5MGNA

Human sirt6 in complex with activator ubcs38
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
b'PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mgnA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mgnA01
4JUFA 4L3OA 1EFPA 2FWNA 2VK1A 5MFPA 2H4JA 2H2GA 2A1UA 1D4OA 2VJYA 1PNOA 1V5GA 1U2GC 2IHTA 4JU9A 2IHVA 4GG1A 1M2GA 4Y6QA 5AHKA 3GLUA 4COKA 4MPRA 1J8FA 4FEEA 2Q27A 2WVHA 1UPBA 5IMSA 3FSJX 4X3PA 3GLSA 1U2DC 4Q9DA 1V5EA 1YHZA 4QELA 2W93A 5EJ4A 4GP9A 3RIYA 2JI8A 2H2HA 1PT9A 3PKJA 1M2KA 4KXQA 2Q5OA 1Q6ZA 4K9NA 5BWNA 5K2OA 4K9PA 1M2JA 4UUBA 3JR3A 4FEGA 2PGNA 4TWIA 5D7NA 5EJ9A 2H2DA 1QPBA 2VBGA 4O8ZA 3PDHA 4JUAA 4MPJA 4UTZA 4K9QA 1MCZA 2VK8A 4UTNA 2UZ1A 4BVBA 1PYDA 3CLTD 3CLSD 3FLMA 3F6EX 4RJJA 1O96B 1S7GA 3OE1A 3U3DA 1XLTC 2WVGA 4K9KA 1UPAA 4IG9A 4KGDA 1POXA 2PGOA 2H2IA 2EZUA 2AG0A 2OORC 1DJLA 1T9AA 4BV2A 4QPZA 4FZ3A 2JLAA 5DGTA 3IAFA 4RJKA 5K6RA 2NXWA 5EJ6A 1M2NA 4K9MA 3CF4G 3CLRD 2JI6A 4BVHA 1T9DA 2QQGA 4MPPA 4KPUA 2NYRA 1POWA 2VBIA 2B4YA 4X3OA 3ZGVA 2OD9A 4J16C 1BFDA 1YI0A 1EFVA 4RJIA 1N0HA 1PTJC 2JI9A 4JD5A 1Q14A 1OVMA 4JUBA 4IF6A 5EJ8A 4ZP1A 4UTVA 4G1CA 3D4BA 4UTXA 4JUDX 4V1CA 2FR8C 2JIBA 1UPCA 1YHYA 4BUZA 4BN5A 3GLRA 2C31A 4RMIA 4V1CB 2OO5C 4GM4A 4JT8A 2EZTA 5DEIA 1MA3A 4C78A 1HZZC 3HWWA 3GLTA 1PNQA 4JU8A 2V3WA 4Y6LA 1OZGA 1Q17A 1ZPDA 2OD7A 1O97D 1M2HA 2QQFA 4RMGA 3JWPA 3EA4A 2Q5LA 5EJMA 2EZ4A 4UU7A 2A1TR 2FSVC 1YNOA 2AG1A 4V1CI 5MGNA 4GPEA 2BRUC 4TWJA 4RMJA 4JSRA 1T9BA 4K9LA 2DJIA 1YC2A 2WVAA 2Q5QA 4IAOA 5BWOA 4R8MA 4MQ5A 2Q5JA 1V5FA 2FN3A 1S5PA 3ZGOA 4QQ8A 4JUCA 3EYAA 1U31A 4L2IA 5DGDA 2EZ9A 3EY9A 1YI1A 1PO7A 4D5GA 4J1TC 4F56A 5BWLA 3U31A 4BVFA 1NM5C 4UUAA 1OZHA 2FRDC 4D5EA 2H4HA 5FEMA 3ZG6A 3IAEA 2JI7A 2HJHA 4FVTA 5MFZA 4Y6OA 4UU8A 2H2FA 3D81A 1Y9DA 3FZNA 1E3TA 1PI3A 4BV3A 2IHUA 1OZFA 4BVGA 2Q28A 1Q1AA 2EZ8A 4I5IA 2PANA 5FYQA 4K9OA 1ICIA 4GM0A 1Z8NA 4HD8A 5EJ5A 1T9CA 5EJAA 1YTLA 2H4FA 4JT9A 2JLCA 1SZCA 4RMHA 1U28C 1PVDA 3E9YA 4BN4A 4GM1A 4HDAA 1JSCA 2VK4A 5MF6A 5K6TA 4ZZIA 2OD2A 3HWX1 2H59A 1YBHA 2VBFA 1SZDA 2Q29A 1YC5A 3D7KA 3RIGA 4BVEA 3CLUD 3K35A 4UTRA 4F4UA 2UZ1B 4MZXA 2X7JA 4C7BA 3F6BX 5EJ7A 3PKIA 5K3SA 3LQ1A
chains in the Genus database with same CATH superfamily
1GA6A 3PHIA 3AOEC 2FEPA 3ZXSA 4LF9B 2YV4A 3OZCA 1JQBA 2ZYDA 5BSFA 5ICEA 1QRRA 2IPLA 3F46A 4KZPA 4CEJA 1MZVA 2G80A 2WB4A 1SC4A 3UAWA 2J85A 3A32A 3I5AA 1XLTA 2I5PO 3FGOA 1DS6A 1ONSA 1V16B 1F2UA 1N3LA 1Q0RA 1CPYA 3IOEA 3N0RA 3NTRA 1JMVA 3ZHCA 1DTWA 5B1IA 1LSUA 1YMQA 2EG5A 3W1WA 1FQOA 4ZWNA 1JDBC 3HYTA 3IIEA 3PFGA 3LH5A 4MWGA 1VIYA 4PAWA 1BDHA 4JI6B 1XFAA 3GGSA 4V0LA 5D2CA 3ES9A 3RVMA 3L41A 3RIXA 4A0SA 1WDMA 2WKWA 1GR0A 1GV0A 2XRMA 5HHTA 4WZAB 3FB4A 5JTTA 1BKDR 2EP5A 4DDWA 5JBIA 3FVRA 3MQFA 3UN1A 3S1ML 3NTXA 3O21A 4IFEA 4NMHA 4EOGA 3CJTA 1HQCA 2AOVA 1BD4A 2FFHA 3DB1A 1UMDB 1ATIA 4JP1A 3WHIA 4DA7A 1X94A 1P8JA 1N9ZA 3HCFA 2WKQA 4TQGA 5K6AA 1X74A 3LWOB 1X39A 3GFFA 3K9CA 5DI3B 3JRNA 4PYIA 1D0SA 4JLSA 2XGGA 4ME6A 2GCOB 1KZGB 1IG0A 2JIQA 1J70A 4NXMB 1NUPA 1V6AA 1KO1A 3NVMB 3W3AD 1N8TA 1CTQA 1E4EA 4NJOA 4XD7A 1O9GA 3AIKA 1XZLA 2MSKA 4J43A 4EGSA 2QAGB 1AHIA 1KMMA 3CBGA 4MPRA 3OJLA 4N49A 1IZYA 4I3FA 3T5DA 4G9GA 1W19A 1WNFA 5CT9A 3S55A 2PS0A 2SBTA 1H1TA 2WTEA 4NBSA 5EMMA 5LQSA 5IMSA 3QVVA 2ZBRA 4NMXB 3H7AA 7MHTA 5AVSA 1ODCA 1U2DC 2DBRA 4I1RA 2P40A 4MARA 3UH0A 2DE0X 4QLOA 3A9TA 4HH0A 4PLTA 1CX9B 3PX2A 4PZLA 3V48A 3ZJ4A 1BE0A 3IRUA 4P7JA 3TQTA 4DLSA 2QVXX 5E0OA 1K98A 3FNQA 2H2HA 5C35A 5JI2E 2AWNA 4S04A 2I71A 1ZMRA 2GERA 4YRBA 1YH3A 4TWRA 4GPIB 2Z4TA 3O3CA 4FB4A 4K9NA 3WIBA 4BNMA 1FTNA 1OWLA 4EKYA 2F9FA 3D2BA 1FTSA 2ZI6A 3OFSA 5ECYA 1BEUB 3Q7RA 3T35A 5EJ9A 1H4VB 2HTFA 4F3NA 4RTMA 3NBKA 3A0UA 3PE4A 1KETA 4J6FA 4R2JA 2WPDA 4BO9A 5J5AA 4YJHB 5JXGA 1KI9A 3F90A 1BHO1 2BMVA 4D42A 1VCXA 3PDHA 3C1AA 1I7PA 2H9IA 3VHLB 1RCTE 2ZQZA 1LDGA 1KAQA 2OO5A 2W2QA 1H8HD 3BFXA 1GCOA 5KQLA 4NBUA 2FPSA 1XA4A 1RWOA 4LCJA 4XM2A 2FSSA 4FINA 4GKAA 5KX5F 3NT2A 4WLVA 4KN5A 3Q8LA 4ER0A 2AFIA 2CLDX 5F4BA 3T41A 3ZD8A 3A7EA 2XTAA 4A26A 1MO2A 1QOQB 4M0PA 4A3ML 4C7KA 1DIAA 1DZIA 3O4GA 5DWQA 2NU8A 2JD2A 1KFKB 3VPDA 2OGSA 1M1NA 1SVSA 4JQYA 3FI9A 3WGYA 4AJNA 3N5KA 2UYCA 1ZCAA 1G2OA 4R9UC 1NP3A 1R5NA 1G3RA 3Q0IA 2MU1A 4M0KA 4W1SA 4E46A 3CNQS 1Q57A 4XJTA 4D0LB 1JLSA 1G5FA 1UXIA 2BGMA 3KYBA 5FBKA 3TLEA 3ZZMA 4YUAA 1JWLA 3MIIA 2UYYA 2GLTA 1VHTA 1Q77A 2QTBA 5IP5A 4R7TA 4CV3A 5GZ6A 4ZVQA 4LMBA 5J2UB 4JBHA 2VZLA 3VA7A 5LD2C 1ECJA 3AI2A 1G63A 1H0HA 5EUMA 4BRUA 3EPLA 1QLHA 2J9GA 4HQLA 3PG5A 4MS1B 4C0HA 4EMUA 5A0TA 1POXA 4NKRA 5CIWA 1NQUA 3CVYA 3RV4A 1B2JA 3R77A 4KREA 1ADBA 3RUAA 1S96A 1KDRA 1V2HE 1XVAA 2C83A 3QZUA 1IEVA 3EG9A 4ITRC 2RI1A 4RXMA 1WXDA 3VZCA 4B33A 4A6PA 4COOA 1Q7GA 1G8HA 4GWGA 2H0AA 1QAQA 3U3RA 3JXEA 3D0RA 4AULA 4S2UA 2M1ZA 1HLGA 3CB2A 3DR3A 2CF5A 3PWSA 4GICA 4IILA 4RFSB 3OSUA 1DFGA 5JDCC 3QKRB 2V9PA 3ZHRA 4C3OB 1EDBA 4YVFA 3I58A 4CN9A 2OAQ1 4M22A 4NIMA 3JQQA 1YZLA 3OF3A 4RCZA 2MDTA 2CW5A 2QXUA 3I6MA 3LHSA 4EJ2A 5DM61 3PVZA 3QEKA 5DCUA 3QGMA 1ZCZA 2AZDA 4ZDIA 3AUTA 2VLBA 4LX0A 4U6NA 3BHMA 4QFCA 3UXYA 1NBWB 3B3FA 4GX2A 4GYJA 5EJFA 3N86A 4OXXA 2BLNA 3K1AB 3OPXA 2XAUA 5E3IA 3AI7A 3DP7A 3F4BA 1OC4A 2HF8A 3MWKA 4F9EA 4MYSA 2PHZA 3OFNA 4MVJH 3M5DA 1R9GA 4MVJM 4EBFA 4FTWA 4NFLA 1VDZA 3WRVA 4KQWA 2XVAA 5CX4A 1Z0IA 1L3CA 2XWBF 2UV8A 4TS4A 1X0XA 3SG0A 1SR8A 3CSUA 4OPMA 3VR5D 4B4UA 1VFNA 2ZBQA 3FLAA 2E87A 4EF5A 4NJEA 4F7DA 4CIWA 1FMFA 4K87A 1D7AA 5TX7A 4YONB 2PH5A 1CUBA 5ERGB 4Y2RA 4QPJC 3ROZA 2AYXA 5DYIA 5K5EA 3WGNA 3AU9A 4LXUA 3U4AA 3CVVA 1SB8A 1F2TB 1KBOA 1T3LA 1FYFA 3GLHA 4YJ3F 3AFIA 4V1CA 4KMSA 2GPYA 2P3SA 2MCFA 4H3VA 1Z62A 2JLRA 2GPSA 2PK3A 1SU4A 3COVA 3SQOA 4CG1A 5JZBA 4X1YA 2PUEA 3VOTA 2WILA 1R6BX 2YNMC 4I6GA 1OI2A 2JHFA 4Q7LA 3OT1A 5BR7A 3KQOA 1TRHA 3V8MA 4BCDA 5FWYA 2JFYA 4C3IL 4MVJP 4MQLA 5B1EA 5FOVA 5HCIA 3ZBPA 1TZJA 1YV1A 2R1VA 4M1ZA 4O08A 1GPH1 3VKUA 1ZR2A 1YFZA 2DPGA 4BNDB 2RJNA 2G82A 4JT8A 3O8OB 3C3DA 5HVNA 1A9ZA 2WAOA 3P5SA 3D1JA 3DL2A 1G0OA 2LPMA 2C7BA 2HZ7A 4L50A 4Y67A 4F93B 3H5VA 3TLJA 4RYLA 4E5DA 2ODEA 2O9JA 2COUA 3Q11A 1TYCA 2X9GA 2NPOA 1WLSA 4LF5B 2O3JA 3SP1A 4LKRA 5DW0A 1ORHA 3G7NA 4UXIA 3LLCA 3OX4A 4FC6A 2QQFA 4WH0A 1E8JA 4HGYA 4U9UA 1BU8A 4D45A 3ENWA 5C5IA 5KWEA 4QBGB 1PV1A 1K7CA 4MJXA 4NYMQ 3A31A 2OKGA 2R7AA 3WKEA 4BL5A 1EFRA 3HUDA 4JQSA 4O2BB 1EQUA 1EWVA 3D9QX 1A9XA 1SG0A 3L8MA 3PPIA 2W4QA 2FI1A 3UV7A 4KXMA 2XNJA 2A0FA 1SUEA 1MPTA 4DJFC 3THYA 1A9YA 4FYXA 1O3YA 5EMJA 4NABA 3OIGA 1SD1A 4JSTA 2DUWA 4TL8A 1OA0A 3HUTA 3IAS6 3ECSA 3M0EA 5D3KA 4DNPA 4QOSA 3M3DA 2ZJ3A 3JRXA 1KH3A 2O2JA 4A0RA 3HH8A 5IW8A 1Q0UA 4BEJA 4D26A 5JJIA 3FUXA 3I9LA 3LK6A 4MMXB 3QY0A 3T52A 1NI3A 4DJDC 3PC4A 4RTJA 3RFUA 2V3CC 3JZAA 5ALFA 4LMAA 2QT1A 2WVAA 5DH9A 1N2CE 4XVCA 1PEKE 3GV0A 1F5SA 3FCEA 2G5PA 2F8MA 1FLDA 2ACVA 3W7AA 3WMFA 3A1EA 5LP6B 5JSYA 2PV0A 2BMAA 3WK8A 1D4ZA 2HL6A 1EHIA 3AO0B 3EMVA 4RX1A 2I1WA 2BKAA 5SZJA 3VNRA 1WCIB 4IOLA 1QRDA 2BFCA 1L1FA 2R93L 2HADA 1AZSC 2PR7A 1J1ZA 2EW1A 1NOIA 3DCIA 4MQ5A 3HSKA 3HKZP 4UULA 1EA5A 5A3SA 4B74A 2CMFA 4KFUA 2BKEA 5IJ9A 1WZ2A 1HE2A 1KSFX 1VZGA 5ALVA 4E09A 2XAAA 1MOSA 4RD3A 1KOFA 5BT9A 1Y5RA 3WKDA 3VDQA 1NQ5A 1Q3KA 4N0EA 3EH2A 2ZAMA 4RHXA 1XZMA 1ZJWA 1QP4A 1U1GA 1PT7A 3O0TA 2P65A 5DTQA 3HV0A 4BXOA 5GAJA 1YQ9A 3EIEA 3CWQA 1Y8AA 2GXQA 1SK8A 4KPGA 2GZHA 1EX6A 3EY9A 3Q3EA 5CK5A 3K8OE 4JYZA 2D5CA 2GWHA 4Q4AB 2GA9A 1ZH4A 3WOVA 4DOMA 4EG1A 1L8XA 1VYUA 4UREA 4FDMA 1KYWA 1VPLA 2RSLA 2YWGA 4IOKA 2QMZA 1JN0A 3D8UA 2PL3A 1PJBA 4RDXA 2NUTA 2IC5A 4R3UC 2FTKE 1ZJ5A 1KHTA 2O2IA 5FOXA 3SC6A 2WTBA 1U7TA 1GFIA 1CCWA 2HCBA 1QGUB 5JRDS 3PL5A 4IJWA 4WDQA 4QUDA 5HIJA 4CBVA 1M34A 2V6JA 2YFKA 2YQ5A 4NYJQ 2H48A 4GXNA 2QYSA 1C3LA 3G2LA 1FP7A 2PEZA 4GX0A 3B9BA 3FHLA 3HP7A 3RVLA 4AKTA 2D1TA 3ZZUA 4MUNA 4IUDS 1G1AA 5AJTA 3VVCA 3OD1A 3LWQB 2VXOA 5MFZA 2ZRFA 3HYLA 4EPXA 3GWZA 1IBKB 2ECPA 4WBSA 1EU1A 1JDZA 4IZIA 4PWZA 4K8RB 3VKWA 4EFMA 1ZGZA 4I7EA 4BNHA 2LIPA 1E79D 4DLRA 2Q2NA 2CNNA 2YFYA 2AOWA 2KS6A 1RYDA 5DXJA 3RBXA 4RQUA 4DMRA 1NW5A 5IH7A 6ABPA 2NNLD 1KIAA 1TEVA 4MWZA 4WE3A 1RAHA 5LA6B 1FMCA 5K3BA 4CMIA 3ZW8A 5B7QA 1G4AE 1QE0A 2JFXA 1LUAA 2C4VA 1AKWA 3HB0A 4RIIA 2ZWOA 1QIHA 3NBXX 4P4LA 1JALA 2DF8A 3WYEA 1T5TA 1WCYA 1X7YB 1SU8A 2AKAB 3SSAA 4R71A 3NAGA 4XR9A 4B6PA 5HKKA 3P9YA 1RWKA 3TNJA 1Q74A 5TPWA 2BEKA 3CWCA 4BKPA 5IWAB 4A3JL 3IE1A 4LRXA 1TEZA 3I62A 3NB0A 4KK3A 9ABPA 3EGVA 2RHCA 4HLUC 1QR2A 3UMCA 3R5TA 4LK3A 2FQYA 1JSLA 5JNRA 2XZDA 1H3NA 2YRFA 1OWCA 1CY4A 3B1KA 5K8CA 1MU0A 1OGYA 2ENWA 1TX4B 1LC0A 1U0RA 2Y4OA 3NV9A 3HVUA 4N9QA 2B4RO 2WWGA 2HIHA 2VYND 1TM5E 2W71A 4W1PA 1XD9A 4H7PA 3SKVA 4BECA 4DXAA 4AHZA 3WNQA 4GPD1 1X1CA 2JCGA 3PWTA 4DQKA 4ZTUB 2PUBA 3CF6R 1E6CA 1FP4B 1X7XA 1ENZA 4DUGA 3A28A 5EEHA 4GYYA 1U99A 2AW5A 1JEEA 1FMTA 3UMRA 3TW6A 1XF9A 1RI3A 2E2JL 1AU9A 1JDJA 4JLWA 3KLOA 2HEGA 4C0XA 1UL1X 4RCYA 4LNUB 5HX7A 5BUCA 4OK5A 4W5OA 3VU1A 1LFDB 5K6TA 1UKZA 1H69A 2IYNA 4B2PA 1UJMA 2W0MA 3H16A 2PKXA 4R6WA 3EQ8A 5ITZB 1O6CA 2OXCA 1Q0LA 2O3SA 1KIMA 2TMYA 4D57A 3DOJA 4EKEA 5JARA 3G9QA 1JLMA 3LCMA 3NHBA 4AR4A 2CXUA 1WXXA 1DEHA 4ERNA 4U2CA 4YAKA 1ESCA 4RK1A 2J3JA 1X1EA 3HV2A 4G5OA 5C3UA 4K46A 4MDEA 3WK9A 1EG2A 2J3DA 1C9EA 3CLUD 3IH5A 4W5JA 2YWBA 4ZIRA 1KYVA 4O63O 3MTQA 3DEFA 3L8EA 4HZIA 4WWHA 4D3DA 2P8JA 3K9BA 1GLGA 1T8RA 2W22A 3F8TA 3IERA 3IOMA 3OUUA 2YBEA 1TW2A 3CIOA 1DQYA 3PD1A 3VPBE 3IT2A 1CQIA 4O4JA 1SUAA 5L7YA 5HM8A 1BXGB 3KU4A 3ZHOA 4ABYA 2X86A 4LZLA 4P34A 2I1VB 4ECAA 1KYQA 5JCJD 1Z26A 5DX8A 3BT7A 4Y2JA 1LPSA 4YCNA 4LFAB 4JR0A 2QLJA 2GD1O 5CLQA 2MOKA 2J3IA 2W2KA 1E1CA 2EJCA 4L5AA 4ESOA 5IDQA 4D4LA 4DARA 1CEYA 1XRQA 3PKIA 2PMDA 2ASEA 4XQCA 3TCNA 4JV5B 3DOOA 1F4PA 1C7EA 3FYTA 1GKYA 4MUBA 5HPYB 4CKEB 1R0RE 1N33B 1J0CA 2CLKB 2AC7A 2OCBA 1V8PA 3H3JA 1X70A 3FFAA 4LVUA 1H2FA 1E0DA 1NVBA 1ZRSA 2K2DA 5CXQA 2O0JA 2YVKA 1OGIA 3N2NA 1O57A 2WFMA 1MBZA 2ZULA 4L15A 1ZICA 3M7IA 1W46A 4PZUA 3V6LA 5LMZA 3OEED 4TOIA 4ZOLA 5SZKB 3EXG1 4UDOA 1MJ5A 2CNBA 3GFVA 2JEOA 4JDPA 2AF3C 5I7FA 3L0YA 4MKZA 3IALA 2PKWA 3PIIA 5AVTA 3LXXA 4HUTA 5LOVA 5EKXA 1I4OA 3W2FA 1GZ5A 3H1AA 4XWKA 2ZZMA 4FX5A 1Q1BA 2VOEA 3G0GA 1TJ3A 4FDTA 4I14A 3RRFA 3RLIA 3T0IA 2VTBB 3GJXC 4NCJA 2Z2ZA 4MLZA 4ND4A 2IYUA 5I48A 2P1ZA 4TM8A 2CDBA 4UHDA 3GGJA 5JMTA 4Q1VA 3LHIA 4HDRB 1U81A 2H4XA 3MFYA 2W8ZA 4D0SA 1T1SA 3U37A 5M29A 1OV4A 4W9MC 1ZQ1A 2ARKA 3O4JA 4JB3A 4M55A 2ZSFA 2J0UB 1H5UA 5DP2A 5TVKA 5B6JA 4BLRA 4D3YA 2IHVA 4RVOA 3LWZA 2ZWIA 4MUJA 2VBCA 5IUNC 1XCMA 4L0DA 3G8AA 2B36A 1W5SA 2PXAA 2PGXA 1CQWA 2A9RA 5GQSA 5BR8B 3AL0C 5JXIA 1FS6A 1YCDA 3P5BA 4OJKA 1D0VA 1WRBA 1LNSA 1VIAA 5AHKA 4LHVA 3P4YA 1WXFA 1E1QD 2OWDA 3WVNA 3LOQA 3SS8A 1ABBA 2QX8A 4J0FA 4WLFA 3NHMA 3S2UA 4RQBA 3GLUA 3FVWA 6REQA 2Y6VA 2C59A 3KQYA 3JAWA 2ZQ5A 2GSWA 3A26A 4A3BL 1O95A 2P4UA 2R7MA 4FXPA 4COKA 1T8WA 2EG9A 1DXYA 5KBYA 3R0IA 1C7JA 3KKPA 3P8ZA 2XA2A 3VR5H 1LBIA 2J6CA 2CCKA 4R0NA 5F64A 3TRJA 4C2UA 1Z5OA 3F1LA 2AKYA 2DP4E 4CF4A 4TMVA 2RK6A 2IXGA 2ZG6A 2QZ9A 5JHHB 1Y48E 1Z92B 2V7VA 1KKMA 3WRWA 3LIPA 3EHDA 1BDJA 3TOSA 2W2LD 3QEOA 5DLEA 3D6NB 3I9KA 5DX1A 4GP9A 1CR1A 5FTJA 3TGLA 2A7QA 1FYWA 2NSJA 2RH5A 4IIUA 3ZS8A 3UWSA 5HG0A 1QHYA 4QX6A 1BH2A 2BMFA 4IEEA 5EE1A 3TAUA 4EP1A 4MVYA 1GKLA 4Y1RA 4JVMA 1X1TA 2GKGA 2E6UX 2I54A 3I30X 3B1YA 1TKBA 1AZLA 3NETA 5FORA 4RHYA 3RS4A 3G6WA 1DBIA 3VHRA 2OP0A 5CCBA 5TF4A 2RGYA 5HGJA 4QXMA 3UA4A 3SS7X 3VH4A 2FR8A 1J8VA 4BBZA 2HBQA 4H0FA 2ZIAA 1CUGA 3S2SA 1QU3A 1W4AA 3I4CA 5KJ1A 3G79A 3CO0S 1QO0A 3KAPA 3PUHA 4IHJA 2FPKA 5A4JA 1N6KA 3W5CA 2H9YA 4C3HL 2ORWA 3URKA 1LCIA 2ZYWX 2X8JA 4AIIA 2A9QA 1Q0PA 1TM1E 4GQAA 2PZLA 2GCEA 4CTKA 4F7WA 3W8EA 1XMJA 3ILXA 4G1MB 2GZ1A 3O8LA 4RK6A 2ZGVA 4OM8A 1AK2A 3ID6C 1ESDA 4FGUA 3BHJA 1XROA 3BILA 4K26A 4NONA 3KNZA 2HX1A 3BJZA 1IOVA 1GLVA 3CLTD 3EF0A 3M2PA 2P9GA 3CLSD 4MUGA 1A1VA 4NMMA 1NXVA 3HRHA 1KFBB 1GU7A 4H15A 1C1DB 1PLLA 3GT4A 2O2SA 3KPYA 1CNFA 1QHNA 3L0PA 3P71T 3N7AA 3TINA 3JARB 1E2EA 4X54A 1E5DA 1JMKC 2DQKA 3ERCA 3E5MA 3X1ZA 4X8HA 1F38A 3RRYA 5AW3A 3LHFA 1OD6A 4G8BA 3FCUB 4BY1L 3WZ2A 1N3YA 1V35A 4GH5A 5B1SA 5BQ3A 3T7DA 2IYTA 1R0JA 2NV0A 4G97A 4O5OA 2ADOA 1PF7E 1M0WA 1IQ0A 2IFTA 3DA8A 3R5HA 1OYVA 4M3NA 5G4LA 2AJDA 4P5EA 1K06A 3V1UA 3Q2OA 3TSWA 4AN4A 2PX4A 3D8BA 3IJEB 2GN4A 4QQFA 4AXXA 4TXJA 1PFKA 1G64A 1LPOA 4P82A 1O5TA 4A0FA 4EGAA 2D8AA 2ZYTX 3Q3JB 4CNQA 3QSYA 1OI3A 2I29A 2DAPA 3BTSA 4QD3A 3V8RA 1NT4A 4H1VA 4AQ7A 1R12A 3KJGA 4ARVA 5C8DA 4L7QA 4KAAA 1AXEA 2QIPA 5DMXA 5KQPA 2G1UA 4R16A 4HWKA 2JLAA 1EK5A 3ZWOA 4EG6A 3EOBI 3PC8C 4QTTB 3AKCA 3CCBA 4OQZA 4LZWA 5FCDA 3WIDA 5FH9A 5D3ZA 1UKCA 1EFDN 2RGEA 3B53X 2HBRA 2HXYA 4HZUB 3DKKA 1TU0A 3FUVA 3N53A 5J1TB 2HN9A 2FF7A 3BL8A 3DZCA 3DBHB 2QTVA 2VVTA 3T0FA 1RKVA 3MQ4A 3JQ7B 1ZA2A 4MUYA 1I0LA 1T3GA 2OR3A 3CLRD 2IELA 4ILKA 4JKIA 4L02A 4D3XA 4X65B 5B58C 3INNA 1Z37A 2IP2A 2VHWA 4MW7A 1GNSA 1YB7A 3NHYA 4QHSA 8ADHA 4RTNA 1IBMB 5C4MA 1G5RA 1O6ZA 4X85A 2NYRA 1KO4A 1KY4A 4J9VA 1VP3A 3LYUA 3HNPA 5AI5A 4KE8A 3H0EA 4YH1A 1PR4A 4BEWA 4B3BA 4BFVA 2POQX 2IHJA 2I78A 2ISQA 3I61A 1SEVA 2OV1A 5JNLA 1ZKMA 5ICGA 3EUFA 4LOAA 3R9IA 3G6KA 3MGGA 2Z5LA 1OT5A 4BO5A 3L8ZA 3L6EA 4RIEA 2B34A 4ZN1B 3G7UA 1V4NA 4LZOA 1OVMA 4AL4A 1XMSA 4B32A 4DLZA 4U2EA 2C78A 1V1JA 4E5MA 1W9MA 4ZMBA 3AUYA 1TJNA 2HRQA 1MX3A 4K05A 4UHCA 1IATA 3RUCA 2F43B 2JRLA 1IWBB 1C30A 3HXKA 5IM5A 5JU6A 2NQTA 4UD2A 2B69A 4EEKA 2BHSA 3I73A 4QDJA 1OLXB 3OFJA 3E15A 1V7ZA 2GBPA 2LXNA 3K4PA 4XARA 2AFIE 1YAJA 3L7MA 4XUGB 4D9HA 4F1JA 1G5TA 3BMCB 1I0ZA 2Z8XA 4YMWA 2BHNA 4PNHA 1P1HA 2HCFA 4ND6A 1ZP6A 5JSFA 3W2GA 4MJLA 1I32A 2V3VA 2FOLA 2XMDA 4HDMB 2EGGA 2J1LA 1J56A 4YAJA 2QAJA 2H5IA 1ZHHA 2EZTA 3A1VA 3OQIB 4AMGA 1CADA 1B6SA 2WMOB 4AROA 3U4MA 2CXHA 4KRYA 2XBUA 1SIUA 4XVRA 2GESA 3W6PA 5KSYA 2APJA 4OHFA 4UXHA 2IQIA 3DDCA 3HJCA 4R01A 1AQJA 3ZE9A 3V32A 4G5HA 5JISA 1W52X 1COWD 3L0OA 2BFBA 2IGTA 2H07A 2KYRA 3IQHX 3ODGA 5KO2A 5KOJA 1AQ6A 1FFHA 2NXNA 3SOZA 4YRKA 1M8FA 4O4JF 3NEAA 3PSAA 3UAYA 1NP6A 3JWPA 3NYWA 3V9PA 3Q4GA 2VZ8A 5C4IA 1P7VA 4KJZA 1QHHA 2GBLA 2WAXA 5DWVA 2VNJA 4FCVA 4C9BA 2EZ4A 5JCOA 4I1PA 5C31A 3ZE6A 3TQRA 3QYPA 1UP4A 4PSVA 3SU8A 1CD5A 4BAZA 2PWYA 3HKCA 4Q3LA 1D5WA 2OZPA 3PEYA 4YMGA 2XUKA 2A3NA 4BFLA 3I6QA 4V1CI 1XAHA 4PTYA 2VL7A 5JYDA 3ZVNA 2JAXA 5MGNA 1IRNA 4A3IL 1XTVA 3L1KA 4KLCA 4BO7A 4HRAA 5IKMA 4AZVA 2Y1DA 1YJ5A 1A5ZA 2X6RA 4G8JA 1WAMA 2YIJA 1UADA 4ZOLF 4R0VA 2RB5A 1GG8A 1AB5A 2YWXA 5CTJA 3D7LA 3PHLA 2AOTA 5DXFA 4E88A 4F4JA 1BS1A 5KYWA 1Q16A 1ULBA 5LOVF 1S30A 4GFDA 4D8XA 3VHXB 1CEXA 5JJ5A 4YP5A 4YJFA 1WJGA 3FNIA 3E7PA 2O7SA 4C6SA 3ONEA 2IVZA 3ZGNA 4BNWA 1ZESA 1LPMA 3ZH2A 3N8KA 1GILA 5FPHA 5JBNA 2F3RA 4DRXA 5KNCD 1YZ3A 4ECEA 1V43A 1GRQA 1FJXA 5C32A 4HEQA 2R6FA 3S5UA 1BKSB 4WK0B 1N4AA 3FRIA 4H1HA 1NN0A 3BIWA 1VPWA 3W06A 5IHXA 3L7KA 1QGZA 3B5JA 4OQPA 3TL2A 5CEFA 2O7NA 1HR0B 4D7AA 1NPDA 2V7QA 1HV8A 5GGXA 1WMEA 3ZPXA 5EIWA 4PZAA 3EFBA 1MA0A 4ZCIA 1SVOA 1CR6A 4U00A 1RM0A 2VDQB 1U9ZA 2VYQA 4PQFA 2FPIB 3HI6A 5IUKC 3TQHA 3UV6A 4AMZA 3BEDA 4GP6A 4TTVA 3RJ5A 4A15A 4I4LA 1UXJA 3HHEA 3L6RA 2Q5CA 5L3QB 4F86A 3QIAA 3M6LA 2JGNA 2VS1A 4KIWA 7MDHA 4CLRA 5I5GA 1GLNA 2I8AA 3U3JA 4PTZA 2GPJA 3HVJA 3K0FA 4FLFA 4GPZA 2I4RA 3GFQA 5LM3A 4G0XA 3AVTA 1ISGA 1OBOA 2Y77A 1HKUA 2GILA 2AR0A 3SZMA 4X1OA 4FNMA 3LUFA 2X0EA 3ZVMA 2VTVA 1L5YA 1UKVY 1V26A 1JFSA 5IJWA 4L5CA 2AK2A 4N8SA 5AXDA 5G0WA 2NV2B 1ZH8A 3USCS 3U7JA 4AZ3B 2PYAA 2PPVA 1TEHA 1D3AA 2I4TA 3K2EA 3KDSE 4ZMSA 3ZWMA 3KQQA 4G4GA 4NHOA 3VYWA 1Y1QA 4CR6A 1AKUA 2ZJ2A 3WR5A 1XTBA 5AH0A 3K3PA 1V45E 4AP6A 1M0EA 3JYPA 3TK1A 4POAA 1RHRA 2GEFA 4DXHA 2YJTD 2HK7A 2X19A 4PX9A 3OOJA 5EIFA 4AIRA 5AXBA 4DWWA 4AS1A 4PLPA 3ADDA 1FS5A 4ZAXA 2Z30A 2XTNA 4QDTA 3RSCA 3T6KA 3WYCA 1WUIS 3AT1A 4JCOA 2W2XA 1FRQA 1MQ9A 2LUOA 4HNVA 3PEUA 5TMPA 1CY8A 1XDUA 1RYYA 2E6KA 1R0CA 1FLNA 2ZCVA 2GAOA 4DCVA 3YASA 2OHVA 1TQHA 1BHSA 4YPVA 4NFHA 1X19A 2VH2A 3N59A 4K0RA 3FZNA 1E3TA 1PSZA 2H2AA 2OCPA 4IHJF 1ZJZA 1OSNA 4IVNA 4QOHA 4DJ5X 1OWPA 2OV4A 1NBOA 3LLSA 3ANYB 4E07A 1UCFA 3QELA 1YR6A 4XQGA 1TAUA 2GYUA 4NH4A 4YWHA 5SY4A 2A5DA 3OIYA 5BN4A 2FW7A 3DE4X 2J5XA 3GEMA 3HA5A 1IBSA 2CB9A 3RTDA 2DETA 5CVJA 4G0QA 1MJHA 2YHSA 3EXFB 4BJ5A 4M0CA 4CTOA 2IEYA 1H2HA 4J75A 4MQMA 3EIFA 2DUNA 3M4YA 4MB6A 1KI6A 4FFBB 4EO9A 1DI0A 1Z8NA 4X91A 1KEEB 5CB4A 3OEHA 5EUQB 4FSDA 1UK9A 3ZWNA 1YVDA 1XVVA 1OE0A 3O6VA 3FKSD 4MINA 3NDRA 4BYMA 4N47A 2XNDA 3BJEA 3HTXA 4TTIA 4G1VA 3TIXB 1RIIA 3AB7A 1U1EA 4K3UA 1S2IA 5JPIA 3W5JA 4BVLA 3AUUA 4OX9Y 3EIXA 5LP1A 1BU5A 1N0WA 4QTYA 2BR4A 1G60A 1OHHD 1WXGA 3FWZA 4MIKA 2IKSA 4XPIB 3ECCA 4H18A 3SLRA 2FMFA 2AUSB 2UYGA 3KE8A 1W2WB 3DL0A 5WRFA 1XP8A 2EJWA 1HMYA 5CA1B 1JSCA 2D1QA 1P5RA 3WMRA 3AZQA 1SVLA 1E5XA 1Z73A 4A5OA 2PX5A 2OFOA 1KKUA 2JB9A 2XGMA 1VXRA 3CXUA 2PKEA 1CDOA 3QFCA 4FFSA 4CFZA 4ZZIA 5C3MA 2QIOA 3IP9A 2ZB8A 5C1OA 2YICA 1R37A 2B2XA 3GL9A 4I4NA 4IDHA 4N40A 4DGSA 4DSZA 4YLYA 3NVKI 1UKEA 1OYWA 3ABZA 2I2CA 1E6UA 4A2WA 1YULA 3F2IA 1EXNA 3UGTA 3UJCA 5B1YA 5I9IA 1QYRA 4MJ7A 2Q5FA 3P32A 2JI1A 1FIUA 2E2HL 3ILYA 3FCXA 1G3QA 3PYLA 3CZ4A 4ALMA 4A3SA 2EBWA 2EBFX 1WE2A 4BVEA 4LMRA 2Q9CA 1IOZA 1YA4A 3SYMA 4KSYA 4MQUA 3OWOA 1KXJA 1I2ZA 3STHA 1LDBA 2SCUB 2XUIA 3CPHA 3R0XA 1Z4QA 1TVCA 3ZTTA 1VSVA 1PN3A 1Z6YA 5LLSA 4HPWA 5TLSA 2YWHA 2V3BB 3EYWA 4BMNA 1RHJA 4P4SB 1DVRA 2BP7B 3SX2A 3FDZA 1M34E 1XJCA 1IC6A 2A1TS 2FN8A 5FL3A 4G67A 3PNVA 3BIXA 2XXJA 1OWBA 4XFDA 4Q4JB 3RUHA 3IUJA 1JQKA 5JYEA 1ZLYA 1O94A 4KIJA 4OV6B 3T12A 3SGLA 3IVXA 2ZRGA 5E2IA 4M89A 4L22A 5FYDA 2XCUA 3HB1A 5JH7B 1I24A 2TMGA 3E9CA 5A9SB 3OT5A 2QXYA 3UAVA 5KOIA 1RMYA 5AKHA 5JNSA 3CT4A 2QW1A 1RXIA 3S99A 3TAXA 2IOFK 3R6WA 3NUQA 3OCWA 5T67A 4NOMA 1BG6A 4QDOA 2NYDA 4QPPA 4ZAGA 1P2SA 1NYQA 4WCFA 4B31A 1SBQA 1KC3A 2QN7A 1CJKC 4K2AA 2EFCB 1XD8A 3JD0A 2NGRA 2ZITA 3N2KB 4PAOA 4B6RA 4B6SA 4YUXA 1DAFA 4IVRA 2VQEB 3T38A 1BOFA 1ZEMA 2PJUA 4OQMA 1QIEA 2G36A 1LF5A 3PRYA 1O58A 1RLOA 1P2UA 5HZHA 5I7UA 3CX8A 3OCZA 1KRHA 1PJZA 4NICA 1A8SA 5IVKA 1JLHA 2IH5A 4LQCA 2LBPA 3VR6H 2YJNA 4KI0A 4PAQA 1WMDA 1V5GA 1C5KA 4C0AC 2CLSA 4PGMA 1I50L 2PLAA 4JBWA 5B37A 4U5XA 2OBYA 3RC3A 3DXZA 3TQFA 4BUCA 1Z0SA 1X8LA 4M6WA 2OOSA 1YRYE 4FWBA 4XWGA 1RHQA 4RJTA 1VL1A 3MQKB 2ZZKA 3UVEA 4C04A 2I2FA 1X8XA 3KKZA 3M9LA 4H1UA 4I55F 5SY6A 1TF2A 4J2TA 1GP2A 1PG5A 1T3TA 3GCGA 5IVHA 1UBRS 1UBLS 2Q2VA 2UDPA 4N3AA 1G16A 2F59A 3MWGA 5K4GA 2G5TA 1MZPA 1GPBA 4BPBA 3SEAA 5FUYA 1I30A 3U3KA 1A9TA 1QIKA 2D2FA 4BBRL 1AGYA 1LGYA 3DQPA 2P9ZA 4KO3S 2HMWA 5C8YF 3WMWA 2HAEA 2O8NA 1J2TA 1QTQA 5BYJA 4YAIA 5FQNA 4XRRA 2IPAB 5AI4A 3SS9X 5CFPA 3MRSA 4L6IA 4LHWA 5E9WA 2NP6A 2FP4B 3QWIA 2X5JO 1Z74A 4DCJA 1Y3HA 3N3AC 2H16A 3WJ1A 1IZ7A 3OICA 1RQPA 4FGSA 3L77A 5E2BA 4C3JL 2O2HA 4I1YA 4GS7D 5CFQA 2JI8A 4OL0A 4TTSA 4O6VA 3U49A 3M5PA 3BWVA 2OFFA 1GDHA 1JLLA 2Y1GA 5KYVA 3BYZA 1L7BA 4WJKB 5FJIA 5P21A 3U3OA 3WK4A 1B2OA 5FOSA 2UKDA 4Z1MD 5K8IA 4ETNA 1RKBA 4RE6A 5K8LA 1AHPA 2EQBA 2VDUE 3GRKA 3RVJA 4UUBA 4ZVKA 1P73A 3DTNA 2FRVA 1BN7A 3LT4A 2HBZA 3FMPB 1N6HA 2G17A 4HLCA 4LYEA 1JSRA 4YNBA 5FOTA 4EG8A 3OETA 4X45A 4XASA 1TZBA 3UGQA 2FE1A 4BQRA 1LRLA 1NBEA 4F38A 1E8NA 2X1MA 3LS2A 4MRVA 4R2XA 3SIXA 2JCSA 4IY1A 5FV4A 2VJKA 3AY3A 1HQKA 2YC4C 4KR0A 2O3UA 3DUFA 2FG5A 2NUAA 1SUPA 4D9CA 1FX0A 1Z2OX 4JIMA 1B0PA 2C92A 3HLKA 1OXMA 3JATB 4MA4A 4EABA 2DWUA 3KVRA 1W75A 4FJ1A 4EUNA 3E0QA 3B82A 5JDIA 1AS3A 1A2BA 2IBTA 2FZEA 3B70A 2EJVA 1QG6A 4U0KA 2YIDA 2HPAA 1WP4A 2X3YA 4ASUD 3ZX5A 5JMOA 1P5FA 1NW8A 5TJHA 2CSXA 2QY9A 5TR9A 2AMLA 1NMXA 1JBQA 4CT4B 2OEPA 8LDHA 3Q7SA 5GADl 5IJXA 1PSWA 4WI1A 5M7EA 2W00A 2XE7A 1X77A 2O5VA 4DIMA 3ND7A 4KYTA 4CLXA 2ZJOA 2JLZA 2JZNA 2EX1A 1DKLA 2IE8A 2R8RA 1K7FB 3IP5A 3BGIA 4ZN6A 3S15L 4KXNA 4MQFA 2F17A 4DPMA 2WWHA 3KLPX 4M2LA 5F73A 3UT5B 3WGLA 2XSZA 3VQTA 5JXWA 1RI5A 4F6CA 5LBTA 1OA1A 1ODHA 5EP1A 5C51B 2W37A 1CUEA 1EUDA 2FPOA 3MELA 4XQ9A 4DBVO 4PNEA 5F1YA 3PE3A 3VPSA 4A8JB 3ACCA 4IH4A 2XVYA 1JWBB 5AVQA 3PIDA 1FPMA 3LSTA 2HLPA 1H05A 5EXTA 4Z51A 5JYBA 4RTOA 2IUSA 4RQAA 4IGIA 3VR4A 3WP0A 4C6RA 5L4LA 3O90A 4I81A 1GCGA 3QG1A 5CLFA 2FZCA 4UBIA 1UXKA 2E2WA 4UUMA 1VSTA 3W5VA 1MAUA 1OROA 5IC4A 4V38A 3WLMA 3GT7A 1OBHA 3U9SA 2G1JA 4D9EA 5BSMA 1T0BA 4FMPA 1BO6A 3VVBA 2GNAA 1PR5A 1S8NA 3AVWA 4KSBA 2Q8PA 2YS6A 3ELBA 3FPKA 5TQJA 3WZMA 4O4HA 5GAGc 3QE3A 1CYDA 3HADA 3MB8A 3TN7A 2HHCA 4JL5A 3EBPA 1X3SA 5JCXA 5CD9A 2Z6UA 4U2KA 5HDQA 1WZNA 1DOZA 1PQPA 1R0SA 1LLQA 1XK6A 2YHAA 4IIFA 5IY0A 2PL9A 4XUCA 2Q6TA 5DHFA 1FFBA 3K7AL 2ZSDA 5AJXA 4OKNA 3R75A 3RNOA 5C7OO 1XPRA 1AVTA 3Q2IA 1F3OA 1DX4A 2B92A 1OB5A 5H70A 3I4FA 4L2IB 4B43A 4BAUA 2Q3HA 1ZK1A 2HB6A 3EXHC 3Q85A 1FS4A 3QE4A 3HJUA 3ZNNA 2QNIA 5CB4F 2J32A 3ESAA 2VHQA 5DM0A 1EE1A 1I2MA 1EFVA 3U39A 2NV6A 3DSRA 3KT8A 1FSSA 4GX1A 1ABEA 4E32A 3C7AA 1T2DA 4PTLA 1ZZEA 3OQMA 1QOPB 2QQEA 3BJMA 3FFXA 1ES9A 2VJAA 4RTPA 3NTUA 3PGMA 3DM9B 4ZT6A 1T8PA 1NNUA 1KJQA 1I5EA 3L4BA 3LW7A 3QJYA 3ZY5A 4EKIA 3STTA 4LOJA 3KKQA 5LZ8A 1TYEB 1Z2EA 4BLUA 5AKLA 3AF1A 3ZYZA 2CLOB 2XYQA 5ALUA 3TZLA 4BN5A 3DAYA 5AP9A 5AI3A 3RO7A 4C6TB 5CB0A 1LZLA 4DV3B 5IYCL 4QJ3A 1J09A 2WTAA 1EDZA 3U5ZB 4QODA 2Y1EA 3UGKA 1L1QA 5HFAA 1EI9A 1KZ1A 4XTRA 3U0BA 3O92A 3ESRA 4KMRA 5AQEA 2FJ0A 1E3EA 3BXPA 3I0NA 2HLNA 4Q37A 3ZE0B 3A4TA 3HFRA 5CA0A 4RK5A 1LSSA 1VIVA 4E1BA 2AD1A 3L02A 2V8BA 5KDLA 1SFOL 5HJ7A 3WZLA 2JAPA 3OO1A 2O59A 3EDOA 2CKMA 1SU6A 1W5EA 3B36A 1MB9A 2R6GA 1ZD2P 1BQ9A 4LZPA 1UEIA 1W2HA 1Q50A 1UM9A 1USVA 2QRZA 3GP3A 2PBRA 1H85A 4BO6A 1AO0A 3OZIA 4AJPA 3FPSA 5F2KA 1E6LA 2XWQA 4B83A 1KYIA 2YXNA 3SXUA 1OASA 4V0SA 4Y9RA 4F9GA 2R8PA 2DLNA 4FS3A 4RMGA 5HQ3B 5DLPA 3KKOA 4O29A 3EOZA 4OOFA 1PQ4A 1XQ6A 3LU1A 2JA6L 5AKIA 1A4XA 2SNIE 2CVFA 2PH7A 3Q3GE 4DLUA 4FGZA 3MVEA 5AICA 3WADA 3TFOA 3P45A 2BBWA 5IASA 1JKFA 2HDNB 2VEOA 7ADHA 3HO1A 2FSVC 1EPUA 1YUNA 3TVTA 1ZN2A 4RL6A 2R25B 1O4WA 5EPUA 1JHPA 3FRHA 1ML4A 1P1JA 2VXCA 1C3OA 2RGUA 4D43A 4OHYA 2VQ3A 1FLAA 3LGSA 1WSAA 1RBQA 5CUQA 5JCJA 4B3RB 1R18A 3S1RL 3NC4A 3BICA 1JHRA 5FQOA 4MLPA 1AKEA 1SC3A 1SMKA 2WUWE 3JQ6A 3UMSA 1P72A 4ZKDA 1B74A 1R0KA 3GVIA 1ZXLA 1KJ8A 3L18A 4UUOA 1YDMA 3AUSA 4W9RA 5DI9A 1U28A 4BHTA 1U7ZA 2B4TO 1T9BA 1US8B 1GRRA 3A4IA 3TZCA 3MT0A 2XJVA 1W4CA 4A3CL 1K7XB 3FCAA 3M6IA 3HZOA 1UJNA 4DAOA 2E2IL 2H1HA 1E4OA 3INTA 3ZH9B 1FDVA 1HWYA 1Z6AA 2ZI4A 1PDVA 3LI2A 3PJGA 4MPDA 4OUDA 4PYQA 4CM1A 4YT4A 5HTOA 5FFNA 2HWYA 5K9ZA 5JCZA 1X14A 2ZWVA 3DHVA 4OFBA 1TE2A 4V03A 4LRSB 2BFDA 2KM1A 1QKIA 4UJ5A 3E2PA 1DQNA 3ASYA 4J9UE 3DBIA 3DONA 3RSHA 4OHOA 3ZCRA 2QG9A 3SR3A 3HZZA 4J0EA 4LDRA 1USWA 4FYHA 5E8JA 5BN1A 3QITA 5CYPA 1A4IA 3K70C 1RXWA 1XHLA 4K6OA 2REQB 4RTLA 5TPZA 3L2OB 3KT6A 3GPDG 1SU7A 3N58A 3ZBUA 2YXDA 2JFQA 2H7CA 2ZWPA 2H08A 4QOEA 1TUEA 3FSEA 3EQZA 1M10A 4HO1X 5E7MA 4A0GA 2G07A 4PPNA 4D74A 5C52B 1D1PA 4F06A 4ZRDA 1MLDA 2VHCA 2E0IA 4BB0A 3E5NA 4EGCB 3U44B 5AVXA 3ZDRA 1P81A 4JAGA 1UXOA 1DKOA 5AW1A 3KSAC 2W6NA 5IX8A 3BRSA 5EXSA 4XWTA 3UZUA 4EG7A 2Y76A 2V0CA 2R4QA 3PQCA 1PUIA 4LC0A 3AF5A 1OT3A 4X7PA 1W0KA 2DWPA 4L4ZA 4J0CA 3OQOA 4D8UA 3RYHB 2I22A 5EMNA 3HLTA 2QL0A 1VLJA 2E1RA 2EVWX 4MVJA 1QRUA 3MJ4A 4GKKB 3L1JA 3S28A 2XUZA 5ELXA 3EGDB 3AONB 3QW4B 3SNKA 3ZX4A 4D5EA 4HEHA 4BX0A 5A2GA 3MA0A 1NRJB 1BW9B 4OHMA 4CIBA 3A4VA 3IV7A 3ZG6A 4ZQHA 4AJHA 4G23A 1DUSA 4PYMA 5BSUA 5AW8A 4Q9IA 4F96A 3DPIA 3U4CA 3D1VA 3QHPA 1FUKA 1D1QA 1HE1C 1KEPA 1JG2A 2R2GA 3AY0A 5G53C 2QU8A 1UR5A 2APOB 4GI1A 4TXNA 1SXJC 4B80A 3DV2A 3HKEA 4DDMA 5AVYA 2BBTA 4A9AA 1IEXA 2C5HA 3RFCA 2GXUA 2ZRQA 4H7DA 4JP5A 3FZYA 4R1MA 1XN1A 4PO8A 3FPLA 4YQYA 3C39A 3VYVA 3W3ZB 4CQMD 2CV2A 2NO7A 4RPJA 4B9EA 3KR0A 3BIJA 1YZTA 1PJAA 2ZI9A 1JB9A 2OILA 2AR7A 3G2QA 2VRCA 1S7CA 3RANA 2PMZP 4F72A 3TOVA 3F5MA 4OYLA 3ADBA 5CT8A 3C74A 2EZ8A 3I39X 4BMSA 3HM2A 4WBNB 3ASVA 1BROA 4XFKA 5AK0A 4P83A 1E9EA 5IEBA 2WJVA 2VHUA 3ZWCA 2BEWB 3AEKA 3IAHA 4HNGA 3IPYA 4HWTA 3MUOA 2ZCUA 3OPYA 4U8HA 1XRJA 2QPOA 4M9ZA 3V2UA 3WLNA 2H18A 3O94A 4WXRA 1D6SA 4YIKA 2DBZA 2IU6A 2XB9A 1T13A 4S1VA 4WASA 4MJ3A 3S4YA 4AYXA 3V8BA 3AR8A 3KPWA 1E2JA 1OU4A 3MD9A 3FDFA 1M73E 2IUFA 2O07A 4XX0A 4W8OA 5SZIA 4FUQA 5I01A 3B1WA 2CYCA 5IZCC 1Y3CE 4E13A 1ZSNA 2IYAA 1SVNA 3O1LA 1E3WB 2D1FA 3I9MA 2OLJA 3K4QA 5H9VA 5B53A 2A30A 3IUYA 1CY1A 1EIZA 1TXGA 4FBLA 3DMGA 2HCRA 2HSDA 4N82A 5AJYA 3T7EA 1UDWA 1NNLA 4ARCA 3ICEA 3RAEC 1QYVA 4GMFA 5B57C 2ZYAA 3HJHA 3T1YB 1T8SA 1B71A 3MTDA 4Q4HB 1XK7A 3QMMA 2PN1A 3BK2A 3DW1X 2Y0DA 4CFSA 2Y1CA 4WCVA 3IC5A 3ZHVA 1ORDA 3E35A 4U7WA 1RP1A 3FHJA 4IIYA 4BX8A 2CCJA 3GRAA 5AVKA 4RD1A 5MF6A 3O38A 5FJJA 4LDZA 1USIA 2IPOA 2AT1A 1K3UB 4Z53A 1TK3A 2CNWA 2GCIA 4QSMA 4X3CA 3KOYA 5L3RA 5TSDA 4BZPA 1IN1A 1XA3A 1NYRA 2ZKLA 4KXWA 4E03A 1GPNA 5AVZA 2RGXA 3EK2A 4Y2UA 4ZMRA 3Q0TA 3NBAA 4HEJA 3DMDA 1FSPA 3FFTA 3L7YA 4TRJA 3CZRA 3JQEA 3ROGA 4JBIA 4QUJA 1UXGA 4HY3A 4U3JA 4CEHB 2QKYA 1JE1A 1JR3D 1JG7A 3HFSA 3HYNA 5I3CA 5C8ZA 4G5RA 3AY7A 5ALHA 4ZHSA 4FOOA 4GMHA 1H6AA 1ZW1A 3JQ8B 2WW8A 2WSLA 4W7IA 5CM8B 2P90A 4YDRA 1MTZA 4M88A 4Y9TA 2WJ6A 2BCJQ 4PCAA 1ST3A 4BAGA 3RVQA 4HKTA 3VU9B 3B85A 5K2ME 1GPJA 4MZXA 1KWKA 1DO0A 2WJ4A 2Y1KA 5AI2A 3R41A 1V8ZA 3WKAA 3ZI4A 5B4VA 2P2YA 1T0HB 1H3EA 1VLMA 2G63A 4M9QA 3T3DA 1K5HA 5I7WA 1I2CA 3B1ZA 3QLVC 1WG8A 2B35A 4IZOA 4ZQBA 4M8NE 4F04A 4CMHA 1ZEJA 3KZ1E 1I2BA 2NVWA 4FFMA 1EM8B 2JBAB 3IQFA 1XX6A 4FYJA 3RM3A 4JUFA 1FFXB 1D1TA 1ULSA 2QPTA 1WU8A 4LOLA 1NE2A 4YMSA 1C0PA 3B38A 3EZGA 3GXOA 4MW1A 3VYTB 3H1FA 4MWCA 3GCZA 2OPHA 3PXAA 3MPOA 3TMKA 1ZR4A 3FPHA 3HOUL 1IJFA 3AF6A 1WUJS 4FQ8A 4RH3A 5MFPA 4XJXA 3VZQA 4KDFA 2H2GA 3RWOA 2H7XA 3C7KA 2A0XA 5ES4B 1ZD5A 3WXMA 3J81A 4IHQA 4E70A 2FEKA 1NDQA 3DYBA 3D54D 5AM3A 1YZYA 4OREX 3VTAA 5FV7A 2W83A 3TW8B 2IZ7A 2NXJA 1E8DA 1C3EA 3B2NA 2OK7A 1UMDA 4K9DA 2QVGA 2XJQA 3QLTA 4JC4A 3USES 1EIWA 4HQFA 4N48A 3KRTA 5DI3A 3UNXA 4ZYVA 2PVEA 2GCOA 4PRYA 5AM5A 1LTQA 3SHOA 1XNRB 3R9WA 5FX2A 3HCRA 1IZ9A 3GBVA 2IZ0A 3MOIA 4UM7A 2FZ4A 4L5BA 1MRSA 3TKYA 3UANA 5CA0F 2HU5A 1E4YA 2RHJA 3E9RA 2OHGA 2N42A 2GN9A 1GYRA 2QAGA 4KQMA 3PEEA 4A8HA 4GG1A 4UM9D 3N2ZB 5H02A 3BVPA 4ZCPA 1MVOA 2C4MA 5D3MA 5E95A 1D4FA 4AJIA 4BRSA 1X42A 3QU9A 3RSSA 1LNZA 1HG1A 5KTMA 4Y6QA 2JFNA 5E7IA 5IC6A 1C0EA 4PBTA 2QZ4A 1Y98A 5BR1A 1M8GA 2I9KA 1YE8A 1FBTA 5D5HA 1J4AA 3OPQA 1U8UA 4PQRA 5JUWA 1R0HA 1NXGA 4MI9A 4RV9A 2AW3A 5K0BA 2Q27A 3JQGB 1WULS 6RXNA 3RS2A 2IWHA 5KAMA 2O1EA 4WEQA 2XEDA 1CJUC 3H3XA 1QUFA 3E7DA 3GVHA 3DVSX 1PWYE 3D6VA 3ZQUA 4BVKA 1CBUA 1R0YA 3D2AA 4GAEA 4MRNA 1Y42X 3TECE 1GUFA 1I14A 1ZO8A 2FP3A 2XBLA 3L7JA 2AN4A 4PS1A 2YWDA 5D86A 1B00A 1L5KA 1G98A 1FHHA 5K3EA 4OCZA 4W99A 2H1SA 1UKYA 3Q5EA 4UBLA 1FYEA 3LDGA 3NPAA 1QPZA 1J2YA 1VKNA 3X0DA 3Q0EA 3EZLA 2YY7A 2ZXFA 1U63A 5LP6C 3LPCA 4GRDA 1E66A 3PCRB 1KE2A 4YJHA 2PSEA 1SA0A 1SKQA 3GUCA 5H68A 4KXQA 5KKAA 1GXSB 1HY3A 2BFPA 4QGHA 4AS3A 4B2LA 5KC8A 4RADA 3JR3A 4QYIA 1NV9A 1OH6A 3OTQA 1HFKA 4RXTA 5CK4A 3O73A 2R96A 5H5JA 2WSYB 1QPBA 2X0DA 3THXB 2ZSIA 2JL1A 3KAJA 1CDDA 3EC2A 1WVGA 1VI6A 2F3UA 2WT9A 1C1XA 3NKVA 4MQEB 4IMPA 3R5FA 4DLTA 4I8XA 4CDRA 1EA7A 3EVBA 3K94A 5IARA 1TCBA 4YT8A 3TZBA 4ALNA 2OQ2A 1IHOA 1YU9A 4A2CA 3HVRA 1TQ6A 1ID8A 2YCBA 3QFHA 3M6WA 2CMGA 1FRZA 1FSFA 2XH8A 5BMOA 3RZ6A 1H2EA 3RV3A 2HGSA 4MO9A 1NUAA 2F8LA 1ESMA 1UJ4A 3G5MA 4KO2S 1YZQA 4MI3A 1N32B 3M9XA 8RXNA 3B7WA 4ON9A 2H06A 3C1OA 4LF7B 1JBEA 1GPWB 3BXFA 1YR1A 4RJJA 5DTIA 4OSPA 3VMFA 3D6UA 3DZKA 5FUBA 4BGDA 2WWIA 4IIXA 4NNOA 2ZE5A 5F78A 2AGVA 3LQQA 4P1ZA 3C43A 1NDHA 4MS1A 1U4NA 1LQTA 1W73A 3B6IA 4H9GA 4XD7D 5CNIA 3VZBA 5H59A 4X0EA 3QXHA 4AYTA 4ZANA 4IOMA 4NVRA 4MKRA 5DYGA 1UQUA 4UATA 4BQNA 4DT1B 3EGEA 4O0LA 3N1UA 4Q7MB 3QKRA 1KK1A 4R3WA 1VPTA 2PGOA 3SLGA 5LJIA 4ZOCA 1XVLA 3OBIA 4MA5A 1LI7A 4MVJF 4K5QA 1SUFA 2Q4OA 2QYHA 3GJ8A 4P7KA 4CU2A 1MVNA 3RTBA 1GPAA 2CLIB 2B0JA 1YWGO 2B30A 4UHFA 1R4MB 2JEZA 4FP9A 4LXQA 4PRLA 1U0EA 4PX3A 2AG0A 2IGBA 2Q9BA 3QV2A 4CGYA 3INYA 1FTYA 2FZ5A 3V1TC 2C5EA 2XQIA 1ADCA 2UXCB 2OBXA 3EDRA 5JS1A 5DGTA 5LL6P 1T91A 1Q7TA 4NP6A 5M5BA 4RPKA 2A9OA 2MTBA 1WKCA 4HAXA 4NCKA 4OFZA 4OHXA 3ORYA 3ZVLA 1Y63A 3AHDA 3FWNA 5FB3A 2F1KA 3RK4A 2B8JA 3M4ZA 2O8CB 3SBEA 2QG4A 1EWYA 1RP7A 3TSOA 1CUYA 1PL7A 3I04M 4GI2A 4UFOA 2EATA 1KZ6A 1QBKC 2AFHA 5KX5B 2WPDD 2PYDA 3AK4A 1GL3A 4MWTA 3B3GA 4OMDA 4ZYTA 2X8AA 3ADCA 1Z6TA 3R9XB 1T9DA 3P4XA 1TCCA 4FB5A 4RTKA 1IE3A 4LOKA 3ZNOA 4D0RA 1KYYA 2IYRA 1LK0A 3HJBA 2NSYA 1C7FA 3KYDB 2VUSA 4JJ8A 5TMEA 3WYAA 3Q5GA 1X7DA 5DN9A 4EK9A 5KIAA 1NASA 4WXYB 5EMHA 1ZI6A 4KXLA 2QU7A 3ITNA 3L06A 4HDSB 3DOEA 5DBOA 5CFOA 1KC1A 4KQGA 3SYKA 5CT4A 3ZY4A 1M6HA 4H7HA 3PQ7A 5H3CA 2VZ9A 3QXCA 1Y7PA 5CJPA 3SZRA 3LBNA 1I7DA 1AG9A 3EMDA 3UT0A 1PTJC 3GA7A 2CXSA 3HI4A 1IXZA 5ILGA 4IV0A 4YQEA 5C9ZA 4E5VA 2Q4TA 3GN2A 5FHRA 4ZHQA 4MV4A 4EVQA 2B5ID 1NVVR 3SFTA 4KVZA 4X6UA 5EJ8A 1WBBA 1ECBA 1YBAA 1SHKA 4Q1FA 1I1HA 1D8AA 4G6BA 2C00A 3BGOS 2EGUA 4L4YA 5KYXB 1E2BA 2YVAA 2RIPA 4BWGA 1RC0A 3T94A 1QYWA 3N8HA 1ENOA 5HKLA 4BNDA 3GJYA 3O8OA 1A82A 4WKGA 4DQLA 4EF6A 3BUSA 1JRLA 5JR3A 4XGRA 2IS1A 1NQXA 2R1ZA 3SQMA 4FCCA 4HAIA 2IODA 4PIVA 1R8JA 1WA5A 3VR5A 4WLNA 4YACA 4R1NA 1MB0A 5EWMB 3WLEA 5JAZA 2HNBA 4BNUA 2C1XA 2OV3A 2QX9A 3KQSA 1SOUA 5AUPB 5HXAA 3UJHA 1IONA 3F96A 3ZY3A 1UBCA 3NWJA 3KYWA 3GFTA 4ZVTA 1F12A 4XYMA 4C7OA 1G3IA 5ICCA 2I7DA 5FF9A 1SWWA 4ALKA 3NAMA 4ALIA 4YAFA 1ZNYA 2KLHA 2NVUA 5IC5A 5MN6A 4C78A 4DREA 3S2DL 3NLLA 1JJ7A 1P74A 1Z18A 4AN1A 4GC9A 3W9UA 3HUFA 3NYQA 1N3IA 4DLBA 3U09A 3LUBA 5CYOA 4GRIA 1JNXX 3UHAA 3OZXA 1RMQA 2DUMA 3AGPA 3BD7A 2CL5A 2P2CA 4P32A 1HQYE 4OLFA 5AJVB 3GMIA 1VHDA 1E3SA 3L7NA 5P8WA 3WV5A 1ZPDA 1VHLA 2JARA 1SHUX 2CVPA 1O97D 3IDOA 1DT5A 3PDIB 1JXOA 3R8XA 4F5DA 4AJJA 2XUAA 5D5QA 3SR4A 2I6QA 1FW8A 2X42A 3OFND 1MW9X 4LPSA 4V0MA 3H42B 4CUJA 3HDJA 4CKXA 2CNOA 2R6CA 4JADA 3G5TA 1VZ3A 4DSTA 5ALMA 1J2UA 4AUMA 3T3HA 4YCAA 1P2DA 3DCNA 1K9VF 3CPSA 3LO5A 1CVLA 3A1NA 4I6JA 4EW3A 3JQDA 1CUZA 3Q9UA 1M1XB 5CGZA 1L0BA 4YJ3B 3SYLA 3IDFA 1XEXB 3GLIB 1WZUA 1H2BA 1I3LA 2TMKA 4Q3EA 1X15A 1Y8QB 4GECA 4GXTA 5HF9A 3U1TA 1T6BY 3EVTA 1QF7A 3HU5A 3R8FA 3ZEAA 1NP7A 4IDDA 2X77A 2DG2A 4AX8A 2XR1A 4AQYB 3R3ZA 1PQUA 3IKTA 2V96A 4ND8A 3FIUA 4CM7A 3IEKA 3O2JA 4ID3A 2PD3A 2XB2A 3T1HB 1C9YA 1JNYA 2ZS8A 4AZ3A 3RGWS 1II0A 2VAXA 4PR0A 3JTEA 1LXCA 1JJIA 3FI0A 3HDVA 3MD0A 4RKQA 4DJTA 1MD9A 2JANA 2R8YA 4IXTA 1TTQB 2WU8A 1KMCA 3CZPA 1FNBA 3BMOA 1N6IA 2O2XA 2PAAA 2IY8A 4UM9B 4WUVA 2IS6A 4Q6WA 4KXFB 4LE2A 4NE2A 4QYTA 1W59A 2BGJA 1GAXA 1G20E 2OMKA 3BIFA 1XOIA 7RXNA 1KPIA 1OX6A 1ICEA 2NTNA 3K0BA 3H5WA 4RSHA 1CEQA 4WFKA 2YVUA 4B46A 1P2TA 5BMVB 2I6TA 2WZCA 3Q10A 4Q4AA 1EK2A 2RFKB 3P0IA 3EF1A 3TTWA 1JIXA 5DFAA 2YY6A 3EFOA 2MSLA 2W8BB 2DM6A 2XDAA 2Z3QB 3TM5A 1Z5WA 1D7OA 2C5SA 4I2VA 3IUEA 1H1LB 3DWGA 4JODA 2G9UA 3LXUX 2VH1A 1QF9A 2F4NA 4IL5A 3UMFA 1BFKA 1U3GA 2WM9B 4L3VA 5FA8A 4LRQA 1IXKA 2YC2C 3DR5A 1YRAA 1YRLA 1QB7A 3WBBA 2HSGA 2R4UA 5HIIA 4A6XA 3G02A 2J0SA 4M21A 2C4UA 4CE6A 4XVHA 1EFRD 1SHJA 3KV1A 4B7CA 5JVDA 3M1AA 2R00C 1YS2X 3MSCA 2XYPA 4CEJB 1BDMA 2RJOA 1DGQA 3VU3A 1O6BA 4FZJA 4KDRA 3SYTA 2J0EA 3RW9A 3L04A 2J6IA 3QEBZ 1H8HA 3HXOA 1B15A 2FRDC 1OR8A 2JVKA 1O8CA 3QXJA 2AUMA 1G8AA 2HQBA 2JCYA 2RHBA 2PUAA 1Y81A 4DIUA 3RHSA 3TIIA 4ND2A 1UBNA 2DR3A 2D06A 4NV3A 4U63A 4C2BA 5HFJA 4PZ9A 5LLTA 1XKXA 4WAUA 2OCIA 3N28A 3ZYCA 4YP0A 3L7IA 4HHEA 121PA 4MGHA 4DN6A 3U17A 4TRRA 3R40A 4UU1A 2CHEA 2WQ7A 3PCXA 1NFQA 1GDDA 4LI0A 3O95A 2IW1A 2BI8A 1HGXA 4WL0A 1T3SA 5FWNA 1QHIA 4QFDA 4BV3A 3IULA 2LCQA 1PLJA 3HVHA 1JXMA 1YU6A 2EDAA 5F52A 4E08A 2GD0A 4W1QA 2CL6X 4Q1CA 3FCYA 2CXNA 4R8RA 3CE6A 2V7XA 2WLTA 5ABPA 1TKCA 3TLMA 1G8KA 1Z08A 3N0TA 1LVUA 1UOPA 2G76A 1E4EB 4RD6A 4LGYA 3SZ3A 5L3SB 2H1IA 1ORWA 1SIBE 2GN2A 1K2WA 5IXJA 5F9FA 5AJWA 1TB4A 3BF7A 3ICWA 1JXQA 1GN9A 2QRPA 2OGUA 3GLGA 1XPUA 2XTZA 1YUMA 1XZBA 4FYVA 2O0MA 2OL4A 4JL8A 2PRKA 3WGVA 5CITA 3VSDA 1NMEA 4X8LA 3K0AA 4KPYA 1DPFA 1T0PA 2P62A 1I5OA 1SZCA 1QV7A 4KDEA 3R7DA 4MVJI 1GQOA 4U2BA 1DQRA 3EDMA 3NOXA 1YS6A 3TUIC 2HV8A 1K8XB 2R5NA 5HMMA 3HY4A 4PLCA 4WXMA 4BN4A 3ZS9A 1CB7A 1WQ3A 5E9QA 1SCJA 3Q12A 4C6HA 4LQLA 1V1MA 4IJVA 4MDFA 2QD3A 2ODTX 3SBOA 1XRLA 2PZFA 3UH1A 1T4DA 3QFSA 4XDZA 4X61A 1RXUA 9LDBA 4ISBA 3I6IA 3NT5A 5I45A 2YHBA 3ZOZA 2JFBA 2VT6A 2ZBDA 5HKBA 1V7PC 2BFNA 5F7JA 4FDUA 3X1DA 3SVTA 5KWJA 1QCZA 2WKRA 2ZUCA 3K20A 3O7MA 4NSNA 1YZHA 4OD0A 5J9FA 3P2EA 2NTEA 4EY6A 3GP8A 2QT9A 2W42A 3BB4A 1BXGA 3HKBA 4XOUA 1BXRB 1K83L 3LT5A 1W5BA 2GO1A 3WGHA 2DPHA 3VHXA 3GLFB 3K35A 1UJBA 1YRHA 3I6ZA 2HY7A 4N5MA 3T34A 4XGHA 3O91A 4YBZA 1OQAA 3LPLA 4GR4A 2YU9L 2QZSA 2UUPA 3K09C 3H6GA 3ROXA 3M6XA 3T7AA 1PNTA 4LJYA 4XWOA 5DU2A 4ZAFA 1MPXA 4IGKA 3SF8A 2Z95A 2Z8ZA 3LNTA 4CKEA 1PFGA 1E0KA 3FF4A 4MVJE 5EY5B 4Z3OA 4IDBA 1CUVA 1ZX1A 2RGAA 1DBWA 4QA9A 5HKKD 3DJYA 1PGJA 3DZGA 1M1NB 5HCUA 4JLDA 2PMFA 2PL1A 1V6SA 4K6KA 2DTDA 4P3YA 5KSZA 1TUIA 2OOKA 3MWEB 2O2YA 3MCTA 3P9KA 3VC3A 1UBJS 2ZYGA 1W5TA 3P9NA 1SPXA 4X44A 1EXVA 3NM6B 4AG3A 1QYIA 1TECE 1KAHA 1VTKA 1AM4D 4V2IA 1J0DA 4BP3A 2ORYA 1DFIA 2J9XB 4AI1A 3LXRA 1YONA 2X8LA 1MN6A 4ZHQF 2VUTA 4A23A 2P9BA 5CFMA 1KU6A 5AW9A 3CUSA 1L9XA 1P44A 1T6XA 2BI7A 2IIBA 2MSEB 3CLUC 3NFPI 4DLPA 3JQ9C 1EB9A 3CNHA 4DUGD 3KTAB 2ZUEA 3FSRA 4KMMA 2HKIA 3ISVA 4HDRA 4Z49A 3O8BA 5I7SA 4J7XA 2CV0A 1NWHA 4CETA 2OG1A 3A3KA 1Q1EA 2VSNA 3I53A 3PTZA 2J0UA 3GJRA 4YP7A 3G0BA 5CNMA 4S1WA 1VHJA 1KVSA 5F5NA 1N7HA 1SCKA 1BNCA 3QBDA 2XVZA 1V71A 2YHIB 1P7WA 1CUUA 1PNOA 4RAOA 3K53A 1XO1A 5A3QA 3OLCX 1T5HX 4KLNA 1TPZA 3QVJA 4K9SA 1P61B 3S2ZA 2REBA 4WKOA 4J07A 2FR1A 5GPBA 1HDGO 1EWTA 3FXAA 3ZCUA 1TO6A 2C9YA 1HEUA 4BNFA 5L3SA 1YE3A 2VAVA 3NEPX 1P3Y1 3CGWA 1BCRB 1O1YA 3DLPX 3Q7QA 2ECQA 1OCEA 1RXSA 3R6DA 3DAFA 4IEFB 3DHNA 3U4HA 1WO8A 4B4DA 4D0GA 3RADC 3JQCA 3OESA 3SAJA 1MQ8B 3F3SA 1U98A 4U2DA 3QTLA 3A2NA 3LQFA 4WESA 5FPTA 4B3MB 5JVH1 1YVUA 3CMMA 3H8JA 1Q1ZA 1F6BA 2YBDA 4Y2HA 4CKYA 1PJLA 4MUHA 1FQWA 5DOVA 4IYJA 3W5AA 3CKLA 3AHEA 1RYNA 4MA0A 4QGGA 1KO5A 4ZV9A 3RODA 1MOZA 3VAZA 3C3PA 4C4OA 5EIOC 2LR0A 4UQPA 2WVHA 4TVSA 4PN7A 4RDHA 3T5BA 2JFUA 2V7UA 4KLAA 3SKXA 4NJEB 1K8QA 2PMCA 3M4XA 1YFLA 1H4QA 2PVCA 4JP8A 3F71A 1HE5A 3IJRA 5JT1A 3WWOA 4P3XA 3QOXA 1YBMA 2O8VA 4NENB 4EB0A 3GX1A 1AJEA 4WXPA 1JDUA 1SC1A 2WJAA 3I42A 4TQ9A 5EJ4A 3OAAA 3GLHB 3DZFA 1RKUA 3DG9A 1VB5A 2FB9A 5FBLB 5BSVA 4O2RA 3MWDB 1SUWA 4J1SA 4A82A 1QZUA 1M2KA 5EJEA 4OJNA 1Q3TA 4YYZA 2NPIA 4GI7A 4R9VA 5FWYB 3BA6A 1PR9A 3KSZO 3ZVKA 4F5WA 4M8IA 1CIVA 4V24A 4PLHA 4OIFA 4GQBA 3HO6A 4INPA 3RK0A 2R1VB 2GR9A 4REOA 4AURA 2WA2A 3DZHA 2DFVA 5FT9A 5T4BA 2Z6AA 2XOEA 5H3HA 5CLJA 3KJIA 2W2VA 4JWTA 1Q0SA 2W2TA 3IKMB 3I9JA 3MSXA 3WWNB 3QMPA 4IXWA 4RPHA 5G2OA 4I5FA 5SYMA 5T5QA 4D92A 5B30A 1J8DA 2FSHA 2X9VA 4G3XA 4QFMA 1JR2A 3JQPA 3RTCA 1N9KA 4QOJA 4QRDA 3BGWA 4KIGA 3T3NA 3JARA 2HWUA 1LPPA 2D5LA 2HHLA 1NBIA 2IPXA 3HL4A 2JLQA 4GMKA 4QYXA 1OTYA 2Q1UA 3KYCB 3ABRB 4MS3A 2F90A 2AN1A 1WZIA 1GZVA 3VDRA 3LTNC 1ZVQA 1FVHA 1OAOC 1RM3A 2JF0A 2WSSA 3OCJA 3W8NA 2GN8A 1DJPA 3O9ZA 1TAHA 4LZAA 4WZAE 3GEPA 4MIEA 3T3OA 2QJRA 2LDBA 2HSWA 2V6MA 3CLKA 4JI2B 2A5FA 4ZPXA 1OILA 1S7GA 2I3AA 3OE1A 4DWOA 1ZGBA 1VECA 4R8LA 4DA6A 1ODIA 3LQ2A 2NO5A 2E89A 3AJEA 4NBWA 1TM4E 1O95D 1YXMA 3THYB 3JQFA 3WB9A 2WVGA 3D2LA 2I33A 3PJRA 2VPZA 4B6GA 1N78A 4G2NA 1N1GA 2ZRKA 3NOVA 4FS8A 3M6AA 4KWTA 4M46A 4R81A 2GHRA 2UVDA 1P5HA 4XWYA 5JVDF 5KYTA 1JBKA 2A3RA 4EPVA 5IXSA 4YROA 4KGDA 1T8YA 4C2M1 1MENA 3OI7A 5K20A 2EXXA 3DDUA 5T41A 1MHTA 1F8YA 3TBHA 4BNYA 2B1IA 4HZUA 2XUDA 2NZJA 2NADA 3DZJA 1RJFA 4G5GA 5K45A 4WIAA 1IY8A 2XI4A 1YQQA 2P4QA 2YRWA 1KPHA 2BRUA 3CIFA 4HYYA 4MEJA 5IF9A 2AQCA 3CLTC 3MXTA 5TVGA 3ZDXB 4D25A 3CLSC 1JKMA 3FNFA 3K6KA 5C53B 1A71A 4TXLA 1YGPA 4FIDA 2B5VA 2Z3VA 3GVCA 3Q8MA 2R79A 3LVQE 4ZC8A 1G8FA 5ESRA 4RA9A 2XQKA 3QKSA 5C44L 2HR5A 5DHSA 3ND5A 3LZCA 3NYIA 5EWLB 5TB5A 3F0TA 3QTBA 3W34A 1EVYA 1QO0D 4AHXA 5IJ9B 1IHDA 1V25A 3G0DA 3NH6A 2O5JD 1F0NA 1BC5A 1TYDE 4NK5A 4X7BA 3VV2A 3ZK9A 4BVHA 1DWOA 1SCIA 2RH4A 2PD4A 1WUHS 3AEZA 5BRNA 5IZ4A 1MAHA 3D3EA 4CMCA 4QVIA 4G4SP 1E6EA 4KXVA 1B4DA 2COKA 4B09A 4Q6BA 4DDVA 3THWA 2ZI3A 2E4ZA 3P97A 2QLTA 3Q98A 3CX3A 4BXOB 2JLWA 3PHCA 4CTJA 1RQ2A 2XMRA 2A88A 1JV2B 4J16C 2HHAA 1KIFA 4MRMA 1ECFA 1B41A 1GQFA 4OATA 5FO1A 1QWSA 2JJYA 1HDZA 1HLPA 1YJCA 2F43A 1T5LA 3KEMA 3QENA 3QVTA 4P3NA 3SX0A 1U90A 2A0YA 2I8LA 2XYHA 1UC4B 4MRAA 4DKJA 4IWYA 1A50B 1NRXA 1NUHA 3QIVA 5A5DA 1D2EA 4FJ0A 1WUKS 4HN2A 5H8WA 5F9MA 2J4CA 1JU3A 1SG9A 2ANBA 2NUTB 5HRCA 4DY4A 4H6PA 4JKOA 4G1CA 4Q5IA 3D4BA 3TTYA 2G71A 4PLWA 3BMCA 4Y6PA 1LKMA 5ECGC 1I6HL 4IFTA 4Z4FA 1JA1A 2AR9A 4HDMA 1UWCA 4J4HA 2ATXA 1ADJA 4OJQA 2DCMA 1E7RA 4XI9A 4FFOA 2XRZA 1E9VA 3CLRC 1SBHA 1G4HA 1K68A 1RM4A 2IL1A 5JAHA 2VL6A 1LJLA 2B82A 5AN9H 3P0RA 1M7BA 1OPRA 2XT6A 2E7ZA 3L40A 3MOSA 4C0WA 1C80A 3K16A 5LC1A 2QLMA 2GJSA 1M6NA 2NYAA 2VHYA 4O0MA 5DT9A 3HK2A 3WGTA 4N5IX 3COSA 3H2ZA 1WB4A 3LX6A 5CGQB 5CH3A 1VBMA 3R74A 3VSBA 3ZI7A 4EZEA 1L1EA 2O1WA 4ODIA 1GZ7A 2VP3A 2I2XB 2P5TB 2Q1WA 1AKMA 2N46A 5FKJA 4NOJA 4Y6LA 3Q6MA 1OPXA 3UENA 3NO4A 4CMGA 1KAEA 4OXIA 1Y6JA 2WSIA 6AT1A 4HSEA 1FSGA 2IF0A 5TPWB 3RZDL 3P19A 1HETA 4V3CA 3C7CB 2QK4A 1IU6A 2AI1A 3K92A 4YWLA 4YB8A 1XLWA 3AR5A 4IZ6A 5EZYF 3U3MA 2I4MA 4KUHA 3CW2A 4A03A 4WN3A 3TZKA 3IKLA 2YYZA 2G1PA 2WVJA 3D59A 3WLPA 2P68A 2NTJA 4PSKA 3SNHA 1DINA 2G8NA 4XH9B 4YUWA 4XXHA 4LWPA 2C0PA 3OZUA 2Q7DA 4X63A 4YQZA 2KJQA 1AC5A 3K73O 4C07A 4E1AA 2ZANA 4S1PA 1XU4A 5AT1A 3B60A 3G5AA 4MI6A 4UJ3A 1S89A 1ZHOA 2C4WA 3WLFA 2IEIA 2QE7A 4MYHA 621PA 2HT6A 1OH8A 1V6CA 3K0CA 4L4XA 1KGDA 4JGGA 2B21A 3ZE7A 4D02A 4JSRA 4AR3A 2HBYA 1PGOA 2VWGA 1QGED 1GKUB 4LV6A 4XOIA 3REOA 3PQDA 2IHZA 3JQBC 4H27A 5TRTA 1DMRA 4NOKA 3WLHA 4JS0A 4F8EA 3ZCVA 4GW3A 3QVOA 3V1MA 4TYNA 4HQNA 2YMLA 1JZSA 3ZHTA 1IROA 4EB3A 3T4XA 2PNJA 2XOXA 2J48A 3KJEA 4UKDA 3NRBA 1LKPA 3E5RA 4G0UA 4DWJA 4UNSA 1PLKA 2F1RA 3MHTA 4X71A 1UC8A 3K9QO 1JFFB 3RE1A 1HDRA 4HN9A 2WUVA 2GPAA 5L3QA 2Q4EA 3IDSA 2JGAA 3DVRX 4ZU1X 4BZXA 2I7TA 2XNSA 2OCXA 2FPRA 2DULA 1NJ1A 2AK3A 2HNAA 3WYFA 4F3RA 4URVR 2GF9A 1E0AA 3EPRA 4O4JB 1IVNA 5LCXA 4TYWA 2IZZA 3IQZA 3T54A 3UKDA 3B13B 1IQPA 3LVRE 3JALB 4AKEA 4LMPA 2X1HA 4HWRA 4JUCA 3IUSA 1UOOA 4C2AA 1YA8A 1S9DA 1E2LA 2NPFA 5CW1A 2ZSUA 4L8FA 4XDHA 3N9IA 3S17L 2R8XA 3ACDA 2I1QA 1EJBA 2F1JA 1XTKA 2ZSEA 3G82C 2QVCA 3IURA 5E4FA 1TF5A 5D87A 2XZOA 2RBEA 1LVHA 4UU0A 1S2OA 4AR5A 1EGAA 2DEUA 1N2SA 4YAUA 1UT5A 3HBJA 1A9RA 1XU9A 2HA6A 3L7BA 4YRPA 4PPYA 4DMMA 1OWMA 2DT8A 4RLSA 2PGDA 2ZSBA 4BVFA 4C88A 4ZTBA 3W8FA 1RI4A 1J25A 4IKPA 4M8SA 3KD2A 5KSPA 3BXGA 2JJ2A 1WEKA 1QIFA 3QLJA 1Z25A 2V58A 2VA8A 3LLUA 3NBFA 4KQFA 4NZYA 4HMPA 2VA9A 2FEMA 2JJ1A 1GPUA 1KH2A 1EVIA 3IUPA 5AKXA 2FETA 3QKWA 5KU1A 4FEYA 4F92B 1Y9EA 1YCFA 2FMKA 1NBMA 1U0OC 1NATA 2GJ4A 4PIPA 1SJ9A 2WU3A 3FY4A 4LOIA 1WXEA 1I7SB 4NDAA 4V0ME 1W8IA 2O20A 4A3DL 4NX2A 3KVYA 4ZVVA 3ACBA 5AFSA 2PZJA 3MCZA 4YV7A 1CUCA 2AOUA 1KQPA 2BEJA 2AQ8A 1NLUA 2GRAA 3A9UA 3CB4A 1TO1E 5CLGA 4FFBA 5CURA 4F91B 4POGA 1L3BA 2HWXA 3V4LA 1RQ7A 3FRJA 3TGPA 4ENSA 3IESA 4DCGA 3QX7A 1E1KA 1YK1A 3FKIL 2D6FA 1AKVA 4FHGA 2VRWA 3I2HA 4KKVA 2AJLI 2QTFA 1D03A 1U2GA 5ARCA 4X6YA 1U2TA 2V7QD 3B9QA 3F9CA 4Y2TA 3ZXUB 2C1EA 3AM4A 4YPOA 1S2LA 3WQHA 1Z12A 3HLYA 3KLBA 2Q3DA 4HD8A 4YAEA 3FBTA 3WSWA 2MWMA 4QEDA 2O3TA 3ZZNA 4ESVA 3JYLA 3N7UA 3PICA 1TMGE 4RJLA 5AVRA 1SN7A 3TL3A 1AH2A 2FPPB 2WM2A 1K0UA 1RRMA 3V4FA 3W4KA 4AG6A 4E21A 2XCSB 1JT2A 1X13A 2V6GA 3U40A 3FWHA 3T5AA 1W4RA 3OY7A 2AMFA 1VJ1A 2RGWA 3KHSA 1RWWA 4PU0A 3LT1A 1E2DA 2AVDA 2MSWA 3TBKA 1JKXA 3MUNA 2ODWA 2DWOA 2OESA 3EIUA 2HUPA 1X38A 2P11A 3KYVA 1DQZA 4NPCA 4YN3A 1KKLA 3NCHA 1FDSA 4EEXA 4YUZA 3A2LA 4YCLA 1JFTA 4K81B 4ZZ1A 1K3TA 2DWQA 1XT6A 2C98A 1IVSA 5EVCA 3HWX1 3WQQA 4CMAA 4Z1OA 2CKDA 4JXJA 5A1TA 2EGHA 5JNUA 1JH8A 2GK3A 3GARA 1Z4KA 4Y0VA 3O1IC 1AN9A 1NW7A 5I9BA 5C18A 4IIVA 3MGBA 2RE8A 1AOXA 1XFDA 4IHJB 3MT9A 2D2IA 3WNCA 3FMIA 2YKGA 3HA2A 4P4SA 3MPUA 5FR1A 1ZJ4A 3SXJA 3OZ7A 2BP7A 5ELLA 1OFVA 3A9CA 4KX3A 5AW4A 4LBYA 5BV8A 1SK9A 4D46A 2E4VA 1PFQA 2C2GA 1Y4ZA 4Q4JA 3TLXA 1NVVQ 1Y1KE 1LV7A 3SQXA 5JECA 2BBSA 3WO0A 1DKUA 2P35A 4YWMA 4V02A 3KZXA 1RZRA 1SBCA 2O0LA 4IICA 2QR5A 1IW7D 1TU4A 4Z4CA 1EWRA 4DTCA 5JH7A 2HSJA 3W8DA 3H9CA 4JJKA 2FWBA 2J9YB 3ZJUA 5EFZA 3FF1A 1XTTA 1JFVA 1A7JA 1UBSB 1TWCL 1Z2NX 2B7BA 3E27A 3QVGB 4ZAZA 4DHEA 4F4HA 1JKJA 4ZO9A 3SQNA 4AJOA 3R6TA 4FR2A 4CMEC 4ENPA 4DNXA 3LLVA 1IFXA 3LWRB 2EYUA 2ERSA 2ODAA 2QYOA 4HGQA 4DQDA 1IDOA 3OEHD 1J21A 1VG9B 2F3QA 1VKZA 1KVTA 2FN7A 3FVTA 3ICVA 3N2KA 3OJFA 1SRQA 1N57A 2CXTA 4YRZA 3PQ6A 2PH3A 1EP3B 1QC5A 1EFUA 2QJWA 1ZGJA 2XNDD