5MGNA

Human sirt6 in complex with activator ubcs38
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mgnA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mgnA01
1M2KA 4R8MA 3K35A 4RJJA 4JUCA 4BV3A 1ICIA 4QELA 2EZTA 3D81A 5D7NA 1MA3A 2OD9A 1U31A 2DJIA 2VK4A 2Q28A 4GM1A 4JU8A 4FVTA 4BV2A 1BFDA 4RMHA 2JI7A 1XLTC 1E3TA 4MPJA 1V5GA 4X3PA 1YTLA 4FEEA 1Z8NA 1PO7A 2VK8A 1PNOA 4KXQA 1V5FA 4BVHA 3HWX1 1MCZA 2VBIA 5IMSA 4J1TC 4JSRA 2UZ1A 1OZFA 2OO5C 3IAEA 4GP9A 4JU9A 3E9YA 1UPAA 1UPCA 1S5PA 1T9DA 1EFVA 1V5EA 2H2HA 4F4UA 1OZHA 1PTJC 4RMIA 4JUBA 1ZPDA 2AG0A 3PKJA 3D7KA 1UPBA 5MFPA 4F56A 4IG9A 4UTVA 2FR8C 4KPUA 2EZUA 3CLRD 3OE1A 1POWA 4KGDA 1SZDA 4MPPA 2VBFA 4JUAA 4ZP1A 4MZXA 5EJ5A 1YC5A 5K3SA 2NXWA 1D4OA 2IHTA 4BN5A 4Q9DA 1EFPA 4FZ3A 2VJYA 3FSJX 1YBHA 4HDAA 4C7BA 2H4HA 1HZZC 2AG1A 4UTXA 4COKA 4UUBA 2V3WA 3LQ1A 2PANA 4IAOA 4UU7A 5K2OA 4TWJA 4JT9A 1M2NA 2IHUA 2JLCA 3RIYA 1M2GA 2X7JA 1S7GA 4X3OA 2Q5JA 3GLRA 2A1TR 4FEGA 2NYRA 1T9AA 3GLTA 1NM5C 5EJ6A 1PYDA 4MQ5A 4BVFA 1OVMA 2VBGA 3PDHA 4Y6LA 1YI0A 3F6BX 5BWLA 5DGDA 4J16C 1J8FA 4GG1A 2JLAA 4MPRA 4L3OA 5EJ9A 4L2IA 1PNQA 5BWOA 5DEIA 2EZ8A 2UZ1B 2HJHA 3D4BA 1PI3A 4ZZIA 4GM4A 3EY9A 4RMJA 4I5IA 1YI1A 2IHVA 2QQGA 1OZGA 1QPBA 3U3DA 2H4JA 5EJ8A 1N0HA 2H2IA 2BRUC 4UUAA 2JI9A 4GM0A 4K9LA 3ZGVA 2H2FA 1Q6ZA 3CLSD 3F6EX 4D5EA 2H2GA 4BVGA 4V1CI 4JD5A 4TWIA 1Y9DA 2WVGA 5EJMA 2Q27A 5K6TA 3ZG6A 1POXA 4G1CA 4K9NA 5BWNA 4BVBA 4QPZA 2PGOA 2Q29A 2OD2A 5EJ7A 4K9KA 1U28C 4V1CA 2B4YA 2WVAA 4QQ8A 5MFZA 4JUDX 5FEMA 2H2DA 2H59A 4O8ZA 1M2HA 4BVEA 4RJKA 1T9BA 3ZGOA 2W93A 4BUZA 1YHYA 4K9MA 5EJ4A 2H4FA 1PVDA 4JT8A 1M2JA 2JIBA 4K9QA 2PGNA 3CLUD 4C78A 3JWPA 2FN3A 1PT9A 2OORC 4UTNA 3RIGA 3CF4G 2OD7A 3EA4A 2QQFA 3FLMA 1JSCA 4K9OA 4IF6A 1YHZA 2Q5QA 1Q17A 4RJIA 2C31A 5DGTA 2JI6A 1YNOA 1O97D 5EJAA 1U2GC 1Q14A 4K9PA 1Q1AA 4UU8A 3U31A 4GPEA 1U2DC 5K6RA 4JUFA 4UTZA 1T9CA 2A1UA 5MGNA 4UTRA 1DJLA 3GLSA 2EZ4A 2FWNA 1O96B 5FYQA 3GLUA 2JI8A 3CLTD 3HWWA 4Y6OA 3FZNA 2Q5OA 3IAFA 4BN4A 2WVHA 2FSVC 3JR3A 3PKIA 2VK1A 3EYAA 4Y6QA 5AHKA 5MF6A 2FRDC 2EZ9A 1YC2A 4HD8A 1SZCA 4D5GA 2Q5LA 4RMGA 4V1CB
chains in the Genus database with same CATH superfamily
2H5JA 4JJEA 5JDIC 3EVFA 3KXKA 5JAMA 3DBRA 4LXHA 3BGSA 5C1IA 2UVDA 3C70A 3EB9A 4B8ZA 3HKDA 2OG2A 3WOHA 5A03A 3PFCA 1NWHA 4MUHA 1PF7E 2BSAA 5E4TA 1E2BA 3I9FA 4N7MA 5CXXA 4ZICA 2OO3A 4C87A 1RWVA 1GVNB 3N0WA 4J9UE 1JH8A 2QMEA 3H5WA 3WHKA 4BFWA 4AKIA 3B3FA 3WGKA 1TMGE 2XF2A 4G4GA 4OX9B 1C7IA 1MA3A 5HJEA 5DGCA 1IM8A 4NBRA 4JS0A 1HRKA 3O94A 3I5XA 1IVNA 2PFGA 4AZTA 1Z13A 2GLUA 2LDBA 4UU1A 4YRZA 1Y98A 4U2CA 1HORA 2AFRA 2IU4A 1ST3A 3RV3A 4TZKA 1TVKB 2QJRA 3TW6A 3WRYA 3IEXA 1MQAA 2QT0A 3TL6A 2HWWA 5MN4A 5C8YF 3KYBA 4Y6PA 1SXPA 3KNZA 1NR1A 4MW9A 2ZSFA 3WLFA 1UJ6A 2C9YA 2ZRAA 1KRWA 3RIHA 1HBJA 1I4OA 4M1KA 1SB8A 4F12A 5KYUB 1PCXA 1E3TA 1Z33A 2P7IA 2EY4E 4EUFA 2IHNA 5A05A 3TZ6A 1A1SA 2C1EA 2JVIA 4ERXA 1FUUA 5T7BA 2E1RA 1LTHR 3TAUA 4BO7A 3FCOA 5CX1B 4FLEA 4E88A 4FS8A 3WGGA 1LI7A 3O8OB 3F3KA 3U2QA 1V6SA 5EUQB 4F04A 5A0TA 4QGAA 2H8KA 4G1FA 5CT6A 2IHJA 2JAPA 1OBFO 3DOCA 1O54A 2ZI5A 3GMDA 2V4ZA 4BVHA 5K0FA 5H02A 2PAAA 1LD3A 3SYLA 3CUTA 3TZBA 4C4PA 3ZZNA 1KK2A 3PGVA 5DW3A 2BKEA 1HLDA 3REQA 1AMNA 3QBVA 2K2DA 3KLBA 4LJ5A 1B76A 1ZC3A 3IEKA 4JU9A 3WOVA 4CM6A 1DKLA 4C7VA 5HWSA 1T9QA 5GZ1A 3NTXA 4RW0A 2XT0A 3SF8B 4DV7B 4GL2A 2H0AA 2V58A 2ONCA 1MIOA 3LX6A 3W5SA 1V8PA 2X9NA 4II7A 5AM0A 1W5TA 1G5IA 1CG6A 1ZH4A 2C97A 4Y2TA 5M5BA 4UAUA 1YJ5A 3K1ZA 3AONB 4ZJYA 3EXEA 3PJEA 3UW3A 4RMIA 2B8WA 2OP1A 4LFAB 1MO2A 2VH1A 4K7JA 3PXGA 1VG1A 1FDVA 1XQXA 5M34A 1J9EA 4PLWA 3K0AA 3D3KA 4JZYA 1DZIA 1PW5A 2J30A 2V1XA 3SZUA 3VNBA 2A0YA 2H5EA 4L4RA 3R24A 4LC0A 3I9LA 4GVLA 4MIYA 1AMOA 3G6KA 3CCBA 3O26A 1J9GA 3GUUA 3NTLA 1XHLA 2IOYA 3HJAA 3GLIA 4E2WA 1JLLB 2ECOA 2XCOA 4QYIA 2O48X 3EF3A 5DMXA 4I9HA 4FCWA 2IH5A 4AHYA 2Y8EA 1KARA 3T1QA 1QMGA 2WB2A 1AURA 3WRVA 2ZJYA 1XIVA 3ZYZA 5CA1A 3IQDB 3DEZA 5F1OA 4OCZA 5AKYA 1QRSA 5HHTA 3IQEA 4OQEA 4I46A 1ODSA 4WRRA 4DW8A 2CJWA 2FCAA 3H8WA 4FGZA 1UIRA 3OQVA 1GCOA 4KFSA 1ZS9A 4IJKA 4ZT6A 1VPEA 1GAQA 5KVCA 5AI5A 4PHGA 1SVLA 3HP4A 4DJ5X 5HIMA 3BQMB 5DX8A 4DDTA 1H1DA 1JEYB 3KKZA 1XPJA 3TTSA 4DNXA 1R4NB 2VJYA 5JUWA 1XTIA 2SKDA 3FNEA 2NO1A 4MCAA 3WFIA 3T5PA 3W7VA 3WC4A 1O9BA 1JS1X 1X7YA 2WYOA 3NPAA 4JVLA 2W2KA 4QICA 5JXIA 2XE4A 5H9WA 1R16A 1U9YA 1NR5A 2P0EA 4ZCQA 2AOTB 2FW8A 1NXWA 5JS6A 1OKKA 3P71T 2XQGA 3KUCA 1Z17A 3PGJA 1MFPA 1N4DA 3WGLA 2J5BA 2XTJA 1QXSA 3FBTA 5CYPA 4FM9A 3OOHA 4MJ7A 4QOSA 3GFPA 3BBPA 5KNLA 3G9XA 1X1CA 3QFSA 1OBHA 3NX4A 5DYTA 4OHZA 2JFQA 1A8HA 2DOKA 2QYHA 5BSWA 5JFGA 4NDAA 4ALJA 5JPIA 1TM4E 4LMAA 1NPYA 2C2GA 3BZBA 3GJYA 4F6RB 4FYMA 2C8LA 4XWAA 3S2YA 1O7JA 1PGJA 4XQ0A 4JMPA 3FPJA 4G0MA 3SIXA 3KYDA 4H3VA 2ABWA 2DC1A 4EYKA 4TWJA 4AY5A 1OAAA 3CR3C 1ORTA 4C06A 2XGOA 3CG4A 3MLBA 4ICIA 5SYAA 2NQ8A 4A82A 1E2EA 4GVPA 1O08A 1Z34A 2IHUA 2LTAA 4IXTA 3F6CA 1OBCA 3TO5A 1DWQA 5ERXA 1FF9A 2VYCA 1XA3A 3T5CA 4WBNF 3CLHA 5AJXA 1XA4A 1EFRA 4OHUA 5FULA 3ZWYA 3WX0A 1D6SA 4RIGA 1JDUA 5D2CA 1GKYA 2OZLB 1F17A 2OV1A 3VNVA 1TYZA 1ATIA 2ISSD 2ZUSA 3GEMA 3EDRA 4DSAA 4ZYZA 4IDHA 5IHXA 4C3VA 3PB3A 3ILHA 1U0EA 3SBEA 3DHYA 2AOUA 2HRZA 3B89A 2BE5D 1U80A 3DKVA 5J4VA 3ESQA 2GCOA 2B25A 3WLMA 4RKWA 5HUHA 1ISIA 1UJMA 3SIRA 1A9ZA 1CZOA 1E1NA 1C80A 1FDWA 1TIBA 3I76A 1IFXA 4WADA 5DM2A 2F3TA 3DTVB 3LWZA 4U7GA 2Q0QA 4BGUA 1FFYA 2VHYA 4DG5A 3IT2A 3F98A 2LZ0A 4JENA 5AKJA 2QZ4A 1A9RA 1RJGA 2PLWA 3ABSB 4JA0A 1R0BA 4WXHA 4AYXA 4BEJA 5CB6A 4X65B 5FLXA 4Z2YA 5ANRB 2HPZA 1XDUA 3BDVA 3CGWA 1YK0A 1M75A 5DYWA 2XDQB 3MTQA 2HT1A 3UW1A 1AHHA 5I3ZA 4LZOA 4WLFA 4IZHA 4N3NA 4V196 3L1JA 4C5BA 4FFLA 5BWLA 5HOEA 2ODAA 3ESDA 4LI3X 1HA3A 4F3KA 1XZPA 1IBKB 4KNYA 4Z4QA 1N0IA 3C6MA 1LV7A 4OU5A 2YMLA 4QDTA 4ND6A 1HF3A 3AVQA 4ZWNA 2YZGA 4IW3B 3LVFO 3M4XA 1CS4C 4UZEA 3PT5A 5LP1A 3I62A 1X9IA 5KI6A 2EZ8A 2FKNA 4CLHA 1NVBA 8AT1A 1DBQA 2UYGA 4OFZA 4UBOA 1R0YA 3NHPA 4JYCA 3VKVA 2DWUA 2R6GA 4H1VA 4DREA 2FQWA 3I01A 1KEPA 2Y4NA 3DV2A 4V0MA 4BKQA 4F46A 4I5IA 4DAOA 3ZNOA 1EBFA 3NS7A 4OTZA 3UGJA 1PZGA 1FDSA 3IPLA 5C44L 5C7OO 2D1YA 2CKDA 2J07A 3EOBI 2LDXA 2XADA 3KKEA 4HLUC 3WK7A 3FMIA 3F6RA 4JI0B 4LZWA 1T8PA 2VHQA 2F3PA 3B2QA 5TQ2A 4F4FA 3KSUA 2OCKA 4HN4B 4DIMA 3EXAA 2H4JA 4R1LA 5TGTA 1ORIA 4DC9A 3RAEC 3IP8A 3SXUB 1Z4PX 2JI9A 4HGNA 4O4IB 3N0VA 3CZ9A 5LZ7A 4KPEC 4NOMA 1TYEB 1OREA 4YJ2B 3IKJA 1LF0A 4Y2XA 4LOAA 3R3YA 1TKCA 1PGOA 1U7DA 5K20A 5FTMA 4LYDA 3UAZA 3I3SR 4XEHA 2BL4A 5BOSA 2RK4A 4W7IA 4XFKA 2JIPA 3SNHA 4OXNA 5DM0A 4JD5A 5JISA 3ESZA 4AM8A 4YRKA 3LGAA 4FHDA 2LD4A 1GG5A 1O96A 2ROQA 4WUVA 4Z7QB 5KNCH 2ZITA 1HT2E 3ZWDA 2ORED 3GJ8A 3C48A 4FW9A 4J0JA 4LQDA 1PVVA 2HCJB 2M1XA 1KK3A 4I99A 4IBOA 4NWIA 3ZIAD 3D3WA 3QNWA 3I05A 4G0NA 1KO5A 2CLDX 4KAJA 3COJA 3JVVA 1XCJA 3QEKA 2MDTA 2FPPB 1POXA 5GQSA 3LCRA 3UO8B 1KYWA 4C0QC 4LYFA 4IZIA 2J9UB 1TQHA 1DG1G 2AG8A 1YDGA 3CBGA 3H4VA 4KQIA 3K96A 5IM5A 1EVQA 3CPEA 3RT9A 1BKSB 3OWHA 2DWQA 4IJWA 4EM6A 2DPXA 3DZKA 1RXYA 4NMWA 1H8HA 2ONYA 2CV1A 4TMKA 1I32A 4IEIA 1M6EX 3E9DA 3LCJA 1VYTA 3DMTC 4PLTA 5IY0A 3SZRA 1JDVA 4BXOA 2GCNA 1MAVA 1S8AA 3JV7A 5IAJA 2C2ZA 1ABBA 4RDCA 1KORA 4XQ9A 5EUCA 2MSWA 3T3PB 2RHRA 3HJYB 2AXNA 3ET5A 2FP4A 3Q3HA 2GM5A 3TEFA 3WWEA 4CF3A 4IUYA 1DUSA 5CNMA 1QCZA 1D09A 5AICA 2I0FA 3T0FA 1RI1A 5B3JA 4R2WA 3N5CA 1W4LA 2HMAA 1P3DA 1YZFA 4NU5A 3WYNA 4F2DA 1CE8B 4FFOA 5TMEA 1MV8A 2D4HA 4GRDA 4XWWA 4NYIQ 2ZETA 4U9IS 5CLIA 2FEXA 3H42B 3WFJA 3VO1A 1BS2A 2JGKA 1IB0A 2H59A 4Q47A 4O8ZA 1OMOA 2VZEA 3K73O 2ENUA 3VC1A 4KQXA 2IE8A 3EQ9A 4NZYA 3THYB 1MFZA 2P7HA 2Q3CA 4KMRA 2W4MA 1FYEA 2ZATA 2W93A 3QENA 3QFHA 4B44A 4DVGA 4B3RB 4K9MA 5TPWB 3QE4A 2QUBA 4P7GA 3GT4A 3A2LA 3PGXA 1W1UA 1XLUA 3VJRA 1IUKA 4DCGA 3LOUA 3UC9A 3LDHA 4L5JA 2O7SA 5ULLA 3QEOA 3LF1A 2W2NA 2WP0A 3LUDA 1B7GO 1CIJA 1JFFB 1WXIA 1X3SA 1Z5PA 2RHTA 3ADPA 4UUQA 3UJNA 3A9RA 3R6DA 4HBGA 1V8FA 5DTJA 1K3FA 4RA9B 5JS2A 4CM3A 2ZWIA 4XUDA 5EWJA 1SHUX 2BGKA 5A5DA 1KY2A 1JQ5A 3P97A 4J4BA 2PBRA 1H2RS 4N1AA 2HAEA 3UJBA 4DLNA 2GKSA 3RVBA 1M1XB 2VIIA 3KOZA 4BFUA 3HUFA 5A0VA 2H51A 2J9ZB 5ALYA 2O07A 4AF7A 1A98A 1IY2A 3EN0A 4FMPA 4BWGA 2YUIA 5ECGC 4HWTA 1LKOA 4ISBA 1VG8A 1ONSA 1XQ6A 4Z9XA 5D3QA 4X93A 1WF3A 1YZYA 4JQYA 4EHBA 4DRYA 1T4DA 1ZH2A 4M9CA 2FH5B 1N78A 2KQUA 4MUAA 3QWHA 5J2UA 3PFKA 1TGYA 1E69A 5BV8A 1U0JA 4JJ4A 4EATA 3H0GL 3CZQA 5AK0A 1EWVA 5EIAA 1GRVA 1KKLA 2FJUA 3JQGB 3UXMA 1QX4A 2JA2A 4E1AA 3FWYA 4KREA 2AV6A 3BS4A 3E48A 2COUA 1MEOA 3A3OA 3FTNA 2WUEA 4NEQA 1MF7A 2FPXA 3AEQA 1E9BA 4IFEA 2HJRA 3KAPA 4IOJA 3BH0A 1H4QA 4C4YA 4FFRA 3AUUA 4JVSB 4JLWA 4WFKA 1L3BA 1ZSVA 3KB8A 2PRSA 4AU1A 4A2QA 2W8BB 4ZIRA 3CCFA 3H2IA 4X44A 4OUDA 4CDGA 1FFAA 1L5HB 1GU1A 1QIMA 1HDCA 2QUHA 4I1SA 3V42A 2P6UA 1K8QA 1KZ7B 4C22A 2WG1A 2O54A 3O5AA 1Z16A 4I4TA 2CVFA 3K0CC 4UPEA 1M10A 2JLWA 2FWIA 4B5KA 1FS4A 3LP6A 3H9EO 2NTNA 2WF9A 2I9KA 4C08A 5FBHA 2YHSA 5AO9A 5T3UA 4D9HA 3DOIA 3MLAA 4FDLA 5LKAA 1U0FA 2V4MA 3AIOA 4HDSB 2XD4A 5D1NA 4A2WA 3KAKA 1ODHA 3LKVA 2P9JA 3T7AA 3TIXB 3LQKA 1J99A 3FZYA 4DFDA 5LP6B 1T1SA 4HRAA 4PGGA 4AHZA 1VZ3A 3DS8A 4L57A 3WGJA 4GVXA 1GPMA 4TLBA 1QO0A 1YA4A 2IHYA 5U9CA 5CDFA 1TZBA 3A1DA 3GLGB 1L9KA 3G02A 4B5LA 1CUXA 2YC2C 1AKEA 2PQ2A 1K7FB 3BWBA 5TC4A 4BN4A 3LLSA 5F23A 4V3CA 5KNBA 4OUKX 4WLVA 1ZKDA 2P8SA 4L02A 1OAKA 2BEVB 1O77A 3CUEF 3OMWA 1CQIA 2VK1A 1QVWA 1ADGA 1VKOA 1BS1A 2ZTMA 4P86A 2GXUA 2GRJA 3MT9A 4OB6A 1YS2X 2EOAA 2KJQA 1LWOA 1JDBC 1XCMA 2CVHA 2WJZB 5ECWA 3O9VA 4X3CA 3VJKA 4DXDA 4QOGA 5BR4A 3DV9A 4XPIA 4GOMD 5F33A 3UK1A 1PV2A 4B75A 4LA4A 1BS9A 1FSGA 4RGVA 1YE3A 2RJ3A 3ZY6A 4F3YA 3EVZA 5E6RA 1HKHA 2HTFA 4O4JF 2OA0A 3I1YA 3QLVC 3U0VA 4OJQA 1NUSA 2HMTA 2WIBA 4JJ6A 1C41A 2PUHA 2JFZA 5C7YA 1L4LA 3S8EA 421PA 4KLZA 4XX0B 3WBKA 3LL4A 4D43A 3E2IA 3EG9B 3AEKA 1LQUA 4Q9KA 1HNWB 3PTZA 2F3UA 1ML4A 4LXYA 1YQDA 4A23A 2OBFA 2P2CA 4B6OA 1JHMA 4CGYA 4D98A 5AI9A 2K5UA 2GYWA 3NYQA 4J3JA 1ORHA 4RFSB 2XE6A 2AXEA 2DZDA 3A9CA 3VYSB 4QKQA 1P5HA 1T1IA 2BGNA 3Q9SA 2EW1A 2IKSA 3FKSD 1SU7A 4G4SO 4MB0A 4QDOA 1FMTA 2HF8A 4O59O 1NVXQ 3E5MA 3I6ZA 3ZGZA 4YLYA 4GSKA 1K6EA 2HRQA 2QIOA 1XCBA 4D8WA 4QLOA 1FJXA 4M8LA 3E3AA 4E6PA 1GPNA 4DMKA 3EAFA 3JQ8A 1UMDA 1CUDA 16PKA 3NEJA 3O9ZA 4OBXA 3CEJA 5GVSA 3VU9B 4DLPA 3CRZA 5BRAA 4I5EA 1J8VA 1P2SA 2HZ7A 1T13A 3RYHB 4ZMBA 4B4DA 3B3JA 3RF7A 2ZBEA 3V8NA 3WB9A 1N92A 4BV2A 4CDNA 3OM8A 5JPDA 3BWXA 5T57A 2WQ6A 3B5JA 4ZO9A 1L8AA 2P6MA 3VYWA 4CV0A 2JI7A 2VUUA 3QUBA 2PKRA 4MLPA 3EDQA 2JGIA 4TL6A 3CB4A 2X0KA 3COSA 1VIDA 3OUZA 4MQFB 4MPJA 4I9NA 4EGCB 3WLRA 2J45A 2L0ZA 1LF5A 1K97A 3QPVA 4JDPA 1OIXA 4KQ2A 4JK3A 5AUQA 3SLGA 1Y4DE 2VHZA 3AESA 1XDGA 3GFBA 3QPBA 4FHZA 2YNMC 3RAPR 1IMOA 1G41A 3I01M 2DBVO 3ZCTA 1WHSB 5TMPA 2FOXA 4BCCA 5TGZA 5E1BA 2QS9A 4LRSB 1CY4A 5KAMA 4X8OA 5ELXA 4MV3A 1DAKA 2NVBA 1QR6A 5GADc 3L8FA 4BC0A 1B1AA 5ER9A 3I9NA 3BH6A 1R50A 4N3BA 1BX3A 2ZPTX 2A88A 3G89A 4JIMA 1G2QA 4RKEA 4YRSA 1OFUA 3G17A 4C0HA 2HHCA 1JIXA 3AINA 4LZJA 2C95A 1IWOA 2VF4X 3MQ2A 2PMCA 3G0HA 1DXQA 3HN2A 1QYXA 2E5FA 1IHXA 4A0SA 2V4UA 3RIMA 3TLBA 1BXGB 3BXHA 1ECPA 1IM5A 4JQCA 2W2QA 2ZAMA 2CL0X 3CMMA 4G6BA 4K87A 1NBMA 2MSNA 2QYSA 4U7WA 1Z0FA 4H31A 3ZKWA 5BORA 1U6JA 4EX7A 5DNEA 1AZTA 4HEJA 4ZARA 2WZQA 1KDPA 4LYHA 2C7RA 2DLCX 1V5EA 5CAEB 2DJ5A 3S68A 4AYBP 3TK1A 4ZXPA 4YCCA 2WTAA 1SD2A 3CEAA 3K32A 3LVQE 2XB8A 4FSXA 3TLMA 4X8LA 5FO0A 1VCNA 1KQ3A 3WSTA 1UFRA 2EIXA 2FE1A 3B85A 5EA2A 2NU8B 1GR1A 2DBRA 3QELB 5DE3A 3LPEB 3DKRA 2QN2A 2VDWA 3MC1A 4RACA 5K0TA 3UUGA 1PQPA 3NIDB 2BJHA 4L4ZA 4BLUA 2HC9A 5REQB 1SG9A 2XA2A 5T4BA 3UAWA 4Q7MB 3UJ9A 5U4QA 3V8EA 3UT6A 1M8GA 5K9ZA 3I1FA 3IEIA 4LJLA 1ZQ1A 3RC7A 3W7AA 2JGNA 4LG1A 3GRCA 3MEQA 1H65A 2G08A 2O7VA 1OPXA 3HGTA 3LG2A 5L3QA 1K7SN 1UT5A 3IVCA 4POOA 3UUFA 3L40A 2GLTA 5FOTA 2QE6A 3SF0A 3LE8A 4BJHB 2ZIEA 3FG9A 4HEA1 3O74A 4AECA 2C9DA 1H7VA 1BW9B 3HL0A 4GR5A 4IM7A 4NI5A 4QA9A 4ZPJA 1NP3A 1RWPA 4Q16A 1DTWA 5BNZA 1ENZA 3PC8A 4OIFA 1X77A 4C30A 4MO2A 2EF0A 4QNMA 4UW9A 4Q1CA 4A3SA 1Q7CA 3UUEA 2EFYA 1UODA 3KO8A 4FDMA 1WB6A 3CVOA 2BTQB 3UJHA 3FCCA 1YS1X 2ZZKA 2BY4A 1YU9A 3BWMA 3L7BA 4D57A 4G8DA 1V1MB 5BN4A 4AJEA 5KC8A 4PM4A 1BXRB 2KMLA 3E9CA 1KJZA 1BXKA 1B41A 2WTMA 1V7ZA 2O14A 2PXAA 1GY8A 1WDMA 1J0DA 3KD2A 3K7EA 3VMMA 2X9LA 4BE4A 3RWBA 1E7QA 4JLSA 1Z5UA 4AI0A 2FWAA 3I9V6 3MJVA 4HGRA 4N7BA 2E89A 3FYHA 1EAYA 3P27A 3UAOA 3WZLA 3ZU2A 1T5HX 1P0MA 1T34A 2H4WA 4RA6B 2ILVA 2ZJ3A 3AFMA 2A67A 2JAQA 3DC7A 3LYHA 4DA8A 4C2UA 1A9SA 3V8QA 1MXHA 3CNEA 5IBPA 3SS9X 4F4DA 1UJBA 2FMIA 5AI2A 1Y1RA 2PL1A 3BD9A 5EINA 3DEFA 3VOTA 4G25A 2QBYA 4Q7QA 1Z36A 3HKEB 4EK9A 1A9PA 2JLBA 4ZCMA 3OY7A 1E1DA 3SEZA 1X8JA 4L74A 3WY9A 1IYZA 1Z75A 2PLAA 4W7SA 3TR0A 4CIDA 1T8SA 3A6JA 1XWIA 2Y1EA 4KE6A 4E08A 4POFA 4DKXA 3DUFB 1JEQA 3PC6A 3OOYA 4QHYA 5IKMA 1OKKD 1WAMA 2GZHA 2JFGA 3GNLA 3FWZA 5JAQA 2JCVA 3E7DA 3L4JA 2WHXA 1NXPA 3L7OA 4JLVA 2J9FA 5DX1A 2NQ2C 1GZSA 3S6JA 1GUAA 3AOEA 2VUTA 3M1AA 4FYJA 4INZA 5ENZA 3MA0A 3AW9A 3MN1A 2CHVA 1NP7A 2Z2JA 4K9RA 1E61A 1YZNA 4NG5A 3W6ZA 4FEGA 3T5BA 1PVOA 1NP6A 4FHGA 4CF5A 4BEBA 4Y1RB 3I04A 2VT2A 1SA0B 3G7SA 3E15A 2M1ZA 4FBGA 3V6LA 4TMWA 1G6Q1 4KMMA 3IAM1 3OJXA 5CT9A 1MAAA 3GGJA 4A10A 1CJTC 1ZIPA 4YLGA 5KVQA 1DIAA 3HJRA 3L8EA 4NK4A 4KX3A 3KT0A 4IS2A 4MQEB 2W6OA 1MHPA 5J2TB 5IVPA 5L3VA 1DIOB 2V6MA 1EFRD 2GEJA 3BXEA 3CKYA 3IE0A 2I03A 4K26A 4E5SA 3LH5A 5FV7A 4AO7A 4OBBA 1U9ZA 2YJ6A 1MNAA 4F9FA 3IBCA 5DGDA 1WVMA 2R47A 4HB4A 5CPBA 1LDGA 1J8FA 2OP0A 5LVAA 2J9XB 3COYA 5AT1A 1E3MA 1G8YA 4GEKA 3R3HA 3BD8A 2IDMA 2WTNA 5BXQC 4Q4AB 1E3QA 1J90A 4MS3A 2A6PA 4XM0A 2IX3A 1E8DA 2E37A 3D3EA 3H86A 1E2GA 1FSSA 1LLUA 3EMVA 1DINA 3UWPA 4J16A 1JEAA 3V46A 3CZCA 4N01A 2WM3A 1QCDA 1PG0A 1A1VA 1E7SA 4M86A 4ZAGA 4FI3F 2GKGA 1E0AA 3D7SA 1UDBA 3FVTA 2GJSA 5D5PA 5F64A 3TIFA 1JR3E 1V8OA 3E9QA 4YR9A 3TLEA 2VNIA 3RJTA 1KMCA 4IIJA 1VKZA 4IQ0A 3UB3A 3TECE 1RQ2A 1NN1A 4W1RA 5D5HA 5EHNA 2HYIC 1QYBA 5AXBA 4Y1GA 1GDHA 5LP6C 5DF1A 4OMFG 1G291 5IASA 3OHMA 3ZI0A 3LFTA 1L3CA 1IHPA 1WF6A 4JLJA 3SSOA 1KQPA 1LLFA 3A28A 5FNZA 3V7WA 5K09A 3NIBA 1BEUB 4P98A 4D5EA 2D1FA 2HRRA 2VNJA 4NAHA 4S12A 1UR5A 5FT9A 2OILA 5IXSA 3N75A 3TDKA 3WGZA 4PQGA 3OQIB 4WQMA 5DPMA 2YXLA 3MTGA 3SFVA 3AR9A 1CUUA 1JJAA 3IP1A 3N2KA 1D0IA 1H0SA 3VR5A 1GRRA 1ENPA 3ROMA 3WNZA 1F9EA 1SUSA 1O0CA 2CDRA 3MS7A 4UBLA 3PDUA 2RC6A 3A6HA 1AGYA 4I50F 3BJRA 2RDVA 3EMKA 1H2YA 1ZJ6A 4QJ4A 1DPGA 1ADCA 1Z2NX 4OK3A 4REMA 5IAGA 1DC6A 1CUBA 3QEAZ 1E3WB 2O2DA 1EFPB 2RGWA 2ZIVB 1AKQA 3VNUA 2PGOA 2Q5HA 4QPDA 2SECE 4YS6A 3NONA 3S1NL 4C43A 1WPQA 1AUOA 2XUPA 4DDHA 3U5TA 1R18A 1NF8A 2RGUA 1MG0A 1T2CA 1CS0A 2JGLA 1DX9A 4O2BB 2RB5A 5C5CA 2ZT8A 2F9FA 5K4GA 4IDOA 4CGZA 3ZXSA 2H1IA 1TECE 1C3LA 5KNDD 3K1YA 3G79A 4RXMA 3UTDA 4NAUA 3EUAA 5HUJA 1TNDA 4ZHQA 1AZLA 5AMXA 4BO8A 2M6PA 5I7FA 1Z37A 5H4HA 2BV3A 5EZYB 4AZ3B 2DWCA 1U3FA 3FBGA 3G8CA 3PPYA 3HYCA 4MROA 4WVLA 4B87A 4EQ6B 1P7ZA 1IBCA 3MMZA 1QZTA 4LHNA 4AUMA 1SBTA 2OAQ1 2JBAB 2AG6A 1HFJA 3B8HA 3PWSA 3PC4A 1JB9A 4RVNA 3IUJA 1H8HD 1KY4A 3A7DA 3CBQA 1CUJA 5E38A 1OZ0A 5HKKA 3H1FA 4BB9A 2I4MA 4XWYA 4HGOA 1PSZA 1DT5A 2A58A 5I7HA 4RD3A 2WAXA 4C89A 3OFJA 3LDFA 4INOA 2ZDGA 3W06A 4O2AB 3NRBA 4JI3B 2F3QA 4XGIA 2Y05A 5HX7A 3TCXB 4M1OA 4L7QA 4YC7A 2WABA 1JPNA 1PRYA 1T9BA 3O6VA 5T8KC 2OR3A 3UMSA 3RRXA 1JIJA 1TQ8A 4ILEA 4JLNA 4BRWA 1W76A 4DMRA 2WB1P 1QDUA 2OFPA 3DE1X 3OJWA 1VJ1A 3C6YA 4Q3EA 4C6TA 1J20A 1JXMA 4OHBA 2VHCA 4DMCA 3DE5X 3S81A 3M3PA 1Z6ZA 4Y7CA 3T7CA 4F5EA 1WW3A 4C2BA 2AB0A 4GSYA 4M87A 4R98A 4I1RA 4AZ0B 1TIKA 1INLA 4K9QA 1ZGGA 4WDRA 1IXSB 2Q3DA 2O8CA 4AY2A 4HCJA 4C78A 1DEXA 3IDZA 2D2XA 3JSXA 4LDZA 4LF8B 4GXNA 1E2MA 5EQTA 5LXTF 2ZXFA 4J0CA 3IS3A 3B1FA 3SZOA 4KIJA 3E1GA 4DPLA 5IBQA 3R6TA 3LC0A 3OTHA 4FLFA 4WXPA 5B1IA 1H5UA 2D2EA 5KTSA 3KZ1E 4X6LA 4I9UA 4UC0A 5D01A 4R2KA 1GL3A 1XVIA 2HL6A 4MVJI 2D3WA 3KUUA 3P8ZA 3M82A 4IR7A 2PSDA 3AI7A 4ADSG 1SCUA 3PVZA 1YOVA 1NQUA 1KNQA 1OLUA 3E22A 5HTKA 5ICFA 1M8PA 1NPDA 4E4RA 4RKQA 2Z5VA 3O03A 3UM9A 1YXMA 1CYDA 1FMJA 2ZRLA 4C0WA 2IKQA 3L01A 4OSOA 5BNFA 2JFHA 3O4IA 3RZDL 1DFIA 4AG5A 3E82A 2HU8A 2LR0A 3R9XB 1GTJ1 3MD9A 1MT0A 1K8ZB 1WXQA 1L7OA 2O20A 2MS3A 4L8FA 4UE6A 2VRBA 1ODCA 4Q6WA 4Z0HO 1DKQA 5JNVA 1SUCA 4FW8A 2OKCA 2CDCA 4EF6A 1YRLA 3PVCA 4KHPB 1Q1AA 3RS7A 1VMKA 3HI4A 4GI3A 2ZB3A 1A88A 4KHZA 1K92A 3DPIA 2PD6A 3D6JA 2ST1A 5EJFA 3TGWA 4KQMA 4EUHA 4HAWA 4CHTA 5GADl 1AXEA 4CN8A 1Q0PA 1XVVA 4MUMA 1XD2A 1J0XO 4N9QA 2QK4A 3D6HA 4XWOA 2WFAA 5HSGA 4FQ8A 3FPEA 4KDFA 1W9HA 1TU3A 2WD7B 4UEKA 1K68A 5AJVB 2OM2A 1MQSA 4YQEA 1L5LA 1PJAA 2I4OA 3IJ5A 1U1EA 1E58A 1SC3A 2GCPA 2XJRA 1SZPA 4PZUA 3BGIA 3QKIA 3SEFA 3QIAA 3GTPL 4DBLC 4EEKA 4K86A 5FWDA 5K4HA 3H4MA 3QYFA 3C5VA 1PD1A 4E1VA 2JI8A 5F2NA 3QX7A 1O9GA 1WVIA 1V37A 2R6R1 3NHWA 4TV8B 5E1MA 1Y6JA 1YQQA 3ACBA 5AW8A 4MKHA 3VPSA 3CX3A 2APOB 4EJSA 4YAJA 4BEVA 3UQYS 3DDSA 3LW7A 5DYIA 2RI1A 1VIVA 2P1DA 4D6YA 2R8YA 5JQGF 1LTQA 4J6EA 1BKDR 1WUHS 1Z38A 3KEMA 4NJMB 4ML3A 2QY9A 1SPXA 2WVHA 4JBXA 4JLPA 5DN9A 4HDMA 2I2WA 3JR3A 4JZKA 4G5QA 4DSTA 2HKIA 5K6AC 1XZGA 5MN6A 2WUVA 4R3WA 2XLCA 2JARA 3W4JA 3F7TA 5E6UB 5AVJA 4KDRA 3FWPA 5BV2P 2AYYA 3KCNA 1H93A 5MGBA 3ABZA 1VYVA 4PZCA 3VYUB 1H9CA 1QO0D 2QX4A 3IA2A 4BHTA 4YV0A 5I9LA 1HLGA 4RHYA 4HXYA 4W99A 3SJ7A 2XWBF 3DBLA 3LT1A 4DLSA 4QWMA 3OZGA 3I04M 4NCAA 1JHZA 4NICA 4DLLA 5KNBD 2D0OB 2P2GA 3KFLA 1JPUA 3NOQA 1FNNA 1QH1A 1TO2E 4G36A 1G4UR 4M0LA 3WWOA 3D3NA 2YZ7A 4LBWA 1RHQA 3N8DA 4ZA2A 1R74A 4FFBA 3MMXA 5F3RA 2O8BB 1FNBA 1YZVA 3PT9A 4XIJA 1MG5A 2YOFA 4PO3X 3G2LA 2DCMA 4AC9A 3QF4A 4JEUA 2B4QA 3DP7A 4X6UA 3SZLA 5H59A 3T1HB 3CX6A 3FIUA 1T36B 2O3JA 3R6LA 4J0QA 4KMOA 2IZOA 4XPZA 5G1PA 2YVAA 3M2PA 1EX6A 3U7QA 4MW4A 5T6BA 1ZVVA 3TRHA 4KXYA 5FCDA 1P7PA 4Q9HA 2J7PA 4RVOA 3BE8A 3CWCA 1LBEA 4F45A 5A6VA 1SQFA 2C2HA 4NBUA 3ZWNA 1HV8A 2K2WA 1G2PA 1RXWA 3C14C 1XEFA 3FH0A 1IEQA 3GFSA 3HVJA 3JQEA 4HX2A 4L9RA 3JWEA 3UJCA 4BIMA 4CNQA 5ALGA 3GU3A 4BDTA 4W4TA 4ND3A 1LFDB 5FBWB 2PVPA 2DT8A 1BFDA 2X5XA 1PYOA 1YT5A 3OCWA 1P2GA 2F43B 2Y92A 4PPNA 4RLHA 1YB1A 4C3OB 4R8VA 2Q6KA 3OCZA 4Q05A 1ZC4A 3IILA 3GUHA 1AE1A 5AW1A 2X4LA 3AJEA 4FN4A 2FNAA 3GAFA 3S1AB 4GLBA 4O6VA 3DOJA 3PX7A 5HKLA 3AM1A 4JXKA 1E9DA 2MHCA 3EASA 1ZESA 1LC3A 3EOZA 1XHFA 1IUOA 3TN7A 1KL7A 3IOMA 1EGAA 4DR7B 3THWB 4W82A 2PD4A 4FE7A 3QVJA 3PUVA 4ZI2A 4HWPA 5LDGA 3HFGA 2JGDA 4FOTA 1ANKA 1Y3FE 4YCMA 5JDCC 1BTOA 3R5FA 4DV6B 3BREA 2PH7A 1F0PA 1LPMA 1A72A 3KYCA 4HWRA 4YQFA 3TM4A 3ESBA 2EYQA 2RG1A 1PQYA 1HDRA 1H5NA 1NFQA 1NMEA 4NYMQ 4TTVA 2CZQA 3MQKB 3W1WA 5DI3A 2PIAA 1K63A 2ZJ2A 1UJ5A 2HCRA 3ESCA 1OTYA 2EVWX 4NBLA 1U4SA 3QPUA 5K3CA 1B71A 3NANA 4Q9IA 1MR3F 3BMQA 3SQMA 4Y1FA 1Q57A 4EB6B 3PQDA 1NGSA 3X2SA 1EK6A 3AM4A 3U4AA 1D2CA 1AC5A 5HP4A 3N8IA 1T2NA 1DKRA 2CYCA 1IJBA 5ADVA 1VLQA 1TCBA 5JROA 2YOHA 2FN7A 4L5CA 2VG8A 2XUKA 2B63L 5EJGA 3WNVA 1PL8A 2ZBDA 2ZSUA 5JH7F 5KTRA 4Z9AA 2ECFA 2Q4EA 4JP1A 1XBTA 2OCBA 4X6XA 2JLZA 1L6IA 3GJZA 3H1GA 3RBZA 4EUEA 1XGKA 2IOQA 3EC7A 3BL6A 1KDZA 1NBMD 1PDVA 3MK31 1NLZA 3MQFA 2X15A 3ELUA 5I4CA 1SUIA 3GFQA 5B57C 1MVOA 1NOIA 1WZCA 4G0PA 4I36A 4AURA 3P7MA 1I7QB 2LIPA 1T8TA 2YWXA 5FOXA 2KBEA 3WV5A 1PGQA 1ZISA 4OP1A 4BX2A 4E5YA 3S4YA 1SN7A 3DVSX 4LF7B 1Q3TA 1WUTA 1J56A 1QP0A 5FEUA 2FLWA 2G04A 3FLBA 2XSZA 4OLHA 4RGQA 4M9XA 5F21A 1T2DA 1V96A 3K9GA 1JWAB 4QYTA 1KJYA 1E1CA 1H1LB 2GA8A 3P9YA 2RHMA 3NBZC 4LN1A 4LYEA 3RTBA 4EL0A 2BEJA 2WIGA 3AVOA 3HHEA 1XRJA 3D8BA 3DYVA 3MILA 3PQEA 1QHHA 4WNAA 1XZBA 1LKZA 2PV0A 1L5FA 4EYQA 3THRA 4KKVA 3GLFA 1P4RA 4KFTA 3C3PA 3Q85A 3GJXC 3D6FA 3S5JA 1VLZA 1PZNA 4IJQA 5HZKA 5THKA 4H2DA 4PZYA 3E9EA 4TLDA 1PR1A 1SAYA 5FOUA 3RKSA 4G97A 3F71A 2WMDA 1O94D 4YMGA 3R3SA 1FU4A 2WU1A 4Q7JB 3QKSB 4G9GA 3KK0A 5LYJB 3CWZA 4F8YA 1TCVA 2DMRA 3N2ZB 3FCAA 3TIVA 3T1OA 4CDMA 1JSRA 1YA8A 2BR3A 3IQXA 1PUIA 4V3BA 5AJZA 1EA7A 4CKEA 5HK8A 1UK8A 3GGPA 3F2IA 4MVYA 1RS0A 1C30A 2VDPB 2QJFA 1B93A 3G1WA 2B9VA 4UBNA 4FFVA 5IVDA 4P7JA 1CDDA 2RGCA 4IJ5A 2I62A 2C0CA 4JVMA 4RGYA 4D3YA 2XBMA 2GA9A 3DW1X 3E18A 4B4OA 3L82B 3HV2A 1QB7A 4ZI7B 4H6PA 4RXNA 5IYZA 2QMOA 1UQUA 1CQJA 3G85A 1C0EA 3GLRA 4IMPA 4GE0A 4M21A 3WWCA 2JL1A 4Z6KA 1YQTA 4PWYA 5C1DA 3JX9A 4RTMA 2FW7A 2CLIB 2EHJA 3OU6A 3QHAA 4MGIR 4CETA 2GJKA 4W5QA 4RTLA 1H2FA 3ZJ4A 2YW9A 2XECA 3MM4A 2HIMA 2BGUA 1FIUA 4RNCA 3D8TA 3N28A 1MX5A 4YUZA 2J32A 4KPFC 4ECAA 4G4JA 2FZGA 1C8KA 2ZB8A 3F96A 4HGYA 3W05A 2B82A 4X1KA 4Z1MA 4NESA 2J48A 1VJTA 2ATIA 4GXQA 3ETNA 4MYSA 5J5VA 2UYHA 3QA3E 3RVJA 3FJ1A 1YIOA 5G0UA 5E95A 4DC0A 3VMFA 2ZG6A 4DLWA 5IDWA 2M6OA 4JAEA 2H16A 3NWJA 4NU0A 4Y6LA 4KNWA 3R7LA 1ABFA 1VHDA 3B1KA 4AMUA 1PL6A 4CBVA 4HUJA 4CG3A 2ZKLA 4W5TA 4L4UA 1GPJA 1L5ZA 5FOQA 2I4NA 2ZU6A 2FSIA 5GWXA 4LFCB 4FYXA 2JA7L 2IITA 4AF8A 4RL6A 1QH8B 1RIFA 2NXEA 2OCIA 2F1RA 2X6RA 5TB5A 3OIFA 3MRVA 4FS3A 1XN1A 4P7FA 4UNRA 4TVSA 1OY1A 1FRZA 1NW8A 3K7AL 1VRWA 2JFNA 3O21A 4WLNA 3VR6H 2AA3A 3AHDA 3ADDA 4RCZA 3K4PA 3PXEA 3B82A 3VA7A 1OI3A 2AWNA 4CLOA 3JYPA 3Q72A 1C1XB 1CJUC 3C6XA 5G4LA 1E8JA 5CVDA 4AX4A 2DR3A 2XTAA 3G9UA 4AICA 1A9XB 1EWTA 3U3JA 3GZJA 8ADHA 4DKJA 5IRCD 4LOKA 4QGFA 3JVUA 2J41A 4BPRA 2VCYA 4I5GA 2VNSA 2RHBA 1SZJG 1CW2B 2P27A 1P0QA 2P3QA 1YCFA 2Z2IA 2XCTB 4GFDA 3ZDBA 2CZCA 3LHSA 3ZHSA 1ZI6A 4D9MA 4MARA 3NKVA 1NHGA 3BL8A 2EV9A 4Z51A 1K66A 1REQB 2R7MA 4M88A 5L6MB 3JU3A 1U11A 3GA5A 1N0HA 4IO0A 4PXSA 4NFSA 4C7OA 2C84A 2YJNA 2H1RA 1ZSNA 1Y9ZA 2GILA 3KT6A 3QQ5A 2NV0A 1U81A 3IRUA 2JCGA 1UKYA 2FQXA 3R77A 3DJYA 2ZI6A 1BKYA 3GC6A 2HT6A 2NVYL 1MDBA 4IF4A 1H4SA 1E98A 3IDAA 3DEHA 3MINB 5HCNA 2VS1A 4KH0A 5A9SA 3ANYB 5AOBA 2BGMA 3EW7A 3OTWA 4JJAA 4K46A 3U44B 4KYVA 1UJ2A 1CUVA 1TT5B 3CUKA 3M8KA 4OHVA 1NW4A 4QUAA 5HJ2A 1ULSA 2JGAA 4RD2A 1O6CA 1U2TA 2DPMA 3I4FA 4Y9SA 3SYTA 5IAOA 1M2VA 1A4XA 1EQAA 1YVDA 3RKUA 5DDIP 1RI5A 3ELDA 5JWHA 3ELYA 4X64B 2J5QA 1E2QA 2QTCA 2OZVA 3GEDA 2BMVA 5T64A 2WM9B 4B40A 2MINB 2YV2A 3EZYA 5DBOA 3NV7A 4NG4A 2XCRB 1W30A 4FWBA 2NZWA 1VHLA 3RVDA 3F4BA 1ZJZA 4PR0A 1ZRPA 5JG7A 4HDNB 2HA6A 1FYFA 1D2GA 2Q29A 2O8NA 3JQAA 1CULC 3SSNA 5EJ2A 4ZYWA 2VC2B 3C39A 3WGQA 4URXR 3AUJB 1OFVA 4CPDA 5DHRA 3DDOA 1IPEA 2A4MA 2V6BA 5TGDA 3VR5D 1MO3A 4TRMA 4QL3A 5IW8A 1HMPA 4M36A 2GK6A 3IQZA 3L79A 3OJLA 5LBUA 2WZCA 4H9GA 4OMUA 4RHUA 3WIBA 4AN1A 3BVPA 1Q7BA 4P2BA 1GQSA 2GARA 3TG2A 1U28C 1X7ZB 3UFXB 2JFOA 5I9BA 5HQTA 4YAIA 4Q18A 4NZZA 4PSAA 2B2XA 3NJ4A 3RFTA 3AJDA 1Q1EA 3TG8A 2A0XA 2CXOA 1UINA 1ZRHA 5LQSA 4BO3A 3IOEA 2R65A 4LY3A 3HA3A 3DF9A 3EMDA 2PWZA 2QVXX 2AC4A 4NV3A 3V5NA 2PGAA 3HYRA 5LQDA 1TZMA 4IHKA 1M34B 3S1LA 1G1MA 1XTPA 1QE5A 3T99A 1P9WA 3D6AA 4L5YA 4OYLA 1RRPA 4OKSA 4UAGA 5TMDA 4YJ3F 4CVNA 3UBTA 1GNLA 1C29B 4F4CA 3C1OA 1GGEA 2BZ1A 4P22A 1DXOA 1B8UA 4RK0A 7REQB 4LV5B 3E70C 3WYCA 5I8WA 4IIVA 4Q1FA 1M2OA 1XK7A 3LC2O 1PK7A 3DEAA 3WGNA 5KJ6A 1N1GA 3BG5A 1CHDA 3ASYA 3L1HA 2RGDA 2E49A 3BD7A 2DFDA 3UMBA 2J3JA 5ALJA 2W6MA 4PPYA 2C9MA 3EF0A 5FXMA 4F60A 1AB6A 1TFRA 4ENUA 4U63A 1ZUWA 2OYCA 1T35A 3SZ3A 4NYJQ 1PJ8A 3DW3X 3NM5A 2ZYVX 1TLLA 1OJ7A 3OQOA 3JWPA 1GCUA 4IQ8A 5IKOA 1DARA 2HJWA 1DMSA 4B85A 5ISMA 1PT9A 1JKFA 1UXHA 4BCDA 4ZAVA 3M81A 3AIMA 2PBLA 1LPOA 3QKWA 3U3MA 1V8BA 2V3VA 4KXFB 5DX0A 1AUQA 3OU7A 1A3CA 5HMMA 1US8A 2F2TA 4DYVA 2A9KA 4YB8A 1NKSA 3BK2A 1UDAA 1UADA 1LQTA 2X0RA 3OKCA 3OTQA 2WPNA 2Y93A 3OLQA 4M0FA 1YJ8A 1DJOA 5CXSA 3ROQA 2IU3A 4BNLA 5KB3A 4DBLE 4HB0A 4LJRA 3TS1A 2ADMA 2O0KA 1O87A 1SKQA 3P2EA 4O3MA 2CHQA 1VGRA 1ZJJA 1MOZA 3RG2A 1JDNA 3TRDA 5L3RA 1E1RD 1RAAA 1RYZA 2NO4A 4CT4B 3I0ZA 2D00A 4GMXA 3TEJA 2QRGA 3DM9B 4X7RA 3BN3A 4AJPA 4OKIA 1S9DA 4JAFA 3FTCA 3IALA 4BGDA 2BEKA 4JOQA 1ESEA 4EGJA 2OQVA 2LXNA 2EG9A 1E6MA 1NC1A 1LDEA 1L7NA 4IIUA 4H7JA 5T41A 4X63A 2ZBRA 5K45A 1GPDG 5DP1A 3KWLA 2ID7A 2H1VA 3A4MA 2G88A 3GJTA 3QVWA 3VPBE 4LWPA 2J59A 3H05A 3H3JA 4MIOA 4NU8X 2WHRA 3NNNA 3QEMB 4QEKA 4GPEA 2YIMA 2ZCJA 3VVLA 5KOJA 3GGSA 5TNXA 2O59A 4HXGA 4TKVB 1IHOA 3NTRA 1PT5A 2VEDA 3A31A 2WRZA 1UBEA 4R1QA 4UBKA 4DQLA 5JZSA 3WV4A 1XTRA 5HIJA 3FOCA 3EE6A 3I2KA 2A1UA 5MGNA 2WNIA 4II3A 4TM8A 4X41A 4YRCA 2WFZA 3X1WA 2PKYX 1X39A 3EZ2A 3IVMA 3UHFA 4IIFA 1RE1A 1WOYA 2F1OA 2GZ2A 3LYAA 4A0HA 2ZPAA 5KSYA 2DR0A 1T1RA 1ULBA 4C3ZA 4COOA 3PXXA 3ND5A 2KHZA 2WU3A 1MB9A 3AQ4A 3PFHA 2YZNA 1QGAA 3BD6A 2AF4C 2QMHA 3PC7A 3CN9A 1YBAA 3OHPA 4U2GA 1IN5A 1WQ1R 2QY6A 4Q03A 4JWTA 5CDHA 2UUAB 4CUZA 4HF7A 1U6IA 3HWWA 1NA5A 1XROA 3DTNA 3L6RA 4HDKB 5ESRA 5SY9A 4UCWA 4DSNA 1B26A 3C41J 2DKOA 3HXTA 2F1IA 4GMGA 4W5HA 1OZAA 2ID4A 3E3NA 2TECE 3GEIA 5DSXA 2Q5OA 3H04A 3U37A 4BDSA 4NZPA 5CNKA 1U90A 1NF2A 5C3EL 3FPSA 2PXCA 1PLJA 1UAYA 1YZUA 4OHFA 3UCXA 3X1DA 4DZZA 4ESOA 4BJ1A 3TH5A 1SVSA 1FBNA 3I2IA 4MRMA 3U61B 3Q1KA 2NO9A 1N2JA 1TW3A 2GBLA 3W9UA 1ZZEA 1SMMA 2PSJA 1N9KA 2OBLA 1SK8A 3CZPA 3MBKA 5KPJA 2QVGA 3SU8A 1P29A 3VDXA 3LO8A 4OI2A 3UWKA 1R4MA 4UNSA 2Q8QA 4JQSA 3W1EA 3LPMA 5CFMA 3D6UA 5K3EA 5A71A 1JR6A 3E4DA 3MB8A 5BQPA 3T0IA 2D1SA 4UD6A 4NS4A 3VUEA 1T8WA 3EXG1 1R0ZA 1EM8A 1JLHA 2YBEA 3G59A 1TJNA 1ZD1A 3A2NA 1HO3A 4KPGA 3K35A 3VSBA 4DJAA 3PFGA 1I3NA 3C4QA 3BK7A 3IH5A 4KW7A 5DT9A 2Z0MA 4OI4A 1EZZA 2YHIA 4ALMA 4QELA 1SKYE 2PAFA 4JEMA 4LXGA 4UMDA 5DLQC 4DUPA 4F91B 2GXAA 4ATNA 3O3NB 1Z2DA 1K6MA 1R9NA 2O6HA 4E6YA 5D7NA 1GPBA 2YYSA 3VU0A 5L7WA 2IYQA 1E5VA 1KSJA 1TZCA 4BY1L 2FP3A 4BLWA 1JA1A 2NUAA 2XVMA 4KR7A 1KFJB 3H3FA 4U7HA 3LWOB 2QN7A 1AQYA 4L8WB 3RBXA 1U9IA 1N2HA 1N6HA 3VSEA 1SNYA 3ZI7A 4UMEA 1M7GA 3PYXA 4G24A 3SZMA 2QQ0A 2FPGA 3FDJA 3V4OA 1GTZA 3BCHA 4F5DA 5A4DA 2ZJZA 1G20A 4EARA 1AJEA 1KPGA 4ZOLF 3WXMA 1Q0HA 2Q6VA 4W9NA 4FTWA 1EG7A 5GONA 4PCUA 5KHAA 2YS7A 3UMVA 3R6WA 4B73A 4JV5B 1K9SA 4EYEA 1IN4A 1X7HA 3PQ4A 4JAVC 4AJJA 1HGXA 1GSIA 1UC8A 2RI0A 3ENKA 3PNOA 4LHXA 2NZVG 1HG1A 4O4LA 1AQLA 1VFNA 2GZSA 2DFNA 3DBVO 3EDMA 5ALDA 5H9VA 1FTNA 5TIIA 4ND8B 4ECEA 2ZJFA 4RLFA 1YRBA 1WD5A 2QPTA 2R8ZA 4L9AA 2KX7A 4XDHA 2R6JA 3FIJA 2VPZA 4AULA 4GHWA 2J7PD 3WLNA 1DVBA 5LOVF 1FLAA 3T4XA 3H5AA 4G4IA 2RG7A 4MW5A 4DABA 3IIMA 3RUHA 5KYXB 1V16A 2V3BB 1UMCB 3LJKA 3QU4A 1IIRA 3WB1A 1AK1A 3EIEA 1I13A 4ZKEA 2VBCA 5CVJA 1H22A 4I3GA 3USZA 3IAS6 3OCYA 1P5RA 4KWHA 1XFDA 2HR5A 4QYWA 5CBPB 5JJ5A 3H11B 4ZVNA 4X61A 4KFCA 2P6NA 2W2PA 3HWX1 3TVTA 1YZQA 3FCXA 4LHEA 1UANA 1BDBA 3O7WA 3H5VA 4UHEA 1JJVA 2GD1O 1ZXLA 5B4UA 1NRWA 2ZI3A 4PLYA 1Y33E 1ESMA 4TLEA 1Q83A 4BVAA 2HIHA 4UAJA 1AA9A 1UPAA 3AVTA 1ECLA 3RZOL 1SHKA 1COWA 2DQSA 2PV7A 4IL5A 1ZI8A 4DLYA 3NFPI 1M0EA 1Y8QA 1NI4B 4R9UC 1FSPA 2BMAA 2NSYA 1ZMTA 3PRYA 4RFLA 5LQKA 5LZ2A 1M6WA 1PR3A 2HK7A 4P35A 3UWMA 1RQRA 4F1KA 3LRXA 1IEXA 5JBIA 2Q6IA 1EFLA 2IXGA 5AIAA 1Q22A 2YWGA 3UA4A 3I2YX 3IT3A 3SHWA 5AVYA 6RXNA 2LCQA 3IV9A 3MMSA 5A5VA 4YAUA 1VLLA 2DWOA 3OEHA 2JW5A 3EPRA 3G8DA 4X7MA 1D4FA 4HAYA 5H83A 3TTTA 3IUBA 4MVJA 2WU0A 3QNMA 3RRZA 5EIFA 3T94A 4Z7JA 5C46F 5L3SA 3HCFA 3HBFA 3G8YA 3SJUA 4NEGA 1ECFA 2W83A 4AVYA 1DIBA 3PG5A 5JRJA 1OWBA 2PMFA 2TSYB 3QXGA 3S70A 4L5AA 1FFXA 3WAKA 2CJYA 1HE1C 3CRVA 3JZDA 4NQZA 5K8JB 1CEXA 3DQQA 1W4AA 4WKOA 4EG3A 1EA5A 3QX8A 2D4AA 5CEFA 2H9YA 1RM5A 4MZXA 1FXWF 3IC5A 4BN0A 1QAOA 3CW9A 4WKPA 2VNKA 1YQEA 2WAQP 3DBOB 5EC8A 1HR0B 4MKRA 4TYYA 4L4XA 3LWQB 2WNHA 4BMYA 1U8YA 4BRSA 3OBIA 1L9XA 3FSJX 1BYIA 5LQCA 4UU0A 4AZVA 3GRRA 3DNMA 3U3RA 1H0HA 2D0DA 2C78A 1H2ZA 2OB2A 5HIAA 1A2BA 3DMPA 1IXZA 1OXSC 4KO8A 4C7KA 3BRQA 1E62A 1HZZC 1BWSA 3NHUA 2XYVA 5ALMA 4UREA 3WMFA 4BMZA 2Q9BA 3VDNB 2XSZD 2B2CA 2KLHA 1XQ9A 2CKMA 3BFPA 3HY3A 4OJNA 4P81A 4XZ3A 4GWKA 3RT7A 2JVKA 5KWVA 2YV1A 1FLDA 1SHLA 4PZ0A 2ZJ8A 5K0EA 1V4NA 3K0FB 4LNUB 4YBZA 5EWMA 5YASA 5F5NA 4BNDA 1FX1A 3ZVNA 3U81A 1SXGA 3I61A 3DD1A 2E4YA 2IK8A 1DDOA 3FOZA 1Y3CE 3P96A 3HKDB 1OBOA 3L07A 4F97A 5JRZA 3IDSA 3TOXA 2XXJA 5GAHc 3HBAA 4QAQA 1LZKA 3G5AA 3TOZA 2OB1A 3GFRA 4H0NA 4TVOA 4JX8A 5TQJA 4O4HA 4BKMA 4DUYB 4IXDA 1M2NA 2AN9A 2JLCA 1PV1A 2J87A 2UYOA 4UNQA 3Q3IA 4FYHA 1X38A 4XSVA 3VI3B 4XXHA 3AI3A 1WTCA 2H85A 3WWZA 1RCUA 1Z5GA 2QSUA 3LBYA 4OHRA 1XAIA 5FP0A 3ROPA 3TB4A 2QTMA 1KOFA 5JWRA 2W2VA 3G2HA 1AK9A 2JK1A 4CLEA 4TROA 3KD3A 3LPDA 4W8OA 3D5TA 2PUTA 3QVGA 1TO6A 2QM8A 4Q7EA 3U62A 4DCUA 3I3OA 3NCTA 1IQ0A 1Y4ZA 4ZGBA 3LXRA 2GPSA 3PE4A 1Z4KA 2ZSAA 3NV9A 3SJAA 1Q91A 1U98A 2PX6A 3L6DA 3NHZA 1AGPA 2GTIA 2RARA 2XRFA 2ZIAA 4RD1A 4B71A 2RGEA 2AQCA 3NBKA 3S44A 2C2KA 1GNRA 3KOMA 4HPJB 1PT7A 4U2KA 3SSAA 3GPCA 2Q9UA 3ZLJA 3LKZA 5AI0A 3N6RA 3OM0A 2D1RA 5IKEA 2OAEA 4CMCA 3TLCA 4B82A 2GBGA 2I2FA 5CX4A 4U7TB 4FOOA 4EF5A 1N34B 5DWVA 1R27A 1NM5A 1NDHA 1QS0A 1YI0A 1L6RA 2LV8A 3A0UA 3D7NA 3I28A 3II6X 5K2ME 2ZS7A 4HDOB 4NVRA 3CZ4A 3QUAA 4NR0A 3A4VA 3FNBA 3OZXA 4CKCB 5DW0A 3LBAA 4JC0A 1UBCA 1F0YA 3EZNA 1Q1NA 2Z83A 4KN6A 1WW8A 3ZU6A 1TM3E 3AEUA 3NHSA 1OBVA 4H60A 4JL6A 3ABRB 4BYGA 5L3SB 1W0JA 5HILA 4Z1MD 4XEUA 2XBUA 3DDHA 2HBRA 4U9UA 3TFOA 3A3YA 2AFHE 3HVIA 4GU5A 5KUTA 3A4LA 4KOEC 4BP3A 3REQB 2WE8A 5D51S 5K8IA 1VI5A 1K5GA 5LMUB 3OX4A 1I7NA 3GCDA 2BGLA 2H4ZA 2M4VA 2BDTA 4TVMA 2R7LA 3K09C 4K8OA 4M3NA 4MYUA 3DMNA 4QTXA 1R2QA 4YN3A 1M8FA 1FL9A 1UJNA 4GM4A 3ZV3A 5AK6A 1MIOB 4CLRA 2CDAA 4MB6A 1I0LA 5DGIA 1J5EB 3U3XA 1KYQA 1Q3HA 2I80A 2VP6A 5DU2A 2QXTA 2LGJA 1GAJA 1M66A 4JCCA 3FAKA 4BGEA 4ZO6A 3HC7A 3U3DA 10MHA 5LA6F 2FSGA 1LXCA 4ARVA 3NPMA 5JXHA 4KDCA 4IGKA 2EP7A 2VJCA 4ARUA 2JFYA 1XXHB 2JEZA 3SIPA 3K0AB 3ZE0B 4RS3A 3RRNA 2WEKA 1GIAA 1YQUA 3G2NA 3AI1A 4ZYVA 1IQUA 4DCNA 3KSBC 4PFSA 3O3CA 2VUSA 3CNHA 5KX5A 1PK8A 2R25B 1IL0A 1HYQA 1KI8A 2VVTA 4TSKA 5KKCA 5B6PA 3ST7A 3GLIB 1IULA 4EHHA 1KDTA 3PTLA 3ZZUA 3T34A 4ESVA 3CGGA 3GDGA 1P5FA 1OI2A 4J0DA 4TUYA 2QTAA 3URMA 1E89A 3CT6A 3R3XA 5IKXA 2Y6VA 4QLBA 5CA1B 5I45A 1KYTA 2CNWA 4YP5A 3OOWA 2WFMA 3V1NA 1AD2A 3ZHOA 1SO8A 4LHZA 1K8XB 1QK3A 4WV3A 5PGMA 4AG3A 2X0FA 4DV0B 3KZVA 4BYMA 2CJWB 3J80A 4V0NA 1QVRA 3PWZA 4I4CA 4WACA 4RPIA 3QF7A 4AROA 2V0GA 4D46A 5LCXA 2IPLA 1I2CA 2BFBA 1Z07A 3T1NA 2G7ZA 4MK4A 4NXMB 3F74A 3OIDA 1XX6A 2GBCA 2BFNA 3M34A 5TE9A 1KFEB 3HNPA 4CIBA 1IU5A 4FDVA 4RVDA 4C4ZA 4BQFA 4MRVA 3KE9A 4EKEA 4B3SB 4BKRA 1P4HA 3QTLA 2PSSA 2W2KB 4X92A 5KBYA 4R40A 4UASA 2C7VA 1ACMA 2QL5A 3JQDA 3SYRA 1LLDA 1G5TA 1KXZA 2I6QA 1E0JA 4PG6A 1TADA 3H6HA 4TLLB 3K5HA 1Z4LA 2JS7A 3HGQA 2XYQA 2OZKA 5EERA 2HIAA 4HEHA 5GV7A 3ZWPA 1Z3CA 3RYCA 2WUFA 1WO8A 2HA5A 2NVUB 4MKFA 2VDKB 4PZLA 1Y37A 1DG9A 1LS1A 2GCIA 1YB7A 1LSOA 5AQEA 4CKXA 3ENWA 1RRMA 3I92A 4ID3A 4Y2QA 4EWLA 3RUCA 5CK4A 2Y1FA 3PCRB 2OYSA 3QUQA 4HSGA 4XSHA 3KYDB 3JQAD 4OD0A 4TTRA 3MCTA 3G13A 2XB6A 1Z0SA 1MA0A 4HHEA 2PUEA 2B2NA 1RW4A 4D3SA 4ZDKA 2J4CA 4ARSA 1XB2A 2OSBA 4FEAA 1M2HA 4C4AA 4JJ8A 4X84A 4D4MA 1NXOA 4CKZA 1MORA 3UKDA 3VKHA 5IYDL 3M3DA 2QRKA 4J1QA 3SOZA 4F2WA 5IDQA 4JAGA 2R1ZA 4FBMA 3ZOZA 2OO7A 5CEEA 1ZK2A 3ONVA 1WB4A 2EKDA 1L0BA 2I7CA 2B83A 3ESRA 4AF6A 5JXGA 1EVEA 1GNTA 3N0RA 3OQ1A 4XFJA 1L7RA 1WZNA 1X86B 2GCOB 3PNSA 2XWQA 5TPZA 4F9TA 3D8RA 4LHYA 4HUTA 3L41A 1KVSA 3I0NA 4MUXA 2XA1A 1SVKA 5EMLA 3JQCA 3QUSA 1YONA 3QY0A 4E12A 4MV0A 4HQFA 3ZR4B 3AEZA 3G0CA 4QASA 2OORC 3F2VA 2X4DA 3PIIA 4BVKA 3EC1A 3QE0A 5KTTA 1ZCAA 2EDAA 3RSHA 1GKLA 1GNVA 2AFIE 3FPKA 2ZT5A 1U7OA 3QUTA 4KMSA 4MVJG 4Z9YA 5G2OA 1AV6A 1NVVR 4MGZR 1SBNE 3N3AC 5KQRA 2WINI 1IVYA 1NSYA 3K4HA 4BNHA 2G67A 3A14A 3DT9A 3QXHA 3USES 1KEEA 4D0GA 4LCEA 3KVRA 4DZRA 3LV8A 2R4QA 4R05A 4NHOA 1QORA 4EHNA 5JARA 4I81A 4YMHA 5KYVA 4BV8A 5ILQA 1FJGB 4XYLA 3LX8A 2HOQA 1DCKA 3CMCO 1KVQA 1RZUA 1VTKA 2WIDA 4JJZA 2H52A 3GL9A 1U8XX 1VZ2A 2X8LA 2YICA 4S2EA 5CNIA 4WLUA 3WIEA 3G2IA 3ZD6A 3JAKA 1YF3A 2Y9MB 1UZMA 4QECA 4MVJM 2BH9A 1Q74A 2W8ZA 3N59A 1X2EA 4JH0A 3V34A 5H82A 1F8FA 2Q49A 2NP7A 3DTYA 3IBYA 4AIIA 3G1UA 4J0FA 3O91A 1QQBA 1Q5PA 1VM6A 3I39X 2A30A 3ADKA 1W9MA 3V2UA 1U5BA 2G3YA 3KYXA 3H9GA 2Z2YA 3WGUA 3E5NA 1CRQA 4BE7B 1K8YB 1MVNA 1NUTA 1U94A 2GBPA 2G40A 2X58A 3ND9A 1D2RA 4KRXA 4Q3DA 1WNTA 1ZU4A 5TQ2B 3LP8A 5DMHA 4EVRA 2GEKA 1NMQA 1SFRA 3GVPA 3IHTA 1K9VF 1YR7A 2I7VA 4FCVA 3UPTA 4LY9A 1EIZA 1LLCA 1YR2A 1RLIA 4DWOA 5K6RA 2J7KA 1IY0A 2B99A 2ANCA 3H6KA 4HH0A 2ACKA 3CKKA 4YASA 3VFDA 4EBFA 2QROA 3EGWA 4DQVA 4M0DA 1LTKA 1YZKA 4YT2A 1WDTA 4TXLA 2HIGA 5BOSB 3DOHA 1I4EB 3AF0A 2HBZA 5FBQB 4A3IL 1X0XA 2BHTA 4QU0A 4WERA 1J25A 1RRFA 1ZITA 2HF9A 1CRWG 1O96B 3CF2A 4EAQA 1WM1A 1SIWA 3BXXA 2Q21A 4OFXA 4XDZA 2ZUCA 3FZEA 3HNRA 3T1VA 4PN3A 4X1YA 4WH0A 3TDMA 1Z35A 2OWEA 3CH7A 4O1IA 4PN7A 4N0MA 5AW4A 3DL0A 3LT2A 8OHMA 1SMKA 1TD1A 3P0IA 1V3TA 4M1QA 3WYBA 4BLVA 3T5MA 5FBVB 3V1LA 1E5TA 4PC2A 2R1VA 4HQRA 4ENSA 5JCJD 2Q3HA 1V4BA 4KWIA 5KKNB 1CLEA 3G68A 2CGEA 2SICE 1G3IA 1W96A 3K9CA 4QXMA 4D4GA 3G2MA 3PGLA 4U5QA 3D0QA 4BXOB 2QRLA 4YMTA 3AL0C 3TMAA 2HCTA 1DDGA 1A4IA 1XU4A 5F12A 4ABYA 4OX9Y 2FMXA 4GMKA 3BORA 3VJMA 1XKTA 3CCCA 1QUFA 1DS6A 3QE3A 4TLMB 1W73A 2KSQA 2WZDA 4TPUA 4IUBS 3L6EA 2FP4B 3GR6A 5JANA 5H8WA 4AKSA 4X8MA 3ZQ4A 2VJNA 4Z8YA 1G5HA 3AB7A 3UNXA 3INNA 3WG9A 3PR2B 1BRFA 3MHPA 2YJZA 1QTQA 3S8YA 4HOYA 1A69A 5G53C 4TLAA 3RSOA 1X87A 3DE3X 4TL8A 2ZM5A 4CW7A 1O6GA 2WJGA 1Q19A 3F5SA 4ENPA 3LGXA 5IHPA 1ZD9A 3IBSA 3LD9A 4RX1A 2RBGA 2VH5R 2QAIA 2RBEA 2G17A 3BXFA 1GXSA 3HB4X 1XZQA 1IWPB 1O95A 3FOAA 3U7JA 1K1EA 4BV3A 2JC3A 4YRNA 3SGLA 2IUTA 5IZ4A 4HTFB 2B34A 3PDCA 3WRYC 1YZGA 5FAKA 3T52A 1MBZA 4FWIB 1ISSA 3U7RA 1DX4A 2WDZA 4Q3AA 3L6UA 2PH5A 1UDRA 3H5LA 3IE2A 2REXB 1UPXA 2F67A 2FW6A 2YQ5A 2A9QA 4M1SA 1X6VA 5I7UA 5TF4A 3OPYA 3L0CA 1WUKS 3O90A 2JI3A 5IPFA 5JHHB 1FPQA 4RPGA 1YDHA 2FWBA 1RYEA 5JJCA 4U1RA 4OLBA 5F3WB 1XZCA 5FUBA 4NBWA 1KK0A 1UT6A 3EARA 1KZHA 4JQZA 4MMZB 5KJEA 3EQ7A 5BYAA 2DM6A 5JPCA 5HOQA 1LLQA 5CJJA 4UAVA 1KO8A 1SUAA 1VMIA 4Z3KA 1G8FA 1BFKA 4N39A 5EWJB 1UKAA 3E8MA 4UM5A 3FWNA 3KXIA 4MCJA 1JG4A 1VBFA 2EL9A 3HMKA 3OX2A 4CEJA 3MB5A 2YCLA 1YJCA 5ABPA 1NXEA 2QMUA 2D1QA 1HE3A 2GRUA 1TK2A 4RQTA 3KOUA 1UBRS 2O50A 2XMCA 1KJNA 2X19A 1IRIA 2I29A 4JOBA 1C3OB 2LNDA 2OCLA 1XZEA 2B8EA 1N6OA 3LWDA 3NTUA 6ADHA 2YZMA 3WL4A 1Z0IA 3G7NA 4NZOA 4EFLA 1Z2CA 4BKPA 3NEYA 5JSHA 3E84A 3FUVA 3UV6A 5J2UB 4HVLA 4QZVA 1IMJA 1WABA 1XMSA 2ET6A 2XNKA 3A1FA 3D4PA 4IMRA 1O9HA 4LOLA 2JEYA 3SX2A 2OG1A 4ALKA 3OZSA 4NBTA 4G5RA 4HS4A 4PFKA 3AF5A 4A0GA 3JZIA 1IZZA 2EJWA 2O2GA 2HPHA 4OM8A 4RAOA 4YRDA 2ZRFA 4FSHA 5AVUA 4A36A 2UZ1A 5C4JL 3ZI4A 4Z5XA 4IQGA 1S2OA 3EGXA 4WFJA 3QXXA 4GP9A 4C88A 2HJ9A 2EX1A 3GJ7A 2P79A 2C1XA 2WJVA 3AEQB 3DCJA 1R8SA 1YFKA 2WTBA 3OP1A 3OT5A 3PEYA 1CUEA 5F1YA 4RNDB 1DMRA 2C99A 4MYDA 8ABPA 5H1Sc 1J2JA 4MLCA 1ST2A 2G70A 3GJ3A 3NHJA 4EP1A 3R5HA 2GBIA 3W8FA 2L18A 4A6XA 4D4IA 1PTJC 3H7AA 3L7AA 4K9DA 3RFCA 2J31A 4MV1A 4XVRA 1M3SA 3O9MA 4RM3A 3W9BA 1O89A 3AB3A 3VX4A 1YHNA 4LSMA 4QGHA 4TYWA 3SICE 4I4TB 1XTQA 3VSCA 2I3GA 2LP4Y 3B60A 1S02A 3NGXA 2C82A 2HWYA 4HVAA 2NV2B 1AQUA 1Z8FA 3QOYA 3EIXA 4C0LA 3R0QA 2Y1XA 3I83A 5P21A 2B1RA 2E3JA 4CN9A 1P1RA 1A8PA 1XF9A 4X00A 5D8DA 3MLEA 1COWD 2XUJA 4A2PA 1ZN2A 3CRRA 1J2EA 4WGGA 1PTKA 1AU9A 2BJVA 1BDMA 1LNQA 3K5WA 4C6RA 4OI0A 1VJRA 2QI9F 1XHEA 2GGSA 2M6SA 3Q8WA 2ACVA 3SBDA 4CKYA 2JHAA 1HI9A 1C5KA 4XJTA 1D9XA 1Z2EA 1WEKA 3O8QA 4H7PA 4QYXA 4MPPA 1X7XA 3F3MA 1MO4A 3RR2A 4DJTA 1ZWLA 1N4AA 3ZJYA 1XA0A 4M22A 1XO1A 3AETA 2ZBFA 3KKPA 3ZCRA 2IPAB 3MXOA 4QXPA 1PN3A 3OEHD 1XTVA 1RLUA 5BMVA 1G3MA 2V7TA 4AMBA 8LDHA 3S55A 2Y71A 1E1LA 4OP3A 2XZDA 3WIVA 3K8OE 4NE2A 2RHHA 4IWYA 3WL5A 4BO0A 3UMFA 4MV6A 2VA8A 1OX6A 1BJRE 2FG7C 3KRTA 3OAAD 4LE2A 2CY0A 4QU9A 2V59A 2F64A 1CQIB 4PG5A 3ML1A 4R83A 3UJAA 1CUWA 1MEEA 1W4CA 3CEMA 1F2UA 5LLSA 3WLOA 4EJFA 5H70A 1E6KA 2ZTVA 2RH8A 3GJ4A 4IGFA 5GINE 4N5LA 3ZZ1A 1XVTA 1PL0A 1Z0KA 4O3FA 4IPTA 2VDRB 5AKLA 2VYVA 3KKKA 1OWOA 2ODWA 4NBKA 5E6RB 1PLLA 5P8WA 4EG5A 2YWCA 1U4NA 5CTJA 4UUBA 4QT4A 3F4LA 1YWGO 2Z98A 2FWRA 3QV2A 5HTOA 2RKOA 2PNFA 2A9VA 3JASA 3MWDB 1VIMA 5G02A 1D2NA 1RKUA 2PWYA 2D62A 2VQSA 3AEKB 3OIYA 2Z8ZA 2B5OA 2P4HX 1RE0A 4MQMA 4F6CA 1FEZA 4BO6A 4MGKR 5I5GA 4G0VA 4MVCA 1QIDA 4DIOA 1Y7HA 1CJMA 4QM7A 4HAIA 4AIRA 3GG2A 2GXSA 2UKDA 3PDWA 4ZT7A 4Y9TA 4XQCA 1G16A 5KWJA 4RVGA 2ZJ0A 1DRKA 1U0HC 1FVOA 5DULA 2O8FA 4NC9A 2R4UA 2QIPA 1R6BX 2CEAA 5CM8B 1PNTA 3NATA 4IDDA 5ETJA 3JRNA 2BFFA 4KB5A 3JQ8B 2HPAA 5LIPA 5ERGB 3C97A 3UMRA 3SBOA 3FSGA 3KHTA 3I09A 3CZMA 4Q34A 3T4PA 1GPAA 1C7ZA 2WJWA 1J7KA 4LJYA 1XD8A 1KJIA 5EE3A 1GU0A 3A2KA 4PGHA 4Z0PA 2YXDA 4WXEA 3QFRA 2C77A 1BFYA 1U4OA 1UJ4A 4F8JA 2DTXA 5EKSA 2XRZA 3KXLA 4MS4A 4G1EB 3PYMA 4J3FA 1OTXA 3LT0A 1KJQA 4EA9A 1TVEA 3HSSA 1ODJA 4Q1EA 4EMBA 3AFOA 4YV1A 3QSYA 5KU1A 1M2EA 2CLHB 5EOVA 3AESB 1LJ8A 3C74A 4QSMA 5GZ6A 4RPLA 1F7UA 5TDHA 1K7EB 5JJKA 2AUSB 4YVFA 5FFMA 1BWRA 4B0OA 4DADA 4F71A 5DRTA 3V7UA 5SY6A 3A32A 3CLVA 3HJTA 3CF6R 4MCHA 1SU4A 2PUFA 3IUSA 4OGLA 3VDMA 1F6BA 5EPOA 2P67A 1N6IA 2IYAA 4JGGA 4PBRA 3USCS 4ARCA 4AO8A 1V43A 5KQPA 5BSUA 5FJ8L 2HN9A 1FCJA 1G4HA 1XTTA 1ZOLA 5EE9A 1YBMA 3SX0A 5IT9A 3GCXA 2XZOA 2G5TA 1EE1A 1Y80A 1EEXB 4OAPA 4RIFA 1XKXA 1LK7A 1C4XA 2I8CA 4XR9A 2HU5A 3ZKWB 4UY81 1UIMA 2JAHA 1HETA 3VC7A 3EY9A 1T2EA 3OC6A 5DLPA 2GZAA 4ENRA 3T3EA 1RMYA 2RKWA 4MULA 2GNOA 2JPDA 2W58A 3UMJA 4UHBA 5F76A 4B33A 2CLLB 1AA6A 4R71A 1W0JD 1EM6A 3ETHA 3S15L 4LJ4A 1JQLB 1YR1A 4A7PA 3CVYA 2ZIFA 3ZV7A 4CQMA 4B3MB 2EQ5A 2LCIA 3LPNA 1Z0DA 4EJMA 2VDWB 2Q8PA 4FNAA 4GX0A 5COBA 3MTAA 4NNOA 4GQIA 5HBRA 2WUDA 4ZCPA 1TAGA 1LX6A 5AI4A 2PIDA 3RVLA 1USUA 2AR9A 3AR5A 4A5SA 1GQ2A 4LCJA 3TJZA 3ZH2A 5KQMA 1QR2A 4ZRMA 4V1CI 2C3YA 3ZGNA 3O0TA 5L3QB 1M33A 1SC6A 1SVOA 2G6BA 2X40A 4HEA6 4OM7A 4XQEA 3STVA 4WJKB 3UIEA 1Y3BE 3QEJA 3EVAA 5DI9A 3GHYA 2BEUB 1HG0A 3N6VA 3LXUX 3ORRA 1Z4MA 2K6GA 4OIMA 4NPCA 4UBIA 2BBWA 5ALZA 5GM1A 3WADA 5CG2A 5IU6A 2EGHA 2IH4A 1B13A 1E60A 2DFKB 3OQNA 1UCFA 1GD1O 3D1LA 3UPUA 3EG5A 3DO5A 1XMXA 5EHQA 2NPOA 3PS9A 4FBLA 3R8XA 4B4VA 4DA6A 3DMYA 3QWBA 4IUCS 1VLJA 5BN4B 3RUIA 3F67A 1KFBB 3RUPA 4KYTA 1L8LA 3UN1A 5KTKA 2CJXA 2G63A 4AUNA 2JFXA 1IOWA 1QPGA 5B3JC 1P1KA 3DKIA 1NULA 4KNVA 5ES4B 5AI3A 4FDAA 4ND1A 4LZZA 1N5KA 5FAXA 3QA9A 4W63A 3DDZX 3EODA 5EL0A 4JLDA 4ZYXA 4L0MA 3ZTTA 2GFQA 5F4BA 2M6LA 4IHJA 3W5JA 1HQKA 3UGKA 3WL3A 1I2ZA 1U02A 2R1UA 1H2EA 3INRA 2DPYA 1B6TA 1BOOA 2FN8A 4RIEA 2QBYB 1NJ1A 1DXHA 2J0EA 1SQSA 3GT0A 1VHJA 2PUDA 3LQYA 3HXMA 1S24A 2XYRA 2DLNA 4QQ8A 2PX0A 4IXNA 4UEOA 4X20B 1U1FA 3KYYA 2AJTA 1P1HA 2PHZA 3K30A 2F9LA 3AHEA 3D5EA 3VPBA 3R7WB 3RH0A 1CVLA 1GITA 1CQXA 3K8ZA 1J2YA 4LMPA 3TQQA 1JEQB 1E3LA 4WZBE 2NX2A 1ZMXA 4BY9E 1TPYA 4BVEA 4L5IA 3D3QA 1NG1A 1GFSA 1UAGA 2Q50A 3MCAA 4MO9A 4OJTA 1P0FA 2GHRA 4WZAE 2J9FB 3DZDA 4HLCA 1RZRA 3IMFA 3R4VA 1BQ9A 1YVRA 4I55F 2IVZA 1QKJA 5FD8A 3HZZA 4K9SA 4L4YA 3GUVA 5HMLA 1EG2A 1BAPA 1KYIA 3DAFA 5AVSA 3PHCA 4YUVA 3TLAA 4ZQFA 1D6MA 3NXSA 3IAM6 4N7RA 5E9JA 4CMKA 1WU8A 3FRHA 3CVUA 3ABIA 3B70A 2FW1A 4G9BA 4J2OA 5KO2A 4C5AA 1VCXA 1N2OA 1CR1A 3F0TA 3GF4A 4KUHA 3GFVA 5IVKA 2QYTA 2O0JA 1WU7A 1RR6A 3DZGA 3ICWA 1ZY2A 4A3KL 1RHKA 3Q7TA 4K3VA 4N8SA 4D9CA 1VL0A 4U6NA 4LYYA 3NRCA 1VGQA 5CJPA 3RI3A 3SC3A 3V7NA 2ZREA 3FUXA 3M6XA 1R4ZA 4EI9A 2B8JA 2FN3A 1U1GA 1XU9A 1XVAA 1DRJA 2I6UA 2XWJI 4KRYA 3F6PA 4GOXA 1ONBA 2HX1A 2X3UA 4GZ5A 3GIWA 3IPRA 3DCIA 3FKIL 3PR3A 5BYBA 1MOSA 1L4EA 1X1EA 3RGGA 3TKAA 3DZJA 2PT7A 1FP2A 3FB1A 4GI1A 2C5LA 1DFGA 3IEUA 1Q20A 2E4XA 1R15A 2GPWA 2XQJA 3NT4A 1I0ZA 2XUFA 1TGVA 4L85A 5DM60 2YW2A 3AERA 3E1SA 3F49S 1N5MA 2DT5A 4MA5A 1TJYA 4MS3B 5BXYA 2JI2A 2Q2OA 4KKXB 4YACA 5JS8A 4WCFA 4LHWA 4YLEA 1I1OA 1YCHA 5FWXA 1R4AA 2YHUA 3R3VA 1UXGA 3E05A 3HADA 4L8LA 2QD4A 3ZWVA 4BFLA 2E4VA 3C3EA 3H2KA 5I6DA 5JNWA 4B2PA 3WLKX 1K5DA 1O6ZA 3LBIA 1ZR4A 5J2UF 1NNSA 3C5EA 4R41A 3Q3GE 5EGSA 3M5WA 2HJGA 1KYYA 2QG4A 1NN5A 3OSZA 1SBYA 1ULZA 3OC0A 4BQRA 1V3VA 4N0DA 2H08A 1JG7A 3BEDA 3M83A 2GO1A 1Q1QA 1FUEA 2PGJA 4ZQEA 4IIJB 3EWSA 5A4AA 1EVYA 5KDDA 4B3GA 3EGVA 2L2QA 1DCMA 4G37A 4ALNA 4FNMA 1T8YA 1C9NA 1MABA 3KQYA 3KTOA 3VTAA 1J97A 3PPIA 1YS6A 2XEXA 3C15C 3WK8A 2VCEA 3CKLA 4KQJA 4YJHA 3L0ZA 2GAOA 4P6VF 2B5VA 3T95A 2H7VA 1YE5A 1OE0A 3HCDA 5HF6A 5IBRA 1NKTA 4RDHA 4FNOA 3MCZA 4OSEA 3ZDDA 5EN4A 4EYOA 4ZT4A 3L7LA 1P18A 3UB2A 5IH7A 2NT4A 5E0KB 5DWDA 4PHFA 2DAPA 3HBMA 2J3KA 4Y2UA 3ZCPA 3VPGA 3BSSA 2QLMA 3HDQA 4HH1A 4QQFA 2GJ9A 3N2KB 1HL7A 4IX1A 6Q21A 3G6WA 3HKBA 2XVXA 4KXVA 4QOIA 2IYFA 2GR9A 4GIBA 3ZBPA 5E4JA 2N9UA 4C5CA 3CRQA 1NQXA 4NCXA 2ZR0A 1GYQA 3H4TA 2H12A 2IYUA 3CW2A 3WYDA 4KE7A 4NL4H 3TPFA 2CYAA 4N5HX 2JIOA 5CG1A 1DHRA 3R44A 1SC4A 1YAJA 4H0CA 2CNNA 3OLWA 3TZEA 2R3SA 3BF7A 2J4FA 4G2NA 4GNKA 4N12A 4OXQA 4RS4A 3PKIA 1S4MA 2W2LA 1Y5LA 3I5MA 4PPFA 4Z9BA 2A9JA 3HBJA 1ODLA 4Y6QA 5LWHA 1H4VB 1Y6QA 4G26A 2I3ZA 1YI8A 3STXA 3HOWL 5FQNA 4BJ3A 1XMPA 4WINA 2C9ZA 2R5NA 4JNKA 2KYRA 4V2IA 1JHVA 3K9HA 5ITZA 1GGNA 4HC4A 5EQJB 2X2OA 5H3CA 1QU3A 3OCCA 3IHWA