5MGNA

Human sirt6 in complex with activator ubcs38
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-6
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mgnA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mgnA01
4FEGA 3JR3A 1UPCA 1YI0A 4GP9A 4GG1A 3JWPA 4F56A 2FR8C 4KGDA 4Y6OA 3GLSA 1QPBA 4V1CA 4JD5A 1PT9A 4RMIA 3HWWA 4FEEA 4QPZA 5FYQA 4UU7A 4BVFA 1U2DC 2OD9A 1M2NA 2EZ9A 4HDAA 4QELA 5K6TA 3EA4A 4MPPA 4TWIA 4UTZA 3CF4G 5K3SA 2AG0A 3GLUA 2FN3A 3FLMA 4QQ8A 4UTNA 3LQ1A 4UTVA 2IHVA 3CLUD 1MA3A 1PTJC 3GLTA 2QQFA 4GM1A 2OD2A 4RJIA 3F6EX 2EZ8A 3F6BX 5EJ4A 5EJ6A 4GPEA 1V5FA 2FWNA 4MZXA 5DEIA 3FSJX 2IHUA 2NXWA 4HD8A 4JUCA 4COKA 1OVMA 2PGNA 4JUAA 4R8MA 5EJ5A 5IMSA 2EZ4A 4BV3A 3FZNA 1YC5A 4RMGA 3EY9A 1YNOA 1SZCA 1ZPDA 2DJIA 1E3TA 4JUDX 2WVHA 4TWJA 4GM4A 5FEMA 1S5PA 2FRDC 2H4JA 3CLRD 3IAFA 5MFZA 4IG9A 4JUFA 2AG1A 3U3DA 4BVBA 5EJAA 4GM0A 2NYRA 1N0HA 1YI1A 4JU9A 1OZGA 4BVHA 5EJ8A 4ZP1A 1Z8NA 1Q14A 1M2HA 1Q6ZA 1V5EA 4J1TC 1T9DA 4UTRA 2BRUC 1POXA 2JI8A 3CLTD 1M2KA 4UU8A 2A1UA 1UPBA 4JUBA 4F4UA 4BVGA 1SZDA 2H59A 2QQGA 2VBFA 4RMHA 5MFPA 1EFVA 2HJHA 5K2OA 4UTXA 5EJ9A 2VK1A 4IAOA 5AHKA 2H2GA 4D5GA 4RJJA 4L3OA 1T9BA 2UZ1B 1YTLA 5BWNA 2B4YA 3ZG6A 1V5GA 2H2HA 4Y6LA 1EFPA 3E9YA 4IF6A 5BWLA 1JSCA 5DGDA 4K9OA 4MPRA 1YHZA 4O8ZA 2EZUA 2VBGA 4C7BA 3PKIA 3ZGVA 4D5EA 5MGNA 1T9AA 2IHTA 4V1CI 4FZ3A 2V3WA 2W93A 3IAEA 5BWOA 5DGTA 5MF6A 4JSRA 1U28C 2FSVC 1BFDA 2Q5LA 3D7KA 1S7GA 4K9LA 5EJMA 1HZZC 4JU8A 1Q17A 4Q9DA 4JT8A 2JI9A 2JI7A 4Y6QA 2JLAA 2Q5OA 1Q1AA 2A1TR 4K9NA 4V1CB 2Q5QA 1O96B 1J8FA 1YBHA 3D4BA 3PDHA 1PVDA 4UUBA 1M2GA 2JIBA 4FVTA 2H4HA 3HWX1 3CLSD 2EZTA 4KXQA 4MPJA 3K35A 1ICIA 1PYDA 1U31A 2WVGA 5D7NA 2H2FA 2VK8A 2X7JA 4UUAA 1T9CA 1PNQA 2C31A 3EYAA 4X3PA 1O97D 1PI3A 3OE1A 3RIYA 4BUZA 1PO7A 2VJYA 2VBIA 2Q28A 4G1CA 4K9PA 4K9QA 3GLRA 4L2IA 3ZGOA 4RJKA 4ZZIA 5EJ7A 5K6RA 3U31A 2Q5JA 1OZFA 2JLCA 2UZ1A 2H4FA 2H2DA 2WVAA 4BVEA 2PANA 2OD7A 4RMJA 2OO5C 2VK4A 4BN5A 1Y9DA 2OORC 4K9KA 3RIGA 3PKJA 4J16C 4JT9A 4X3OA 1DJLA 2H2IA 1OZHA 3D81A 2PGOA 1M2JA 4K9MA 1MCZA 1PNOA 2JI6A 1NM5C 1POWA 4MQ5A 2Q27A 1XLTC 4BN4A 2Q29A 1YC2A 1YHYA 1U2GC 4KPUA 4C78A 4BV2A 1D4OA 4I5IA 1UPAA
chains in the Genus database with same CATH superfamily
3KQVA 1A9ZA 4GSYA 1RVV1 3KXLA 3PGXA 2GSDA 1SK9A 2Q1XA 4EPTA 2FWAA 5TF4A 3DOJA 4US2R 3IPXA 4K05A 2IHBA 1T24A 1ZK3A 4LV8B 4GECA 5ICFA 3SQDA 3PEVA 4YWJA 1M2NA 2DBYA 2EZ9A 2RHLA 2VYQA 1CZUA 1P1BA 5WRFA 4DQDA 4QJ5A 3KD2A 4IO1A 4OA5A 3X1XA 1NN3A 4FWTA 1QU3A 1TUGA 3IH5A 5E9QA 5J59A 2O5CA 2XOEA 4CMEC 1RM5A 5G1NA 2R751 4AYXA 1BJKA 3CWQA 1DXYA 3INGA 3S8YA 3ISJA 4QDUA 4UULA 4P81A 4U9UA 4D4LA 4LZJA 9ABPA 2X9NA 2L18A 4OJQA 1WW2A 3JQGB 2C3YA 2QN9A 2H6EA 1P4GA 1U2DA 2BHRA 3CC8A 1ZBQA 2VT7A 1GRQA 2YH2A 3GJXC 3RWBA 3A4NA 1G8SA 5HUQA 4AR5A 1Z34A 5DHAA 4KYIB 2I2AA 4O5OA 4QQRA 4DRYA 4RSGA 2CF6A 3P2MA 3R6TA 5THKA 4H1WA 1QWOA 3RS3A 5J43A 4ZP1A 1V5EA 1JJIA 1N3BA 4YJGB 5L9AA 3PXEA 2KWIA 1M2KA 1DCMA 2BCEA 2QTTA 4KVGA 3AOEC 3OHSX 4O0MA 4LHLA 3WFJA 1IXZA 3KEFA 3OT4A 1EXNA 3MMSA 5B1EA 3U3OA 3BSFA 1R8SA 4GRDA 1H66A 1ULBA 4BLUA 3LBIA 2ZUFA 3QTBA 4YLYA 3ABIA 2WWHA 4HG2A 2OK8A 3BWYA 1XMOB 3ZG6A 2DFKB 4YAGA 1ZP6A 2AMFA 2Z2YA 4DYHA 5LKRA 1QHHB 5HGXA 3E84A 2HSDA 3AESB 1T9AA 3KUKA 1B73A 3NEPX 4IWXA 2IXGA 1CUAA 3QEKA 4J0QA 4JLPA 4JL6A 1PV2A 4YRCA 2CMKA 2YWHA 1I51A 4KFSA 5COQA 3LPAA 4IGAA 2WJGA 2CF5A 3OLZA 4LE0A 4Q4AA 1T36A 1ETHA 2R96A 1XZPA 2QOEA 4NPAA 4IIHA 1PNTA 4OHOA 2AE2A 4DLTA 1PSDA 3D4NA 4O2AB 2J48A 1UH5A 3H19A 3Q11A 2ZIXA 4HBGA 4XVHA 3C3CA 3OAAD 3U37A 2WJ6A 2G9UA 1M1NA 5HCNA 1E1QA 3RFFA 4ZT4A 3JAKB 3C8ZA 1D2AA 4XYEA 4NBUA 1JSLA 3UBTA 1OZAA 2OFWA 4GOOD 2Q6VA 1WJGA 3TLXA 3KQTA 2E4XA 1P31A 1UZLA 2JVIA 4X60A 4BNTA 3STVA 3DONA 1FF9A 1LX7A 4NY1A 4CGYA 5AVUA 1FNCA 2C8KA 4POGA 5SZJA 2QX4A 3S6JA 4BQEA 2RBGA 4NFYA 1DKOA 1OTXA 5JCJA 4CEHA 3SDBA 4B76A 1J0EA 3EXIA 4RVFA 2BKXA 1EUCB 2X4IA 4MQ5A 1D2NA 4DJEC 3C3XA 4HLCA 1FLAA 1Z3IX 1MIHA 2J33A 3IDSA 4XOUA 1Z75A 5FEUA 5K4HA 5TEVA 3VKHA 3ETCA 2QTMA 2GBFA 2O3QA 4HPXB 4DSOA 4PLFA 5DF1A 1RWQA 4W7IA 1O6ZA 4AVYA 1XZAA 1KTVA 2ZYDA 4F3NA 3OWXA 2PMBA 4UPDA 2RGYA 4D4KA 2BBTA 1SKYB 1ENPA 1U7OA 2NSJA 4LGVA 4R3UC 3RAEC 3DXZA 4DIMA 1T2DA 2XA9A 3KAQA 4ZO8A 2WKQA 3IOMA 4DCJA 4F72A 3L5OA 2L2QA 2Q5HA 3FYCA 4M0DA 4RVDA 4AJ9A 1USGA 4IIDA 5HHTA 4Q4AB 2QUHA 4M21A 2FUNB 2CWWA 2JIZD 4HWGA 1ADYA 2ZWPA 5F12A 2XJPA 2DHQA 2I6SA 5EXPA 2EKZA 4K9RA 4OMCA 4G4SO 4HQ6A 3RS7A 5DIZA 5IJ9A 2LD4A 8RXNA 2Z9CA 4JA2A 4RTJA 1ST3A 3AUJB 5DXAA 2C2YA 5IP7L 2Q9BA 2FMXA 2XJRA 3U4QA 1QH0A 2IELA 2E0IA 4TWJA 1XVVA 4E5DA 1E1KA 4K28A 1ND6A 4BPBA 1BKSB 3O7MA 1CB0A 1D0IA 1F5SA 5EKDA 4RZ3A 5F3DA 5E7QA 3AVYA 3DDSA 4JU9A 4FKBA 3E82A 1R4NA 1V6CA 3V1TC 1P5JA 2XUAA 4FBLA 3ZK7A 4F2GA 2WM2A 3C3DA 2HW8A 3ZJ4A 1PNVA 1T4CB 4PO9A 5E95A 5M3ML 4AN1A 1D4FA 2GZSA 5LMUB 3BBLA 2GNAA 4XQ9A 1WHTA 4F0JA 4G0NA 1DUIA 4U7TB 4X6YA 3SLRA 3P0JA 4YROA 1SKBA 4MQFA 1XDZA 3AC0A 3LUCA 5REQB 3EF0A 2GBCA 4MWDA 3VJKA 3WK9A 3V48A 3ZTTA 1O94A 2HY7A 2XVAA 1A98A 3JYOA 4CNBA 2AOUA 3GDWA 3D0QA 1JKJB 4OQLA 3PNOA 4XSHA 5DSZA 4B09A 5M34A 1ECPA 4TL9A 3V8NA 4QPJC 1C0IA 1ZQ9A 3I30X 4RS3A 2XQIA 2IUTA 5TNXA 3PF8A 4H0CA 4N40A 1X8LA 4ZCPA 1TW2A 2UVQA 1T4MA 4MR9B 3NHSA 1P7CA 4U3JA 2LGJA 1X15A 5AVSA 4EFMA 3ZX5A 1CDDA 1PVDA 2IC5A 4G25A 2HWUA 1KEUA 1UBMS 3LHDA 2H0QA 4TSFA 1FDIA 3WLEA 1BQ9A 1FSZA 2CBXA 2CYAA 3U9TA 5EHQA 1TD9A 3NDPA 4F12A 2FW6A 3EUFA 4NZOA 4DPLA 3G1TA 4F7DA 3RJMA 1SWVA 1D6JA 4XUCA 1JS1X 5JYCA 2R1TA 1W96A 4YBZA 2EEPA 3GFQA 3CRMA 4D8XA 4IDEA 2CCJA 4DNQA 3ZWWA 5CXSA 3VOTA 5ELXA 5HRCA 2WF9A 1UJNA 4ROTA 2J9YB 3ZHYA 1IY9A 4IQFA 2JEOA 4Z7NB 1IK6A 1K8ZB 1R0BA 4W6ZA 2D6FA 5LMNB 1O9GA 4MICA 4DADA 3P96A 4C9BA 1E1CB 1QVVA 3LAWA 4FFLA 4R2LA 4U7JA 3PQDA 4G56A 4ILEA 5LQMA 1RP1A 2VHQA 4EHJA 3T7JA 2HRDA 2XH8A 1JF8A 4TYQA 1NW6A 1ZFNA 1Z6PA 3BH7A 4QGSA 2AYXA 1H5QA 1BIFA 1DG9A 1HNNA 3LRPA 3O2JA 1U9IA 1YDGA 3MQ2A 1MZVA 4IV5A 3HL4A 5BUSA 4BV9A 2JEYA 1TZBA 3L6CA 3W2FA 2EJUA 4IDOA 5JSZB 5HQ3A 1LD3A 5KKCA 2FUG6 2WA1A 2IYAA 1VBFA 1XWFA 1PUJA 3HGQA 1AV7A 4BFVA 1B1CA 3X1JA 4M0FA 1KIAA 4E94A 2I4NA 1H7VA 8OHMA 3EGXB 1K8QA 2CXRA 3JQRA 4QODA 3P2KA 3GVXA 1S3GA 1X1TA 3GLIE 3JALA 1SK8A 2PKWA 2H4WA 3R24A 4IVPA 4MV1A 1AGPA 2X9LA 3DQQA 5IRCD 4DV5B 3LNTA 4XDYA 4HR7A 4U2BA 1E98A 2DLNA 1HDXA 2ZYGA 1HDGO 3N8NA 1V16B 1RDVA 3N59A 2ORVA 4E4RA 3UJ9A 1QAOA 3L2OB 1MC5A 4I19A 4E2YA 1E94E 3MSUA 1ZGAA 2HADA 5LL6P 3I12A 4C0XA 1IBLB 3RJTA 2ZM5A 3QV2A 4GE0A 5IW8A 3QVKA 1KOLA 4MRNA 1MQ8B 1QFSA 1I7SB 1JWBB 3IAXA 1KJQA 2BGNA 3ET5A 5KI6A 3UY4A 4P4SA 3DO8A 2CE2X 3BMOA 2PR7A 1UPUA 4ZAYA 5T57A 1GPNA 4XVUA 5BW4A 3PGVA 1Y5RA 3K9HA 4NR0A 4S1VA 5FUWA 1NF9A 2VHUA 2Z5VA 3FZGA 4XUEA 1XF9A 1NVBA 1R0SA 1YSCA 5ALMA 3TTUA 4DLKA 3LL7A 4UE6A 3GRRA 3GR6A 3TW4A 4LF9B 4J91A 4NZMA 4IHKA 1PLJA 1IQUA 4JBIA 1SZDA 4MB2A 2PGIA 2OCDA 3IBYA 4RWEA 5ALOA 1QGDA 3TG2A 4IAOA 5AVOA 2RH4A 2JI4A 4ROSA 4RJJA 2AHOA 2X6TA 1XYGA 3Q6IA 4FQ7A 1G6KA 2E6UX 2HI0A 4IZOA 3ELBA 1PCXA 3HXOA 1J22A 4FDLA 3NFRA 1BFYA 1BMFA 1NW4A 1SCUB 3I1YA 3FTPA 4L5CA 2PPVA 1KOFA 2PO7A 5IY0A 1JX6A 4GIBA 3T52A 4J4TA 1OWLA 3B1ZA 5FBLB 3RUHA 4WY5A 5J2TB 1IG0A 4LF5B 1K8XB 2ST1A 5L3VA 5JFGA 4XQCA 4UUNA 5GJCA 3SJAA 1KPGA 4GMXA 4TKMA 3RIMA 3UCFA 2PLAA 2ZQYA 1OE0A 4WEOA 1Z8HA 2XMRA 3E9EA 2Y9MB 4PNPA 2HM7A 4AX8A 2CDAA 1RMQA 1GD1O 2HCJB 1GOTA 2IW1A 3F4BA 3S2UA 2HF8A 3P1JA 3S68A 3HDGA 3EWSA 3L7YA 3WIOA 2HR1A 4G5FA 1QLJA 1XHFA 3JVIA 1UCFA 3QG5A 1T1SA 4TTSA 5K09A 2AE1A 3HVHA 2KHZA 1P1JA 4ZEOA 2PSHA 4S2EA 1EVYA 4RDCA 4Q93A 5J2UF 1NMZA 3FM9A 1QYCA 2EIXA 1Q7BA 4FW8A 3CZ9A 1J39A 4NLLA 2WE8A 2XHEA 1CR2A 5JQGB 2EW2A 4B4KA 1E2EA 2CYCA 2R6FA 1GRRA 2RJOA 3GRAA 4LOAA 5C4JL 4MVXA 5JXHA 16PKA 4RTKA 3QGMA 3NIGB 1VPWA 4NCXA 3I9V1 3I28A 1L5KA 4A3IL 3CPSA 1IFXA 5IFLA 1G5FA 1LQ2A 5TMEA 3RUDA 4QKQA 4C01A 1DOHA 3PO3L 1HX7A 2R97A 3VO9A 1K9VF 3K1JA 4FDTA 3L77A 4LY6A 2QMZA 4ZARA 5LMCA 3AKCA 4GXTA 4QA9A 3DUWA 1RJDA 5GIPE 2X0DA 4Y6OA 4D9NA 3G5MA 3HR4A 2CJWA 3TOZA 1D07A 1XMQB 2Y9PB 4AMBA 1NVWQ 4Z4FA 1R0GA 1ENYA 3TOSA 1ZMOA 4MLPA 5U4QA 4LFCB 5C4MA 3PXDA 1V3VA 2P11A 4P0TA 3H99A 1MJNA 3EOBI 4N7MA 1NN1A 3EA4A 3OM1A 5KU7A 5FV4A 2DPGA 1L5HB 3R41A 2HUNA 1U2QA 2V7VA 2VNHA 2W6QA 3MWGA 3OX1A 4OXIA 1Y5LA 3TTVA 4CM4A 2GARA 1NG9A 3HA5A 1JEYA 1XTTA 2NU8A 2PZBA 2O20A 1BCRA 2JW5A 2ZRDA 4M9CA 3VH2A 4S12A 2E6KA 4II3A 4BWYA 4D0GA 3JAWB 2QX6A 1LNQA 1H2YA 2GO1A 4OAPA 1B6RA 4DWJA 3ZCPA 1J8YF 1Y7TA 1FTGA 3L8HA 3TB4A 1VXRA 1EVIA 4LUCA 4AY3A 1RXVA 1D6MA 1IJKA 1GU7A 1JXAA 3GEDA 3BC1A 5GAGc 4L15A 1KJZA 2BEUB 4RHEA 3I9MA 1AXRA 2WDZA 4MA5A 4PTZA 2B8WA 1GA1A 2O2GA 3VNBA 1HMPA 2CVZA 5KSOA 2WQ7A 2D06A 4X9XA 4WA8A 3VOSA 1YS1X 1N7IA 3LDAA 5LOVF 1D2CA 3U3XA 3OO1A 3P9NA 3I04A 2V0FA 3W6ZA 2FB9A 3ZWAA 1NBME 4DCMA 2YY5A 1VHWA 4TL6A 4N3CA 3CNLA 1RI1A 1E1RA 1WUTA 2DFPA 3QU4A 3SNHA 4RZSA 3T3PB 1V95A 3ZBPA 1U8FO 1F38A 1Z4JA 1M7GA 2ZRNA 3QW4B 1QOPB 2EQ5A 2QK4A 4RGQA 1CUYA 5ALJA 3SHTA 1M9NA 1NLYA 4CDRA 2YR0A 3ZCRA 2AFHB 4ZOAA 3AR9A 1TQ4A 4PC1A 3PWFA 2EJWA 3AINA 1UC9A 5FWYB 3LPMA 3OBBA 1V96A 3ANMA 4FOTA 2HV9A 1E1DA 1ZK0A 4AB1A 3AV0B 5I3CA 1J49A 3FYTA 4J9UE 4UMDA 1JR2A 2ZB4A 4M22A 5D7NA 1KVUA 2BGGA 4PYLA 2FP4A 3UK2A 1OV6A 3PVZA 4JITA 3E9MA 2X15A 2NXEA 3GCZA 2KMLA 3GP3A 4NJMA 1WS6A 2MOKA 4P4NA 4ZAVA 4KR3A 2PU5A 1WUKS 4GL4A 4MQBA 3W5JA 1JIKA 2G4VA 2VDVE 1X94A 3TAUA 4BASA 2XDQA 5CNIA 1G3QA 4DQLA 2V6GA 1KQ3A 2I1VB 2V54A 2YV2A 3GUUA 4DEXA 3SVTA 4ZN3B 4XVRA 3E7PA 1S2LA 2G17A 4YRNA 2VJOA 1EM8A 2VPYA 3FYUC 3ETGA 3T1OA 1F8XA 1NBIA 2VXYA 3G2NA 3K1ZA 4QECA 4HAIA 4PHHA 5DULA 1AGNA 3C3JA 4DA7A 1PS8A 4HAYA 4PAOA 2RK4A 4GX2A 4EPYA 4DMRA 4AN0A 3HE3A 4JXKA 5AW3A 2YQZA 1UJ5A 1NV9A 2A0WA 4LHSA 4C30A 5HOQA 3OCCA 1L2TA 1SBQA 4O4JF 1G9XA 3P2YA 4XOIA 4RDIA 3TEMA 1TECE 1Y6ZA 3OA2A 5CB6A 5LKAA 2IPMA 1IWBB 3E9NA 3KOWA 5HFJA 1Z5PA 2VHCA 3QX7A 1E92A 4B3HA 2Z3VA 3PDUA 3K53A 3JWJA 4MCJA 2Q6IA 4OX9B 3PZBA 2BAGA 3M3DA 3TUJC 2QAGA 4QFDA 4LGCA 4A2PA 2Y0CA 1Q7CA 1KZ7B 1LTQA 3C5EA 1Z39A 1ND5A 2NUAB 2X4GA 3FBTA 5LVAA 1BFKA 3LKZA 4TZKA 1ZH2A 2Y6VA 4DAOA 5KZMB 4KNWA 1CY0A 4ECAA 3KRTA 1CEQA 2WKPA 3KLNA 3A6HA 4Z4QA 4I4CA 3NC1C 3V00A 1T8SA 3WDSA 4Q19A 3ASUA 4P7BA 1Q0LA 5LYYA 1NSTA 4B44A 1XD2A 4TM8A 3H1FA 3M6FA 3HV2A 2B61A 3HY4A 1FTWA 3EXFA 3L7LA 4KK4A 1HK7A 4QC2A 5CH8A 1UK6A 3FDIA 2YVLA 1V6SA 3K7AL 1BJRE 3DL0A 3LPLA 1CR4A 2WK1A 1P3Y1 1HETA 1PSWA 1H5NA 2NXCA 1QIJA 1CETA 4NJMB 4EPVA 1W88A 2NLOA 3AWIA 2V6BA 2YXLA 4J03A 2OPHA 2NZ8A 2IK8A 1VP3A 1T4GA 5HTKA 5KCMA 5CVTA 2ZTLA 2QQGA 5E4YA 3MTQA 1U8YA 2EW8A 4NBNA 2FE1A 1CS4C 3QWFA 1DX4A 3QNMA 2QTBA 4X20B 1RZUA 4RXTA 5LQCA 1XA3A 4D4GA 1RAFA 5CXXA 5K0CA 1QORA 1SC3A 2BR3A 2D13A 2ZJ0A 1IHPA 1PJRA 3L07A 4UDXX 5AMXA 1TZMA 3NOXA 4MR7B 4URZR 3ZDYB 3T1TA 3I01A 2J87A 2W93A 4Z99A 3PUZA 5THQA 2ZRKA 3AEQB 3AY7A 5M29A 2VF2A 2VDQB 2BEWA 2EP8A 5JVDF 1ZOOA 3L1IA 3VDMA 4E21A 3CLRC 3NP7A 5AUPB 4FNAA 3N87A 1T43A 3AESA 3UAGA 2F1IA 1L9XA 3JARA 5L53A 3WLNA 2EHDA 3PX7A 3FCAA 1C3VA 1T8RA 2JB9A 1TWFL 2RHMA 4PE5B 3B89A 1PG5A 4JFRA 3WKEA 2ZDQA 3IAM6 4P08A 4ED9A 3E9RA 3WGQA 3L6EA 3H2YA 4OHFA 3D5TA 3NHZA 1WJVA 2VJYA 4KPFC 2VBIA 2Q28A 2VO1A 3CUTA 3IQWA 1XDWA 2XNDA 3OZTA 4O2AA 3TM5A 3AJ9A 3PEEA 3WYAA 3Q2IA 1DRWA 1QGZA 1H1DA 1X39A 2I54A 4FOLA 4QXOA 2ZJ3A 5JAIA 1TYZA 3RADC 1Z6QA 3F5MA 1GUYA 5AI3A 1VKHA 1Y9EA 3FW1A 3OPYB 1I32A 3FMPB 3QELB 4HWOA 4IIBA 2VDKB 4HRXA 1L8QA 2Z3QB 3IOBA 4BN5A 1KVRA 5HKAA 1VFPA 4CKWA 3ZTWA 5K6AC 4IW3B 4G41A 1MB4A 1DI0A 1QIEA 2FH5B 3K4HA 3QU9A 3DO5A 4C20A 5AD1A 1B0ZA 3NUZA 4OAOA 1U8TA 4TXJA 1Z5WA 4HFMA 2IHJA 3PQ6A 3T3IA 4PSDA 3VYTB 5ARDA 4ZEXA 4NARA 1G59A 2QPAA 3CUVA 4TS9A 2WUFA 3O8QB 3M4JA 4ATNA 2NM0A 2PXCA 1EP3B 3UC5A 4JP1A 1A95A 4PU0A 5FLEX 3NHKA 2ONZA 2CN1A 2NTVA 4UDOA 1DLIA 3JWPA 1MEOA 3C6QA 1Q21A 4IIFA 2YHIA 4AR3A 1H05A 1TK2A 3AUUA 5CAEB 4YJGA 5FPSA 5A9TA 3B1YA 1QG2A 1P9WA 3RQSA 5EWJA 5EHXA 4WJLA 1JHUA 2EIHA 5DEOA 4AF8A 5ICCA 3RS9A 1Y1VL 4HDOB 3EYWA 2C83A 4W7HA 2ACKA 5AW2A 3PFHA 2CXNA 3D02A 3RAJA 2BZGA 3MQKB 1V1MB 4D96A 2IWHA 3R9WA 1TKCA 5DHUA 2ET6A 4QGGA 2A9QA 1WBJB 3RR2A 6LDHA 3L41A 4YAUA 3INTA 2ZSDA 3AM3A 2X1LA 2JDID 2H1LA 1KBQA 3KKMA 1TO6A 2FFQA 4HEQA 5K8VA 2VAWA 2X2EA 1PHRA 2ATEA 2JHPA 3DV0A 3NOQA 1Y7IA 1Y8CA 4AY6A 1AMOA 1NW7A 4TQ9A 2NG1A 4MGYR 4UUOA 2NO0A 4G23A 4UAGA 1QYBA 3N5CA 4FI3C 2IGBA 4Z9BA 2OHFA 3VNRA 2X0KA 5F3WB 5EE9A 5JJLA 3L6RA 2BR5A 3T7DA 1Y5IA 2PSSA 3LW7A 4RFLA 5KYXB 2GPBA 1AUPA 5FB3A 5K8UA 2YHSA 3QJGA 4C76A 4E5MA 3ERCA 3LWVB 2BEWB 2HJWA 4L4SA 3RSCA 2L42A 5FO0A 3FJYA 3HBMA 3NVAA 5EIWA 1RKQA 4MPRA 2Q3HA 4JBXA 4YYZA 5ADVA 2GNPA 4NOKA 1YL5A 3MD0A 4OREX 3WDKA 3EVNA 3EZGA 3NS7A 1WCML 4GGMX 1WP4A 2FWJA 4TQUS 2HR5A 1E59A 3TTWA 4AWXA 1G8JA 2OKGA 2WA2A 1CK4A 1NW5A 3A25A 3S16L 3G1WA 4XGNA 2IUUA 1XNRB 3UWPA 2G9VA 5IYCL 1HG1A 3JY6A 1Z4OA 4DM4A 3E7DA 4Y18A 4TX1A 1T2UA 3GOHA 3GLIA 3D4BA 4Z0HO 1FS5A 3KZVA 4EVIA 2AJLI 3N74A 4C2M1 4ZI7A 2H07A 2ZDHA 3VSEA 3CH7A 4DKXA 1ZH6A 3Q98A 4ER7A 3HJBA 3DMDA 1GARA 3T3EA 2HOQA 4S2UA 3S3TA 4EEZA 1KYVA 2DBVO 3IJEB 4YR7A 4ZZIA 3C39A 1M54A 2B6NA 3Q3JB 2WP8J 1M5TA 3UWOA 1ZIXA 2CL5A 4Q12A 1V25A 1VTKA 4R7GA 4DPKA 3L8CA 1L1QA 5HUJA 4S1PA 1Z0IA 2EERA 1GP2A 2PH5A 3EN0A 3Q7SA 4S0XA 1KDVA 1Z7GA 2Q49A 5TV2A 1BWRA 1SVOA 2QD5A 2YWCA 4LXTA 1M66A 4Q3DA 3RVDA 3VYWA 4IIUA 3M9WA 2EOAA 1YZTA 1OGYA 2ORYA 1U11A 3BCUA 4YH1A 2ODAA 4YLGA 3GUZA 2QVCA 1N32B 4MUGA 1KJ9A 5IHXA 2QJTA 3E8SA 3R0QA 1I13A 3GJ8A 3PQ3A 4I9HA 3KUDA 3CMCO 1UBGA 4XE5A 2PMDA 2YFKA 5H7XA 5IUJC 2XGGA 3H84A 3TTXA 2R0QC 4DA4A 5BNWA 4JLUA 4IHAA 5ALIA 3J81k 1BX0A 1RYDA 5GIOE 2RHRA 4Q9LA 3CHYA 2ID9A 4MRAA 5CMLA 1E2PA 1N1MA 4CV0A 4V0RA 3DKVA 1NMSA 3UJ6A 3I3OA 1WETA 2Q5CA 4QTXA 1PVVA 1XRQA 4H15A 2RAUA 3INNA 1Y4DE 4G5SA 1OREA 4U2EA 1GNVA 3L9WA 4JQSA 4RTNA 3KLPX 3QUTA 4U2GA 1W34A 3HMKA 4IXDA 3WQSB 3WLIA 1AUVA 4JVLA 1RZRD 1ISFA 1OA1A 5B53A 5DTRA 5LM3A 1U94A 1JXOA 1QFJA 2PSDA 5BQ3A 4JB3A 1RXIA 4J1NA 3KKEA 5LYJF 2HMAA 2JJQA 1IULA 1Y8QA 3VPFA 2I2WA 4BMYA 2MSLA 3M1AA 3RD5A 4PPFA 3SQLA 1GUZA 2ZSHA 3CSUA 2OMEA 5IF3A 4B0OA 1YC5A 4HAUA 1YR1A 3TNYA 3UQZA 1WY5A 2NZ2A 4JUDX 5C35A 4A2CA 4Z86A 2RG1A 3GDOA 2ZYHA 3IAFA 3LPNA 5CTAA 5DHSA 1P0IA 4XWOA 2QRVB 1MJGM 2XMCA 4AXXA 3RUIA 4E33A 3EGCA 1R4MB 3EMKA 1V7CA 1PEYA 2PHZA 1ZUHA 2ZJ2A 4YRZA 1TO1E 1GNQA 1RACA 4CF7A 2YY6A 1A2BA 5JH7F 1N5OX 3BCRA 4PS1A 4HRYA 4MGHA 4DLPA 5BY2A 1KZ6A 2WKSA 2Y1OA 4LJSA 2WTBA 1KAQA 3M0EA 4FUTA 4WW0A 3NNDA 3R3ZA 3CZ5A 3ZE9A 2H2HA 5BWNA 5IKMA 3FWNA 2G1JA 1F5NA 1NJFA 1SR8A 3FUXA 1U1FA 3PKIA 2HDWA 2F9MA 1KRHA 2NO5A 3BK2A 3C98A 2V0EA 1U0TA 4A8JA 1LY1A 3KALA 2Z8YM 3MAAC 4AQYB 1PDVA 1GCIA 3E9QA 1B6SA 1BROA 3R5JA 4BNDB 4DY4A 3RYHB 2QRKA 4Y7NL 5EYPA 4TWBA 2VXBA 4ZYWA 1GQ2A 1U1IA 1VSTA 3IHLA 5KPJA 3KB6A 1U7HA 4GBMA 3QOWA 4CGZA 2LIVA 1CEEA 2RBKA 1R4MA 1I8TA 3B3AA 4MAMA 4F8JA 2RH9B 5C8YB 2J9GA 2PTHA 3EDRA 2QSZA 5H83A 4ZMRA 3N3AC 2FU5C 4RVHA 4K9PA 4GMKA 5B1IA 1B2RA 1HNZB 1QKIA 3VISA 5BO5A 2EEZA 1A5SB 4ZK6A 1GL3A 4WKGA 2QM3A 3NASA 1LVGA 5LWQA 5IVIA 3ZWXA 1TWCL 4C2TA 2GD0A 1O7JA 4ENRA 2HQ1A 2XYQA 3SC2A 4DLLA 5F35A 1N3LA 3KJFA 4K9KA 1NFRA 2MIIA 3A32A 1ACJA 1DKPA 3Q3VA 4OYRA 3QEMA 2JI6A 3KEQA 2VRCA 3C4JA 2PL5A 4QHSA 4E31A 5DX8A 4YJHA 3U09A 3EZ6A 4YAWA 1GPYA 1TKBA 3U4DA 1IOVA 1RJFA 3LC1O 4QDZA 3OFKA 1W4CA 3FNGA 4HLUC 4IJ5A 4QJBA 3WB0A 4K1LA 3ZHZA 4EZEA 5D7BA 5K8CA 4E07A 3U61B 5B3LA 1LNSA 3MB8A 4TWAA 3A58B 3R5HA 3OC6A 3SE7A 3T99A 3E1SA 3THYB 1VMEA 2V74B 3EWNA 1XU7A 1DIBA 5D1NA 1E5VA 2IDKA 1PL6A 4XDHA 1E9FA 2WWTA 3DMFA 3M89A 2GXSA 3PUYA 5AVXA 1M1YB 1L5SA 1WIWA 2OCLA 3GLFE 4BVFA 1XI2A 3K2BA 1LDBA 4B32A 2I3GA 1ABBA 4X62B 4LK3A 1DBIA 3NI2A 2XWPA 2C04A 2CFCA 2Y1WA 4D0LB 5JRDS 2GFQA 3L7KA 2G4LA 3LOUA 1UP7A 3HM2A 2WY2D 1EJ0A 1Y4AE 2YZKA 1UFRA 2Q4DA 2W11A 3FWPA 1W87A 4LC1A 4TV8B 3SHVA 2E55A 1OC4A 1X13A 2D0DA 2PMKA 3DWGA 3E7WA 3UWKA 4A23A 5HMMA 4D9FA 1PGQA 1PT6A 4DMHA 1Z2CA 1HRKA 4TMVA 3ONDA 3A6ZA 4DWVA 1G55A 1DXQA 1Y1KE 3GEEA 1YDHA 4HUTA 3HNRA 3MTGA 3TJZA 1ZOLA 5J1TB 1IBMB 2FUG1 4XWTA 1VSVA 4QSHA 1NF8A 1NGSA 4IOJA 3U4IA 2RHJA 2DWOA 3PJDA 4FC7A 3L7IA 2PRSA 4XXBB 4H7JA 4LPSA 3H3FA 5JUWA 4DQXA 4DSNA 1V47A 5HILA 2IH4A 2IOFK 4LSWA 3GTJL 3DEIA 1EWKA 1FFWA 3LO8A 3KJHA 4BKOA 4AW9A 4HGYA 3RRZA 1M2HA 1NU6A 4I50B 3OE7A 1V48A 1A7JA 5LMZA 2NO9A 3SQWA 1HEUA 5IEJA 4I4TA 1D2GA 1E58A 4CDNA 5LZ2A 4HMOA 3Q1LA 1LLCA 3LX5A 4GGPA 4EFNA 2X22A 4OYLA 2AD1A 2FOIA 2WIKA 3S99A 2PJDA 2GA8A 4CQLA 3B6ZA 5AHOA 1W8DA 1HEIA 4DUGD 2ZUDA 3I6MA 1LPSA 2NO1A 4YP9A 2J9FB 1RCFA 4C0HA 4YUAA 2BONA 4YO7A 4OQQA 1XD9A 4FFBA 5CXUA 3HK2A 3RSFA 2VP2A 4UBOA 1E0JA 2XCRB 4EZIA 4BQIA 2D5BA 4JI1B 4L78A 1NAHA 3EXAA 3JQ7A 2JNWA 1U2EA 2P75A 1AO0A 5ALWA 1SCIA 1AOXA 3O38A 1H2AS 1R6BX 1HYQA 4FMDF 3KFXA 1OLSB 3FDXA 2Q1YA 3QVTA 1OJLA 1X8XA 3VOBA 2H18A 4CF4A 2WAXA 3BXXA 3P2AA 3PXBA 3Q87B 5DNAA 5FULA 2O7VA 4GKJB 4BNJA 3K3PA 3ZBTA 3IXQA 2W9XA 3F9IA 5KYWB 2HWYA 4AJKA 2ZB7A 3K6SB 2GFIA 2PUEA 1ZNQO 4NENA 4MUNA 1W36B 3IEIA 1QE0A 4LJ9A 1BKYA 1M6WA 1OKKD 3TBKA 1AIPA 4LHEA 3B3QA 5CFLA 5LCXA 3MC1A 3B3FA 4L27A 4A8HA 1PLLA 3QJ5A 2FWIA 4X7BA 1ZKDA 4G63A 4OY3A 4B7AA 5CIYA 4N49A 1UBHS 2VUHB 4KQ1A 1N5JA 4HNGA 5AI9A 5DTQA 3IB6A 4JYMA 2GD1O 1MX5A 1I9CA 3DKRA 3HBAA 5CM2Z 2YOHA 3D59A 4LDNA 4OSOA 4OQYA 1JALA 4C0QC 4MUBA 5GOZA 3U7QB 1Z5ZA 3DOCA 3LGAA 4EVQA 5I7UA 3G6KA 4KGDA 2FTKE 2JG3A 3EBOA 2W71A 1HDEA 4HEA6 1RYZA 2HK9A 2ENWA 4TKUA 1B26A 1RP7A 1X7YB 2YWJA 1GNTA 1GR1A 3EHDA 5JXIA 5AKXA 5E6SB 3ZGZA 4CDMA 4X8LA 4HQOA 4K3VA 4UHHA 4ZVRA 2ZJZA 4HI0E 4A91A 4F3YA 1KP2A 3ELYA 3W5IA 1NASA 5KQLA 1CRQA 2A58A 2IPOA 4K26A 3PNLA 4RZQA 6REQA 4WBNA 2J85A 2FP3A 5E8JA 2GD2A 3SEQA 1PZMA 3O84A 4D0SA 3OIVA 2CLSA 1Z06A 3WAGA 3OY2A 3K8YA 3R3WA 4DMLA 3FNRA 2WSYB 5J2TF 4E1VA 4LISA 4BBZA 4TOIA 3ZYCA 4R6XA 1U7XA 3EIHA 4MGEA 2HTEA 3GMDA 4LKRA 5FEMA 2OQ2A 1JQ3A 2XDAA 4X95A 4HTFA 2AOTA 1KSJA 4BU1A 1O9HA 2BUAA 1S8FA 1ZN2A 2Z6UA 4G4IA 1I1NA 3T9EA 3ZHTA 4CIAA 5HIMA 3W7VA 1G3UA 2D1SA 3QKSA 4J1TC 4Y6PA 5KPDA 1NOKA 2D54A 2QRJA 3G17A 1U9IC 3PV0A 5EA2A 3LQQA 5BRAA 1KZYC 1LDMA 2CC2A 2IZZA 2ZT5A 4E12A 2NU6A 2WSLA 1OCEA 2VI5A 5MFPA 4C22A 5EJ9A 2X5XA 4KR0A 3IDQA 3DE4X 1A8QA 3LCVB 3AW8A 4P7GA 5CNMA 1CUFA 1OF1A 1W88B 3MSCA 5FNZA 5KVVA 3CVVA 2ZWOA 2HIAA 3B9QA 3E5RA 1JPVA 5B2ZA 5LIPA 1W1IA 3D6NB 2PH7A 3IL2A 3UJPA 1ULZA 4RY8A 4YGYA 5E1MA 3R9XA 3E18A 1Y8RA 2PO5A 1L1EA 5EZQA 4DTIA 3PQFA 1N6IA 4X20A 2BFBA 1E9DA 2XCIA 3GAMA 3NCHA 4F4FA 4WNCA 1GSHA 1R0RE 3GJ3A 3GAZA 3MUFA 4FZ5A 1FQWA 5DH9A 4UBLA 1GFSA 3ROEA 3VI3B 3CYFA 4JJFA 1DAEA 1SVIA 2W6CX 4IGFA 3UGJA 2ZXUA 5AI2A 3KFVA 4DSTA 2ECKA 3GFSA 2B35A 2QE7A 3PC8A 3KYJB 2EL9A 4K6OA 5CT9A 5I9LA 4B3MB 3J7Z1 1P4HA 1CBUA 3H9CA 2ADOA 2E2JL 2WVGA 3E3LA 1H5UA 3QPBA 2DGDA 3H3XA 4DDWA 2H1OA 3FNBA 2G7ZA 1X1QA 5ULLA 4BBJA 1QF6A 3ANTA 3HL0A 4R9NA 5AJVB 4C4TA 4ETWA 3T9FA 2FSVA 4RA9B 1DIGA 1Q83A 2KJQA 1IWOA 3OZDA 3QHPA 4M1TA 3PC6A 2PA3A 4I55B 4KAAA 4YRPA 1AMNA 5ILOA 1BHJA 3E48A 2I5PO 4MEBA 4PWZA 1GTZA 4RPKA 1KFJB 2PCLA 1VHTA 4OJKA 4JWTA 5H68A 1VB3A 1EX1A 4KXYA 3OQVA 1IY0A 3DEFA 3N2KB 5EQTA 3HJUA 2IL1A 1NRXA 4JMPA 2YWDA 2YJ4A 4D42A 4EITA 4JJ8A 5BXYA 4O29A 3VRHA 1JG6A 1BQ3A 1HFJA 1QZUA 2YRWA 5E4FA 4LSGA 3TNLA 3I04M 3QPVA 1M6YA 3FPEA 3WK8A 3Q3EA 4DRZA 4EI8A 1NC1A 5CB8A 3EMVA 1ZA2A 4MQMA 3TPFA 4IMRA 3O8BA 2YYAA 1DJMA 2YZMA 4R2HA 2PSEA 4X24A 5C44L 2GO7A 3JVEA 3ROXA 1C1HA 1WOYA 4O6VA 4IOMA 4GP9A 5HW0A 1QQAA 1Z15A 4IIYA 3ZDXB 5KYUB 4X1IB 3OLWA 4NZ9A 1VCMA 4F3KA 4QHTA 1N7GA 1H2BA 4G07A 2P30A 3FNFA 4DE5A 3JQ8B 4EGQA 4B4WA 2H5LA 3HXKA 3MMNA 4O4LA 3T15A 4BE9A 5GZ3A 1NUUA 1BDBA 3G1UA 2B2CA 2Q41A 4NDNE 1ZJ5A 1TAGA 1KF0A 2I34A 5EQFA 3TTTA 2RH5A 2HPHA 3BVPA 4ZYXA 1PP4A 1ZD8A 1RIIA 2NZJA 2R85A 4M98A 1PGPA 1MRZA 4S1OA 3K0CC 5FPTA 4JLJA 4MUXA 2NV6A 4EX6A 1PG2A 1N6RA 2F48A 1GN8A 621PA 1M8KA 2I7XA 1GL9B 3C3KA 4JLSA 1M1ZA 3EEIA 3QMPA 3QI2A 4JX8A 1OXUA 3BK1A 4X3CA 1TLTA 2SHKA 3GBVA 3L0ZA 4LCBA 4Y2QA 421PA 1SUPA 1KMMA 3N7AA 5JARA 1FTNA 3X2SA 1J1ZA 1O4WA 2J6CA 1MAVA 3PXGA 3ZJUA 1UBEA 1P4JA 2CNNA 4UE2A 5EQJB 3R3XA 1DTEA 1M6VB 2REXB 1R37A 3A1VA 3NKFA 2A0YA 4WQMA 3LF1A 1JHDA 3FTDA 4IS2A 4ZGBA 5JYEA 1FU8A 1H1TA 1MA0A 2ZXEA 1NP3A 3A1FA 2MSKA 4G09A 1QQ6A 1G42A 2SKCA 1DV1A 2XRMA 4C3VA 4F9GA 4RTMA 3R9KA 1I9GA 1PFKA 2A7XA 4P2BA 1UMCB 5HBGA 2NU9B 4D4JA 2RC6A 2KS6A 3QYAA 3P9RA 1SVMA 4BEWA 4EYGA 1QG0A 1GGKA 2I1WA 5JECA 5JFTA 1XP5A 1XMJA 3LBYA 4QFCA 4L0CA 3L05A 4LRYA 3H83A 1S2GA 2CZCA 3PQ8A 2OBBA 5COBA 5I4BA 3SR3A 1KYQA 2IHZA 3PZRA 4Z4HA 1FHMA 2B8JA 4U1RA 2IYYA 1M67A 3AILA 1JUDA 3T38A 3TLEA 3ZHXA 4D79A 3DTTA 5CIWA 3P0HA 3OX3A 5DP2A 5BSWA 2C92A 3G8BA 2JAUA 3LWRB 3B60A 3G3EA 4KXMA 4B7UA 3F3YA 4EPWA 1F17A 4ND5A 5A5DA 4O1HA 1U8AA 2Q0SA 2XEDA 2G6BA 4S3MA 5ESXA 4KLNA 3ZDBA 3UKOA 1DB3A 3C3BA 5IK2A 4HKTA 3HKDA 1QO0A 4RKWA 1SHKA 4EGAA 4OI4A 2EBFX 2F62A 2QRMA 4AY2A 2P2YA 4UY81 1PI3A 3NAQA 4JB0A 5D00A 5ICEA 3IOYA 3T0FA 2YL2A 4HQKA 2GXUA 3HOZL 1CS0B 4KODA 5M3FL 2D7JA 1TB4A 2HNBA 3HKZP 2VT2A 4JXJA 4XRGA 3ZWMA 4ER5A 1XZFA 1C41A 4GYWA 3OI7A 3UXYA 3V4FA 3KXPA 1ZUIA 4TTAA 3EZLA 2DPHA 1B43A 2DTEA 2HSJA 3TLBA 3OMWA 4GS5A 3PRJA 3DDWA 3GROA 3NIDB 5ED4A 3FYUA 2QY6A 2Z30A 3P2JA 1PNOA 3PRHA 4CM1A 2O6HA 4MKZA 1JDZA 1W0KD 4TKLA 5DN9A 5FJJA 4TYPA 3N6XA 4TPUA 1BNCA 2ZJ7A 3GUCA 4H3KB 4K88A 1YXMA 3UH1A 2VF7A 4ARAA 1UBLS 5I7HA 5EXXA 3HYTA 3R3YA 4JI3B 2H9IA 1AN0A 3M49A 5DHFA 5ERXA 2FDRA 5FI0B 5IJXA 4RIIA 5LA6A 3RT1A 2I78A 3SJ7A 3RRXA 1GGNA 3HTXA 4RYDA 4AJPA 1Y37A 1NR1A 3QKTA 4NFHA 3R7DA 5I7WA 1YFZA 1J0BA 2XA2A 3EBPA 3GLSA 3NAMA 4OBXA 3T54A 3W4KA 1JKFA 1DV2A 1HMYA 4LHWA 4Q9HA 4MS1B 1W0JD 3T34A 5CK4A 2JFWA 4OMFG 3AGQA 2ZCUA 4CM7A 4QQNA 3DO6A 3HB4X 3KSMA 3KIPA 1M1YE 3C3YA 3QKWA 3VZPA 1LCIA 1NF2A 3HZOA 3UCEA 5B6JA 2JFBA 3JTMA 4YVFA 3UMGA 4OU4A 1VB5A 3FPAA 3BXPA 4WK4B 4Y2HA 5FDFA 5DLEA 4IDNA 1M83A 1X19A 4KWTA 4P22A 4KIJA 4B82A 1PGJA 1O58A 2BFAA 1V35A 2GYUA 3OE4A 2ACEA 1Z18A 4L5IA 3YASA 3WSWA 5EWLA 1DRKA 5EJ5A 3FNEA 1L5ZA 3IPLA 4O2BB 1DBPA 4UCWA 1TMGE 1IHXA 1UZNA 3AHGA 3R74A 2G72A 4BWVA 4ZXPA 3O73A 1XHLA 4ONEA 1MHPA 3SXUB 2OEPA 3UAVA 4Z9FA 2QNIA 3CKKA 2PXAA 2C5HA 2QZ4A 4JEIA 4EHNA 5LYJB 2AQHA 3PC2A 3LYHA 2EVWX 1K89A 2DPLA 3MCTA 4YJ3A 5ALXA 4MV7A 5JAZA 1IIRA 1LPPA 4WLFA 2IY7A 4D2IA 1NUSA 1MGOA 4XYLA 2ODTX 4AN4A 1MABB 4J3JA 3PGLA 2OPBA 5HZKA 3FDZA 3K5HA 5I9BA 2Y0PA 1H0HA 1BQ8A 2R3SA 1JAZA 2EWVA 3EEBA 2BGMA 4HDSB 3QBEA 2P9JA 4BB0A 1U4OA 3BZWA 2G06A 2HBZA 2GJKA 4JNKA 2GNOA 2ARKA 3ZDQA 2YJ5A 5DO9A 3LWOB 1H6CA 2ZSIA 2R84A 4DA6A 3MRXA 3DLBA 4IRUB 5JBIA 3BT7A 4LHZA 1LI4A 4ND1A 4LK2A 3DT9A 2LNDA 5BW5A 1SC9A 5TQ2A 2H00A 2NYAA 2V45A 3K0EA 3WGYA 1T35A 2V3CC 3NANA 2AX3A 1ADBA 4ZEVA 3O93A 4XZ3A 1AA9A 4J0JA 2GZDA 3H1AA 4D97A 1LJ8A 3D8SA 5F5NA 3ZCSA 1RXEA 1NN5A 5IJWA 1YFJA 4Q7LA 1KKUA 1UMKA 1MJGA 1CUIA 1Z36A 4MRVA 3TZBA 4ZIRB 3PFGA 2J09A 4UM8B 4QNMA 3URKA 4Y7CA 4YRRA 3KQPA 1VECA 5JCJD 2R87A 1R6VA 3EG9B 3NC4A 4YASA 1I94B 1DC6A 5CVUA 4CKEA 4EENA 3WLHA 3O1LA 4IO0A 2FW8A 5JXJA 4RV4A 4A4DA 1J9GA 3MJHA 2F3RA 3TGLA 2PJRA 3DDNA 2O8NA 4IIXA 3L9XA 1EGMB 1TZKA 4P5EA 5BYJA 4C4XA 2Q50A 4JIGA 5DGXA 3G2QA 9LDBA 1KVQA 1OLOA 2O57A 3BRQA 1GU1A 1COWD 3WL4A 2I3BA 3A6KA 3MTDA 3WWYA 5F2NA 2VTKA 2HHLA 3K2IA 2ANBA 2YY7A 3KWFA 5KB3A 3F7TA 4NCNA 1ISHA 2Q29A 3ABQB 5TPZA 4BN4A 3H0EA 2PZJA 3Q3CA 4EZBA 3HO1A 1IRXA 2EGUA 4QPNA 1GAJA 5AI8A 3A4MA 2C58A 3ZK8A 4AX4A 2GN0A 4HYEA 1ZR2A 1EUZA 3W9SA 2IGTA 1B0UA 4B6JA 4OFBA 1J42A 1JFSA 3QVGB 4QASA 1P39A 4HDMA 2ID8A 2AMVA 5IU6A 1K6JA 1RYHA 4FEEA 4L4RA 5TQ0B 1X7ZA 3K5PA 4RXUA 2ZB2A 1J24A 1A9XB 5ISMA 4ZYZA 3BEDA 1KH3A 2XWSA 3LXMA 1YHNA 2ZATA 1N9KA 3IX7A 2D00A 3R7AA 4ZV9A 3ZLUA 3C6XA 1RQGA 1A27A 2QD3A 4X8MA 3UGKA 1XKXA 4H3SA 3ZIAA 1E8MA 1G1AA 1OIWA 2G1KA 2OD2A 1LJLA 1UXOA 2QUKA 3F6BX 3G8YA 4TQGA 5IJ0A 5EFOA 3AF6A 1XE3A 2AX4A 3OHMA 4LJLA 3B1FA 3ZHOA 2OHVA 2O2CA 5JSUA 4HWPA 4IXTA 4CF6A 1PRYA 1OA0A 4TZ6A 4MARA 2JA2A 2WM9B 2MSEB 2E5WA 3UV3A 2PL1A 3F73A 3JVUA 3F90A 2G83A 2X3UA 4NOLA 1A9OA 3QU5A 4BJ1A 4BVBA 3GN1A 1QPGA 2M4YA 1RBYA 2VLBA 2YTZA 2ZT7A 4TMXA 3RVOA 2XB8A 3M4ZA 3TW8A 1BHQ1 4ZTZB 1EWTA 5HF9A 1KR5A 4Q1DA 4GPAA 1VZGA 3M6LA 1G4HA 4GEKA 4URHA 3OP1A 3WB2A 1RPNA 4E88A 4M7OA 1Z33A 3CO5A 1G2PA 3K8ZA 4O33A 3LL4A 1A7UA 1VLZA 2OV1A 1XXHB 2FW0A 2FWPA 4UTXA 1TC1A 3AFHA 1B3BA 4XQEA 4TUYB 5K01A 5KYTA 1R4NB 1H2FA 3ZNPA 3LUJA 2Q3MA 3C4VA 5KTOA 5LQUA 4HT3B 5A6VA 4M1ZA 3MJVA 1EB8A 3GXBA 4AF6A 3IV9A 4R3WA 4ASUD 3B2NA 2XECA 1YH3A 3IE2A 4KB5A 3NFPI 8LDHA 4QUDA 4HDMB 2RIPA 3MGBA 3IMCA 1RRMA 2QR2A 3QHAA 3IE0A 3LPDA 3GZNA 3HO8A 4I8XA 4AZWA 1QJ4A 4B83A 1KJYA 2UKDA 4MWZA 4X8OA 1XK7A 1WUHS 1XP8A 3MMXA 1QH8B 4GLJA 3JWIA 4E2WA 3AR8A 3FVWA 1A8PA 1U5BA 3RVSA 4J29A 1US8A 4MRMB 4YGXB 4A73A 1RYEA 4FOSA 3UOAB 4M0PA 2I6QA 1KEWA 2VF8A 1G7CA 3DTYA 1Z6AA 4UE3S 4E4TA 5J58A 1UK7A 1YZKA 2IODA 2Q4EA 4K81B 2P1ZA 1ENZA 1VI5A 3I8OA 3L8EA 2VDRB 5K4AA 5A02A 1D3AA 2OM6A 3PGJA 4B7ZA 2ONCA 3O9VA 5B57C 3CF6R 4RPJA 5CDUA 2QBYA 1FFAA 3AL2A 3HXQA 2H31A 1TXGA 3TSCA 2UZ3A 2FR1A 1CY6A 1V7PC 4Z0TA 2PGAA 5IM4A 2O3TA 2QRUA 3MRVA 4JVOA 4U2DA 1SAYA 3WYEA 3VHLB 4B3FX 1YRYE 3KC2A 1FDVA 4WOCA 1QYWA 3HI4A 1A97A 2B9EA 1XL1A 5DHQA 2OXIA 2CJWB 2C8VA 3GRCA 3GRKA 2WJPA 3OFNA 3QPUA 4RADA 4RVCA 1SH7A 5DHTA 3M4OL 4Q18A 4Q3BA 3B85A 1YE8A 2VT3A 3BEOA 4PFKA 4V02A 2F3QA 1Y48E 2BGTA 2IXEA 3KXKA 1ZUNA 5MDHA 4EA6A 5HJ5A 3UFXA 4UU7A 2FGKA 4RHXA 1UPXA 3O3CA 3VAZA 4EGJA 4W5NA 1KYYA 1TX4B 3KR9A 5K99A 1RW4A 2VA9A 1G8GA 3JD2A 5EJFA 2KPOA 3EBLA 1A7AA 1MDBA 3H1EA 5DM1A 2AG0A 2JDIA 4LC0A 1L7BA 1OAOA 1YRBA 3E0QA 5IT0A 1QDUA 1BQEA 2Z1DA 3LUAA 5KSYA 4N9QA 1RAGA 1XTVA 3HJGA 2DEUA 4F38A 3WYDA 1OFUA 5CGZA 3AVVA 1H8HA 1SMKA 1X0XA 1CR6A 2HAEA 1NL3A 1SQGA 2J31A 4ZO6A 4TS3A 2OHHA 2YMQA 3VR2D 1TTQB 1DC4A 3NV7A 1QFXA 4ZCIA 1UBOS 3IT1A 5EIOC 4RMGA 3B1XA 2SNIE 2GVZC 2VUSA 3QLVC 4C06A 1EKXA 1UKVY 4JLAA 3W4IA 1XPOA 3KUXA 3DLIA 2QRPA 3MHPA 4NDZA 3SQOA 1EFAA 3KNZA 5D85A 2RMKA 4HTAA 2DULA 5KTSA 4L76A 4ZANA 1E9CA 5H02A 1KJJA 1MQ9A 1K92A 1OFTA 2OFOA 4HHEA 3WRYC 4E5UA 3IOCA 2ZQ5A 4Z9YA 1F0PA 5GJBA 3RRJA 4FE7A 3TW0A 4N3GA 1HQKA 1WCWA 4W63A 2FXVA 2NTYC 4UM9B 1GZ5A 1W1UA 5E4JA 1T0HB 1UAAA 4M9SA 1ZMXA 3AI3A 4LQ4A 1N1EA 1WDTA 1WUIS 4G86A 4O59O 3K0BA 4J94A 4OJMX 5CB0A 4NMLA 4C88A 2QG6A 4F06A 4WK0B 3NYRA 3BWVA 2PUBA 4Y6LA 1G38A 2HN9A 4J0GA 5DGDA 3GZNB 3F1KA 3CCBA 5DBHX 2I1LA 2PLFA 2QVYX 5C51B 1G20E 3LUPA 3L7CA 4H35A 1WEHA 3IAEA 4PG5A 3QYPA 4HGRA 5JROA 1H22A 1A2KC 1V8ZA 3IDAA 1ZK1A 4Q7JB 1PZXA 1OBCA 1RMYA 4R81A 3C1TA 4JC0A 4FONA 2AKYA 4DV0B 2RGEA 5L6LB 4B3JA 4EABA 3U44A 1VKRA 4K3UA 3SIWA 1GKYA 1S8AA 3H9BA 2X9GA 3MT8A 4CI9A 1MAAA 3MAGA 4NICA 1ZGJA 2NU8B 1AHNA 5CDTA 4YRSA 2CXXA 3OCVA 3U2QA 5FWYA 4M8KA 3G79A 3WSVA 1GYRA 3V8BA 1HXHA 3BXEA 5ALZA 3RU9A 3ZWPA 5DGIA 1O8BA 1I3MA 2FRXA 3ZGOA 2PNJA 1P6UA 2RJNA 3G5AA 3NH9A 3ROGA 3SBOA 3VR4H 3ORRA 4TUYA 3ONEA 1Q0HA 4B47A 4RJTA 5KSZA 1BXGA 3CTPA 2ENUA 5DYIA 2J9RA 3UV6A 4GSKA 1VSBA 5HNKA 5L7WA 1ESDA 4V3CA 3SFZA 3BICA 4CFYA 1KI8A 5I8PA 4Y9SA 4EB6B 2ZI6A 4JBGA 1ZGZA 4IRXA 3VQTA 1R15A 4W5QA 1WMDA 3CEHA 2R1TB 4D02A 1WSDA 1J9ZA 4PGGA 3I6BA 4AJNA 1UMDB 1Q57A 3LX6A 5IDVA 2ZDGA 3UK1A 2OKCA 2QXYA 5K3BA 1C8KA 1JAHA 3IHWA 3PX3A 3AIMA 4D3FA 1IQ0A 2V98A 4CMBA 1GRNA 3FXAA 4TWZA 5E6UB 5JDCA 3SR0A 4EO7A 3NBFA 3RNLA 5GM2A 2AN3A 4TT3D 4RIGA 2IX9A 1J7JA 1MG0A 2J0VA 2H17A 3JQQA 1U0NA 3ZWCA 1Q19A 4FINA 5CCXA 2W0SA 1Y6FA 2DLCX 4RY2A 1C5KA 1TVKA 3WWEA 5F2OA 3LCMA 1QYDA 2VH5R 2WINI 4R3NA 4RS4A 5EIBD 1SVSA 4E0BA 1NF3A 1PZHA 1JDSA 1L7EA 1VJGA 1ONSA 2O07A 4K8OA 3RM3A 3DMGA 3PUWA 1DIRA 3UJCA 2GAFA 4FWIB 3I4NL 2FX3A 2IBSA 1T9QA 4PY2A 4EA8A 1W4AA 1FMFA 2GI4A 1V9CA 1SB9A 3COWA 3MBKA 4IXWA 4PIVA 5DTIA 1N6HA 2BFFA 4GLFA 5KUTA 1BWQA 1JXMA 4ADSG 4EQ6B 1NXEA 2J30A 1E2NA 5KAPA 4W7SA 1P7WA 2C07A 3WMXA 2X23A 4XIGS 3QUBA 2FFHA 2XW6A 1GDHA 1N8KA 2FRDC 2C54A 1G5RA 1DQZA 2VAMA 4WI1A 1R8YA 5FAXA 1JPUA 1LS1A 1ZINA 3PNYA 1V2HE 1EK6A 3BQNB 3HP4A 5IYZB 3A2NA 2VJPA 3HOXL 3MWJA 1ZG3A 2J5BA 3KQSA 2M6KA 2P2LA 3JW8A 1G9TA 3UJHA 5IKEA 2C99A 4G97A 2UZ4A 3HOVL 1K5GA 5F4ZA 5I4IA 4D8VA 5L40A 3AR4A 4Y0NA 1UOQA 3QF4A 1P7ZA 4UAUA 2H0RA 3IEMA 1C3OA 3VKVA 4GMHA 3PT9A 4LZWA 4ZRDA 4NBKA 3B20A 2NSHA 1T26A 5AJTA 2NVBA 3M4XA 4GGOA 1E3WA 1Y3DE 1J8VA 3C16C 3ESZA 4MUJA 4P84A 5TC4A 1Z25A 1GZ4A 1VJTA 3FUCA 3P19A 4DR7B 5T41A 1KKMA 3C87A 1GZ6A 3UKDA 4RF3A 3UJDA 1L5YA 1JJBA 2E4VA 4BMZA 4RM2A 1WV1A 3D3QA 1LPAB 1VYUA 1WMFA 1S02A 4JV5B 3NHFA 2JI7A 1S4QA 2F4NA 1Q1ZA 3DOHA 3KOXA 1F6BA 5U4XA 5HWSA 3FMIA 4LJAA 3WQQA 1NVXQ 3FSRA 2X5KO 3NZEA 1XC7A 5AK4A 2PS9A 5A7GA 1FQOA 4TMWA 2ZZMA 1JFFB 4RF4A 3WI7A 1SXJD 2DFTA 3HBNA 5LP6C 4BKQA 1EE2A 1Y8RB 2QTAA 1NPDA 1QLWA 2Q3JA 4H31A 2QM8A 4EUEA 1JI0A 1MIOB 3R4CA 1CVRA 1EDEA 3KKQA 4TMTA 1NUAA 2QW1A 1GNLA 5JPCA 2D2VA 4DCPA 4DIKA 2QTWB 4XPZA 1C0PA 5AKKA 1P1HA 2J7KA 2MHCA 3DBLB 1UXIA 3HKCA 5TPWB 5A06A 2IDJA 3QX3A 2JFPA 5GAJA 1ILWA 2BMWA 2O06A 1FUIA 2Q0HA 1JLHA 3DOOA 3E0XA 4J1SA 4MVCA 4FFBB 2RBEA 3TRDA 2QYOA 2ZEJA 3PKZA 4CTKA 3U19A 4K40A 2GTHA 2Q9UA 3QUQA 1WZIA 3LT2A 5T4EA 3PPWA 4R71A 5JHHB 4R8SA 3K9GA 3HCCA 2ZI9A 3RIEA 3RVMA 2A14A 4EG3A 5FJ8L 4KIUA 4NZZA 1X8KA 2OZPA 5JJIA 1U6IA 4F4DA 5HPYB 3WBKA 3A37A 3R7WB 1FUUA 2I8LA 5BQPA 4EHFA 5J1SB 2V7GA 1DARA 3AI1A 5J40A 1BS9A 1G6OA 1U5CA 3KS9A 2HSEA 2P3LA 1E66A 3TLAA 1KEPA 4EG6A 4XD7D 1EVJA 2IYLD 3A7DA 1SUEA 1DO0A 4WN3A 4E51A 1C1XA 5LDHA 3BOSA 1JB1A 4GP7A 2J45A 4U671 1ZA1A 2XNCA 2ZETA 5JASA 2NQTA 4RVUA 4L7QA 1E4EB 5BYAA 1PQYA 3LUGA 4F97A 1A4UA 1A76A 3LSTA 4UAJA 1G5HA 3HFGA 3BE4A 1DBQA 2JI1A 5A62A 5IYZA 4PPQA 3KSAC 3FNQA 2ATVA 3H9GA 1XJ5A 3GIWA 2C8JA 4V38A 1WD5A 1VMIA 2CUZA 3DQPA 4YFYA 2F90A 3NOVA 4YMWA 4KQHA 4KI0A 2EBUA 3O4GA 4GMFA 4RM3A 3N05A 1Y3AA 3PJRA 1UBJS 3ROPA 3NH6A 4NZPA 4R4JA 4TT8A 4DA8A 4F45A 4HGNA 2RD2A 1X38A 4BMOB 4Q39A 4NBTA 3LT0A 2DZDA 3O74A 3RNOA 1I30A 1L6IA 1PAUA 1O77A 2IYRA 4IMPA 2AA3A 1AH2A 2C2GA 1ZD9A 3NYQA 3RGGA 4A15A 1TM1E 6CHYA 1UKAA 3GJYA 1L1RA 4WFJA 3QFFA 3I32A 2I1QA 3CVJA 4Q4DA 3NWOA 5DNCA 1TWAL 4Q4HA 4FB5A 1Y63A 4X92A 3QK7A 1IY8A 1N4DA 3V9AA 2O23A 3LWQB 2MMGA 2QN6A 1O96A 1Q15A 1RHMA 1XGKA 2GCEA 2CKMA 4AKHA 1HFWA 2R93L 2AGVA 4WVFA 1XN4A 3GXOA 2VHVA 4HNQA 5ALKA 4ZXFA 3QUAA 3MXOA 4I6JA 4W5OA 3VNUA 1ZD1A 1JEYB 1NRWA 3WRXC 1KQGA 1QNLA 1VL8A 2G82A 2BBOA 3GT7A 4LYGA 5CUQA 2AZMA 1I2AA 1Z35A 1H2ZA 2P9ZA 3BHIA 2GK7A 4UUBA 1FXWF 4C7OA 4FVTA 3UK0A 3AG6A 2GPJA 4R0NA 3D43A 4GKAA 2LR0A 4F46A 5JALA 3S8MA 1E9VA 1XRLA 2A9PA 2BFWA 2K2QB 2VP9A 3U7GA 5FLKA 2DBQA 2O0MA 4FW9A 1PO7A 1O03A 5IXSA 4CQJA 2RDVA 2R8YA 3SN6A 2IOYA 1U28A 1H23A 3S2GA 4LWZA 4ZVUA 4A93L 3IE1A 4FNOA 1NP6A 5F7JA 1Y33E 3WDMA 3COPA 2CL6X 3EUWA 4BFCA 3GNSA 1ETUA 2IQ5A 1Q84A 2FZEA 5K3AA 2QEQA 3IUBA 3KWMA 4A3KL 1TWHL 4OF4A 1VE7A 2W2KB 1F51E 2GFHA 5FT9A 1KMCA 4TSFD 3EVCA 4JJZA 4OFXA 5KNCD 1S7CA 3FG9A 2Q8PA 1OWPA 3HA7A 3TIVA 1OH7A 1USIA 4WL0A 1JQLB 1RJ9A 1VHLA 3BAZA 3BDIA 5I3ZA 3SGLA 3BJIC 4DSAA 2JFVA 3ZWNA 1C80A 1AK2A 4HATA 1DJNA 2XIJA 4PZLA 2PFGA 5C52B 1L5NA 4JD5A 4WGGA 1WQ3A 1D0SA 2X0JA 3CIOA 3MCZA 4UTPA 5EIBC 2BR4A 5JZVA 3CWCA 3PXXA 1WEKA 3OWOA 2I4TA 4M55A 4EHHA 1OPRA 3RUFA 2GBLC 2IYOA 4U0KA 2Q2NA 1P9RA 2GDJA 3ZEAA 5KCZA 2ZSJA 4R1MA 3WRYA 3B2EA 4FTWA 3TVTA 1AQUA 1A69A 4ZI3A 1C4WA 4IDPA 4QBTA 5CVJA 3C97A 2B0CA 2CXQA 2DCUA 3PDJA 2MR5A 3B13B 1NLUA 1NLZA 1WWKA 4Y0AA 4OXYA 4G0YA 2WM3A 3EVFA 4UBMA 1K9SA 4QYWA 1LV7A 1EVZA 4Z0PA 4BMVA 9ATCA 4LZNA 5ANRB 4DR5B 3LO5A 3QXCA 2OP1A 3IT3A 4FYYA 2FZVA 3SNKA 2A94A 4YPOA 2UYCA 4Q3KA 3BQMB 1TF2A 3C8MA 3GARA 1M33A 5H5JA 1XLWA 2ZR9A 4O4IF 4IVQA 4R54A 1NJ5A 1YQDA 2OL4A 3M1YA 4FZVA 4PO1A 3WAKA 5DNUA 4MUKA 4OMUA 3IODA 3TXXA 1HZZA 2BUBA 5I7VA 1BYIA 3NORA 3S55A 3G9XA 4WINA 1O95C 4XPIA 2VPWA 2YZ7A 1XXHE 2PY6A 1TNDA 2ISCA 1DDOA 1Q1QA 3DL2A 4Q16A 1BGXT 2H8GA 5DBOA 5CFNA 1DFGA 5JWHA 2B1RA 1Z0KA 3LCRA 4F85A 5B6PA 2PT5A 3KPUA 3CQZL 3ZPXA 3ZWVA 5E1DA 1TVCA 3H5WA 1LLUA 2C9YA 1CY8A 1EP1B 2M1ZA 1SBIA 3F0TA 5A1TA 5F23A 4RTSA 4RPHA 2GZ1A 5HFNA 3ZE0B 1C9KA 3QSYA 1W36C 3L8YA 4S05A 3AM4A 5A2GA 5BVGB 5JZMA 3K4QA 5F1OA 5B1YA 3QUSA 4Q1BA 1VJCA 1QIDA 3HGMA 2ODBA 3HB9A 1ISIA 2XUOA 3BAFA 3HBLA 4C6TB 2GKSA 2VDUE 3HB7A 4LDJA 4C1BA 1J2EA 3DLAA 4I36A 3SWWA 1ZVVA 2OXEA 3GDHA 1UMBB 1IAQA 5C37A 1CE8B 1WB9A 5HQJA 1N4AA 4EH1A 5ICMA 3T3DA 3RSQA 2HHJA 2OB2A 4FMBB 4NMWA 3NHJA 2IX3A 1P8JA 4R05A 2Z08A 3ICVA 1DO2A 1PYDA 3C85A 2ZIGA 3GP5A 2AQ8A 2G9NA 4I1IA 3ZIAD 1LXCA 5FFNA 4JENA 1P0MA 1WDKA 2OFXA 3DVSX 2G70A 3NHMA 4F04A 3PSAA 1MJHA 3T5CA 4UBKA 2H4FA 4KQFA 4EG7A 1G5PA 3ZZUA 2WOOA 4XSGA 4M7RA 4DCNA 1GLVA 1H6AA 1U5BB 2MINB 2EFGA 2Q1SA 3V55A 3N0XA 3MWYW 3O3NB 1NUTA 1UPTA 3WO0A 3AB3A 1J09A 5AOVA 5JYBA 3OY7A 2VOEA 4LV5B 1ADCA 2Q4RA 4MIEA 4YAFA 3IUYA 1IEVA 1JG3A 4AP9A 3CNBA 1EUDB 2B7LA 1XZQA 2D0OB 3HWSA 4XGKA 4IXNA 5B7GA 2B1GA 4K6HA 2QMEA 2R2GA 1Z5OA 4A3JL 1AKVA 2G0TA 3GT4A 3PYLA 4PQEA 3RAGA 5KJ6A 4W5TA 1BRTA 2O8BA 3CTMA 4FYJA 3VV2A 2Q07A 4LYJA 1ZC4A 5DIFA 5I4KA 4OHWA 4BYMA 4FGKA 2VKTA 5FTJA 2COUA 4JH0A 3TFWA 4DDVA 3C74A 3ZVLA 4JT4A 1UAGA 2ZUTA 3LWPB 1J00A 1G21B 5J2UA 2JFGA 2RGWA 4BLSA 1Q1NA 1LS6A 1XT6A 4XYBA 3A31A 1Z73A 3GJ6A 3RYGA 4FR0A 1GCGA 1TJ3A 3WNVA 1OB2A 4EF5A 5CR9A 1ZX1A 5C8YF 1ECFA 1TZCA 1ISPA 1H6DA 1CQPA 1KKLA 2QV7A 3IMGA 4Z1MA 2G04A 1WF6A 4D99A 2H57A 5BN3B 2OCGA 3VU9A 5IT4A 3WWLA 1LBHA 3FYUB 3QIAA 1TA9A 5EKXA 4ZCSA 3KKLA 4LX0A 5ALFA 1CJKC 5DSXA 3U9LA 2AH5A 1QS0A 3LYLA 4IH9A 2FHSA 2FXIA 1G16A 4P6VF 4IMJB 1H2RS 3MT7A 3T0GA 3KPJA 3OZVA 4JBNA 2A88A 1U3WA 5BYBA 4KVZA 3NR2A 5LQJA 1SXGA 5AM4A 4QNNA 1O2DA 4Y7DA 3RUEA 3EWAA 2BMDA 3MUEA 5LFAA 3NNSA 4PGFA 2VWQA 4BFTA 2RHBA 3QVJA 4P33A 5AVVA 5LDDC 3IQGX 4KN9S 4G0QA 3ZBUA 1FFBA 2ZUSA 1LC3A 3LM8A 5HIIA 3STXA 3H4IA 4DCVA 1YKFA 5JANA 1BGWA 3QFHA 3KSRA 1GPLA 4HUQB 1O0SA 2XODA 1PFVA 3KB2A 3G88A 1DAGA 1Z08A 1G7RA 2HIHA 4EECA 4XM0A 1S89A 3B9PA 5CYOA 3DLTA 3AK4A 5GQSA 1BE0A 1MW9X 1HQDA 2AOUB 3A70A 3MBIA 5LUBA 5DVZA 1HL7A 3BDVA 1NVGA 3FMFA 4NECA 2EZUA 2VKQA 5DT9A 3TE7A 2IY9A 5MGNA 2CHEA 3AUSA 2N42A 4Z49A 3RAFC 1CP3A 2BEKA 2YS6A 4G67A 4IGKA 2H1IA 1WMSA 3NTUA 1QR2A 4FK8A 4H7KA 2E4YA 4JSRA 4O8CA 1OLXB 1FX1A 5E1OA 5F33A 2NZVG 3IFSA 4N3AA 5IBRA 1S01A 3EQ8A 4DW8A 2HWXA 4TTTS 4JT8A 2OC4A 1D0VA 2PUWA 2WRZA 2R6HA 1P0QA 1NI3A 1TJYA 5CXQA 1OSNA 2HT6A 2XBUA 2BBWA 1M2GA 3RRMA 2J7PA 1E60A 1XIVA 3QA9A 1J97A 4IWYA 2AMYA 2RHTA 1P75A 4A0HA 2DPYA 3CNHA 1U2PA 2ANCA 2DWQA 1X3LA 1M75A 2EYUA 4KMRA 3RRFA 4KIWA 3M9XA 1IWPB 2JAOA 3CM0A 2ZTHA 3RUAA 2XMSA 4DMUB 1QLHA 3S1QL 3SQXA 1UJCA 3ZCVA 1TUBA 4JJAA 3CPJB 3ODPA 3SBDA 1GZ7A 2BI7A 5TY0A 2ZT8A 1XTUA 2ZUVA 5EWMB 1X14A 3KYUA 3S5JA 1E2UA 1Y9DA 4AUEA 1IROA 1UZMA 1XQ6A 2BZSA 2EHJA 2GAAA 1E3IA 1RAIA 2QP9X 2UYOA 2IXTA 3A1CA 3BHJA 3C7TA 3STHA 2OAEA 4QUBA 1HC7A 5EINA 3CN7A 3FKIL 5M3BA 1KK0A 5HDQA 1ODSA 4IH1A 3TDKA 3VX4A 5FOXA 3TOCA 1YHYA 3WNBA 4UMFA 2M4VA 4WZ6A 2C3UA 2NAPA 4FYIA 3ZE6A 1NUHA 3ZGLA 2Y76A 1NG1A 2HIGA 3HZRA 3LXXA 3OF5A 2BTEA 2CJPA 3M81A 3DE3X 4FC6A 4CI0B 2W43A 4ZVNA 5DM70 3IP8A 1TTPB 5AXAA 3L4BA 3LWNA 4ZKDA 1NU8A 4LZAA 3SVZA 1BE8A 5DCLA 2B82A 2DBRA 5I9NA 1REQB 3GLHE 2DB3A 3Q0TA 1S6YA 4F8YA 3SHFA 4BRWA 2P65A 2I6TA 1PYGA 3OM8A 5K4GA 2J9XB 4MIOA 1CQJB 1LQTA 1RIFA 3ZQJA 3HCRA 4CMGA 1VPDA 2FI1A 3QOXA 3AL0C 2X4DA 2XD4A 3HN2A 3QG1A 1LWOA 1WCIA 1DC8A 3KLOA 3T5TA 1JR4A 1MN6A 3QTTA 2KE5A 3ZWOA 4FILA 2KW5A 1YCFA 4R9VA 5LA6F 5BVHA 1O08A 1UEIA 4N76A 4UMEA 3IKMB 3CLVA 2WSSA 4MUAA 3UMCA 5KOJA 1FFHA 2AB0A 3OOJA 4L6AA 3N5KA 4R2WA 4P4SB 4CMKA 4EATA 2G9ZA 3HA2A 2ID7A 1RM4A 3PR3A 4OH7A 1AD2A 3ER6A 4QLBA 5A4FS 1RAEA 2ONKA 3QU7A 1ESEA 3NT5A 4KVFA 4H60A 5B12A 5LD2B 1Z22A 2K7FA 1TCUA 4CKBA 4ISBA 4C7MA 4BVHA 4DANA 3SZ3A 5E3HA 1AQNA 2FMIA 4LHNA 4OHKA 4EJFA 1AZTA 5U1PA 2D2EA 4HNVA 2DFNA 5C8DA 1F8FA 2N3ZA 1EYZA 4AI0A 2PKYX 2ZROA 3UB3A 3BWMA 5KEIA 2XTMA 3LK7A 2V9ZA 3MERA 4X1KB 3TRKA 1YMQA 1HE2A 2VHJA 2WIJA 3B70A 1PR5A 4TT3A 1FC0A 1K2WA 3ELUA 1YBFA 2VPXA 3I2YX 1ORRA 3PITA 1J07A 1NXGA 3H9JA 4TTQA 5IS2A 3S27A 2HA0A 1TRKA 2H2AA 4UHKA 5G02A 1VLVA 1JFRA 1PR9A 5C7IO 4RH1A 2Z2ZA 1EP2B 2E1RA 2PKEA 3GYGA 4GI1A 5AVRA 4DV2B 2IF0A 1Z0SA 3S7ZA 2WB4A 3VYUB 3ZH9B 2YKGA 1BFDA 1IMOA 2E2WA 4NFLA 4OQPA 4FUQA 5GVRA 5BMVF 2JLZA 2BHTA 2A4MA 4R8RA 3CLKA 3E58A 2W6JA 4XWYA 5EL0A 1PUXA 2PWAA 4YA6A 3ZVRA 1NX6A 3WQHA 4CVNA 1MO2A 1P5FA 3QVWA 5FLXA 4XTCS 5EEGA 2PGJA 1RYNA 3DOIA 4JY7A 5JH7A 1UKEA 2P62A 5H3LA 2P9QA 3EWIA 4MOWA 2GTPA 2OV6A 4N0QA 5TGZA 1H4TA 1U0HC 2BUCA 1ONPA 4KGVA 4A16A 3KOYA 2BBSA 3L0YA 4NULA 3PIP1 4PG8A 4HEHA 2B25A 4QPPA 1SIWA 4XASA 1X74A 4CMJA 3OQIB 3FFWA 2HRBA 3I2KA 3PBKA 4BO1A 1BXZA 2VP6A 4ZYLA 1ZGCA 4L0MA 4QBGB 4ESVA 1G9SA 3E5NA 3TZCA 5LD2C 4QDTA 5GPBA 2VPQA 3IUQA 3TTSA 4YCLA 2HCFA 3WL7A 5DU2A 1VLMA 3AMVA 3C6MA 2QRGA 5LP1A 2I9KA 4F2DA 1YQQA 4E14A 3AP3A 3DC2A 2Z95A 3OMXA 4X6UA 4PAMA 2R9VA 3LY7A 3K9FC 1GSIA 5I51A 3WGTA 5IPFA 2GERA 3GA7A 3HWRA 4LMBA 1ZVMA 1Z0FA 4QJ3A 5MHTA 1G18A 1UEJA 1A8IA 3B6KA 1UZAA 4G84A 2X5NA 4LNUA 5FQOA 1F14A 3UT5A 2WG1A 4YRTA 1UFVA 3M6UA 3EPLA 2CV0A 3I83A 2O3UA 3OUUA 4ND8B 1LPOA 1G21E 2VPTA 4CW7A 1SY7A 1ZESA 3S1RL 4KDFA 4EY6A 1Z4NA 2VP3A 1JHOA 1B41A 2WNIA 221PA 4Y67A 1RPTA 1GNSA 4AIIA 2W6PA 1K7FB 4DNFA 4L9SA 3STTA 3AJ8A 4ZI7F 1V43A 3FMVA 7MHTA 2O2YA 3KO8A 1L7VC 4BQSA 1M0WA 2G88A 2QL5A 4KH1A 5AI0A 1RWXA 1IH8A 1JG2A 1IATA 2UUPA 2WG0A 3B0AB 1FP6A 5FI5A 1V8BA 2UAGA 1JDJA 4NNOA 3Q4GA 5EHZA 1NHWA 2PLWA 4WCDA 3ZLTA 2HWWA 1MT3A 3VZRA 3LUDA 3NU1A 4BUJA 1KYIA 1QXSA 2PUDA 2JGDB 4I7EA 3VR0A 3WHIA 3CVXA 1DKLA 5C3EL 2CLIB 1Y42X 4QJ4A 6YASA 5FUMA 1DAPA 2QT0A 2OQVA 1LKMA 4YAKA 2Q8NA 2DT5A 2QTCA 2PPTA 4GM4A 4MRSA 4YWHA 3U62A 2G5GX 3U0BA 2EARA 2FVXA 4QARA 3UHJA 1KPHA 4BFYA 4EVRA 4EYKA 3QBJA 1A2OA 1BXKA 1LGYA 1N0HA 3GHYA 4XGIA 3S2SA 1OLSA 4M8LA 3Q7QA 4M9UA 5C46F 3HSSA 5KWSA 4YMIA 4JFAA 5BR4A 5LZ9A 1FBNA 1NMXA 2H0AA 4CLEA 4TZTA 3KTDA 1VL0A 2A0FA 5H4HA 4JUBA 4AKEA 1YJQA 2O3RA 3ICCA 5D3QA 3GRPA 2VBFA 3W3AD 1H8EA 5HJEA 2V0GA 3DCJA 1QCZA 4ZI7B 2WHYA 1MORA 2R48A 1CUVA 1DKNA 1W4ZA 3NTXA 3KETA 3AIIA 2QB5A 1XTIA 4ER6A 1SOAA 1T2AA 4JBWA 4ZT3A 1B4DA 4K9OA 1VKZA 1YHZA 3GFTA 4KYUA 3FMOB 3A26A 1S3IA 1XTZA 4Q4JB 3GRZA 3EOAI 1NTRA 3PGKA 2GF0A 4RGBA 1M1NB 2QE7D 3D4LA 3PFBA 2XZDA 4HL6A 5I8ZA 1NATA 5C5CA 2IEZA 3SG0A 2IV2X 2W37A 3WBBA 4QDXA 3DYBA 4M8IA 5C7OO 1BHSA 2C3OA 3UOWA 1N2OA 3IVGA 3UUGA 1VL6A 4YUZA 4O2BF 4YMGA 5K05A 1U6JA 3IV6A 5ALRA 1LSJA 4QBKA 2OFFA 2XJQA 2O8CB 3K0FA 1Z8DA 2WUWE 3ZIDA 2ZKIA 2ONYA 1ZWLA 4JHLA 4MYHA 3WAJA 3LLMA 2B1JA 3MJFA 3ZLBA 3I6QA 3RO7A 1LLDA 5LZ7A 1LV8A 3A6FA 3EXIB 3G0GA 4L5AA 1ZYUA 2QYSA 4BN0A 3O4FA 3G8AA 1IDN1 4P3OA 4OATA 3F8WA 3ZJTA 3KKOA 2YV5A 3TD6A 4NS1A 2G77B 4EI7A 3KVRA 3A2KA 1HDIA 4D43A 4B2IA 1SKAA 1PJBA 1UODA 3GMTA 2EWWA 3DPUA 1H8HD 1QRAA 2BJWA 5FORA 3SQNA 2G1UA 1YACA 1JIVA 3RARA 1BVRA 4BJ6A 5DNYB 4O4JB 2FF7A 1G66A 3R40A 2ZI4A 3KYVA 3GQBA 4FP9A 4WCFB 3UPDA 3QBDA 5G40A 3INRA 3MXTA 4YUYA 2IYZA 5B1DA 1B6GA 3NAZA 1YVDA 1EDZA 4IFTA 4QEKA 3CRW1 4D8WA 2CSXA 1Z4IA 4OL0A 5JAHA 3IDZA 2HLHA 2QZJA 4KAXA 4CLOB 2R5NA 2QX9A 1X1AA 4E5NA 4FEGA 5JNSA 2AFHE 5E3JA 3JQGA 3EFHA 5JD3A 1BN6A 1JKIA 1RVDA 5A4AA 2I7VA 1H85A 3RDPA 5BT8A 1FMCA 5G4LA 4PINA 4HVTA 1E5TA 1MQSA 1OLXA 1PFUA 1OBHA 3LY5A 4HB3A 5AK5A 4BO9A 4BJ5A 1Y1LA 3HVIA 3PJFA 2OD9A 4MJ3A 5IKOA 1QB7A 4BCCA 1LDGA 5LXTA 3WKBA 1VL5A 1Y3BE 1YRHA 3A7EA 4KBFA 1G8AA 3SBXA 3UMSA 2XTAA 4WLOA 2W2LD 3VX3A 3MD9A 3RIXA 4UTVA 4W9NC 1CUSA 4MVJI 2VZ8A 1YFLA 4F2PA 2IH5A 2HMUA 3BFVA 1PQWA 1TYBE 3V8PA 5JVDA 1W30A 3IP3A 3AIOA 4BQOA 2REQA 4GPEA 3TMAA 2GAIA 3C3MA 4BMSA 2W58A 3MPSA 1DIOB 4CU2A 3IS3A 1WG8A 3KT0A 3MJCA 2EBHX 3F8TA 3FZNA 2J5KA 3H8SA 1YA6A 1R0JA 3ESRA 4I1RA 3RF7A 3LWBA 5FBVB 2PQ2A 4XJTA 3M7IA 2VTVA 4R40A 4EA7A 5TIIA 3RBVA 1SRRA 1LBEA 3GFRA 3TIIA 5ADUS 2PD3A 3AUTA 1NONA 3QYJA 4J7CA 4DUZB 1MJFA 5E7IA 2KX7A 3RHZA 4RZXA 1ZI6A 5KDOA 4RAOA 3G0BA 4H1UA 2X2OA 2J41A 3DBIA 4O3FA 4PXSA 5SYAA 1NMYA 2ZE8A 4WY2A 4HO1X 4OQFA 1QQ7A 3JXEA 4LGMA 4V3BA 1CUUA 3AXTA 1GCAA 3EIOA 2EFDB 3EFOB 3S2IA 4MWSA 3LCCA 5FCDA 4RKQA 2HK7A 4BV8A 4PX9A 1ISRA 5AJZA 5EP4A 5CNKA 1XF1A 5GP1A 1XVUA 1X1EA 2BFNA 3RHTA 2O7SA 2GBPA 2E82A 1Y8QB 1Y7LA 2OAGA 2WLTA 1C1XB 1HI9A 3CBQA 3ITEA 4LZZA 3W5DA 4HFJA 2JGFA 4X1YB 2X0NA 3VSCA 4ZJUA 1C7EA 5CD1A 4KJZA 3B12A 3C45A 4KWHA 1GTRA 2W83A 3C6KA 1GTJ1 4CTMA 1WMAA 4FBMA 4AHZA 3CZQA 1NC3A 1K0FA 1L4UA 2HB6A 3LBNA 1BD4A 4K9NA 2DFVA 1XNGA 4X64B 1R4ZA 4LEIA 1YUXA 3CWZA 1U0EA 2BIFA 2LUOA 2R00C 2VJMB 4KIFA 3UB2A 5EMLA 5MGBA 3EZ2A 1ECJA 4XYMA 5CDHA 1M0EA 2XGJA 3NJRA 3ILHA 4UNIA 4OI1A 2Z4RA 2IUYA 4QTYA 4HYYA 4AI2A 5M5XL 3LFUA 3K73O 5DASA 5GV8A 4O4JA 2P69A 1AXGA 4WESA 3BGVA 4RKRA 3W2IA 2DWUA 1IJEA 2VNAA 4Z1MD 1QZ3A 2HRCA 2HPZA 1Q3HA