6W A;  4QMG A;  3VR5 A;  3S17 H;  3K5M A;  3H0G L;  3M3Y H;  1E22 A;  3V2T A;  2KCT A;  4B9X A;  2Z1C A;  1UWV A;  4A3D L;  1B2O A;  3DM1 A;  4R4O A;  3S14 B;  4QUC A;  4GKK L;  5C4X B;  1A3V A;  1IRN A;  4DR2 L;  1IYV A;  4ZUI A;  3VYR A;  2NVT L;  5C44 L;  3OIP A;  5AJ3 Q;  2I46 A;  1SBB B;  2ATW A;  1VQ9 A;  5M3M B;  3KYX A;  1JT8 A;  1TWA H;  1CKM A;  1ODH A;  3U4V A;  2M4Y A;  2CH4 A;  3FVQ A;  3IRB A;  2QKI C;  4AHZ A;  2R7Z L;  1GOZ A;  2KHI A;  1ZXT A;  4OEL B;  2HCC A;  4JI8 L;  2UXC L;  4LNQ A;  2AQ3 B;  3H91 A;  5A2Q L;  2XTI A;  1XXG A;  4B8C D;  2DNE A;  3L2P A;  2OTL A;  2EDG A;  1LKO A;  4MTK A;  4FF2 A;  2XGT A;  2JA5 B;  1U4L A;  2NVY L;  3LWR B;  1D2B A;  2KCN A;  3HOZ B;  5JAV A;  1TY2 A;  2AWN A;  4A3F B;  1TWH H;  3GTL B;  4C3J L;  4ZLT F;  2ZM6 L;  4UP8 A;  1QNU A;  3OOC A;  1A6X A;  3H94 A;  3BYY B;  5A2Q E;  3ZG6 A;  1PFS A;  1CSP A;  5D65 A;  4RHS A;  2OF1 A;  5FLM H;  3RZO B;  2HIV A;  5LMN W;  1HUM A;  4DFA A;  3I55 A;  3MAQ A;  1SMW A;  1VQ7 A;  2NVQ L;  1A8V A;  1XNR Q;  1TS2 A;  1ILQ A;  1K83 B;  5GAG c;  2QDB A;  4XIG S;  5IGG A;  1RL2 A;  5FJ8 L;  4B3T L;  1O7I A;  1K9M C;  1DOK A;  3L0O A;  3MZ5 A;  4DAY A;  5JEA G;  4JI2 L;  4A93 H;  4R8I A;  1WOC A;  2L0C A;  3GV6 A;  4B3R Q;  3S1R L;  1N8R C;  1FL0 A;  4R4Q A;  1S5D D;  4C1N K;  1Q1E A;  4BY7 G;  3S1Q H;  3OPO A;  4KHZ A;  3H99 A;  1CKN A;  2TSS A;  4A3G B;  3I4N B;  4PQX A;  4O42 A;  2L1B A;  3FP9 A;  1RTO A;  3SGI A;  3A44 A;  3P7J A;  2ALY B;  2BH8 A;  3JC6 3;  3FKI B;  4LW1 A;  1GUG A;  5M5X H;  4BXX L;  1XYI A;  1SFO L;  3G4S A;  2EYM A;  5LHY 1;  4IN3 A;  2DN8 A;  3HOX H;  1RDV A;  4POF A;  2E76 C;  2F0E A;  3MTS A;  4J15 A;  3TZU A;  1ROD A;  1H9J A;  1FHH A;  1PVO A;  3RLO A;  1IZ6 A;  2F0F A;  1L0X B;  2E74 C;  1LAC A;  3MFG A;  2KJX A;  5IYB L;  1FNU A;  3S1M B;  1VQD A;  1Z47 A;  3D0F A;  4H44 C;  5C4J H;  1TWC L;  4FP5 D;  1ET6 A;  4EVO A;  3TS0 A;  3K7A L;  4CHT B;  1EY9 A;  5IP7 G;  3K35 A;  3GTK L;  4IQZ A;  4ALP A;  3TQY A;  1B50 A;  3LX0 A;  4LF8 L;  4BBR G;  1R4Q B;  1A0I A;  1XPR A;  2R93 G;  2N78 A;  1KHI A;  1EZ8 A;  2WII B;  2AQ2 B;  4XXB B;  4JW0 A;  3G71 A;  1NMF A;  2V4D A;  3K81 C;  4A3I B;  3S24 A;  5KNB A;  2FJ2 A;  1BXT A;  4NXM Q;  5D3I B;  2VQF Q;  1X3E A;  4EQ5 A;  4EX5 A;  3PUW A;  3TRZ A;  3Q22 A;  4G6B A;  1C7Y A;  2NUC A;  1VQ8 A;  1VF7 A;  4OWT B;  4LFB L;  4RAU C;  2Z8L A;  1WCM B;  3H9C A;  2EVB A;  2MP1 A;  4EQN A;  3RN5 A;  1B1Z A;  4LHL A;  1PYW D;  1I94 L;  3T56 B;  5E4X A;  2R61 A;  1XMO Q;  1LTT D;  1MD2 D;  3E9H A;  5LMN L;  4A3M B;  1LT5 D;  1CQV A;  3MEF A;  4DUY Q;  4ZCK A;  1EFW A;  2E2H H;  1K28 A;  4X3U A;  5T1I A;  4BBS H;  4ODG A;  3WOE A;  3S2H L;  1KAW A;  3G6E A;  3K6O A;  3GQB A;  2M4V A;  2YTV A;  2E2I B;  1VQA A;  4F7X A;  1CAA A;  3GP7 A;  1YUZ A;  2XIW A;  5G3L D;  1VZI A;  5M3F H;  1IU6 A;  1C0A A;  5FO9 B;  2UUB Q;  3GTQ H;  1B7Y B;  3RN2 A;  3I72 A;  3CPF A;  4RGN A;  3CQZ L;  3S15 L;  4GN3 B;  4CGY B;  5T1G A;  2EQS A;  2L11 A;  1TWG H;  4PZ8 A;  3T13 A;  4KKU A;  1HQR D;  3BDC A;  4WRD A;  2HHH Q;  1JOO A;  4X64 Q;  2RQX A;  3M7N A;  2JA7 G;  2A68 D;  4ZK9 B;  4HJA A;  3KF6 B;  5A35 A;  2APO B;  2IHE A;  4DR6 Q;  5ELE A;  1EL0 A;  2EIF A;  2I5H A;  3I4M H;  4J6H A;  3AB9 A;  4C3I L;  2WAQ E;  4NDX A;  1KDC A;  4YY3 Q;  4KHP L;  3GTL L;  4XGH A;  2UU9 L;  3GTP H;  3H0G B;  3RLN A;  1U4R A;  3K5N A;  1SDF A;  1HJP A;  2QA4 A;  1S2Z A;  4CKB A;  4A3D B;  3LWP B;  3HFZ B;  4DV0 Q;  1E2V A;  3PUY A;  3T1Y L;  1D1I A;  3HOV H;  1NE3 A;  2N55 A;  1Y1W G;  1BCP D;  5E7N A;  4JVZ A;  2NVT B;  3MQK B;  5C5L A;  2M6O A;  1AE3 A;  4A3G G;  1D8L A;  3W3A A;  1B71 A;  3VPB E;  3T4A C;  2A69 C;  3MHB A;  4OWX B;  2ERS A;  4JAF A;  1QE6 A;  2KEN A;  1IW7 D;  2Z6K C;  4RA8 A;  5EGT A;  1PH9 A;  1L1O B;  3VR3 A;  4J1M A;  2ZXP A;  3S2D H;  4B9W A;  1I6V C;  1JWU D;  3ER0 A;  2EE1 A;  2A8V A;  2UXB Q;  3OIQ A;  4OWW B;  2HIX A;  3RD4 A;  1PH7 A;  2DUD A;  1R0F A;  4DV6 L;  2I0Q A;  2PMZ P;  5DNF A;  1RJT A;  4X3T A;  1SN8 A;  4PZ7 A;  1JE5 A;  2NVY B;  3K58 A;  4EQP A;  1IKM A;  2CFM A;  1F2L A;  1SE4 A;  2RHS B;  4AR5 A;  1QZH A;  4FF4 A;  2B8F A;  3SHL A;  4B3S L;  4QIW P;  2K50 A;  2M6P A;  3F2U A;  4GLV B;  4LFC Q;  3K0Y A;  1L0W A;  1N33 L;  3HOY B;  1I50 B;  3P75 A;  5COR A;  5EPJ A;  1Y1V H;  3ZJY C;  3QWN A;  1V1O A;  2H4O A;  2AUK A;  1WYD A;  1SE3 A;  3GTJ L;  2HDM A;  1KRS A;  1CUK A;  3PO2 L;  1LT3 D;  2SDF A;  1N34 L;  2IX1 A;  1F9R A;  1IBK Q;  3VR2 A;  2IT1 A;  4POG A;  2EPB A;  4BY1 L;  1SYF A;  1CKO A;  2X6L A;  2CCZ A;  3VDY A;  4LWC A;  2RSN A;  4MHE A;  1V9P A;  2NVQ B;  1XTC D;  1VQL A;  3MXN B;  4KKS A;  1U9R A;  3FDT A;  4C3H L;  2QL0 A;  1STE A;  4A3J H;  2YYZ A;  1DOM A;  5C0X H;  1HHV A;  5CV5 A;  1H9M A;  2WIN B;  1BKB A;  3S1R B;  2WB1 E;  2ZTC A;  3QIA A;  4DR7 L;  4B08 A;  1TS4 A;  2EYH A;  2ICE C;  2WFW A;  3CRK C;  3EBE A;  3HEJ A;  2B63 G;  1X3G A;  2L5T A;  3KOJ A;  1G29 1;  5M3M L;  1UUP A;  3PUZ A;  4A3E H;  2VNU D;  3OTO Q;  4ZUJ A;  3A5U A;  5FLX c;  1UEB A;  4CBV A;  4X66 L;  4A3K B;  1I4R A;  1WTR A;  4M1U B;  3CF5 A;  2K75 A;  1SFO B;  2OT2 A;  3SR1 A;  4RFB A;  4RMF A;  3KYY A;  2F4I A;  3DUZ A;  3PO3 G;  2VUM G;  3CCV A;  5IP9 G;  1PTO D;  4MIU A;  2Y0S P;  1YBY A;  1IL2 A;  3PCO B;  3QOJ A;  4DU9 A;  1U4P A;  2BOS A;  3NE5 B;  2M9V A;  5MGN A;  2UUC Q;  2F0N A;  3SK8 A;  3J7Y W;  5IYD G;  2AMC B;  3M4O L;  2EJF C;  4X65 L;  3VR6 A;  3HOZ L;  1MIU A;  5GAD C;  3H15 A;  5H1S E;  4ZN3 B;  1HR0 Q;  1LT4 D;  2Q2H A;  3HP3 A;  1TWC B;  1WTX A;  1BRF A;  1SLJ A;  1DYQ A;  2LXJ A;  1BF4 A;  3C2P A;  3K7A B;  1GM5 A;  3TBI B;  2K2D A;  6RXN A;  4IZ8 A;  1LUZ A;  2JK8 A;  4RHR A;  1R9T H;  3GTK B;  1D5Z C;  4N9T A;  3J7Y 1;  1LTG D;  3BYT B;  3A8K E;  4X62 Q;  3FMC A;  1RYQ A;  3LWO B;  1Y14 B;  2PI2 E;  1TWA L;  2IPK D;  1HZA A;  3WWV A;  2ZXR A;  5M3F G;  4F87 A;  3I90 A;  5IGC A;  1K83 L;  1I4X A;  2RHQ B;  5EJW A;  2EYO A;  4K5V A;  2EYF A;  3CW2 C;  4WJW A;  3O13 A;  4Y7N B;  1CZW A;  4ZRZ A;  3WWL A;  1CFM A;  2IY5 B;  2YU9 H;  4IPD A;  4DR4 Q;  3QVD A;  3UI2 A;  2K5V A;  1TWH L;  1LAB A;  4C56 C;  4JOI C;  1PV4 A;  5M5Y H;  3HKZ G;  4HR7 B;  3PKJ A;  3FKI L;  2N3S A;  5C44 G;  4FXD A;  2YV5 A;  2K5H A;  1PTO F;  3IFT A;  4CJ2 C;  1VQG A;  4GLX A;  3VYS A;  3I70 A;  2VZA A;  3RZD H;  2EY6 A;  1IBL L;  2PZW A;  3S2H B;  1B2T A;  2E75 C;  2JE6 I;  3OHX C;  2AQ1 B;  4RWS C;  3E5S A;  1EYG A;  3MPS A;  2O5J C;  3T1H L;  4OX9 L;  2V1C C;  2R7Z G;  2JA9 A;  4V19 6;  2WAQ B;  4DUZ L;  3PGZ A;  3KBG A;  1RB9 A;  5C4H A;  3R8B A;  4AIM A;  5DAU A;  1MSG A;  4CKE A;  3VA5 A;  3S1M L;  1PFB A;  2K5W A;  3CQZ B;  3NQI A;  4C1N I;  3S15 B;  4A93 L;  3NEM A;  1E1T A;  5JEA H;  1IBM L;  2FFK B;  2F0O A;  4CJ0 B;  2E2J H;  2SNS A;  4K0K Q;  4BY7 H;  4JI3 L;  5CV4 A;  2KEE A;  3CHB D;  4C3J G;  4Q5V A;  2CVR A;  2JA6 G;  4GLA C;  5K2M E;  1TS3 A;  4YIJ A;  5C3E G;  2QEJ C;  3TN2 A;  1BNZ A;  4CDE C;  3KF6 A;  1YK4 A;  5D3D A;  4OO1 G;  3AU7 A;  2JSO A;  4C3I B;  3GTO H;  2JA8 G;  3M4P A;  1C09 A;  1B9N A;  1WJV A;  3J81 L;  1GHJ A;  1JOQ A;  4KV6 A;  5IT9 L;  1NNQ A;  4TSS A;  2PVX A;  3HOX L;  2BE5 D;  3E3X A;  1PFY A;  1YHQ A;  2RDV A;  4JV5 Q;  4JI4 Q;  4OXP A;  2OEO A;  5FOB B;  3G6J B;  4GN4 B;  4H7B A;  5CC4 A;  3K59 A;  4NXN Q;  3PSI A;  1A2U A;  1WVL A;  1Q90 A;  2NN6 G;  2B2W A;  1UE1 A;  5EAY A;  4A3B H;  2L9H A;  1QOH A;  5IYC H;  1PZI D;  1W6J A;  1RD9 D;  4QF4 A;  1DJR D;  3A54 A;  1OXV A;  2PNR C;  1CM9 A;  3R3O A;  4GNX B;  2DJG C;  4N8X 1;  3P8B A;  1L1O C;  1HNX L;  1G6Z A;  1OXU A;  1J8I A;  5C4J L;  2Y0S G;  1LKM A;  4A3M L;  4K5W A;  3A7A B;  2TMP A;  4P71 A;  3J81 E;  2K28 A;  1B8A A;  2AWO A;  2CKA A;  4UPA A;  5IP7 H;  3DLL A;  3R2I A;  4L5Q A;  4ZKB B;  5IT9 E;  1H9R A;  1L1O A;  2R93 H;  1XX8 A;  3WDN A;  5GAE c;  5GRO A;  2MQH A;  5C0X G;  3NEN A;  3F2C A;  4J8Q A;  1N32 L;  4P74 A;  4LF4 Q;  1EIF A;  2PVE A;  2F4V Q;  2MUY A;  3A8J E;  2VQE L;  1X55 A;  1M4V A;  3B08 B;  3EJI A;  5BN4 A;  2WKD A;  2PZT A;  3LWE A;  1UE7 A;  3NTK A;  1PH6 A;  3STB C;  5LL6 S;  2UXC Q;  4A3E G;  2UUA Q;  1SAP A;  3VYT A;  1HZ9 A;  5IYB G;  5KGU A;  1ENC A;  1HZC A;  4A3C L;  4L63 B;  5JPM C;  2WB1 B;  1F9P A;  3S14 H;  1PZJ D;  4K8I A;  5C4X H;  3GTJ B;  1ZKO A;  4NP5 A;  2O5I C;  3ERO A;  4YCV A;  4ID6 A;  3JAM L;  2A6E C;  1QVC A;  2EY5 A;  4XYQ A;  4OIJ A;  1NCV A;  2JYO A;  3CXC A;  4BBS L;  3DWQ A;  1RDG A;  1EY4 A;  3KBX A;  1AW7 A;  1F2Y A;  2XVS A;  3CCQ A;  3VR4 A;  4RGT A;  4JI0 Q;  4DV4 L;  1EY8 A;  2R92 G;  3UE1 A;  2ID0 A;  2ASB A;  4LUV A;  4C3H B;  2GA4 B;  5L37 A;  2KED A;  4LF5 L;  1FYC A;  4YWK A;  4TRD A;  1HTL D;  4DR5 L;  2M2L A;  4B3M Q;  4P72 A;  1II3 A;  3S1N B;  3MFY A;  4LHN A;  3Q23 A;  1KQS A;  1F2M A;  1Z92 B;  3NTI A;  5EKK A;  4LF6 Q;  2EYL A;  4X6A H;  1KD1 C;  1DON A;  4TQU S;  2RVL A;  4AYB E;  5I6Y A;  1DD2 A;  4HTH A;  3NBH B;  1TWG L;  4LFA L;  2PZU A;  3JAM E;  3D4R A;  1VQK A;  3EVQ A;  5JVG 1;  3ULP A;  2QF7 A;  5KRU A;  4HJ9 A;  2K1B A;  3KF8 A;  2MO1 A;  2JA7 H;  1NTG A;  1TWF H;  2K14 A;  4FXG C;  4QQB X;  3J7A F;  3MXU A;  3QJY A;  1I6H H;  3I4M L;  5GQO A;  2L15 A;  4P2C B;  3A55 A;  5EPK A;  1DGS A;  2MNA A;  4DV5 L;  4AQY L;  1XJV A;  1IL8 A;  2CW0 C;  3NXW A;  5I2Y A;  4FF1 A;  3M4O B;  5LMU L;  3QB3 A;  4WJ3 M;  3N52 A;  2EYJ A;  3PKI A;  1A3U A;  1V43 A;  1T9P A;  5GAG C;  3NHH A;  3I8Z A;  3M3Y B;  2QW7 A;  1YJN A;  1EY6 A;  2DY8 A;  3NFP I;  3ULJ A;  2B5I D;  4OO1 I;  1J9O A;  2KA7 A;  2EJG C;  3HOY L;  1I50 L;  1RDP D;  1NUC A;  2JI2 A;  1FNV A;  1EZ6 A;  2N8N A;  1MKH A;  4I65 A;  3HOV L;  4JI1 Q;  2NVX L;  1F9Q A;  3S16 H;  1Y1W H;  2NBF A;  2E5L L;  1BO0 A;  1KNA A;  1SEB D;  2M00 A;  2OCE A;  5C3X A;  2F52 A;  2HR5 A;  4A3G H;  1D5M C;  4MNO A;  3W5O A;  4DV7 Q;  1E8J A;  1TWA B;  3MA2 B;  1IYJ B;  3BU2 A;  2KQ3 A;  1SYC A;  3RNU A;  4OEM B;  3HOW H;  3C46 A;  2NN6 I;  4DK3 C;  3S2D L;  2MGS A;  4DKA C;  5I9O A;  1JMC A;  1EOV A;  1NY4 A;  2NTT A;  1VQP A;  2JXM B;  1XMQ Q;  5EKL A;  1AZQ A;  4G7Z C;  1WTH A;  1ONL A;  2ENB A;  5JVG 3;  1KTK A;  1PH2 A;  1LO5 D;  1UAP A;  1TWH B;  3CKI B;  4DV2 Q;  4A3L L;  2EYP A;  5AJ3 L;  2H12 A;  1EYC A;  1QJO A;  1OWC A;  3K8A A;  5C0X I;  2XJV A;  4A3K L;  4IUV A;  1R0I A;  2HVY C;  1Y1V L;  4WOR A;  1ET9 A;  2WKC A;  2AYJ A;  1S4Z A;  2LSS A;  4LK1 C;  3PF4 A;  2FHT A;  4PNY A;  1TY0 A;  4BS9 A;  4PZ6 A;  4JYA Q;  3HOU L;  1YNN C;  4DA2 A;  2ZJQ A;  2Z9H A;  1CI3 M;  5EPL A;  3I4L A;  4FDB A;  4A3B G;  3SK6 A;  5IYC G;  1G2T A;  4TPU A;  2CQO A;  4A93 B;  2J7Z A;  1Q12 A;  4PV1 C;  5I9P A;  3QO2 A;  4PMB A;  1NMG A;  1DOL A;  3WWN B;  1SYD A;  2CWA A;  1B3Q A;  1LTB D;  3S1Q B;  3I4O A;  3H6M A;  3E0E A;  1CZG A;  5IGF A;  2B63 H;  1NSN S;  2G9D A;  1SRO A;  4I7Z C;  1WCM H;  1QYB A;  1Z7T A;  5CV9 A;  3KJO A;  3V05 A;  4LAA A;  2JQO A;  4HJ8 A;  1ESR A;  2CKZ B;  5M5X B;  3PO2 G;  1JWM D;  2K03 A;  1HZB A;  4DR3 L;  4BY1 G;  1SMY C;  4DN4 M;  3QQC E;  1SNC A;  3PO3 H;  1ZYR D;  4HED A;  4RGO S;  3HOX B;  2VUM H;  5IP9 H;  4Y7N L;  1STY A;  1XNR L;  2KHS A;  1BFY A;  2F3W A;  3H97 A;  3PF5 A;  2SNM A;  1OO9 B;  3UDF A;  5IYD H;  1A15 A;  4GNX C;  1AH9 A;  2MHV A;  4DAP A;  1CT1 D;  4B3R L;  1YHA A;  1BBW A;  2IL8 A;  2VW9 A;  1LTL A;  2NYZ D;  3CCM A;  3ZYY X;  5C4X G;  1NXE A;  2EXZ A;  1X65 A;  4UHV A;  1JR0 D;  2Z3R B;  4GNX A;  2K4K A;  5C4J B;  2R7D A;  1MI2 A;  5ELB A;  5M3M G;  1K8M A;  3ONA B;  5EIO C;  1JYB A;  3PUV A;  1R9T L;  3T1Y Q;  1I5F A;  4IUT A;  4YWL A;  1ESF A;  1MJC A;  1WTO A;  3CC2 A;  2EZV A;  4DF7 A;  1GJX A;  3A7L A;  4ZAI A;  2X6G A;  5FKA C;  4ZKC B;  5FO8 B;  1TQO A;  5C3W A;  2IX3 A;  3CCJ A;  1EUJ A;  1T5X D;  1S5B D;  3EFX D;  2JA5 G;  1DM0 B;  2L0Z A;  3H3V H;  2D0O A;  3DWA A;  3HOZ G;  3C1F A;  4A3F G;  3KLW A;  1AZP A;  5HUR A;  1PFN A;  4U68 A;  1YHB A;  4C2M H;  1IYU A;  1VQJ A;  1HTP A;  4KKT A;  1E2W A;  4A75 A;  1N9W A;  1PTO H;  1LTA D;  1PDQ A;  4KD3 A;  1V1P B;  1KAA A;  3HJW B;  5M5W L;  3J80 c;  2DNC A;  2EY2 A;  2DJF C;  4AYB B;  1P7P A;  1WTP A;  4KJO A;  2NVT H;  5C44 H;  3CCE A;  2JJQ A;  1PRT B;  5DM7 1;  2C6A A;  2XJP A;  5JJZ A;  2F3I A;  1ICW A;  1VCX A;  1LTI D;  3CC7 A;  4BA2 I;  1EIY B;  1N33 Q;  4BBS B;  3RZD L;  3KJP A;  4NMZ A;  4Y52 L;  2DSX A;  3UDG A;  1YNJ D;  5C0X J;  3HS0 C;  3B6Y A;  4NXM L;  1PXU A;  5KYL A;  2R7Z H;  1FD7 D;  1EIG A;  1WJJ A;  2VQF L;  4K8J A;  1MBY A;  4XT3 B;  1SMU A;  1E24 A;  1WD0 A;  1JIC A;  2Q8T A;  1G6P A;  2FXQ A;  1HNW L;  1IU5 A;  1NNX A;  1KDA A;  2L12 A;  4FNF A;  1P8L A;  2F0W A;  4AR3 A;  3KLS A;  3RZ6 A;  3DEP A;  3I4N G;  1TWG B;  4DNR B;  3BG3 A;  3NBH A;  5IWA Q;  1XMO L;  4BY7 L;  3RMH A;  4C3J H;  2JA6 H;  5DM6 1;  2B2Y C;  4R4I A;  1PZK D;  1GXD C;  3FKI G;  4DUY L;  5C3E H;  3U4Z A;  1YIT A;  5BN3 A;  1PH3 A;  3HKZ P;  1HH2 P;  4QL5 A;  4OO1 H;  3I4M B;  1CA5 A;  1R0H A;  4R4T A;  4HSP A;  2JA8 H;  1SNP A;  1SNQ A;  1O78 A;  2Z6K A;  2CHB D;  5TSS A;  4L8J A;  2B2Y A;  4XXE A;  5MF6 A;  4K6L A;  2EY1 A;  1X54 A;  4OGQ C;  1E1O A;  2PI2 A;  3J80 i;  4GZY C;  4CKC A;  5CGK A;  2K5D A;  1F9S A;  3GTP B;  1VQE A;  2UUB L;  3D6C A;  1C48 A;  3HOW G;  2NVQ H;  3DMU A;  3W1G A;  1AFP A;  1H9S B;  3NWT A;  2GMG A;  1HA6 A;  3I2Z A;  2LKV A;  3ND8 A;  2Q2U A;  4UP9 A;  3RUZ A;  3M9B A;  5FJ8 H;  3AEV A;  2A19 A;  4IPG A;  2NN6 H;  2F1M A;  3HOV B;  2NVX B;  2I5M X;  1LTR D;  3K5O A;  1G8Z D;  4KI0 A;  4JI7 Q;  5HGQ A;  3A0J A;  1TKW B;  3MVV A;  1X3Q A;  2F0G A;  3I73 A;  4DR6 L;  5IP7 L;  4DGZ A;  4JI6 Q;  1G91 A;  2ZTE A;  4L5T A;  1J5E Q;  2KCM A;  5E1F A;  3S2D B;  4H0L C;  3P2A A;  4BBR L;  2HUG A;  3KLR A;  1PH1 A;  5IGD A;  1SFO H;  1VQ6 A;  2C5C A;  4A3I G;  3WOF A;  3GDE A;  1X3F A;  4HCS A;  1B53 A;  3D31 A;  5FK9 C;  3S1N L;  2F0V A;  3GTG L;  5J39 A;  1JJ2 A;  4CDC C;  4CDF C;  4DV0 L;  4HAE A;  1OWB A;  5DM6 3;  1WCM G;  1HRJ A;  4RKB A;  4AR4 A;  5AI3 A;  4HJ7 A;  5E4W C;  2E8G A;  5HY6 A;  1CHQ D;  5IYB H;  1HR0 W;  1K73 C;  1HUN A;  4RGM A;  1SXT A;  3CCU A;  1AN8 A;  1Y1V B;  1E0B A;  4A3M G;  1LLR D;  1JOK A;  2Z4H A;  2A5H A;  1I3Q L;  1ZRP A;  1QWY A;  2B2U C;  5ELC A;  3GTK H;  1HXY D;  3HOU B;  1J6Q A;  1WTW A;  1XNQ Q;  1XWE A;  1CAD A;  2B3G A;  1O80 A;  3S17 L;  4ZQ3 A;  4JI5 L;  3M3Y L;  2R92 H;  1S30 A;  5JEA J;  3IU3 I;  5KND A;  3OSO A;  2R3Z A;  4A3J B;  2G9H D;  3TZD A;  2GVA A;  2BDO A;  4RH6 A;  3T51 B;  3FDJ A;  1QUQ B;  3P20 A;  3PZA A;  4IJL A;  4X6A L;  2D62 A;  4DV1 L;  4DXG A;  3PQI A;  2BH2 A;  4A3C G;  1NR2 A;  1HNZ Q;  5JVH 1;  4E6Y A;  1PH8 A;  2X69 A;  1E3P A;  1IBK L;  3EN2 A;  3D8G A;  2JA7 L;  4YHH Q;  4AI2 A;  3HKS A;  2XWB B;  2CKC A;  1EQR A;  1YZ6 A;  2ZJR A;  4WFN 1;  5LL6 X;  4AI0 A;  1EOT A;  5DLQ E;  2K52 A;  1QNK A;  1I6H L;  1BCP C;  3V96 A;  1FR3 A;  4K5X A;  3S2H H;  3M85 A;  3PUX A;  3STB D;  3BDL A;  4ILW A;  3H0G G;  4A76 A;  1PRT F;  1YUX A;  2K7V A;  3SE0 A;  4LF7 Q;  4IAL A;  1RCV D;  3CD6 A;  1IW7 C;  4BWG B;  4A3D G;  3IL8 A;  2KOL A;  1GKH A;  2ES2 A;  3JC6 2;  1VQ5 A;  1W6K A;  3KYH C;  3PMF A;  3F8T A;  2V3B B;  5K36 G;  5IOC A;  4DV3 L;  2MO0 A;  3CQZ H;  4JAE A;  4JBM A;  1AP0 A;  1FGB D;  1R4P B;  2LCQ A;  2A6E D;  5GAH c;  1Q81 C;  4PG3 A;  1ZEQ X;  3CP0 A;  4YCU A;  1SNO A;  4XT1 B;  5C6A A;  3S16 L;  1R9T B;  5EKI A;  1Y1W L;  4JOI A;  4MN3 A;  2BA0 A;  1CKN B;  3TP8 A;  4KD4 A;  1T9H A;  1B9M A;  3K7U C;  1M1K C;  1BQQ T;  1F4L A;  2R6G A;  5FLM L;  1SMM A;  2AUJ D;  3AQQ A;  3J81 c;  2UXD Q;  5D14 A;  2ZTD A;  3HOW L;  2OTJ A;  1MGS A;  1VZG A;  2DGY A;  2UUC L;  1QVF A;  1NJI C;  4NW2 A;  5IT9 c;  5BR8 Q;  1VQO A;  1Q7Y C;  2B2V C;  3PIO 1;  4DR1 Q;  5ELN A;  1PLF A;  3F1Z A;  3PIP 1;  3GTL H;  2Z6B A;  4YCW A;  2HQE A;  5JOB A;  4HCE A;  3T16 A;  1FJG Q;  4IUU A;  1HR0 L;  1K0R A;  1VS0 A;  3S1Q L;  2WAQ P;  1NXG A;  4HIO A;  5JVH 3;  3PIO A;  2YU9 B;  1Q46 A;  1PRT C;  3HOY G;  4LF9 L;  2AUS B;  3RR5 A;  4GKJ Q;  5M5W B;  1A3T A;  1V1P A;  3P1H A;  4HMJ A;  1ASZ A;  1GUN A;  2NZH A;  5M5Y B;  1QCV A;  2HCI A;  4EQO A;  5M5X L;  3LGJ A;  4DK0 A;  4L5S A;  3A8I E;  3RZD B;  1BE7 A;  3OMG A;  4RCN A;  4HIK A;  2RDG A;  2F0S A;  2Q2T A;  8RXN A;  1DZ1 A;  1OXS C;  4JCV E;  4G7H C;  2PPB C;  1O7Z A;  1KIX A;  1KL9 A;  1HFN A;  5FJ8 G;  4GOP C;  1KXL A;  3BZD B;  1L2F A;  1LM0 A;  3SK5 A;  5AFW A;  2OQK A;  1Y8O B;  1XTD A;  2NYD A;  1MHW C;  3GO5 A;  4C2M 1;  5DEH A;  4NKL A;  2KCC A;  2XNA C;  4S3S A;  2IW3 A;  5IIF A;  2R7F A;  1PYS B;  2XJR A;  4BY7 B;  4GKK Q;  2BA1 A;  1TS5 A;  1TR5 A;  4DR2 Q;  4A3K G;  3GTM H;  2K01 A;  2ERJ A;  4KN4 C;  1VMP A;  1B4O A;  1XPU A;  4BXX G;  2V0E A;  4GS3 A;  1X9N A;  1N36 L;  1FNW A;  3JAM c;  4X3S A;  3PIO 3;  2HT1 A;  1JWS D;  2J9U B;  1HFG A;  2NZO A;  3GTO B;  3GTJ H;  3CPW A;  2C6B A;  3PIP 3;  4IOA A;  2AQC A;  5J22 A;  3PO2 H;  2EJM A;  3NBI A;  3TP7 A;  4BY1 H;  1EWI A;  1AEX A;  3PO3 L;  2VUM L;  5IP9 L;  3SK4 A;  1KLG D;  3CMA A;  4JI8 Q;  1K3R A;  1SE2 A;  2PPT A;  4LUO A;  2RSO A;  2IJ0 A;  4CDD C;  1DXM A;  2Z0S A;  2ICI A;  3F2D A;  2IX0 A;  1FHM A;  1YJW A;  1H9S A;  2A1A A;  3KDF B;  1EQV A;  3DHQ A;  3OW7 A;  5JJK A;  3UE0 A;  5M9O A;  4IFD G;  4K0K L;  4FF3 A;  5EBC A;  1I4G A;  1X56 A;  3SS2 A;  3KFU A;  1QZG A;  3H3V I;  1ENF A;  1X6O A;  5M3M H;  2ZM6 Q;  5F2D A;  2E2H L;  3B0A B;  1IKL A;  2I07 B;  4AI1 A;  5CMD A;  1STB A;  2LS0 1;  1JJC B;  3LNN A;  1YNN D;  4JK1 C;  1JB7 A;  3NSW A;  3X3M A;  4BBR B;  2R93 B;  5EIN C;  3MXN A;  1VZH A;  3KYV A;  3R2T A;  1WD1 A;  4JV5 L;  5JJL A;  5M3F L;  4I7A A;  4R8N A;  4AHW A;  2D2C C;  4NXN L;  3GTQ L;  1QIL A;  3GTG B;  1BOS A;  2CH4 W;  2K32 A;  1A63 A;  2KBN A;  3HGB A;  2JA5 H;  1AE2 A;  2WAC A;  3K0X A;  1P16 A;  1EU4 A;  1PFU A;  3JAM i;  4B3T Q;  4P75 A;  1EU3 A;  1JE4 A;  5COY A;  3HOZ H;  4MTN A;  4A3F H;  1CSQ A;  4JI2 Q;  4KY6 A;  1TII D;  4DNT B;  4K6D A;  3PV0 A;  4KN7 C;  5FO7 B;  2LFN A;  1B44 D;  1GUS A;  3BDO A;  2NB0 A;  1PMR A;  2RF4 A;  1X3P A;  1I3Q B;  1SMY D;  3DM3 A;  1TVX A;  1VDZ A;  1DCZ A;  2OWO A;  3I91 A;  5MFP A;  2PYK A;  2K6A A;  4LF4 L;  3RZO H;  3DXJ C;  2WAQ G;  4H13 C;  2F4V L;  3S17 B;  3GTP L;  3NEL A;  5I2X A;  1K83 H;  3DEO A;  2IWH A;  1RTN A;  1V8Q A;  2QEX A;  3DWP A;  3J81 j;  2UUA L;  1EWC A;  1OXX K;  1VQI A;  5ELD A;  3MXG A;  1I4H A;  1RHP A;  2RDH A;  3BJU A;  2ZJP A;  1QUQ A;  1FVI A;  1VMC A;  3NPP A;  4KK7 A;  1TXY A;  2BE5 C;  3HKZ E;  1YI2 A;  4Z9C B;  4KY5 A;  3I4N H;  2FIN B;  2ZXO A;  2F0J A;  3E6Z X;  1WFQ A;  2LXK A;  5NUC A;  4JBK A;  2PMZ E;  2JA6 L;  4C3I G;  1R0G A;  5KYI A;  3FKI H;  2JA7 B;  5C3E L;  3CU7 A;  1TWF B;  1K8G A;  2K04 A;  4O1N A;  4LF8 Q;  2VB3 X;  2F0H A;  3OW2 A;  1I6H B;  2PQA B;  3ITP A;  3BVM A;  1W2B A;  4JI0 L;  4QIW E;  2JA8 L;  3IKJ A;  1SRU A;  4LJZ C;  1STA A;  2JN4 A;  2PSM C;  2N49 A;  1H9K A;  3MXP A;  4B3M L;  1VQN A;  4DR3 Q;  2A6H C;  4X3K A;  1BVS A;  2ZT9 C;  2KKD A;  4XYO A;  4HSV A;  4IUQ A;  4HJ5 A;  4LF6 L;  1Y69 U;  3TP6 A;  3M4Y A;  2V0F A;  5ELF A;  1C4Q A;  4IUP A;  3S1M H;  1OXT A;  3C1E A;  1PA6 A;  1SYE A;  2C35 B;  3LWU A;  3OWF A;  3VA7 A;  4U67 1;  4LFB Q;  3I3C A;  5AI2 A;  3S16 B;  1Y1W B;  1I94 Q;  5IE8 A;  1W3S A;  3HG9 A;  2KHJ A;  1E2Z A;  2J4X A;  1U4M A;  5LMN Q;  3SVM A;  2SEB D;  4XTC S;  2KUM A;  2XJS A;  3IFD A;  4GS7 D;  4K14 A;  3HOW B;  3MEH A;  1G2S A;  4Q0F A;  2NTS A;  2XN9 C;  3FEW X;  4QCL A;  3TRE A;  4IFD I;  4QB4 A;  2FMC A;  4A3J L;  4A3I H;  3RZT A;  3K5L A;  1GUW A;  2PYA A;  4XDX A;  1BUV T;  4JC0 A;  4RXN A;  2J0T D;  1C8C A;  1YEZ A;  2MFI A;  2A69 D;  2RBM A;  4JI1 L;  1CK1 A;  1IXR A;  2WV6 D;  4A3E L;  2WB1 G;  4IJH A;  2Y0S E;  3BVG A;  4AI3 A;  1S5E D;  3TP5 A;  4K9F A;  2PQE A;  1HQM C;  3ND9 A;  3EQL C;  4EGV A;  2JEA I;  2F3V A;  3CCR A;  1Y8N B;  2XSC A;  1XPO A;  4DV7 L;  2K33 A;  2F0K A;  1U5K A;  4A3M H;  3NQT A;  4NPS A;  4YWM A;  1PZX A;  2F0U A;  1O7L A;  2HDL A;  3JR7 A;  1KC8 C;  2K5N A;  2KN9 A;  5K5P A;  7RXN A;  2B29 A;  4KY7 A;  5ELO A;  1SYB A;  4C3H G;  2E2I H;  3HJY B;  2MJ8 A;  4HID A;  4JPB W;  5KNC A;  1BCP B;  4HN7 A;  1RWD A;  4PMC A;  1XMQ L;  3BVZ A;  4KHP Q;  2R92 L;  2UU9 Q;  2XWJ B; 
#chains in the Genus database with same CATH homology
 1Q8K A;  3M4Q A;  4R4C A;  4R1J A;  3UDI A;  4O2D A;  4DV2 L;  1E7Z A;  1YIJ A;  4P73 A;  4A4I A;  1EQQ A;  1HNW Q;  3RLF A;  1YVC A;  4A3C H;  1DX8 A;  5AN9 H;  4JYA L;  1K8A C;  4WJ4 A;  1V1Q A;  4QJF A;  3E9I A;  4L5R C;  3H0G H;  4DV6 Q;  2GN5 A;  2OQ0 A;  1S72 A;  4JBJ A;  4A3D H;  3KDF A;  3LNL A;  1SE8 A;  4B3S Q;  1GVP A;  3FHW A;  4DK6 C;  2VY3 A;  1PHJ A;  1GO3 E;  1UE6 A;  1T9Q A;  2XJT A;  1N34 Q;  3CAM A;  5MFZ A;  4LUZ A;  1VQM A;  4GOP B;  3AYH B;  2NVY H;  4DNI A;  1YV1 A;  3BZC A;  1NBW A;  3A5Z B;  4IFD J;  2XJQ A;  1GD7 A;  4TVM A;  3ERS X;  4DR7 Q;  3HOY H;  1I50 H;  1U0L A;  3CCL A;  1PYB A;  3GD7 A;  3A74 A;  2NVX H;  4X66 Q;  5FLM G;  2CWP A;  5RXN A;  4MZ9 A;  1S40 A;  4A93 G;  4X65 Q;  2HHH L;  2IHF A;  4JI5 Q;  4X64 L;  3S1R H;  5H1S c;  4JAD A;  3U58 A;  4IO9 A;  2O5J D;  2QGQ A;  4A3L H;  2H5X A;  2WP8 J;  4A3K H;  2D0P A;  4YY3 L;  2AKW B;  1PH4 A;  4BXX H;  4AH6 A;  4DV1 Q;  1H95 A;  1WI5 A;  3HOX G;  2PQA A;  1B13 A;  4DAM A;  1R0J A;  3HOU H;  1B2J A;  1SR3 A;  3EIV A;  1G51 A;  4APV A;  3W1B A;  1VCI A;  5IWA L;  1TWC H;  1VQ4 A;  3K7A H;  2EXD A;  3TS2 A;  2CR8 A;  4TVA B;  1S3O A;  3ULL A;  4DV3 Q;  2UXB L;  4AHY A;  3KF8 B;  1DVB A;  1IBL Q;  1MJE A;  1OTC A;  3UDX A;  1BQ9 A;  4ME3 A;  3T1H Q;  1M90 C;  4OX9 Q;  5IY0 A;  4UP7 A;  4Y7N H;  4DUZ Q;  2VL6 A;  3ICE A;  4LFC L;  4OON A;  3U50 C;  4IPC A;  5MLC 3;  3CME A;  2JI3 A;  3PWF A;  2YTY A;  4NB3 A;  3MSU A;  1IRO A;  2ZIX A;  1IBM Q;  4JI7 L;  4AYB G;  2HQL A;  5GAH C;  4UY8 C;  4JI3 Q;  4IOC A;  3JC6 6;  4UY8 1;  2YTX A;  3RYG A;  4JI6 L;  1D7Q A;  4LF9 Q;  4BBS G;  1J5E L;  3AFQ A;  2Z3Q B;  3J7Z C;  3J7Z 1;  3G48 A;  4BA1 I;  1T9O A;  5GAD c;  4DAY B;  3S15 H;  1UE5 A;  1RYT A;  3OTO L;  3CC4 A;  1VQH A;  4QGU A;  1YJ9 A;  2MS3 A;  3LPE B;  4PMW A;  1KRT A;  1HNX Q;  5M5W H;  5J3B A;  4JBW A;  4RG1 A;  1S24 A;  3I4M G;  1VQF A;  1A62 A;  4C3I H;  1XNQ L;  4JG2 A;  4H02 A;  1RIP A;  3J7A 5;  1LYL A;  4Y52 H;  1N36 Q;  1N32 Q;  2AHO B;  1JJG A;  2VQE Q;  2GVB A;  3PIP A;  2JEB I;  3TEH B;  2VS1 A;  3HOV G;  4X62 L;  1LKP A;  4ZN1 B;  1VQC A;  4KLK A;  1HNZ L;  3KYW A;  4YHH L;  1YNX A;  5GAE C;  1H7V A;  4AHX A;  4LF7 L;  4DR4 L;  4DV4 Q;  1VQB A;  3J81 i;  2JI1 A;  4LF5 Q;  3K80 C;  4AR6 A;  4GOP A;  3OYY A;  4DR5 Q;  4DPG A;  4A3L G;  2Q2I A;  1SMX A;  1Y1V G;  1YK5 A;  1Z9F A;  1PH5 A;  1C9O A;  3I7F A;  4LFA Q;  1ASY A;  4O0A A;  2PNH A;  3HOU G;  2I5L X;  2UXD L;  3L7Z C;  5BR8 L;  2A6H D;  4DR1 L;  4DV5 Q;  3BZK A;  4BBR H;  4AQY Q;  4C3H H;  4A3J G;  1FJG L;  1BQ8 A;  4HIM A;  5LMU Q;  3AFP A;  3S1N H;  5JJI A;  4QY7 A;  3GTG H;  4GN5 A;  4IPH A;  4JAG A;  4GKJ L;  3KYU A;  1QVG A;  3F2B A;  1Q82 C;  3CCS A;  2E5L Q;  1BBU A;  2RCN A;  1I3Q H;  4JI4 L;  2XJU A;  1B70 B;  1FGU A;  1Q1B A;  3I56 A;  1Q86 C;  3M4O H;  3Q8D A;  3S17 H;  3M3Y H;  1E22 A;  2KCT A;  1UWV A;  1B2O A;  4R4O A;  4GKK L;  1IRN A;  4DR2 L;  5AJ3 Q;  2ATW A;  1VQ9 A;  3KYX A;  1JT8 A;  1TWA H;  1CKM A;  1ODH A;  3U4V A;  2M4Y A;  3IRB A;  4AHZ A;  2KHI A;  2UXC L;  4JI8 L;  4LNQ A;  2XTI A;  4B8C D;  3L2P A;  2OTL A;  1LKO A;  2XGT A;  2AWN A;  1TWH H;  2ZM6 L;  4UP8 A;  3ZG6 A;  1PFS A;  1CSP A;  5FLM H;  2HIV A;  5LMN W;  3I55 A;  1SMW A;  1VQ7 A;  1A8V A;  1XNR Q;  5GAG c;  4XIG S;  1RL2 A;  4B3T L;  1O7I A;  1K9M C;  3L0O A;  5JEA G;  4JI2 L;  4A93 H;  1WOC A;  4B3R Q;  1N8R C;  1FL0 A;  4R4Q A;  1Q1E A;  4BY7 G;  3S1Q H;  4KHZ A;  1CKN A;  3FP9 A;  3SGI A;  3A44 A;  2ALY B;  2BH8 A;  3JC6 3;  4LW1 A;  5M5X H;  3G4S A;  3HOX H;  1RDV A;  4POF A;  4J15 A;  1FHH A;  1PVO A;  3RLO A;  1IZ6 A;  1VQD A;  1Z47 A;  3D0F A;  5C4J H;  3TS0 A;  5IP7 G;  3K35 A;  4ALP A;  3TQY A;  4LF8 L;  4BBR G;  2R93 G;  1A0I A;  1XPR A;  2N78 A;  1KHI A;  4XXB B;  3G71 A;  1NMF A;  3K81 C;  3S24 A;  4NXM Q;  2VQF Q;  1X3E A;  4EQ5 A;  4EX5 A;  3PUW A;  3TRZ A;  4G6B A;  1C7Y A;  1VQ8 A;  4OWT B;  4LFB L;  3RN5 A;  4LHL A;  1I94 L;  1XMO Q;  3E9H A;  5LMN L;  3MEF A;  4DUY Q;  2E2H H;  1EFW A;  4BBS H;  1KAW A;  3G6E A;  2M4V A;  2YTV A;  1VQA A;  1CAA A;  1YUZ A;  1VZI A;  5M3F H;  1IU6 A;  1C0A A;  2UUB Q;  3GTQ H;  1B7Y B;  3RN2 A;  3CPF A;  4GN3 B;  2EQS A;  1TWG H;  4PZ8 A;  2HHH Q;  4X64 Q;  3M7N A;  2JA7 G;  2A68 D;  4HJA A;  3KF6 B;  2IHE A;  4DR6 Q;  2EIF A;  2I5H A;  3I4M H;  2WAQ E;  4YY3 Q;  4KHP L;  4XGH A;  2UU9 L;  3GTP H;  3RLN A;  1HJP A;  2QA4 A;  1S2Z A;  3HFZ B;  4DV0 Q;  3PUY A;  3T1Y L;  3HOV H;  1NE3 A;  1Y1W G;  5E7N A;  2M6O A;  1AE3 A;  4A3G G;  1D8L A;  1B71 A;  3VPB E;  4OWX B;  2ERS A;  4JAF A;  1PH9 A;  2KEN A;  1IW7 D;  2Z6K C;  3HOW G;  1L1O B;  3S2D H;  3ER0 A;  2A8V A;  2UXB Q;  4OWW B;  2HIX A;  1PH7 A;  2DUD A;  1R0F A;  4DV6 L;  2I0Q A;  1SN8 A;  4PZ7 A;  1JE5 A;  2CFM A;  2RHS B;  4AR5 A;  1QZH A;  4B3S L;  2K50 A;  2M6P A;  4LFC Q;  4GLV B;  1L0W A;  1N33 L;  1Y1V H;  3ZJY C;  1WYD A;  1KRS A;  1CUK A;  1N34 L;  2IX1 A;  1IBK Q;  2IT1 A;  4POG A;  1CKO A;  2CCZ A;  3VDY A;  4LWC A;  1V9P A;  1VQL A;  3MXN B;  2QL0 A;  4A3J H;  2YYZ A;  1BKB A;  2WB1 E;  2ZTC A;  4DR7 L;  2WFW A;  3EBE A;  2B63 G;  1X3G A;  3KOJ A;  1G29 1;  3PUZ A;  4A3E H;  2VNU D;  3OTO Q;  3A5U A;  5FLX c;  1UEB A;  4X66 L;  3CF5 A;  2K75 A;  4RMF A;  3KYY A;  3PO3 G;  2VUM G;  3CCV A;  5IP9 G;  1YBY A;  1IL2 A;  3PCO B;  5MGN A;  2UUC Q;  5IYD G;  2AMC B;  4X65 L;  1MIU A;  5GAD C;  3H15 A;  5H1S E;  4ZN3 B;  1HR0 Q;  2Q2H A;  1BRF A;  1SLJ A;  2LXJ A;  1GM5 A;  2K2D A;  6RXN A;  1LUZ A;  2JK8 A;  1R9T H;  3J7Y 1;  4X62 Q;  1RYQ A;  1Y14 B;  2PI2 E;  1HZA A;  3WWV A;  5M3F G;  2RHQ B;  3CW2 C;  3WWL A;  2IY5 B;  2YU9 H;  4IPD A;  4DR4 Q;  3QVD A;  2K5V A;  4JOI C;  1PV4 A;  5M5Y H;  3HKZ G;  3PKJ A;  2N3S A;  5C44 G;  2YV5 A;  2K5H A;  1VQG A;  4GLX A;  2VZA A;  3RZD H;  1IBL L;  2JE6 I;  1EYG A;  3MPS A;  3T1H L;  4OX9 L;  2V1C C;  2R7Z G;  2JA9 A;  4V19 6;  4DUZ L;  3PGZ A;  1RB9 A;  4AIM A;  3NEM A;  1E1T A;  1IBM L;  2E2J H;  4K0K Q;  4BY7 H;  4JI3 L;  2JA6 G;  4GLA C;  5K2M E;  5C3E G;  3KF6 A;  1YK4 A;  4OO1 G;  3GTO H;  2JA8 G;  3M4P A;  1C09 A;  1WJV A;  1NNQ A;  2PVX A;  2BE5 D;  1YHQ A;  4JV5 Q;  2RDV A;  4JI4 Q;  4OXP A;  4GN4 B;  4NXN Q;  3PSI A;  2NN6 G;  1UE1 A;  5EAY A;  4A3B H;  5IYC H;  1OXV A;  4GNX B;  3P8B A;  1L1O C;  1HNX L;  1OXU A;  2Y0S G;  1LKM A;  4P71 A;  1B8A A;  2AWO A;  2CKA A;  4UPA A;  5IP7 H;  3DLL A;  4L5Q A;  1L1O A;  2R93 H;  5GAE c;  5GRO A;  2MQH A;  5C0X G;  3NEN A;  3F2C A;  1N32 L;  4P74 A;  4LF4 Q;  1EIF A;  2PVE A;  2F4V Q;  2VQE L;  1X55 A;  3B08 B;  1UE7 A;  1PH6 A;  3STB C;  2UXC Q;  4A3E G;  2UUA Q;  1HZ9 A;  5IYB G;  1HZC A;  3S14 H;  5C4X H;  4YCV A;  1QVC A;  3CXC A;  1RDG A;  3CCQ A;  2R92 G;  4JI0 Q;  4DV4 L;  3UE1 A;  2ID0 A;  2ASB A;  4LUV A;  4LF5 L;  4YWK A;  4DR5 L;  4B3M Q;  4P72 A;  4LHN A;  1KQS A;  1Z92 B;  4LF6 Q;  4X6A H;  1KD1 C;  4TQU S;  4AYB E;  3NBH B;  4LFA L;  1VQK A;  5JVG 1;  3ULP A;  4HJ9 A;  2MO1 A;  2JA7 H;  1NTG A;  1TWF H;  2K14 A;  4QQB X;  1I6H H;  5GQO A;  2L15 A;  1DGS A;  2MNA A;  4DV5 L;  4AQY L;  1XJV A;  5LMU L;  4WJ3 M;  3PKI A;  1V43 A;  5GAG C;  1T9P A;  1YJN A;  3NFP I;  3ULJ A;  2B5I D;  4OO1 I;  2JI2 A;  2N8N A;  1MKH A;  4JI1 Q;  3S16 H;  1Y1W H;  2E5L L;  2OCE A;  2F52 A;  2HR5 A;  4A3G H;  4MNO A;  3W5O A;  4DV7 Q;  1E8J A;  1IYJ B;  3BU2 A;  3RNU A;  3HOW H;  2NN6 I;  4DK3 C;  4DKA C;  1JMC A;  1EOV A;  1NY4 A;  1VQP A;  1XMQ Q;  1PH2 A;  4DV2 Q;  5AJ3 L;  2H12 A;  1OWC A;  3K8A A;  5C0X I;  2XJV A;  1R0I A;  2AYJ A;  2LSS A;  3PF4 A;  4PZ6 A;  4JYA Q;  2ZJQ A;  4FDB A;  4A3B G;  5IYC G;  4TPU A;  2CQO A;  1Q12 A;  1NMG A;  3WWN B;  2CWA A;  3I4O A;  3E0E A;  2B63 H;  1SRO A;  1WCM H;  1QYB A;  3KJO A;  2JQO A;  4HJ8 A;  2CKZ B;  3PO2 G;  1HZB A;  4DR3 L;  4BY1 G;  3QQC E;  3PO3 H;  2VUM H;  5IP9 H;  1XNR L;  1BFY A;  3PF5 A;  3UDF A;  5IYD H;  4GNX C;  1AH9 A;  4B3R L;  1YHA A;  1BBW A;  2VW9 A;  1LTL A;  3CCM A;  5C4X G;  1NXE A;  1X65 A;  2Z3R B;  4GNX A;  2K4K A;  2R7D A;  5M3M G;  5EIO C;  1JYB A;  3PUV A;  3T1Y Q;  1I5F A;  4YWL A;  1MJC A;  3CC2 A;  3CCJ A;  1EUJ A;  2JA5 G;  2L0Z A;  3H3V H;  2D0O A;  3HOZ G;  4A3F G;  3KLW A;  1YHB A;  4C2M H;  1VQJ A;  4A75 A;  1N9W A;  3J80 c;  2NVT H;  5C44 H;  3CCE A;  2Q2T A;  2JJQ A;  4BA2 I;  5DM7 1;  2C6A A;  2XJP A;  2F3I A;  3CC7 A;  1VCX A;  1EIY B;  1N33 Q;  3KJP A;  2DSX A;  3UDG A;  5C0X J;  3B6Y A;  4NXM L;  2R7Z H;  1WJJ A;  2VQF L;  1SMU A;  1E24 A;  1G6P A;  2FXQ A;  1HNW L;  1IU5 A;  1P8L A;  4AR3 A;  3RZ6 A;  3I4N G;  1XMO L;  5IWA Q;  4C3J H;  2JA6 H;  5DM6 1;  4R4I A;  3FKI G;  4DUY L;  5C3E H;  3U4Z A;  1YIT A;  1PH3 A;  1HH2 P;  4QL5 A;  1R0H A;  4R4T A;  2JA8 H;  2Z6K A;  5MF6 A;  1X54 A;  1E1O A;  2PI2 A;  3J80 i;  1VQE A;  2UUB L;  2NVQ H;  3W1G A;  2GMG A;  3I2Z A;  2Q2U A;  4UP9 A;  3M9B A;  5FJ8 H;  3AEV A;  2A19 A;  4IPG A;  2I5M X;  4KI0 A;  4JI7 Q;  5HGQ A;  3A0J A;  4DR6 L;  4JI6 Q;  2ZTE A;  4L5T A;  1J5E Q;  2KCM A;  3P2A A;  1PH1 A;  1SFO H;  1VQ6 A;  4A3I G;  3GDE A;  1X3F A;  3D31 A;  1JJ2 A;  4DV0 L;  1OWB A;  1WCM G;  4AR4 A;  5AI3 A;  4HJ7 A;  5HY6 A;  2E8G A;  5IYB H;  1HR0 W;  1K73 C;  3CCU A;  4A3M G;  1ZRP A;  3GTK H;  1J6Q A;  1XNQ Q;  1CAD A;  2B3G A;  4JI5 L;  2R92 H;  1S30 A;  5JEA J;  3IU3 I;  2GVA A;  1QUQ B;  3PZA A;  4IJL A;  2D62 A;  4DV1 L;  2BH2 A;  4A3C G;  1HNZ Q;  5JVH 1;  4E6Y A;  1PH8 A;  1E3P A;  1IBK L;  3EN2 A;  4YHH Q;  4AI2 A;  3HKS A;  2CKC A;  1EQR A;  1YZ6 A;  2ZJR A;  4WFN 1;  4AI0 A;  5DLQ E;  2K52 A;  3S2H H;  3M85 A;  3PUX A;  3STB D;  3H0G G;  4A76 A;  1YUX A;  4LF7 Q;  3CD6 A;  4A3D G;  2ES2 A;  1GKH A;  3JC6 2;  1VQ5 A;  3KYH C;  5K36 G;  3F8T A;  2V3B B;  4DV3 L;  2MO0 A;  3CQZ H;  4JAE A;  4JBM A;  2LCQ A;  2A6E D;  5GAH c;  1Q81 C;  4PG3 A;  3CP0 A;  4YCU A;  4JOI A;  2BA0 A;  1CKN B;  1T9H A;  3K7U C;  1M1K C;  2R6G A;  1SMM A;  3AQQ A;  3J81 c;  2UXD Q;  2ZTD A;  2OTJ A;  2DGY A;  1VZG A;  2UUC L;  1QVF A;  1NJI C;  5IT9 c;  5BR8 Q;  1VQO A;  1Q7Y C;  3PIO 1;  4DR1 Q;  5ELN A;  3F1Z A;  3PIP 1;  3GTL H;  4YCW A;  1FJG Q;  1HR0 L;  1K0R A;  1VS0 A;  1NXG A;  4HIO A;  3PIO A;  1Q46 A;  3HOY G;  4LF9 L;  3RR5 A;  4GKJ Q;  1ASZ A;  2NZH A;  1QCV A;  3LGJ A;  4L5S A;  1BE7 A;  4HIK A;  8RXN A;  1OXS C;  4JCV E;  1KIX A;  1KL9 A;  5FJ8 G;  4GOP C;  1KXL A;  1L2F A;  1LM0 A;  2OQK A;  1XTD A;  2NYD A;  3GO5 A;  2R7F A;  1PYS B;  2XJR A;  4GKK Q;  2BA1 A;  4DR2 Q;  3GTM H;  4A3K G;  2ERJ A;  1XPU A;  4BXX G;  2V0E A;  4GS3 A;  1X9N A;  1N36 L;  2HT1 A;  3JAM c;  2J9U B;  2NZO A;  3GTJ H;  3CPW A;  2C6B A;  4IOA A;  3PO2 H;  4BY1 H;  1EWI A;  3CMA A;  4JI8 Q;  1K3R A;  2PPT A;  4LUO A;  2Z0S A;  3F2D A;  1YJW A;  2IX0 A;  1FHM A;  2A1A A;  3KDF B;  5JJK A;  3UE0 A;  4IFD G;  4K0K L;  1X56 A;  3KFU A;  3SS2 A;  1QZG A;  3H3V I;  1X6O A;  5M3M H;  2ZM6 Q;  3B0A B;  4AI1 A;  1JJC B;  1JB7 A;  5EIN C;  1VZH A;  3KYV A;  4JV5 L;  5JJL A;  4AHW A;  4NXN L;  1A63 A;  2KBN A;  2JA5 H;  1AE2 A;  3K0X A;  1P16 A;  3JAM i;  4B3T Q;  4P75 A;  3HOZ H;  4MTN A;  4A3F H;  1CSQ A;  4JI2 Q;  3PV0 A;  2RF4 A;  3DM3 A;  2OWO A;  5MFP A;  4LF4 L;  3RZO H;  2WAQ G;  2F4V L;  3NEL A;  1K83 H;  2QEX A;  3J81 j;  2UUA L;  1OXX K;  1VQI A;  2ZJP A;  3BJU A;  1QUQ A;  1FVI A;  1TXY A;  3HKZ E;  1YI2 A;  3I4N H;  1WFQ A;  2LXK A;  4JBK A;  2PMZ E;  1R0G A;  3FKI H;  1K8G A;  4LF8 Q;  3OW2 A;  2PQA B;  1W2B A;  4JI0 L;  4QIW E;  1SRU A;  2PSM C;  2N49 A;  4B3M L;  1VQN A;  4DR3 Q;  1BVS A;  2KKD A;  4HJ5 A;  4LF6 L;  2V0F A;  3S1M H;  1OXT A;  1PA6 A;  2C35 B;  4U67 1;  4LFB Q;  5AI2 A;  1I94 Q;  5IE8 A;  1W3S A;  2KHJ A;  5LMN Q;  4XTC S;  2XJS A;  4GS7 D;  3TRE A;  4IFD I;  4A3I H;  3RZT A;  2PYA A;  4JC0 A;  4RXN A;  1YEZ A;  2MFI A;  2A69 D;  4JI1 L;  1IXR A;  2WB1 G;  4IJH A;  2Y0S E;  4AI3 A;  4K9F A;  2JEA I;  3CCR A;  1XPO A;  4DV7 L;  1U5K A;  4A3M H;  4NPS A;  4YWM A;  1KC8 C;  2K5N A;  2KN9 A;  7RXN A;  2B29 A;  5ELO A;  2E2I H;  4HID A;  1RWD A;  1XMQ L;  4KHP Q;  2UU9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...