5MGNA

Human sirt6 in complex with activator ubcs38
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mgnA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mgnA01
4COKA 2JI8A 2HJHA 1Y9DA 3GLSA 1D4OA 4QPZA 4BN4A 2H4FA 5K6RA 5MFPA 2Q5OA 5FEMA 2FWNA 4BV2A 5DGTA 2Q5QA 2VBGA 1PYDA 4J16C 5BWNA 2VBIA 2WVHA 4JU9A 4BVFA 4O8ZA 1T9CA 1PTJC 4GM0A 4IF6A 3U3DA 3ZG6A 1SZCA 1PVDA 2EZUA 1PI3A 3RIGA 2WVAA 3JR3A 1Q14A 2PGNA 1OVMA 4JUBA 2PGOA 2FRDC 3E9YA 2C31A 2JIBA 5K2OA 4X3OA 2VK4A 1S5PA 3RIYA 4D5EA 1U2DC 4Y6OA 4FZ3A 4V1CI 3PKIA 2PANA 4GG1A 1S7GA 4RJJA 1XLTC 2H2GA 3EYAA 4KGDA 2EZTA 1DJLA 5MFZA 4QQ8A 3OE1A 2Q5JA 4Q9DA 3CLTD 3CLRD 3D81A 2VK1A 1BFDA 1O97D 2FN3A 4IAOA 1OZGA 1OZHA 4V1CA 2QQGA 2H59A 2B4YA 3FLMA 4X3PA 4C78A 4UUBA 3IAFA 4TWJA 4MPRA 4GM1A 4D5GA 2JLAA 1POXA 4HD8A 2FSVC 2IHUA 4MQ5A 1NM5C 1JSCA 1M2NA 4TWIA 3EY9A 2A1TR 4BVHA 1PNOA 3F6EX 1UPBA 3PKJA 4RJKA 1SZDA 1T9AA 2BRUC 1OZFA 5EJ4A 3GLUA 4JT8A 2AG1A 2V3WA 3ZGVA 2EZ9A 1N0HA 2FR8C 1E3TA 3U31A 2AG0A 4GM4A 2VK8A 2IHVA 2W93A 1UPCA 4JSRA 2H2FA 4L3OA 2Q29A 4JT9A 2VJYA 2UZ1A 1PT9A 4HDAA 3CF4G 3K35A 4KXQA 1MA3A 3HWWA 4FEGA 1J8FA 4JUFA 2EZ4A 2Q28A 1YC2A 2OD2A 4RMJA 4FVTA 1V5GA 4I5IA 4L2IA 2Q5LA 5AHKA 4UTRA 5MGNA 1EFVA 1YHYA 3IAEA 2IHTA 4R8MA 5EJ7A 1ICIA 1Q17A 1U2GC 4UTXA 4MZXA 5IMSA 4BUZA 3GLTA 2EZ8A 4GP9A 4RJIA 4K9KA 5K3SA 1Q1AA 3LQ1A 5EJ5A 2JI6A 2OORC 4K9PA 2OO5C 4MPPA 4JU8A 1V5EA 1YI0A 4KPUA 5EJAA 2NYRA 1QPBA 2H2IA 3ZGOA 4C7BA 4F4UA 5EJ8A 1UPAA 2H4JA 4UTNA 1M2GA 3JWPA 2H2HA 4RMGA 1POWA 1YC5A 4K9QA 2JI9A 1T9BA 5MF6A 1M2JA 1Q6ZA 2JI7A 4J1TC 2OD9A 4G1CA 4V1CB 5EJMA 1HZZC 4BN5A 1YNOA 1YBHA 5K6TA 4JUAA 1PO7A 3EA4A 5DGDA 2QQFA 4UTZA 3PDHA 2Q27A 1U28C 2A1UA 3CLUD 2DJIA 2H2DA 2OD7A 5BWLA 3CLSD 2X7JA 4K9MA 3GLRA 4UU7A 4K9NA 4MPJA 3D7KA 4BV3A 4BVBA 1EFPA 2H4HA 3FSJX 4K9OA 1M2HA 1ZPDA 4QELA 4BVGA 1V5FA 4BVEA 4RMHA 5D7NA 5EJ9A 5FYQA 3FZNA 2NXWA 1Z8NA 4UUAA 4GPEA 4Y6LA 4Y6QA 4UTVA 5BWOA 1PNQA 4FEEA 4UU8A 1YTLA 2UZ1B 4JUCA 4RMIA 4F56A 5EJ6A 3HWX1 4JD5A 1YHZA 1YI1A 4ZP1A 1T9DA 1U31A 1O96B 4K9LA 4JUDX 4IG9A 1MCZA 1M2KA 3F6BX 3D4BA 5DEIA 2WVGA 2JLCA 4ZZIA 2VBFA
chains in the Genus database with same CATH superfamily
4P92A 4Y9DA 1KEEA 3QE9Y 1VBFA 2FQQA 2EFJA 4ECEA 1LDEA 2IODA 4KG7A 4M60A 3OOYA 4DQVA 3LVRE 2DFVA 2JI8A 2H48A 1TA0A 1Z45A 2OOSA 3ELBA 3HV2A 4PANA 2B4AA 4YJGB 5ALQA 5BSWA 5J3JA 4WBSA 3L8ZA 2XVZA 5CLIA 3GJSA 4BKPA 4EG1A 3W5DA 4TYQA 3RREA 1RKQA 3W4KA 5LZ2A 3BSWA 4EI9A 3ZYCA 2ILVA 2Q5OA 4F6CA 2VJMB 5FFNA 2IHNA 4DLAA 5CAEA 3F3MA 2IBTA 3FYUC 1AZTA 2ZCUA 3OJXA 4R1LA 3WGGA 3A1NA 3E81A 3D7MA 3LVBA 2A9QA 4MKXA 3NRBA 4DNPA 1CR2A 3DZKA 4DG5A 2O8BB 4MW4A 2I6GA 3IV9A 1JIXA 4RZUA 3E2MA 2WK1A 2BF7A 4TPUA 1GGFA 1T13A 3AV3A 3CE9A 4AC9A 6YASA 3CONA 3HCOA 4Y7CA 3NR2A 1DAEA 3AVPA 3ETCA 3L84A 2WKRA 4KRYA 3JRXA 1VPTA 3DDHA 4B7ZA 5BR8B 1JILA 2CZGA 5AKEA 3RGWS 2AW5A 1LQ2A 1KDRA 1VJCA 2WABA 4KUHA 5LZ5A 1OX4B 2P8JA 3K9BA 2IELA 4C3VA 3LBNA 2H8KA 1MW8X 2Q50A 1EAYA 3T7TA 1LY1A 3ASUA 3HB0A 3R7BA 3TIIA 3P2AA 4C76A 1B42A 3A2KA 1PKXA 3F71A 1XLVA 5DOZA 3SVTA 4ECAA 3DLIA 2JJYA 3ZDQA 1IB6A 2NZ2A 4BO1A 4NMMA 3OQPA 3FY4A 3JR3A 1OOEA 4L78A 4BC0A 1KKLA 1Q14A 1M9NA 4WZBB 1DAMA 1HPLA 2B9EA 2M2IA 4FFBA 1X9HA 2JI4A 5JVH1 3VA7A 2YOGA 2Y1FA 1OVMA 3HXMA 5AI6A 5DCWA 5F4BA 4Z53A 4G09A 4BTEA 3PF8A 4KGVA 1E66A 4DCOA 3DC7A 3LPMA 2DTEA 3U40A 4C29A 1MIOB 5K2OA 3E3OA 3BS4A 4QG3A 1O8BA 4CL2A 1T5OA 4IHJB 5THXA 1YIDA 3OWXA 1JR3D 4R05A 4L75A 1DL5A 1C0IA 4ENVA 3CUYA 3FPFA 1DG1G 1X7YA 5C5EA 3IU3I 1VCOA 4D25A 3MK31 2K2QB 4QDZA 2NIPA 3HO8A 3WV5A 4RL4A 4AVYA 1GEGA 1UADA 4GOOD 1B74A 3HXPA 3KLOA 3LUDA 2ZSDA 2FZ5A 3CCBA 3MJHA 1COZA 2EEZA 2J85A 3O03A 4FC6A 4UASA 3ABSB 3LQKA 4GXTA 1NE7A 1AF4A 4OVKA 3W1WA 5TF0A 1I10A 3JX9A 3FJYA 3PEVA 1NKTA 3D8UA 2Z2YA 3GFBA 4RIEA 3FWKA 4C4SA 1MX9A 5IULC 4CEIA 3ZEIA 4R2HA 4RH3A 4WZAB 1AA9A 1M34B 3AY0A 1QO7A 1WB6A 3CRMA 4MWTA 4RHFA 5LU9A 2HDHA 4NMWA 1II0A 1UK7A 4S24A 2PGJA 4REOA 3F78A 5CXQA 3KKPA 4I9UA 3HN6A 3MMXA 3FNHA 3QOWA 5J2TA 3ZZUA 3P20A 3SFVA 3AZOA 1X42A 3WJ2A 3NB0A 2WTMA 1WP9A 4NBVA 3SJCA 3E15A 5JQGA 2Q9BA 1XLTA 4L15A 4UDXX 2W2OA 2ZWAA 3TD9A 1CKEA 4LTDA 4AP5A 2VJLA 4BO4A 4Z9YA 1N0IA 1SELA 3RVRA 4B40A 2P78A 4R1TA 1Q7RA 1Y42X 1OZHA 2R751 1FQKA 4GZ5A 4J4TA 3LW7A 1P7ZA 4O0MA 3M4XA 4E2XA 2IZ6A 3OVMA 1VIMA 2B1JA 2I3DA 5I7VA 4TTQA 2GRUA 1QHHA 4QWMA 4XA8A 2JLWA 3B48A 4GKJB 1GQQA 4EO9A 5F7OA 3HSSA 1FZTA 3HA3A 1Z25A 2NTEA 2PX2A 4C7XA 3LCJA 2GZHA 2YZKA 4EL5A 4WIAA 2M6LA 5CCDA 3JALB 4XDYA 4KO3S 2Q4RA 4QSHA 4EHFA 4KR3A 4IRXA 2X13A 3HA7A 1G64A 2C92A 3RSLA 4DZRA 4EA7A 4BPBA 1C7EA 1WSDA 4L5CA 3BT7A 1GPAA 4Q3AA 2B78A 5AI0A 4HD8A 1QHYA 3VR6D 1PLLA 2XRYA 1BEZA 1GFIA 3HP4A 1P33A 2W98A 2JATA 2ZUCA 3DZJA 3KDAA 3N0XA 4MQ5A 2DBRA 4BNDA 4E09A 2H08A 1T6ZA 2QVZX 2NLOA 1ZN2A 2R8EA 3T3HA 2PPVA 3MPSA 2AL7A 1VPLA 1T0JB 3NOXA 4TWIA 4Y2YA 1RYNA 1S89A 1XWWA 1IK4A 1HWYA 1YQQA 2NUPA 1VSVA 3AQIA 1IRNA 2GO7A 1XPRA 3M5PA 3U4DA 1KYIA 5LBIA 2OM2A 2YJGA 4RL6A 3UV7A 1PNOA 2O3QA 5JXGA 1B6RA 4W7SA 1N3LA 2WAAA 3LBYA 3TAUA 5FTLA 1JIQA 5ALUA 1X80A 4A8JA 4BWYA 4Z4GA 1CUYA 4HFMA 1YH3A 3MCUA 4F85A 4RY0A 3CA8A 4MW2A 4Y6GB 1FXUA 1TRHA 4LCJA 1B00A 2AUSB 3I4NL 1QRDA 2IEIA 3AGPA 4QDJA 1TIPA 2QUIA 4EH1A 4V196 2ZAOA 1M7GA 2GTIA 2R6ZA 2IYLD 4HGPA 1T24A 1C9MA 3AEKB 4N5DA 3WLOA 3WXBA 2LIPA 4MWOA 3SC6A 1W94A 1ECCA 3PC2A 4H6XA 4K3VA 5FI5A 2J59A 3BGVA 4Q34A 2J09A 5DBEX 1DC8A 3GBSA 1FTWA 1AHIA 3F7MA 4PHFA 4YAOA 5GWXA 1GYRA 1UXJA 4BMNA 4RDIA 1GPJA 1E0SA 1YKSA 3DUFB 4RXMA 3FJOA 2IBSA 2B21A 1G20E 1O3YA 3RC7A 1P4AA 3EIHA 1PAUA 1I3MA 1ZH0A 3IOCA 3R7NA 3EXG1 1QE3A 3GYGA 4HUJA 4RD3A 1T1GA 1P2FA 2BFDA 2DCMA 2H7YA 2H92A 2RCYA 2V7TA 1P19A 2JKYA 4K0RA 4OUKX 4PC3A 5ALKA 4ES6A 1UOQA 1GXSB 4CV3A 2YRWA 4PNZA 5E4TA 4YJ3F 4CMIA 4D4HA 1TAHA 2QE7A 4JBGA 2B8NA 4TKLA 5ALDA 1NTOA 1YFKA 3U1BA 2DH5A 1CVIA 2GBCA 2MTBA 1WKVA 3PWTA 3S27A 3T06B 1C50A 1A3CA 3EFEA 4G5HA 2IYWA 4DUPA 2XA2A 3A4LA 1Q0TA 5EJ2A 3RIHA 1Y4SA 1E59A 2DUNA 3KZKA 1DQRA 4EF6A 1AQ6A 4R0MA 1H93A 2F2TA 2DLCX 3MAJA 3ND8A 1JHRA 1XCJA 4GGMX 1JZTA 2EAUA 5B1SA 5TGTA 4MUFA 3IT1A 5CIWA 1U65A 1MXHA 2REOA 3PHIA 5GJCA 4AZ3A 3PFBA 5RXNA 1OROA 1DNPA 1I01A 2ZEJA 4MTLA 3C1OA 3K3PA 4Q82A 1UUFA 2VF5X 3A6ZA 3CZMA 3RB8A 1F20A 5AVSA 2RBEA 5L7YA 3V8RA 1KTIA 2CJWB 4XFKA 3H3JA 4LRUA 1VJRA 2OHVA 2WIAA 4OLJA 1US8A 3TB4A 1HKHA 5BMVA 1R74A 5B53A 3ADDA 1KYXA 2XGJA 3NTQA 4Q3DA 3TXAA 2OFOA 4D45A 1W52X 2HADA 5DM60 1IE3A 1T3LA 4ZEMA 1XQ9A 1EDBA 4J29A 3MELA 5DZSA 2QLMA 3OZAA 3HBJA 5COQA 3NTXA 3HUEA 4XQ0A 3T1TA 2G4CA 2QRZA 4AKGA 2AFVA 4AZVA 4JROA 1K7YA 2LTAA 4DQ0A 5L4NA 1CW2B 4NFLA 5ES4B 3VR5H 3AYXB 3SEQA 1NAHA 2AJCA 2BBWA 2ZIVB 4OHXA 5ES3A 1WAMA 1HDGO 1OIXA 1PSWA 1WPRA 3UM9A 1H69A 5KKNB 2C3OA 4K8RB 3I8OA 2I3BA 3QFTA 4KWHA 3X2SA 4E08A 4DCJA 1A7AA 1LLUA 2V7BA 2PWPA 5I9MA 5H83A 1PL0A 3LIPA 3LHKA 4HSEA 3DLAA 1RYFA 2M9MA 4P3YA 1E9BA 1JDPA 2ZE8A 1UJNA 2IUTA 3QU7A 1RI2A 4J3FA 4M37A 3N7TA 3NEJA 1LFDB 3T9DA 1JR6A 1DBPA 2Y2UA 2WHEA 4HLNA 2WC1A 4CUJA 5CLFA 2XQKA 3WIDA 1OXKB 3BHMA 4AHYA 2CSUA 1XPOA 1D8TA 1TQ2A 3KR0A 2JGMA 2AR7A 1V5EA 1T4CB 3HLTA 1D7OA 3DS8A 3ETNA 1MAVA 2H1RA 1J2TA 5DM0A 3TSWA 2BZSA 1VP9A 3ADOA 4QU0A 4XZ3A 1SQGA 3R5JA 4FT4A 5CLHA 4DNXA 5EJ8A 2F43B 5A9SB 4TVKA 1YF3A 1JG4A 2QD5A 4C05A 4FJ0A 1KH3A 1ZQ1A 4W5WA 1CY8A 4DFDA 3OF2A 4M1QA 3HYCA 5JNRA 2C6AA 1R5BA 1BS2A 3N74A 4P1ZA 3ZJYA 5CEFA 1GA1A 1PFVA 2FLKA 1IIBA 1D09A 2H1IA 2H5LA 2JHCA 2NUBA 2WD7B 2ZUBA 1C7RA 1QIMA 4IMIB 2O0KA 3ZU2A 3THYA 1P3Y1 3E58A 2F1JA 5E1MA 2AT1A 4CKBA 3K70B 2ZRGA 2Y1KA 5K2MA 2UXDB 5TIIA 2OK7A 4MVJE 1NWCA 4ZT3A 3KDSE 4QNRA 4CG1A 3E2IA 2IYXA 4A0RA 5F2OA 3OKFA 4D0SA 2DHQA 3TL2A 2GFIA 4XD7D 4AQ7A 4IMRA 4TM8A 3IT3A 3Q7TA 1R8SA 4ZK6A 2H2AA 3HDGA 5FULA 5I9NA 5CRIA 3TTTA 1QFSA 5DHSA 5KC8A 1KVTA 5EIOC 1M8GA 1Z4QA 3BTUA 3EA4A 3HYLA 3IDFA 1XHLA 3ILXA 1JW9B 1KMHB 4IKPA 4DXAA 2HZBA 5EWLA 4DRXB 2ZI5A 1VPWA 1RRMA 3N8DA 2WILA 3DEYX 3GD7A 1CQPA 2QTHA 5DLEA 1AB5A 2OCBA 4R9NA 1CF9A 2OBNA 4G1MB 1NR5A 5LN1A 3FNGA 3LGAA 2YC2C 2RARA 1G2QA 2PU7A 3QQPA 4OCZA 4CIXA 2OGSA 1ZOOA 3R1IA 4IILA 7MDHA 4Z0PA 3KJEA 2ZRFA 3LNTA 1NE2A 2Z4RA 3SHWA 3BWMA 4AJHA 3H2GA 3FF4A 4OGKA 1MD9A 4W4TA 2AFRA 1MNQA 2EBHX 3TNLA 4OL0A 4Q3OA 1KL7A 1Q92A 1YB5A 2FU5C 2H1CA 3QJ5A 2YMPA 3W3AH 3DKKA 4UU0A 3CT4A 3K4HA 3RROA 1X1TA 1JDUA 1SULA 3PXXA 4Z7OB 2QAIA 4KQWA 4ZN1B 3NBKA 3K0CC 4CR7A 3CR8A 5IM4A 1XO1A 2WAYA 1W6RA 5B1DA 4Y9UA 3KO8A 3LYAA 4UXIA 1TIKA 3DFZA 4EPYA 2CLFB 3PGXA 1W44A 4CKWB 1A04A 4LHYA 5IKOA 3TW4A 2V1UA 1CV2A 2B63L 5A9RA 1NQVA 1Y9JA 1SUPA 1YJAA 3BK7A 4C07A 4DWWA 1QHGA 4XTRA 4FE3A 2QEQA 2IYUA 3V6MA 4BLPA 4CV0A 4LHSA 3W2HA 1H4QA 1DJQA 4WESA 5KJCA 3ZNPA 4NBRA 1P1JA 4C1BA 1ND6A 5JS6A 3K0FB 1Z8NA 1KAEA 5CFQA 1CUHA 3NP7A 3UAXA 2W2KA 3EOZA 4Z3DA 1UXKA 2XSZD 4GPEA 2I66A 4RVGA 5LNK1 4W5QA 2JFUA 4FR0A 4B7XA 5HM8A 4WY8A 1GGNA 1A4IA 3CUVA 1J99A 1EUDB 1GO2A 2VXOA 4WUVA 4Y2JA 3SIPA 2DXIA 3S0JA 1TUEA 2O2XA 1E3IA 1BXGB 2JCYA 1BKDR 3OF3A 2X6TA 4YP6A 5B6JA 2HDNB 1J5PA 5IJAA 1FRZA 2AA3A 5EMKA 4BLTA 2AHRA 2G6TA 2XT6A 3KJHA 3EDOA 3HKZP 1EIZA 3I23A 3MMNA 4OY3A 3DP7A 4X85A 5IJ9B 2HHHB 1NY5A 1ZJ5A 2HBQA 2J3EA 2ONCA 2XXBA 1DRJA 2ZJFA 5K03A 2D5BA 3NPAA 4I66A 3IELA 3NT5A 1I2DA 3R3VA 4AXXA 5KIAA 5EIHA 3V1NA 4Z49A 5B3KA 5JXWA 2GAIA 4ZQBA 1N5RA 3KQMA 1USKA 4JY7A 4A82A 5DV9A 1YUNA 4YJ2B 3B1FA 5J5CA 4B3IA 2WT9A 2XQFA 5BT8A 2YU9L 4N6NA 2B1IA 2LKDA 4DSOA 2QX9A 1P6QA 4HUTA 2R79A 3JYPA 3KZNA 2XV1A 4MB0A 2QIOA 2KM1A 4NXMB 1EQ2A 5F4ZA 2JIQA 4F2HA 3W4JA 2HUPA 1RVV1 4QPDA 3WK6A 1UC5B 3WQQA 5CA0F 4C6SA 4II2A 5DM71 2BFCB 4KR2A 4YRQA 3D02A 1ZLYA 1Q15A 5AVQA 5A3RA 3KYCA 4YUXA 3V8QA 4UXHA 1EFVB 2ZQYA 1JPJA 2Z6VA 3A2LA 1WNTA 3D4BA 2AZ4A 2QJTA 2X9NA 3QXSA 4N7JA 4BJ1A 1R9NA 4BZZA 4Y2PA 4V02A 1Y4UA 4D4KA 3FYCA 1FSZA 1UOOA 4IIFA 2D1SA 3PITA 4R7ZA 1A8UA 3CEAA 4NDNE 1E2NA 2QZSA 3B78A 4NAVA 1WDWB 3D8RA 5F5NA 5DNDA 4ZOLB 3DVAB 4N82A 5KOHA 3O3OB 1LNQA 4OYHA 3DD1A 3WDSA 2QL7A 2CDRA 2X3UA 1O95D 4EKDA 1OHHA 4WVFA 2E82A 2IUYA 2EGUA 3FFWA 4IKOA 3ANMA 1R0BA 2PZKA 1A8PA 1S2IA 3VX3A 2QTBA 1KDOA 5JCOC 3R9XB 1APBA 3OLYA 1XYVA 1C3JA 2W11A 2QRUA 5HQTA 1K7SN 1W4LA 2Y0BA 3KSZO 1L5QA 1E9CA 1GARA 1O5OA 2DQSA 1B6TA 2ECKA 2FWNA 3MQKB 1JEQB 5IZCC 3TLEA 2ZSJA 5HM6A 3L0IB 3B12A 3IBGA 3QEJA 3KSMA 2I1QA 4MHOA 3WWDA 1FNBA 1KDPA 4HWTA 1LVUA 2ZRPA 4LZWA 3WNQA 5IHPA 1WPGA 1JL3A 5EI5A 5JS7A 1T9CA 3FMIA 1CJKC 3P2YA 2A2ZA 1DCTA 1XV5A 1BDBA 3HCAA 1GDDA 1YB4A 1PWZA 3FB4A 5CPBA 2O57A 3KYIB 2J3DA 4F1KA 1NLMA 4JLJA 2RJ3A 3V8PA 2WPDA 4PEVA 1ZHFA 5KYKA 4DUYB 3JQGB 4QTXA 3WQBA 1ZSNA 5BUSA 4M38A 1ZCFA 2W2LD 3KAJA 3L07A 1GU7A 4L9WA 3DAFA 2F3SA 4R7GA 3TSCA 2EZUA 1NJ2A 3K1AA 4A6PA 4FX2A 1MH1A 4PBSA 2GB4A 2KWIA 3QP9A 5JI3E 3EGVA 3V9AA 1OKKD 4MIEA 3UA3A 1IXSB 4F3NA 2P9ZA 4MS3B 2BTQB 3C98A 4QE3A 2JFGA 4WRRA 4HVLA 5CEJA 2BWJA 2C9CA 3O4RA 3JYNA 3FVVA 3M4OL 5JFGA 4IINA 1IOVA 4CMEA 2O8EB 3MTEA 1OX6A 2HY7A 4A10A 4WCFB 4R16A 3EB9A 2JGNA 2QA5A 2WG1A 2PH1A 4KFTA 4ZIRA 5LIRA 3NVMB 2W2NA 5AN9H 3U6BA 3TL6A 1Q5PA 2H54A 3MT8A 1BJTA 3BRWA 4X24A 3WBKA 2IKQA 3X1YA 2HJSA 1JKIA 1IIRA 1UJBA 1M2FA 3Q10A 4RYDA 4P4NA 3E35A 4YALA 3CEHA 1HEIA 1B1AA 2OP1A 3QEMA 2BN4A 4HDQB 2XUKA 3S2ZA 2Z8YA 4G85A 1RXSA 4ITRC 2J9GA 3A26A 4WKCA 2G5CA 2XB6A 1S7GA 2GN8A 3PD7A 4J0JA 4PLZA 1ZL2A 3RRYA 2GESA 1R64A 2OSVA 4B7CA 3MUEA 1E79A 2FDCA 4NAUA 4OI2A 5E9WA 2OKGA 5HQ3A 2FRDA 1RZRA 4D4LA 4YRBA 1SHJA 1T8PA 4KXMA 3M2PA 4XQEA 1A76A 2QTFA 5FUQA 2P2DA 2O3SA 3K9GA 2F8LA 2Y66A 3IMFA 2CKMA 2GF9A 1PGJA 2VRNA 3QOFA 1ZX1A 2ZDGA 3KV1A 4CLRB 5LQNA 3RQSA 3SM3A 5JLJA 2RHTA 2WNIA 3SICE 5AVXA 1UAAA 2WNSA 1J7JA 4K03A 3AY7A 5IBQA 2X6RA 5HIAA 4ESOA 4LF5B 1Z38A 4QOEA 2V3BB 4UBJA 1JIIA 4U0KA 3A1VA 4DIDA 2W6JA 1R6TA 4N6OA 2A4MA 1BFDA 1QCCA 2OXCA 1NULA 2QGFA 1O94A 3DCJA 3HJRA 1RYZA 3LG2A 3EGIA 3OFKA 5KX5B 2Z6AA 1UXGA 4Q19A 4F12A 3C5WP 1RE0A 2C95A 4MQEB 1UFQA 2D1QA 4X20A 1OZGA 1QOZA 1VYHA 3IQXA 4FE7A 4GWLA 4JJ8A 5CK4A 5CW1A 3PNQA 5FQNA 3D4PA 2OENG 3DPUA 2AFHB 4NU6A 3D7LA 1HI9A 2YIDA 3DE2X 2ZVQX 3QWBA 5FLYA 5FL7D 5I7SA 1EJ0A 2P68A 4ESVA 3WNVA 1SOUA 2PJDA 4XSGA 3FCYA 3HXOA 2AGVA 2JVJA 3IKLA 1IDOA 3IAM1 1T9HA 3R3JA 1XTQA 4NU8X 1RQGA 1U3CA 4ROSA 4U3JB 1Y80A 1AKMA 3Q3EA 2QRPA 4DNQA 1FU8A 2Q6KA 3D6FA 3ZVRA 4QPNA 2XTNA 5DLQC 4W9NA 3ULKA 3I32A 1P0MA 2C9MA 3E18A 3RYIA 5G0TA 2JGRA 1CJSA 2Q9CA 3BXPA 3R5XA 5K20A 4OQFA 2XF8A 3MXTA 3NG1A 2HXYA 2E2HL 3PHHA 1G8HA 1Z28A 4UOZA 2QTLA 2BCGY 5TMBA 1HLPA 3IQEA 2JLVA 4WPGA 3TRFA 2VUML 2AI1A 3L4SO 3HUTA 3L8FA 3ILVA 3JQBA 2JH8A 3NHPA 4S2EA 3CLTC 3MA0A 5IJXA 4NV0A 3CLRC 1E5LA 3RRJA 1ZZGA 4OXYA 3SQLA 2R6FA 1NBIA 1QTNA 4WOKA 4IIBA 4ETMA 1DAGA 4Z1OA 4CM5A 3VM6A 3K0HA 5JO9A 3UZUA 2JIZD 1EGHA 4OQPA 1NI5A 4EF5A 2FQWA 3JYOA 4J0FA 1YZ3A 3W9UA 4CGZA 4DYDA 2ZYUX 3RE1A 1IB0A 3OFND 1JJ7A 4JX8A 4PPQA 1RACA 2ZP1A 3GFOA 2OAP1 3ASYA 3BJMA 4IPTA 4JP5A 1VLZA 2MHCA 2PN1A 3ZY4A 4PLFA 5AYVA 4C7OB 2WKSA 3WIBA 3KOXA 4ZJZA 5I4CA 2FMTA 3U3ZA 2RE8A 4O4HA 3VYRB 5DNCA 4ZYXA 1SU8A 2IQ5A 3MJTA 2D4HA 5HR5A 1YMUA 4IWYA 4HI0E 4UEWA 2AG0A 2IYNA 3IR5A 3OOHA 3QZUA 4MVJA 4BMCA 1KO7A 2X9VA 4E5UA 2HH9A 1OI3A 1KK0A 2A86A 5A06A 5JANA 1QRSA 2IHVA 1GNLA 1V5WA 3A9CA 4E15A 1R4AA 3K20A 2ENWA 4FSXA 4LG1A 5FP0A 1JVNA 3UGJA 5AI3A 3FSRA 4QOGA 1B3RA 2JKVA 1T0HB 2Q29A 4DMGA 5I7EA 5HF9A 1G8SA 1W35A 1BDMA 1Z6QA 1MU0A 2D2FA 1BWSA 4TOIA 2JD1A 3BMNB 4RVNA 3U4GA 2QYTA 2ZPAA 5P21A 1E2IA 1XSEA 2QV0A 3F2VA 4WLUA 5JQWA 3TH5A 3PFIA 1VXOA 4KXQA 2IWHA 2XE7A 1CWUA 1J0BA 4JBYA 1XMXA 3PRHA 4EPXA 3UCXA 2KQUA 3I34X 5DDIP 4YN3A 4BRUA 4KITB 3BUSA 1TO6A 4RD1A 1N5MA 4XYLA 3A6LA 3Q0TA 1AXRA 1KE2A 1CQZA 1CZRA 4KL8S 4PLHA 4E6YA 4NI5A 4D8WA 3SE7A 2EZ4A 1Y6FA 2VSNA 4L73A 2NV2B 5CB4A 5L40A 1T91A 1SUSA 1AB6A 4MARA 4P4UA 4OHPA 4L4UA 3E7XA 5GP1A 3R0XA 3UB4A 2WIDA 1NF9A 2HK8A 4R1SA 4RSRA 4UVDA 5B1YA 4PQFA 1H9BA 1RQLA 1JR2A 2C4MA 4RZSA 5F9MA 4OSOA 3TVYA 2DP4E 1BYIA 2BBSA 2YVUA 3W34A 2ISQA 1K8ZB 2DULA 4L0CA 3UJCA 3PICA 4CFYA 4EI8A 1THMA 1U2DA 2CHFA 2BFBB 3INRA 4X8HA 5DHFA 5IC5A 3ZU4A 1G3MA 1TX4B 1YE3A 3B6IA 3RZTA 2QUJA 4UTXA 1WHTA 1W0CA 4I99A 4L76A 5LFAA 4L4YA 1G60A 1YVPA 1Q83A 3OZTA 1Q77A 3HBNA 3P2OA 4LC0A 4URWR 4HQOA 4ZT5A 4E14A 3U44B 1A9ZA 4G4JA 3OCZA 4IX1A 3PXBA 1HT1E 2J8ZA 1X9IA 4FNMA 3E1GA 4YMLA 1E8MA 1F9EA 2NUAA 3PLNA 3TCXB 1SQ6A 1BXKA 2HIAA 2VF8A 3EFOB 4PYKA 2B30A 4PHGA 4Q7KA 3U2QA 1T3HA 1DMSA 3U7FB 1L1FA 3DZCA 5AW2A 1ENOA 1G0NA 3AKYA 3VR4H 2FZWA 3ID6C 3WHKA 2XXJA 3JZFA 5ICEA 3N2IA 5JAMA 1LKPA 3WIUA 1IU9A 3F73A 3KOOA 5BPFA 1UM9A 4WFN1 4PVDA 5K3SA 2ID9A 2VHWA 1N6LA 3L18A 5JCPA 2QBYB 3SX0A 4HWPA 1R15A 3HNOA 4DSZA 4ZGWA 2VRCD 4NZMA 3GT4A 2JLSA 5ENVA 2F4VB 2EFCB 3FUXA 3NDRA 4PS1A 3VU9A 3WGNA 3C16C 3O8LA 5HMLA 1CQIA 1VL0A 2P3LA 1VECA 4TVOA 1IATA 3ZGOA 2MSWA 1ZNZA 3ISJA 2IYZA 4JK3A 3L6EA 1MB2A 5JZVA 2PKCA 1ZJWA 3W5HA 2J9XB 3LP5A 2HMWA 2V7PA 3W7VA 1JHAA 1T2CA 4JVSB 3WMWA 2GS9A 2A0KA 5J47A 5K0JA 3TIXB 4OM8A 1I1NA 1O1YA 3NGLA 4Q6WA 3SK0A 2NT4A 1VYTA 3CO0S 1RWNA 5T6MA 3ZDEA 4DA9A 5ISMA 1POWA 3K0AA 5DHUA 1AT1A 2IZOA 2OTCA 2ZYTX 3IUJA 1AU9A 3P97A 3NU1A 4FW9A 4XYEA 5A5GA 2R5NA 3FPSA 1OLUA 7RXNA 2CEKA 5AKJA 2YUTA 2QLNA 1YL5A 2RDVA 1ZIXA 3IUSA 4C04A 3RJMA 4NCKA 4COOA 2FSVA 2W71A 2P75A 1VCHA 2XT0A 2ZAGA 2C4HA 3G7NA 3UCFA 1RB9A 3V1UA 2QNBA 2Q3EA 4G9EA 4YVFA 1R4MA 4FMDF 5AM0A 5CTAA 3UAOA 1E2QA 4DIEA 4HAIA 4O08A 1NG1A 4RADA 1WXXA 1AQIA 1JI3A 3L8DA 1IHUA 5FLXA 3DBLA 1G21E 2FY8A 1C3LA 5BUCA 3JYLA 3A6KA 3OZBA 4A3GL 4FGKA 2NACA 3FCSB 4WACA 5CT6A 5J2TF 2G5PA 5JDCC 2OWDA 4NF2A 2RGWA 4A1OA 2J4CA 1A2KC 5JISA 1UAYA 2Q6VA 1SC3A 3FWZA 5JQGF 4RANA 4KO4S 3OICA 2Y92A 4CQLB 3SXUB 1SWWA 2VN8A 1AUPA 1XZPA 3GFFA 2NU9B 3TM4A 3FYHA 1S6YA 2GFQA 1S3GA 3JVVA 2Z04A 5JG7A 3E05A 4GNKA 4QRHA 3ZV5A 1WB9A 1X1SA 1FLNA 2FOIA 5IARA 2A3RA 3JWEA 1R10A 1UJCA 2C5SA 4X0EA 5AUNB 1UBSB 3IVGA 4O63O 4O4JF 1D2RA 2FX3A 5DH9A 2QYHA 5FXMA 2A9KA 3W9YA 1QS0A 3ONEA 3AVWA 2DBQA 4LOLA 3GMTA 4XM1A 3GZNA 1QFZA 1TYAE 5IW8A 1NXVA 1IUOA 2PRSA 2VJDA 3QEOA 2ZSHA 4IGEA 4B34A 4GI2A 5JBQA 1DHTA 2PVCA 2EBFX 4JH0A 1KKMA 4MLCA 4Y0AA 1SKYE 2B37A 4BFUA 2VHCA 2V9ZA 3E5RA 4RTOA 1KI6B 2GYYA 2GEBA 2YJ3A 3FDZA 4GLBA 3SLGA 5C35A 4R69A 1V4VA 2F55A 1BOFA 4Q9NA 5ITSA 2QJFA 1Y34E 2X5NA 5A7HA 5EE3A 1NJ5A 3T4PA 3CSUA 4UD6A 1ZYUA 2ZDHA 3A7EA 4KGXA 3TVDA 3QE0A 4JLVA 2NSJA 4URHA 4AF6A 2VDOB 1SKBA 4Z7NB 5A0TA 5FO0A 2W48A 5CM2Z 1ZPDA 1OAOC 1H2HA 2EJBA 3QQCE 1E63A 4OQNA 4LYFA 1S7CA 1MJ5A 1V5FA 2R7NA 3QH4A 4BECA 2C2HA 3HY6A 4YCDA 3WZMA 5EJ9A 1II9A 4L9RA 4G0PA 4IHQA 4URXR 3QE2A 4RD2A 4U2DA 1FRNA 1X3SA 4IIEA 3G88A 1SXQA 1NMZA 2QY9A 2XMCA 4X1KB 4BNIA 1HSOA 3OA2A 5A6SA 1VGQA 3FVWA 3JAWA 4BWFB 1IJEA 4QOJA 3FHOA 4EEXA 1YR8A 4QRIA 3ZH9B 2Z1DA 5JVG1 1UFKA 3NM6B 1NFRA 2YRXA 4PX2A 5AVYA 3KNZA 3MT0A 1T43A 5DSXA 1E7RA 1U8EA 3AJRA 4GX1A 5E1DA 5KNBA 4AI0A 3ANXA 2X6QA 3AUXA 5GTDA 3LT4A 3M5CA 2BFPA 3CX3A 2DPHA 1L5MA 2ZBDA 1XAJA 1W0KD 1MF7A 4DJDC 2HVYC 2NVQL 1RWOA 1SCIA 2XEDA 1B15A 3L4EA 3N3BC 4NEHB 4P4SA 3RLIA 3Q0EA 3W8RA 4AI2A 2ERSA 2I8AA 3CINA 3D64A 2KBEA 4TXJA 5JJCA 1DQSA 1TU0A 1JTEA 3NHKA 4JLPA 3UT0A 2J9FA 4UHJA 5ERGB 2PDAA 1SN7A 4TKZA 1V7PC 1FUEA 5CLQA 3VZPA 4JB2A 3RTDA 3NVKI 3MTJA 4MI1A 3A6FA 4P7KA 1TVKA 1SVOA 3HEBA 2FPGA 1N5KA 1ZI8A 4PG5A 4TM7A 5ERXA 1YVRA 4R41A 5HSGA 1W48A 4EJFA 2X2OA 5JCJA 1CUCA 3WP0A 4CG0A 2D4AA 4I5FA 1QUFA 3T5MA 5FUXA 1M1YB 4RJ2A 3GAMA 4NPCA 4OQQA 4RTSA 2QMZA 3JYHA 5BYBA 2M1ZA 3OSZA 3GVPA 3LC2O 4UEQA 2AJ8A 4FYYA 4D9HA 2D0DA 2FWJA 1KXJA 1LI4A 1PZHA 3F6BX 3ET5A 4TQUS 1EVJA 4BEWA 2VQFB 4TQAA 2QROA 3AHGA 4G0OA 4IEIA 5L6MB 1TI7A 3I9KA 1YHNA 2ZUDA 4X90A 3S29A 1N92A 3PE3A 1SKQA 4LXYA 1TAQA 4RPJA 5IBCA 1H3NA 1TF7A 5JMWA 1V9CA 5D8DA 1GM5A 4S1OA 3GWGA 3R7LA 1JHYA 4BO3A 3DMHA 3NUZA 1HO3A 4NQZA 2PQ0A 3G2JA 3IA7A 3E9QA 1FNSA 4Y1RB 4DT1B 4FU0A 1TEXA 3S2SA 1NX9A 3ZHCA 2HRRA 5CURA 2E4XA 4N3NA 3KG2A 2J07A 3COZA 1IOZA 4TRMA 5J43A 4PPGA 4ZPXA 1O6FA 1TWCL 2FN7A 1QV6A 4EDHA 1QIHA 2XTJA 1FFCA 2B5WA 3OO0A 2FETA 1Q1BA 3MPUA 2C7RA 3DQZA 1WIWA 4PLPA 2GHIA 3BZBA 4BV2A 5KNCD 1V11A 4BIMA 4E5DA 1P74A 1PBNA 5C9ZA 1QHSA 3TQIA 4YRFA 2HFJA 4GF5A 4B9AA 2JRCA 1FP1D 2QSZA 4D6YA 4EFMA 2BEUB 3BXOA 3HADA 4OBEA 5DKFA 3ZK8A 4J16C 3O9ZA 5IK2A 3CURA 5AUOB 4OHOA 5L6LB 1WOMA 4D9MA 1FTYA 2VEDA 1ZIPA 2YVQA 4LDNA 3AOEA 1THZA 1CHNA 4OFXA 3RW9A 2WB2A 4C7JA 3VRHA 2BZGA 4NZOA 4L8FA 2WSMA 3PIO1 1X87A 3SWWA 1H22A 2WD9A 1IHYA 3TR5A 3KYVA 1B6GA 1GNPA 3H9QA 4AURA 3VYWA 1V9SA 3IVXA 4Z1MD 5BP7A 2O8CA 2RI6A 4B3XA 3BGDA 3CUTA 1X1EA 2PIDA 4PAQA 5E4JA 1FW8A 1EP3B 4BBSL 2K87A 1A50B 5DIFA 3X44A 4EYKA 1REQB 1E64A 3ZKAA 2C7GA 2CV0A 2BGKA 4KQ9A 3H5WA 4DC0A 1FP7A 1SOVA 1ZZEA 2WFAA 3NNSA 4GYJA 2VPPA 1MB0A 1Z35A 3FMOB 2WVAA 4ZDKA 3K72B 4HSGA 1U28A 2I22A 2PX5A 3MN1A 3ZHZA 1VIYA 3N0VA 3PNYA 4NFHA 1XZCA 3ZD7A 3P0JA 3JYQA 5JD6A 1OYVA 1OGJA 4BJ6A 1R5JA 3GEMA 4GPIB 2WIJA 3G8BA 2WM3A 4AJKA 2HJVA 3L6OO 1MT3A 2Y1CA 4K05A 2Z09A 4G0NA 4Z6KA 1J2RA 1WCIB 1DHRA 3NQ41 5EHIA 2ORVA 2QLFA 4P80A 4RA6A 1J49A 3D1VA 3H9GA 4LKRA 4RPLA 3BFXA 3WIEA 4D8VA 5HS4A 3QE4A 5BUZA 1CR6A 3GAAA 2J0UB 2O9JA 5C8XA 4NDZA 3D3EA 4QUIA 3ILHA 1XXLA 2CLHB 3OF5A 4EELA 5KTRA 1C14A 5LQRA 3K94A 2JGDA 4A36A 3SFZA 2BCJQ 2YW2A 3F0TA 1U7DA 1DIOB 3JATB 3FGOA 4X7BA 1SMKA 2JGLA 3D7SA 1JBEA 3GPIA 5EE1A 5JXIA 2WTAA 1PZMA 1MR3F 2PAFA 3HWSA 1RHRA 3D7NA 1G3IA 2XGOA 3SZ3A 2D13A 1FJXA 1RJWA 3O6VA 4KK4A 4MS4A 4ITVA 4KFUA 1MA0A 1YDWA 1IJFA 1K3UB 3RTAA 4DHEA 3TLBA 2PMCA 4M4SA 4AJPA 3M6XA 4K40A 4MLZA 1PWHA 2HCFA 1ORWA 3BJRA 4K5QA 2HAEA 5DBIA 3LL4A 1KOLA 3I45A 5G2OA 4EEKA 1FOEB 1FU4A 1P1KA 3GA0A 4W8GA 3P52A 4PINA 3DUWA 3CFYA 3OPNA 3UXMA 3IE2A 4HDRA 4K9RA 4XTCS 4DYHA 4YJFA 1V26A 5CNKA 3WBBA 4MW7A 3QVTA 1J1IA 3V8VA 5K4AA 4D9BA 4ETNA 4KE8A 3T4UA 2QMOA 4EJSB 1Z3IX 3E7WA 1DIHA 1KMIY 3ZCSA 1OFVA 4IAOA 4RELA 3C87A 4N41A 2J3IA 5KSOA 2ZIXA 3QHAA 3PRKE 4RS3A 4WZBE 4B48A 1DU4A 2C0QA 3GR6A 3KFVA 3L79A 3BD9A 4N9WA 5B3JC 3KT0A 4GLJA 1F2TB 4RVOA 5HRCA 5LQDA 1NNQA 1EWVA 1G8MA 1TB4A 1DPGA 4ESHA 4IEFB 3DVLA 3CLVA 5FUYA 1SHKA 3IIKA 1X8KA 2JARA 3DNFA 1IAVA 3WGOA 1DG9A 3DE1X 4R9SA 4KYIB 4MQMA 2JBAA 3PPYA 1SBIA 4AR6A 2AZTA 2ZRDA 3NHWA 5JY6A 3IMEA 4H6VA 2BT4A 1W0JA 2ZR8A 3OFVA 2BKEA 1ZSYA 1BWPA 1Z47A 4C0KA 4YWLA 1T2FA 1V1RB 3PUIA 1Z39A 1JSCA 4JELA 4RK7A 4ZARA 2D5LA 2FWRA 1F48A 2XB4A 2W58A 2K2WA 3R20A 3E3LA 3KWFA 4V3BA 2OQRA 1M0WA 2BHTA 3DKRA 3E9NA 4DCUA 4EGCB 1CK4A 1V39A 2AXNA 2E2WA 5EEHA 5CIQA 1WW3A 1VDZA 2PLAA 4R2KA 1LSSA 3FPJA 3SKVA 4YMSA 1BQ4A 1NU6A 4JLDA 1QH8A 1UZMA 1M34E 3T7AA 3UB3A 1GDHA 1DO8A 3IVAA 2GN9A 4WH0A 1WBBA 4ON9A 3WK4A 1QU3A 3PKJA 3VUEA 3WYEA 4GZLA 3QJYA 2CKAA 3ZEAA 1NJ1A 2AXQA 3V4VB 3HJYB 2O4UX 1WJGA 2RJNA 3PJRA 5MN4A 1VMDA 5BSMA 5EKSA 3G68A 2GAOA 3I9OA 1KZ9A 5DNYB 1Z2OX 1U6IA 3SIXA 3FSGA 1Y3FE 4N7RA 1Z2AA 1D4ZA 1WZIA 1NBOA 2PS3A 3K7EA 2XTZA 4L6AA 5HFAA 5T64A 3ZE6A 3JARA 3V7UA 2GYUA 4AIRA 1SXJB 1XEFA 2ARKA 3JQRA 5AQEA 3ACCA 2QJRA 3U7EB 5C18A 4WERA 3AHHA 4AMGA 1DEAA 5ALZA 3VI4B 5TE9A 4ZICA 1OLSB 3KZVA 4H4EA 3D0QA 3TNFA 1BCRA 1EP1B 2QMQA 4MVWA 2O5JD 2EX0A 2VP5A 4C30A 5JJBA 3AJAA 3OFSA 1J23A 1SOMA 3CX4A 1IVYA 3F3YA 4FJ1A 4A3BL 2QDKA 4YAEA 5AOAA 4PPYA 1RPZA 3FF1A 3LLVA 4QEKA 1LD3A 4B5KA 5GVRA 1E2GA 3F4BA 1Q74A 1QQ6A 3IKJA 2QN8A 1D6JA 2CXTA 2IPXA 3K35A 2EL7A 3LUKA 3TKYA 4AG6A 4BMZA 4RIFA 1UM8A 1T1EA 1DO2A 5K0BA 1GFSA 2FX5A 1OWCA 4A03A 2YNMA 3PD1A 3SZOA 4FDVA 3L8MA 1ZUIA 1VE5A 2QIPA 1JDVA 3W6PA 2Q28A 2YWDA 1E2LA 2CMHA 2YWCA 3ASZA 3JWJA 2UVQA 2LD4A 4MCAA 2FPMA 4MQFB 1KOGA 3IR6A 3UY4A 1JLLA 3KLBA 4RPIA 1FJHA 5FUBA 1VYUA 2FB9A 2NADA 2Q46A 1X19A 4ZO8A 2C0CA 4AQYB 1U3WA 4YQYA 3CF4A 1OGYA 3JQ9A 1NP3A 3WQSB 1IBKB 3RK1A 1CQXA 2A84A 3FGNA 2FE4A 3OLQA 4JX9A 4YMTA 1WDTA 3N2GA 2P3QA 3BIXA 1QOQB 3D59A 2J41A 1S2OA 1QZXA 2LRHA 4AYTA 4YUWA 4E6EA 1Y6GA 1JHUA 4MEBA 3SVLA 2HTEA 4AY3A 5EZYB 5H3LA 4D97A 2QM3A 1DC4A 3HUUA 3AIOA 3C3MA 4GQBA 4G41A 3G0DA 4DY6A 3OESA 1LKOA 3GVCA 4N1AA 4H6PA 3L02A 2SKCA 4A9AA 2CJYA 5IXJA 4TXHA 1QO0D 3K92A 4MZXA 4YFYA 2XOEA 4ZU6X 4IH1A 1LF5A 5M5WL 1K5HA 1EBFA 1P2VA 1PQPA 2NO6A 3IQDB 2VJQA 1L5WA 2XWSA 4ITUA 5KYUA 5LP6A 1SMWA 1TPZA 1Y82A 5A05A 5KYWA 5KWSA 4C08A 4JVMA 3ZQUA 4QUEA 3V8NA 1YBAA 5IKXA 1QSGA 4IFTA 1Q0RA 2FSGA 3OIYA 4QBIA 1HDOA 1QR2A 2BEVB 2FPPB 3LLSA 1V35A 4HYYA 2ZTMA 4N3CA 4Z8YA 4ZVOA 1MABA 4UOQA 5LKAA 1HFJA 5FWYA 1SHTX 3F6CA 4OHCA 3ESYA 3HR8A 3LWRB 3QRWA 3U7JA 1P0FA 1Q19A 3CG4A 2X4GA 4LGYA 3FLBA 2QTWB 3GLVA 2VR1A 3ZNQA 1XLWA 4B44A 3H7AA 4B3BA 1YQUA 3CNQS 3WNZA 3QWAA 4IRMA 1DZIA 1C1HA 1NXGA 1JU9A 2AJDA 4MPPA 4POOA 1EJ2A 5LD2C 4EZEA 2IBMA 1PS8A 3FHLA 3QMWA 4BAGA 2RC6A 2PZFA 3DEIA 3N59A 1SZPA 1U8TA 3BGIA 3NCTA 3LT0A 2HCRA 3ZUPA 3VR3A 4CMKA 4L8LA 4P38A 4YV7A 3HOYL 4O2AA 2FP4A 2G63A 5HEKA 5J4LA 4G5FA 3FI0A 3ENNA 3IBSA 1FTQA 2FFBA 4BQQA 5TGZA 4RDXA 5K99A 2H2HA 5I7AA 4DLWA 5JEEA 5AUQA 3GDOA 3QKSB 1J1UA 1U2QA 4CKXA 1EFRA 3B53X 4YO7A 1TUGA 2JASA 4YRPA 1ZKMA 4WQMA 3DLHA 1GR1A 5KWIA 4KQJA 2OBYA 3EF3A 4OG2A 4B3DA 4OQ4A 1I30A 1L5NA 2JVKA 1R3UA 2SNIE 2ZE5A 4RHTA 3TFQA 5BXQC 3CKKA 2M98A 4D79A 1S3IA 2O8FA 4YRDA 2AZDA 5BVHB 1KORA 2P6RA 2G0TA 3IPLA 1RADA 3LA8A 2XW6A 3QU9A 3R24A 4KYTA 3MWYW 1ITZA 4OP1A 5IJ0B 2OBFA 2JL1A 4TWRA 3W4IA 1HZZC 1Q0HA 2I1WA 2J08A 4G5GA 3O7WA 4LUCA 2Q7OE 4QPPA 4RH1A 3CRRA 3C6ZA 1MPTA 3TTXA 4WK4B 1II8B 1RQXA 4K86A 4LJKA 2QM8A 2QQFA 4LXTA 1U3GA 1USUA 4R5HA 2PL5A 5CJPA 1HNNA 4WXMA 4FGLA 4YC7A 1NI4B 1SCUB 1YV9A 2LPMA 2R1VB 3ZW7A 5F51A 4KMSA 4DIFA 2QR2A 4ICIA 3O7MA 5CB6A 1DAHA 1MB4A 4FCCA 4Y8VA 4YXFA 4UMVA 4M8SA 4WCDA 2PT9A 1LLCA 4UPVA 2TMYA 4LNUB 3CJTA 4QBHA 4D4IA 5TNXA 3TM5A 1YDEA 3NBFA 1SMMA 3FCUB 5TB5A 3N2KB 2W2MA 1BN6A 5I9TA 1KEKA 3CVVA 4C9BA 5DYWA 4ZT7A 2GGSA 3VHLB 2NTVA 2O59A 3GTQL 4FXPA 4BKRA 2JI1A 2D2VA 1P7PA 1XZBA 2YHBA 3AR4A 1XMPA 1NMSA 2VYNA 2RHOA 2XVYA 2Y67A 5SICE 2FN9A 2REBA 3LY7A 3ABZA 3WHPA 3BF7A 4FZRA 1ADFA 3LQ4A 2YZMA 1FE8A 3LH5A 3CUSA 2H51A 2GA8A 3JQ8B 4YDQA 3K5HA 3IP5A 3V1MA 1R7RA 5KTKA 1RRVA 4ND5A 3T1HB 1JFFA 3ES9A 2JKZA 4B2YA 1R50A 2XYHA 3AFIA 5I5GA 3ZJTA 4M22A 2O2IA 3FZNA 3M70A 1YRBA 3QV2A 3EARA 2IXGA 1KOFA 1L4HA 4EVQA 4H7KA 2P79A 3HC7A 3M7IA 3M6IA 4QYIA 3CPSA 5DTMA 4ZAVA 2KE5A 3VNBA 1QM5A 2OOKA 2LIVA 2FPIB 3LLUA 4G5SA 3CZCA 2C2GA 1KQNA 3WLEA 3QEKA 3MFQA 4DKXA 5FH9A 1U8ZA 5TF4A 3O8BA 3EXHA 1RZ3A 3QG1A 5AJXA 4LFAB 1H9CA 4DABA 4NE9A 2CNNA 2GKGA 3A1SA 1ESCA 3A0UA 3DM9B 4TV9A 3SYLA 4P86A 1J06A 2NAPA 3WLFA 3OEEA 2Z58A 3TQHA 2XCOA 5EP4A 1QGOA 1QGUB 3OZDA 2G77B 1XUOA 4XSHA 3QX8A 4MUXA 3A4VA 3H5NA 4MGEA 3GRCA 4O2BA 4O4HF 4ABYA 4DMMA 5B5SA 3C6MA 5L9AA 3KSBC 1NPDA 1L7BA 2EWMA 3CXRA 3PNKA 3QBEA 1ZUNB 1OAAA 2C99A 3TOZA 4GMFA 1M6YA 1QK3A 1EFAA 5FLEX 3DZFA 2TMKA 3QLEA 4GVLA 4IQ0A 3DMFA 4S1NA 3WB9A 4NOKA 1K83L 2Q3FA 3HXTA 2Q49A 4G5XA 2YZ2A 3HCFA 3QY9A 3MERA 1Z08A 2A94A 1X94A 4L3VA 4BATA 2Q3JA 4DILA 1IWPB 4C4XA 1EXDA 5FBVB 3HBFA 2YTZA 5DOVA 3LK6A 3RM3A 3L41A 2XCIA 2Q62A 3E70C 3FZEA 4WFKA 4QTZA 3G0CA 1MCZA 3DP9A 4FOOA 1NZJA 5FBQB 3FOCA 2ZRJA 4EW2A 1WXDA 2WBLC 4G89A 2JLBA 5H7XA 3IAM6 3C70A 3UATA 1PE0A 3V4RA 2VH2A 4OKNA 2BMJA 2XE8A 1PUJA 2OMKA 5CGQB 3TMKA 3ZXSA 2ETXA 2H1FA 1TQDA 5AKZA 1CADA 5M3ML 1JKJB 2VBFA 4RORA 3SBDA 1Y3HA 3DZBA 3WYGA 5CB4F 2DY1A 5DHAA 4ZI5A 1PDVA 4FFNA 1OIWA 2PEZA 2W6IA 4DG8A 1LPOA 1IZZA 3OKPA 1JECA 4NYIR 3VC7A 5MDHA 2OA0A 4JYCA 3CPEA 1J5EB 3Q98A 1YQDA 1AO3A 4JYAB 1X38A 1JYFA 4QPZA 5AW1A 1JJVA 3KPVA 2PJZA 2DWPA 4PNPA 5F73A 1LTHR 1XI2A 1E2HA 2ZIZA 2BJHA 1UJMA 1N1GA 4GPTA 3ZWKA 3PHCA 2EJVA 1BAPA 1YGPA 4IJVA 4MKHA 3AJ9A 1NXWA 4W7IA 5TPWA 1RBQA 1ODTC 5GONF 5TQ0B 4CF3A 5B58C 4P0PB 2QRNA 1R1DA 4ZI7B 2BUCA 1X7ZA 5G0VA 3LY8A 4DDTA 1Z2DA 3BGOS 1MT0A 1QWSA 2WWTA 4BNXA 3SEZA 1E4YA 2I78A 3DNMA 2HLPA 3O0DA 3MGKA 1P91A 4GMXA 1OFHA 4FDUA 3ETEA 3CR3C 4IFEA 4KYUA 4BE7B 5HIJA 5GAHc 1HDIA 1LEHA 3EC7A 3TIGA 4G24A 4P83A 2WA1A 5CYGA 3PUWA 3M6MD 5EE5B 4JP3A 1K06A 2GD2A 4ACAA 4M0UA 1L4GA 4IF6A 4PNEA 3W1VA 4BUCA 1AO0A 4QFBA 1WBJB 1VJ1A 1UFVA 2I2FA 3ED5A 4Q3BA 3SF8B 1GU0A 3V2IA 6GPBA 3DULA 2HYDA 1UMBA 3FYUA 5DLPA 3BWVA 2B69A 1UBFA 2E4WA 5JMOA 4UCWA 3DHYA 1PSDA 1R0LA 3PC3A 2X9LA 3HJBA 1D6SA 3MGCA 1N2GA 1PI3A 1GQFA 1FCJA 1OXMA 2PXCA 3ZHXA 4BJ5A 4RTLA 4RMNA 4B71A 3CWZA 2HT1A 2G0NA 2YWRA 1EB9A 4R3NA 3K9CA 5FOXA 1D6MA 2QX4A 5A02A 1KSJA 4KIWA 4LIPD 4PG4A 4JT2A 2X0FA 5JATA 4I2VA 1KHTA 4X54A 4JWTA 4EVRA 2XWPA 2PX6A 2C96A 4G8CA 4U9HS 2FFAA 3IPRA 2IZ5A 1ECPA 4C14A 3PQ4A 4PU0A 3D4IA 1XBTA 1BCSA 1NUAA 4FGWA 2BTOA 4X3OA 5ALEA 2ZM5A 2VK4A 2PKYX 1GTRA 1QTQA 1E96A 3H5IA 3MINB 3NPMA 4HNAA 5G3YA 3UEOA 3TNYA 2QGNA 3WLIA 4WKBA 4QG7A 3TDKA 3ASVA 1X14A 4N47A 4JXZA 1J56A 4ND6A 1VHJA 4BMOB 4P5EA 5CXXA 1ZA2A 4FLEA 2IDKA 1BNCA 1EXWA 2CMDA 2QRQA 4HTAA 4WWHA 3P9QA 3GL9A 2W0SA 1JJAA 4P0TA 2XNHA 5BUQA 2E6UX 5JYDA 2HT6A 4GQIA 3TVTA 3EH2A 1N32B 3TD2A 1DJLA 1F3OA 3JQ7B 3SDBA 1ACJA 2X7XA 3LOQA 4FYMA 3MRSA 5KOIA 4UCFA 1EFUA 2YXLA 1SK9A 2BFMA 1TTHA 5MLC3 4JVOA 1R9TL 3D6TB 1UCFA 4D9NA 3BEOA 3IEVA 3DEAA 1NA5A 2C2ZA 2R6CA 3DVRX 4BV9A 3LUJA 4BASA 4DV6B 5KJEA 5J2UA 4KQIA 3B7WA 2VP0A 1OLXA 3CF0A 3OZCA 4DLKA 1PJ3A 2O06A 1KQ3A 2FGKA 1OVGA 1KBQA 3KWJA 4U9IS 3GOHA 5EIXA 3GJZA 4Y52L 4V38A 4BNNA 3LJKA 4D4JA 1P29A 3Q9SA 2G71A 4JLMA 1UEIA 5H68A 1TF5A 3E1KA 3D1LA 5BSKA 2PVPA 2O7QA 1Z82A 1DRVA 3MSUA 1OPXA 1XP5A 2O1SA 2ZT6A 4PO1A 2QPTA 5AK3A 1WL8A 5G4KA 1QAMA 3FMVA 3K9NA 4CKEA 4E7PA 3J80A 3CVUA 2QMHA 5EP1A 3FKSA 2X3FA 2R6AA 3NETA 4RV4A 1F2UA 5FV7A 1X7XA 3V46A 4E2WA 4F2WA 5ECGC 4IDHA 4RHXA 5EEGA 3KQHA 2H7CA 1RRPA 2PUGA 4UCXA 2P3SA 2C42A 5I8WA 3F1KA 2IW1A 2EWVA 2A6ED 4K87A 1T9OA 4AZWA 1SD5A 4F1JA 3DEZA 4CR8A 2P6OA 4NNPA 1ZICA 5INTA 1NW8A 5BSTA 2Q6OA 1NVUQ 1R37A 1HL7A 2FHPA 2Z5FA 1GSAA 1P3DA 1UDRA 3G82C 2DTDA 1XZAA 1KA9H 4N5HX 2CUNA 1C3OB 1DG3A 3PIDA 2B99A 3PNSA 4HWOA 1IVNA 1EVLA 1S3FA 5C8DA 5CX1B 4J75A 1IG3A 4X9XA 3NHLA 4UM8B 5DI3A 4KSCA 5E3HA 2H1SA 3TPFA 5A2GA 5KVCA 2Q6LA 3KR1A 2FXVA 2PYDA 1W85A 2BR3A 4AYBP 4KRGA 4LWZA 1SCBA 2WUWE 3M4JA 3QYJA 3C8MA 1U8UA 3EHDA 3RNLA 2FMIA 2KYRA 1I4EB 3SP1A 1GN8A 4BNLA 4JQSA 1YZNA 3GCWA 3E1SA 4E5NA 1RNLA 2R60A 4I3GA 2ZIWB 1UWKA 2AQ8A 3TTSA 3B36A 2XEXA 2PYAA 1MO5A 2BRUC 3AZPA 3I01M 3ZXYA 4ZYWA 5AJYA 2G9UA 4QXAA 3ZZMA 1H2EA 2Z98A 2J48A 3L1VA 3M6WA 3QVGB 4ZXFA 3KYWA 1N9KA 5FHQA 2H00A 2F1RA 2BC9A 4J7AA 4RGQA 3H6KA 2B4QA 4F04A 1M1NA 1B14A 3X2EA 1HR0B 3COVA 4ZN3B 4INZA 3QX3A 1DC5A 3GCZA 3QUAA 3ZVLA 5E6UB 4FHDA 3WLAA 1U3FA 4G2NA 3Q1KA 2GHRA 1R5NA 2CVHA 3RAPR 4RWZA 3SPXA 4LF9B 4XGRA 3WLHA 1XMIA 4NYMQ 1WVIA 1VZ3A 3GJQA 5JFTA 1QGED 1BVUA 4WLOA 1Z6GA 3HEAA 3NV7A 1ULHA 2P1ZA 5LYJA 2J4DA 2C8JA 3JASB 1N6NA 5LBUA 1QHFA 4MNTA 3GTKL 1C8BA 4CE6A 4JLKA 4XW2A 4CRWB 4C4OA 4K0KB 2PHZA 1BE6A 4M0KA 3RV3A 1LX6A 4U2EA 4BLQA 2DLDA 1WA5A 2BLNA 4FZVA 3S55A 2HGZA 3R0QA 2PM8A 4YJHB 3CH4B 3I0ZA 5TSDA 3WSWA 5C81A 5K8TA 3DOOA 4J2HA 4UFNA 3LGXA 4P31A 5FNZA 3GRFA 3NTRA 3HWWA 2FSSA 3TR6A 3GEGA 1E1MA 1NBMD 2IYRA 4GSLA 5KO2A 1QLHA 1E5VA 4A3DL 3DR3A 3C4JA 3DE4X 3V48A 2DSXA 4CM8A 1J8FA 4GX2A 4E13A 2ISSD 3CUWA 4MR9A 4QNNA 4Q9KA 4ER6A 2ZYDA 4H7EA 4YV0A 1KGSA 1Q1GA 3BCUA 5K3FA 2PR2A 1SG6A 2FWMX 1EWTA 1A88A 3Q2IA 3AG6A 1P80A 1DC3A 3HMQA 4YPVA 1CUSA 2B1QA 4GZ3A 4XIFA 3MPOA 1EM8A 5JVDA 1QZ3A 1EUZA 1S9HA 1PR3A 1KPHA 4IUDS 2ZB8A 3EQ9A 3KD3A 4EJMA 3F5MA 4QARA 1ODJA 2QL6A 4JAFA 3F2IA 3H1AA 4JI3B 4ZV7A 3VJMA 2Q5LA 4EY5A 4OM7A 5IJZA 3PJGA 1OAKA 4CM4B 1Q11A 3MWEB 3NBAA 4RUKA 1V16B 2BM0A 4CM9D 3PQFA 2EG9A 2W2XA 2WOJA 3BFPA 2PO7A 3RYHB 3TNJA 4JL6A 4QO8A 4W7HA 2GBIA 1F17A 4BP8A 4N9QA 3PFGA 1E3WA 2IOQA 1LC3A 3U16A 4GC9A 2VIIA 1TUBA 5HDBB 5SZHB 4EITA 4ISBA 3MCWA 2AE1A 5DM1A 4M6WA 4A3FL 1RYDA 1GEEA 1KETA 3UVEA 4QHSA 4LISA 3DDOA 7REQA 4NRDA 1M74A 1XDBA 4MRVA 2B5VA 1H1LA 4AWXA 5B4VA 1GD1O 2WDPA 1HC7A 5J59A 2BISA 5E6RA 3RSOA 4IH9A 4BMYA 1L4BA 1N7GA 2QQ0A 3BCHA 2YWFA 3K5WA 1L4LA 4KKXB 1M7HA 3LPEB 2DWOA 5CPFA 2GPNA 5SYAA 1H66A 3RT1A 5JCXA 5JZMA 1UOPA 1EWRA 1ORIA 3GLIB 1RHMA 5B7PA 4K9KA 4QECA 5TRTA 4UUPA 1W5EA 2Y68A 3K8YA 1Q0QA 1O7JA 1P1FA 2KLBA 3GELA 3QUQA 2J5QA 3EPLA 4FXOA 3WBFA 2C82A 2Q41A 2Q9UA 3N6XA 2E1PA 2ZT5A 3VTZA 4K9PA 4BO0A 1CQJA 5D3MB 3U9TA 5ABPA 4XWWA 1NG9A 3WWYA 1XTRA 2PBFA 3Q3CA 2VNIA 1NVVQ 4PPFA 5ECYA 4BQFA 2I2AA 3GRRA 3KQTA 2WF9A 1GGMA 2OMEA 3EVBA 1HQYE 3MLBA 5CJ2A 3S4YA 3LFHA 2JLXA 4ND8A 1TOAA 1J4AA 4X3CA 4C7BA 4LRQA 1GP2A 5AP9A 1OASA 3PZBA 3M33A 3JSAA 2ST1A 1KY5A 2OZLA 5DN6D 4N0EA 5L3SA 1CFZA 5HG0A 2MSEB 3ET4A 1AS0A 2SECE 3W06A 3QKTA 4FB5A 3CZRA 4KQGA 3S2HL 4LPSA 4XQ9A 5HF8A 1E6EA 3NBYC 1CJUC 3GCXA 3NWBA 2J7PD 1UBLS 3O91A 1FA9A 3GT3A 1XF9A 3P71T 1G5QA 3DV2A 4LY3A 1PR0A 1JG1A 3R9IA 5KVAA 2H52A 5FLML 4HTFB 1U3VA 4I5EA 4KACA 4DCCA 4N03A 4P98A 4FPXA 1PR6A 1BKSB 3DTVD 4BE4A 1RFGE 3DSRA 2N1MA 4QGAA 1KO8A 1H6BA 4NNJA 3VGPA 2X8LA 4Q21A 5EJMA 4KQ6A 4R7TA 2J0VA 3N8IA 1RKVA 1XNRB 2C07A 2PBRA 3C74A 3LRTA 2FYTA 3H9UA 4POGA 3MQ4A 3O9MA 4QD3A 4RVHA 5CM9C 1PJQA 1TKRA 1B16A 4N0DA 1WXQA 2W6CX 3U3XA 3RFXA 4ARZA 1NVTA 1Z75A 1T35A 1GIAA 1QQ5A 3H1BA 1C7JA 3A6DA 3ICVA 2B8JA 3KVOA 5BOVA 1R4NB 3LP8A 2R1UA 3I12A 4LYYA 2QQEA 1NUUA 1QYXA 1ZMXA 2A9FA 1F3LA 3GYBA 2LKCA 2PKEA 3NTOA 3EZ2A 5HFJA 5BV2P 1C1DA 3HCBA 1Y0BA 4QFDA 3GG2A 3Q9NA 4DDHA 1W4CA 1CT9A 3H9EO 3TLJA 3Q8KA 2EKPA 4G01B 2A30A 5CUQA 1K68A 4X60A 3TSOA 2EIXA 3U7RA 4UUQA 1IRXA 1XXHB 2GD6A 2XNJA 4FJ2A 1S8FA 2TS1A 2ZB4A 4MV5A 1FQOA 3D7KA 3IDQA 4FBMA 4QGGA 5EIOA 5IC6A 5CNMA 4PN7A 5LXTA 3T1YB 3BHJA 3IEIA 4WY5A 3ZLUA 4M99A 5AT1A 4D0NA 1SA0B 2OUKA 4YJDA 5BSVA 5KU1A 4JIMA 1V8PA 4O4IA 1NIPA 1PFWA 3PXCX 4MPDA 1YB1A 2CF5A 1QC5A 1EDDA 2ZB7A 1FNCA 1RKBA 3B82A 3NAMA 4HY3A 4L6IA 4O1IA 4C3JL 4E1VA 5JS1A 4MV3A 3FSJX 2LCFA 4D92A 3NS7A 4K9OA 1NLUA 1NLYA 3LU1A 3TX6A 5AICA 4HZUA 3NVAA 3NMUF 3I5YA 1WUYA 2ZRLA 1HT2E 1IC6A 2L19A 3VVBA 1ZINA 1EP2B 3SC3A 3VH3A 2X8AA 4GPD1 1IY1A 3ISVA 3QF7A 4KK3A 1H8EA 4UUAA 1DCMA 4KHPB 1ZD3A 1RAHA 2OP0A 2KW5A 3T52A 3D6NB 4OL9A 3W9SA 4QZVA 3OOJA 4KAJA 1NXQA 4IVRA 3BXXA 1KRHA 4E2ZA 1H4SA 2L82A 1RYEA 3O2QB 4TT3A 4RZQA 1ZUHA 1J1ZA 1CJVC 1EQUA 2IYFA 2RGGA 4HH4A 3BB4A 3EW7A 3PWFA 1RU3A 2PMKA 3M34A 3BIWA 4JQCA 2JLZA 3X1XA 5JNTA 3U56A 4JXXA 5C51B 1V3TA 1E4EB 5K0NA 1D1SA 1GRNA 2UZ1B 3AG5A 4Q1VA 1YK1A 4I4LA 4RMIA 5IYCL 1NQOA 5F2NA 2GM9A 3N0WA 2YJNA 1N5IA 1QE0A 4QJ5A 3UJ8A 4MVJH 2NU6A 3L1UA 2J33A 2CNLA 2HHAA 2J3LA 3NWOA 4PLVA 4FMCF 4XR9A 2F1OA 2UZ0A 3E48A 1TZCA 1A4UA 2XYQA 4YAUA 3NM4A 4PLYA 1KFJB 3P2KA 3QPBA 1FUUA 4WSOA 4X63A 2ZTSA 3HE3A 1UAGA 1L6IA 1U2GA 2GETA 4ALJA 3FW1A 4LHZA 5KAPA 4BZXA 5IF9A 1TWFL 3X0DA 3AEUB 1YUBA 3PYLA 1P6XA 1XPUA 3OPYA 1XVVA 3OUTA 3IALA 1W2WB 3C43A 3DL4A 4PYOA 3FOFC 2Z2ZA 4K9LA 4C0WA 3GJ0A 3B7GA 2WWIA 1G8PA 3AF4A 2ZBUA 2A33A 4FS3A 5AM5A 2CNBA 4DR4B 2A9RA 2ZI6A 4TTSA 2DECA 1TM4E 4Y6RA 4D81A 5E6SB 1TTPB 1SUCA 3HJWB 1A1VA 4P32A 1HT3A 3S14L 3N86A 1HTWA 2G8LA 3V32A 2JLCA 4PYLA 4XJXA 3WHIA 1J0DA 2Q0XA 1NW5A 3I92A 3OEHD 3QX7A 4HL6A 1AMUA 1KI9A 1UT8A 2V6IA 3IXQA 1NYQA 2ODBA 1UWCA 2CVQA 4G97A 1UZUA 4QRDA 3SMQA 3IP1A 3JQAA 1C5KA 4KIGA 5AOVA 5I9LA 4A8JC 2ZJ6A 2VATA 2DOKA 5KVVA 1E60A 5E9JA 1KNXA 2PD4A 4MB6A 1Y7PA 1YD7A 1XEXB 3ERCA 4XXBB 1JXQA 2IJGX 4OP2A 5C31A 4PZZA 2ZVPX 4E4YA 3V4PB 5DXAA 3EVTA 5D5QA 2FAXA 3TQCA 1CCWA 4DSNA 2I1VB 5BQXA 1QXSA 1WQ3A 3RARA 3LWPB 1H8HD 4EB0A 2HA0A 1FXWA 4A3JL 4MMYB 1NJFA 3EA0A 4RGVA 2R48A 2OY0A 2ZRQA 4LSWA 5EINC 1ML4A 2IS2A 1MW9X 1OFGA 2IW3A 2H12A 1UH5A 2VPWA 2ZIAA 4QVIA 3EGOA 3ITDA 2CXNA 5LP6F 5TS2A 2QN2A 2M6PA 3OQJA 4DLNA 4FR5A 4B9EA 9ATCA 1NU8A 3OT1A 4FX5A 4ZHSA 3NIFB 1R0JA 2QTGA 2R8RA 2WVHA 5BWNA 4FDAA 3MBIA 4DM3A 1G38A 2G9NA 2QX7A 1ZRNA 3VHXA 2N3ZA 4ZALA 3UQZA 1GKLA 3IRVA 2XGGA 3THWB 4CQNA 2QGZA 4XFDA 2PMWB 2WHPB 3E3AA 5DX1A 4RK5A 3R7WB 2X19A 3W6OA 2J67A 1PJ4A 2JW5A 2RDMA 2VSXA 2WIBA 5G53C 3KIPA 5DMHA 2MU1A 1O6ZA 1NT4A 4YAFA 2BCEA 4PCVA 4PWZA 1JXMA 1M1YE 3LHFA 1OTXA 4W82A 2DWUA 5I51A 3L1IA 1KOJA 1IFXA 1L5FA 3MMPA 4N54A 4KPFC 3GFVA 3WYDA 2CNOA 4DY4A 5CD1A 9LDTA 4DREA 3TKAA 3KYDA 1A7KA 5C52B 1NV8A 4QAJA 1YDFA 2A67A 2AI3A 2ODAA 4EHLA 3ZDRA 4FS8A 2QY6A 3QVLA 3I5UA 4IJKA 1CB7A 4YCMA 3A6HA 2PX4A 5DSZA 2I80A 2YOHA 5ED4A 3QYAA 3IP6A 1PW7A 1B8OA 2EFHB 4Y0NA 1WVGA 1W73A 2JIBA 4CF4A 3RHTA 4ZHQF 4BNMA 4L02A 4WI1A 4XUCA 4ZO6A 3V3TA 2NV0A 1GSHA 4WXYB 2AMFA 5ED0A 3ZWXA 2ZUSA 1TJ4A 1IQ0A 4H59A 4E1AA 5IK2D 4FZ3A 3G7SA 4Y7NL 1TK3A 3TEJA 1B76A 4I9HA 4JYMA 4E5SA 4YCSA 1NHGA 2HSDA 3CZAA 1WV1A 3EVZA 5B58T 1ZHHA 1WDKA 3WYNA 3T3EA 3B7PA 1EWKA 4WNAB 4Y2RA 2IDJA 2JAQA 1M2VB 1P7CA 2QRJA 3T5CA 1XK6A 2V98A 4E3WA 3FNIA 3SJAA 1AZWA 2GARA 2E4UA 5KJFA 1NPTO 1L7EA 3MQ2A 4CLEA 1OBVA 3HVUA 5SZKB 3LLMA 3KEMA 1CJMA 1NASA 4HDNB 1I0LA 4B6QA 5CD9A 2CNDA 5C4XL 2NO4A 3CS3A 1KZHA 3MAAC 4CM6A 1I9GA 1UANA 5A4IS 1CR4A 5EXDA 3IAUA 5MHTA 4H18A 4QA9A 1NMXA 4QGHA 4F86A 2XUJA 4P3OA 4AS3A 3K0KA 2W5UA 1R8JA 2L2QA 1IXZA 1HYHA 1UP6A 4R40A 4FUTA 4U7WA 5EPOA 3L7CA 4PGMA 2ORED 3T5GA 2XAAA 4NH0A 5CCXA 5E1OA 2JHGA 1QKKA 2R25B 3HKDB 1OWLA 2ZXFA 4ASUD 3PI6A 4KN5A 2IPLA 2BI4A 4NULA 2WY2D 4EMTA 5JMTA 2FDRA 2YV5A 5HS6A 5HTOA 9MHTA 4MTCA 1BH2A 1FB5A 5K0FA 1RRKA 2O8DA 2C5BA 4PYJA 2VAMA 1GJRA 1FYFA 5DISB 4CM1A 4D02A 4QJBA 4DPLA 3B6JA 1AGNA 3ZS9A 4CQMA 2BGNA 3KQWA 3IAFA 5D5HA 3I1YA 3I5XA 1CY1A 4HFJA 1YZKA 3NEAA 4JJZA 1GV1A 3EEIA 1KVQA 4P7JA 3SBXA 3N5KA 4CGYA 2RG1A 4GOND 2J3MA 4ZVVA 3TRDA 4LA4A 4XRGA 3UOGA 5EIAA 5JALA 1WTCA 5CFNA 2WU4A 5C7YA 1GSOA 3JWHA 3Q6NA 4G0WA 1V3QE 4DRYA 4HQ0A 5CLJA 2ZM6B 5B7QA 1EUCA 3CTMA 4JI8B 4IRUB 1RP7A 4AMVA 3V9PA 3CC8A 1ST2A 3HOWL 1JYBA 1TEHA 2D74A 4KU4A 4LMBA 5CT5A 1IHXA 3MMZA 5JD3A 3P8BA 4EAAA 3ZWVA 4CDGA 1VI2A 1OI4A 4PFQA 5ADVA 4FQ8A 3LI2A 2I91A 3GEDA 3OD5A 4LRTB 1D9ZA 1RMYA 2VHYA 4HH1A 3DOIA 4RF4A 3RK0A 3EXIA 2WM2A 2Z4TA 5KNBH 5ICGA 4QGSA 4BVHA 2ID4A 3EBLA 3LYLA 3N70A 3TTUA 1PGQA 1QOPB 3WYCA 4YACA 4M1OA 3FTFA 2Z3RB 4N48A 1PTKA 2GF2A 1DBRA 1JQBA 1Z5PA 4JAVC 4Q00A 1YMVA 3EC1A 1SXIA 3TBKA 1VE6A 3ZY6A 2HMYB 2OG2A 2IEDA 3QLVA 4TV9F 2X4DA 1PFQA 1MEJA 1A9PA 1UODA 2Z56A 1J20A 2F3RA 5KZMB 1RM0A 4TKVA 3GQBA 4L8VA 4G23A 1XRMA 1Y89A 3KP1A 3SLKA 5HUHA 1DQPA 4IP0A 1MC8A 3FKJA 4O2BF 3VYTB 5HKAA 3HO1A 1TAUA 4YRZA 2ENUA 3K7AL 2PX0A 1ZK0A 3DV9A 2OXIA 1AH2A 1M8PA 4ZO4A 3PEEA 2HIMA 3QF4B 1IMOA 1NURA 1S4MA 3LDGA 2AXEA 4L8YA 2Z6UA 1C30B 3GGDA 4HOYA 4MGIR 1CD5A 3KTOA 5D3KA 3LWBA 2EP7A 3VZDA 3C7AA 4G0MA 2HU5A 2N75A 1HYBA 5ENZA 4JBIA 4NBWA 4IDPA 1HTTA 1TVEA 1DQNA 3OWHA 4J76A 5FNVB 1AD2A 3AHFA 4JL8A 3SQMA 5JYBA 1XKXA 5HZHA 1XWFA 4KX5A 3BMQB 1ILWA 3SR0A 2ZROA 2YASA 1Z6PA 5CNIA 1QGYA 2IFTA 1DXYA 3JD2A 2GBGA 4WKOA 3Q0IA 4ER5A 1QPZA 1WCYA 2H2FA 1F2DA 1QE5A 1SM4A 1TNDA 1Z29A 3DDWA 1QJ4A 3EZLA 4L3OA 4LK3A 3OC0A 4RF5A 5CYOA 5FIUA 4M53A 4U7PB 3HBAA 3ZDYB 3WWZA 5COBA 2P5SA 5K5EA 2V03A 1X77A 3HV0A 4RTKA 3P9NA 1PT9A 1DBWA 2EU8A 4LYEA 3KQUA 3HWRA 3GZJA 1Z06A 2GNAA 4C5AA 4HDAA 1NJ8A 4IZHA 3S17L 4QDOA 1EAMA 1PHPA 3MS2A 4G8JA 3JAKB 4RNCA 5DXFA 5AVTA 5BN3B 1FTNA 2EFYA 1QGZA 4ME3A 3D4NA 2AZXA 1NC1A 1PZEA 1LLDA 1UJ4A 4IDGA 4X6YA 3WLKX 2XYGA 2VQEB 3H05A 1AF7A 3MGBA 1TO1E 1U8YA 2WFLB 2Q3BA 2DF8A 2ZSFA 3FCOA 1YS6A 3O8QA 5EQJB 5BNFA 3DBHB 4ZVNA 4YHHB 4FNOA 1H5QA 1M8FA 1RC1A 3EPRA 3L8YA 1XZNA 4U6NA 4F0JA 1PGOA 1AXEA 4F9EA 1NRXA 1TKBA 4KR9A 4C3HL 4U2CA 4R2WA 1CZUA 4BZPA 4HNSA 3JRNA 5CX4A 4ZD6A 2ERCA 3I6BA 3I0NA 1HYGA 1V8FA 4A91A 1FP2A 1OXXK 1P45A 1XALA 1Y33E 2F00A 3E23A 1D8AA 1GRQA 1B41A 3B5JA 3CBGA 4FHFA 3T61A 4BS9A 1A98A 4IHJF 3JQQA 1HM5A 2QSUA 2AYJA 4I1VA 3RV4A 1MJHA 4YMIA 2GWRA 2XE6A 3T3GA 1VJ5A 2HX1A 2I1LA 4L5AA 1AMOA 2WUFA 3RG2A 3RLFA 2VNKA 4OKIA 1FIUA 2HDOA 4TYPA 4BNTA 2ODNA 1ATIA 3U49A 1M6VA 1YQXA 5HF6A 4WBNF 1RD4A 1CR0A 3DB2A 5FUWA 5CA1B 4CEJA 1FPMA 1SXJE 3U4QA 3RJ5A 4AJNA 5KYYA 3AKZA 1A9TA 3KLPX 3CNEA 3MWDB 4PBTA 4KAFA 1IUPA 3N8HA 4RAQA 4LYHA 4URFA 1HFEL 2KJQA 1RLIA 2W8BA 1J2EA 4YRCA 4B4KA 3TRJA 1IUNA 3EGDB 1T0UA 2ZG6A 2JIDA 1YBMA 2BONA 4J90A 1CUFA 4K46A 2GH1A 4M8IA 3X1MA 4EAQA 3EYWA 4PAOA 1K1EA 3K0EA 4X8MA 2E7ZA 4WOJA 1NKVA 7GPBA 1A77A 2XJTA 3OT5A 4WJZA 1JPNA 5D87A 4OHYA 4KPEC 1VSBA 1J2JA 2N1BA 2Q1TA 1R12A 1E32A 1HF3A 3DE7X 1YJQA 1TYBE 3HCPA 1ZR4A 4LOAA 2I7VA 1KYVA 3OH8A 4MUEA 3AIKA 2C2OA 2I8LA 3E22A 5GGYA 4B3CA 1E2DA 1XJ0A 2OEPA 2DT5A 3AETA 4LZZA 1AKEA 1HDXA 4JIGA 2D0IA 1JAXA 1M73E 3PR2B 3KYUA 221PA 3QUCA 4JEHA 4YDRA 3UICA 1F4VA 3PNPA 4PLGA 3RUCA 1SVLA 3I9V1 4CIVA 3K9HA 5EMJA 1BW9A 2CDCA 2YFHA 3DMTC 4NOJA 4OJTA 2ATEA 5D84A 3N6RA 3VJLA 3K73O 5LJLA 2IXEA 4ZVTA 3SQDA 3WA6A 1JEYA 1M2GA 3A9UA 1CDDA 2V7VA 3M1IA 4EM6A 1IULA 1DCKA 3IOYA 1UZAA 4HRVA 1QMGA 3ZDZB 4RJTA 2MMCA 1YC5A 3DFUA 4V0SA 1K7XB 4R31A 1A5ZA 2IY8A 3Q7EA 1SO8A 3IJPA 2F1KA 3MLEA 3KZOA 1Q6ZA 4UBNA 3STTA 1J9EA 4ENQA 5FOTA 1E4OA 1X7WA 1I14A 3K5PA 1MZVA 3TZCA 5IF3A 3U4HA 1HQDA 4N8SA 5AJVB 4XWOA 1W88A 3RJZA 3LC7O 2Z43A 1PWEA 2RIRA 2Q8NA 2NP6A 3HN2A 3P0IA 1KWGA 1M6NA 2IDMA 2EKBA 4P5DA 4BX8A 2Q99A 3PTZA 2ZWVA 4M0LA 5FOSA 5J2UF 1OB5A 2FHSA 4OBXA 4BMPB 2HR1A 3QFHA 2Q5CA 1F0PA 5COAA 1I7PA 3EHEA 2BM9A 4TUYB 4UNPA 2O7NA 3ER6A 4U7JA 1BFKA 3RJTA 3VXKA 1N2HA 3BICA 4K6HA 4AUKA 4HMPA 5EWMA 1K88A 2HQOA 5C4JL 2PKQP 4IUBS 1GCOA 1UQTA 4NONA 1JZSA 4PAGA 3K70D 2JHFA 4GZ6A 3UMCA 4CMEC 3B08B 1RI1A 2QN6A 2Y99A 3ESQA 3VDMA 3VNUA 4UHKA 4Q9IA 4F3RA 2XRZA 1YZYA 4UU7A 4F91B 2NO9A 5E2BA 4UUOA 1ZRHA 3FDIA 3UANA 4K9NA 4MINA 3MCAA 1OMOA 4HZGA 3N7UA 1A69A 4HVAA 4IY1A 4YUVA 3ZU5A 5IXYA 1QYBA 2WWYA 2YBEA 3QBVA 4R9UC 2RI1A 4IX9A 1VKZA 5IP7L 5FBZA 1XQVA 5JYCA 1PL6A 3LPDA 3VMFA 3RBZA 1JYSA 5F33A 2VJNA 2QL0A 4OJQA 5C7LO 2CFSA 1T9PA 3PPVA 1ZXLA 3QFSA 1QB8A 4EYEA 2R2GA 3DO5A 1C7IA 2WYWA 1UBUS 4MR8A 4OFBA 1VE3A 1R0WA 3OZEA 3A11A 3U7QB 1AQLA 2QWXA 4NZ9A 5A4FS 4YFVA 5FLKA 4OK6A 2NU8A 2WA2A 4I4TA 4CHGA 3W7AA 1N2OA 2R11A 4X61A 3I3OA 4EB6B 1U9YA 3ISTA 1Q1ZA 2H5IA 5D7NA 5KSYA 2O3RA 4PGFA 1P1RA 3AKDA 2XH8A 5E0OA 2G7MC 5L4LA 3C5VA 1USVA 2CW5A 2HWWA 4MUJA 4RK1A 4Q4HA 5FWXB 4ZVQA 1HGXA 2BY4A 3CLUC 1AGPA 1EVIA 4I55A 5HE8A 5LDDC 3MT7A 1Y1TA 4MCHA 4PC7A 2QJWA 2CUZA 1IWOA 3OM9A 3I09A 4RFSB 5CH3A 5JJIA 2PLFA 1ZNQO 1XZEA 2LGJA 2XMZA 4Q9AA 5CB0A 4W8OA 2C7QA 1OFUA 2GM4A 3EXAA 2IZZA 2Q3DA 3QKRB 3MZ0A 3NHRA 3S81A 4CDRA 1CDZA 2EBWA 3D8BA 4HR7A 5CHYA 5K0LA 1JT2A 4I50B 4ZPJA 3K6SA 4NL4H 3CEPB 3DHNA 4PR3A 5LIPA 1K8YB 2FW9A 2ORWA 2P0YA 3IEKA 3OOSA 3GRVA 5DK6A 2UXCB 4EPWA 2JBHA 1G9XA 1BQ8A 1WZCA 1EZ1A 2PPLA 4F06A 4JNKA 4F46A 4QKQA 1T9DA 3DFKA 4C2M1 1JR3E 4GLFA 2WYHA 2FEPA 3LBHA 3VNAA 3A4YA 4LE1A 4W9NC 2DY0A 5DSTA 4L2IB 1O96B 2X23A 1LDGA 3IHKA 5K4GA 1D6NA 3WFIA 1AV6A 5TEVA 4AB1A 5KSWB 3N0RA 2QZJA 1MAWA 1UF9A 4TV8B 1ABFA 1E8DA 3C5HA 2L18A 1IBMB 5H70A 1PK8A 3MQFA 4BLUA 3TW8A 5FORA 1E1RA 3QELA 3Q1LA 3JQBC 3QM1A 4CVNA 4X92A 1RCFA 1QFXA 2E4YA 3DJFA 3EQ2A