4YWMA

Pyrococcus furiosus mcm n-terminal domain beta-turn triple mutant pentameric ring
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEAAEATPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
molecule keywords Cell division control protein 21
total genus 67
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ywmA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywmA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywmA01
3TS0A 1S24A 3K81C 4LNQA 1H95A 1A62A 1L1OC 1VQ9A 4A93G 2LSSA 1C9OA 4A3BH 3DLLA 1W3SA 2PI2E 1VQGA 4HJAA 4DV3L 1YITA 1BRFA 3AFPA 4JI2Q 3S15H 1Z47A 1I5FA 2HQLA 3IRBA 3BZKA 5E7NA 2JE6I 4DV5Q 1KIXA 3D0FA 2F52A 4K9FA 3GTPH 1X54A 2ZTCA 3T1HL 1ASZA 2HIVA 3H0GG 4IO9A 1I50H 3L0OA 1HR0L 4RXNA 3HKSA 4LF4L 4DV6Q 2HHHQ 3M3YH 3I56A 2R93G 1YNXA 4FDBA 4GKKL 4A3CH 4DK6C 1Y1VG 2IT1A 3D31A 4C3IH 1YJ9A 5LMUQ 1UE7A 1EIYB 2K5HA 4RMFA 2R7FA 1N36Q 5M3MH 2JA7G 1A0IA 4AQYL 2UUCQ 4MTNA 1CAAA 3HOUG 3CW2C 1JYBA 5BR8L 1DX8A 4DV0Q 4GKJL 2VNUD 4AR3A 3PUVA 3WWVA 1C0AA 2RDVA 2YU9H 2ATWA 2I5LX 2VQFQ 1X56A 4GOPC 4YY3Q 1XJVA 1Q82C 1N8RC 1YV1A 2Z6KC 1D8LA 2R7DA 3J80i 1BVSA 4BXXH 2Y0SE 4OWWB 1FJGL 1VQ7A 4LWCA 4YCVA 4AR6A 2K50A 5GAEC 3RR5A 1XNRQ 3RN5A 4DV5L 1UEBA 3S1RH 3HOYH 1R0FA 2KHJA 5RXNA 3KOJA 1VQPA 4OO1I 4O2DA 3S16H 4LFCL 1UWVA 2YV5A 2IY5B 4DR4L 1B2JA 1GD7A 4C3HH 4HIDA 2I5MX 2IX1A 2CKZB 1IBLL 4UPAA 4JI5L 2HIXA 1FHMA 1T9PA 2WP8J 3GTMH 3JC62 2RF4A 1GO3E 3U58A 1XMQL 2JA7H 3GTJH 2AWNA 2R92H 2CQOA 3F8TA 2IHFA 5C44G 3CCQA 4NB3A 4JI6Q 3TRZA 3S14H 4A3LG 1VS0A 4PZ8A 1X3EA 4GKJQ 4LF5L 4GOPB 4P73A 1PHJA 3NBHB 2K75A 1FGUA 2DUDA 3EN2A 2EXDA 4X65L 1G6PA 4JYAQ 4L5SA 1VQOA 2B3GA 4LFAQ 3J81i 3CCSA 1GM5A 4YHHL 1R0IA 5LMUL 1SMUA 1K73C 3T1YQ 2E5LQ 1AH9A 5AJ3Q 1YIJA 1WI5A 1P8LA 4GLVB 2I0QA 1HNZQ 1SR3A 5C4XH 3HOWH 1Y1VH 1R9TH 4NXML 4A3DG 1WFQA 1C09A 1X65A 2Y0SG 4KHPQ 5IWAQ 5HY6A 5FJ8H 4JI2L 2MS3A 1YBYA 4X65Q 4B3TL 5IT9c 2ZTEA 2OQKA 2V1CC 3FKIG 4BY1G 3JC66 3NENA 4OO1G 2N3SA 4LW1A 3W1GA 3S1MH 4IOAA 1IRNA 5IP7H 1K3RA 3RZDH 1HH2P 4BBSH 4GNXC 2LXKA 5GAHC 4DUZQ 1AE3A 3KYYA 2AWOA 2VS1A 5ELNA 2GVBA 4JI7L 1W2BA 4DNIA 4JV5L 2K4KA 1JT8A 1NTGA 2F3IA 4R1JA 1VQEA 4XIGS 4DUZL 3TEHB 1PH2A 1IBKL 4BA2I 3E0EA 2OTLA 1LYLA 2VL6A 2NN6I 1IBML 2NVTH 4XTCS 2VUMG 2UXBL 4DR6Q 2NZHA 3J80c 4A3IG 1VQMA 1PH5A 2JEAI 1E7ZA 3G6EA 4ME3A 1U0LA 1D7QA 1PFSA 4NXNQ 3CMEA 2PNHA 4L5RC 4QQBX 3UDXA 1FJGQ 5LMNQ 4OWTB 1MKHA 3A5UA 5IYDG 4A3GG 1NBWA 1Q8KA 4RG1A 1WCMH 4X66Q 6RXNA 3LGJA 4B3RL 1SROA 2VQEL 2R6GA 2B63G 5K36G 1Q1EA 2PMZE 4KLKA 2A1AA 2MO1A 1PH1A 3RZTA 4DV2L 2R7ZH 4LFBQ 3CF5A 1IU5A 3B6YA 1T9QA 5GQOA 5M3FH 4JV5Q 1B13A 1OXXK 1UE5A 1SN8A 3W1BA 2GVAA 1YK4A 2WB1E 4X64L 1WOCA 1T9HA 4L5TA 4APVA 3OTOL 3GTQH 2AKWB 5FJ8G 3CCJA 2R92G 3FHWA 3DM3A 4MNOA 2HHHL 2XGTA 2M4YA 2E2JH 2E8GA 4LFBL 1R0GA 1CSQA 2JA8H 1VCXA 1S30A 3UDFA 1Y14B 1KQSA 3CCUA 2WB1G 2UUBL 2KBNA 3PWFA 1JMCA 5GAGC 4DAYB 4LFCQ 2K2DA 1K83H 3A5ZB 5C4JH 5LMNL 3M4PA 1YK5A 5AJ3L 2OQ0A 4P75A 4JYAL 1X9NA 1MIUA 2JEBI 1VQKA 4OX9L 5M5XH 1Y1WG 1Q12A 4NPSA 4DAMA 4EQ5A 2WAQE 2NVXH 3BJUA 3H15A 4QIWE 4HIKA 3A0JA 2UUAQ 4UY8C 5IY0A 3PV0A 5JEAJ 3I4NG 4A3IH 4JOIC 4DV1L 4TPUA 3M4QA 2JJQA 3AYHB 1XNQQ 4TVAB 1TXYA 5C0XJ 1K8AC 5DLQE 2R7ZG 2WAQG 3ZJYC 4DR6L 3JAMi 4OXPA 1RWDA 1SLJA 4A3KG 1HNWQ 1XMQQ 1EQRA 2E2HH 1XNQL 3NEMA 4A3CG 3FP9A 1XTDA 1Y1WH 3KYUA 3KDFA 1E8JA 1IBLQ 1Q46A 4IFDG 1CSPA 2Z6KA 1HZBA 2IX0A 1PH9A 1BBWA 1L0WA 4JI1L 2N78A 4GNXA 2F4VQ 1EQQA 1TWGH 1T9OA 2GMGA 2UUBQ 2LCQA 3CCLA 4LF8L 4JOIA 3RZ6A 5HGQA 2JA8G 2E2IH 1CKMA 1TWCH 4BA1I 1VQCA 2I5HA 4LF4Q 2B63H 3H3VI 1N34Q 4LF9L 3RZOH 1EIFA 3KYXA 4AH6A 2A8VA 1KXLA 4K0KL 2ZJQA 1X6OA 1Z9FA 1GVPA 2YTVA 4AIMA 4YWMA 3OTOQ 1N34L 2JA5G 4LF9Q 3AEVA 3HOVH 4HIOA 1PH6A 3KYWA 3MEFA 2HT1A 4DV0L 3HOWG 4YWKA 4YHHQ 3SGIA 2H5XA 4AQYQ 2UUCL 4LFAL 1UE1A 4QJFA 4KI0A 1V43A 4GN3B 1N32L 1YJNA 1SMMA 1VQ5A 5GROA 4GOPA 2PYAA 2VQEQ 1K8GA 2R93H 1UE6A 1VQIA 4R4CA 2KKDA 3S1NH 1HNWL 1FVIA 2JA5H 1NNQA 4OONA 4DV4L 1YHQA 5JJKA 4GKKQ 4IPGA 4AYBG 1E22A 3I2ZA 2KCTA 4JBJA 2MNAA 3F2CA 1XPRA 2VY3A 4PZ7A 1QCVA 5M5WH 4JG2A 3VDYA 2Z0SA 1VQAA 3PUWA 4ALPA 4DV7L 4X6AH 2DSXA 4DV3Q 1CADA 4EX5A 2VUMH 2NVYH 3KLWA 3M9BA 3M85A 1QVCA 1S40A 2V3BB 4UP7A 4AYBE 1XMOQ 1KL9A 1VQ8A 1K9MC 4JCVE 3F1ZA 4JI7Q 4GLAC 1IYJB 1KAWA 3J7ZC 3RLNA 2ZM6Q 1M1KC 5M3MG 4YWLA 3RLOA 2K14A 1EUJA 3PSIA 3A44A 2HR5A 1R0HA 1RL2A 4DR5Q 1HNXL 3I4NH 3EBEA 4DV1Q 4A3JH 3RYGA 1PH8A 1TWHH 1QUQA 2AHOB 2GN5A 3KDFB 3W5OA 5IP9H 3G71A 3CPWA 4A76A 3OW2A 4X64Q 4MZ9A 5C0XI 4A3KH 1N33L 3U4ZA 3H0GH 3PGZA 5IP9G 3HFZB 4DUYL 5IYCH 5BR8Q 3GTGH 4B3MQ 2MFIA 4BY7G 1LKPA 4NXMQ 1HZCA 1VCIA 3J81j 4X66L 4IOCA 1EWIA 1NY4A 1VQFA 4QL5A 1WYDA 1EYGA 4JI0L 3CCEA 2VW9A 1PV4A 1QZGA 1NE3A 4DV6L 3KFUA 3ULPA 2ALYB 1LKOA 2BH8A 5LMNW 1YUZA 4HJ9A 3GTLH 2QGQA 3PUYA 1B7YB 3PCOB 4DKAC 2ASBA 3STBD 2EIFA 1BBUA 4PMWA 4DR5L 1HNXQ 5C3EH 4JI4L 4BBSG 1PVOA 2BA0A 1VQ4A 1QZHA 1VQ6A 4A3BG 5ELOA 4BXXG 2IHEA 5GADC 4UP8A 2KCMA 1KD1C 1E24A 2KENA 2PVXA 4A3FG 4DR4Q 2PQAA 1SMXA 3U4VA 2XTIA 3K80C 2JA6H 1A63A 3JAMc 2YYZA 1OXSC 2UU9Q 3G48A 4R4OA 1XNRL 3TQYA 5C0XG 1JE5A 1XPUA 2UUAL 2K52A 3CP0A 1BE7A 3MPSA 5C3EG 2NZOA 3G4SA 4DR2Q 1H7VA 3S1QH 1WJJA 1DVBA 1I3QH 3S2HH 3HOVG 3GO5A 2VZAA 4HIMA 2NN6G 1YJWA 2UXCQ 1JJGA 1XPOA 4A4IA 4GLXA 4KHPL 3T1YL 1WCMG 1JJ2A 4DPGA 2E5LL 4H02A 2UXBQ 1PH7A 4C3JH 1IBKQ 4DR7L 1VQHA 1DGSA 4GN5A 2K5NA 4A3EH 8RXNA 4B3SL 3KF6A 2UXDQ 3A74A 1I6HH 4OWXB 4DR3L 3PUXA 1QUQB 1N32Q 2KN9A 4X62Q 4QGUA 1SMWA 3KJOA 4LF5Q 4BY7H 1FHHA 4GN4B 1Q1BA 3I4MH 1P16A 1N36L 3OYYA 4B3SQ 1GKHA 4PG3A 1MJEA 4A3LH 4WJ3M 3KF8B 4YCWA 3HOYG 2Q2HA 1BKBA 4DV2Q 1G291 2DGYA 4J15A 5IP7G 1U5KA 1OXVA 5IWAL 1LKMA 3PZAA 5IYBH 3CCRA 5M3FG 3PO3G 3ER0A 3M4OH 4K0KQ 4IJHA 7RXNA 1KHIA 1B71A 3T1HQ 4BY1H 1HNZL 3J7A5 3F2DA 1S3OA 4GNXB 1YEZA 2ID0A 4PZ6A 4JI3L 2F4VL 1NMGA 3CCMA 1K0RA 2EQSA 4JI8Q 3TREA 3KJPA 3RNUA 1OTCA 1EFWA 1XMOL 2RCNA 4BBRH 1QVFA 1L2FA 1RB9A 4JI1Q 1BQ8A 4IPDA 4JBWA 3STBC 5H1SE 5FLXc 1IXRA 2C35B 2WFWA 3I7FA 4IPCA 3S24A 4A3FH 1B8AA 4IPHA 2VQFL 4A3MH 1CKNB 2D0OA 1IBMQ 2QEXA 1X3GA 1FL0A 1J6QA 1VQJA 1V9PA 1VQBA 1BQ9A 1NMFA 3H3VH 3KYVA 1EOVA 2MQHA 3K7AH 4O0AA 5EAYA 4JC0A 2PQAB 4Y7NH 2D62A 4LUOA 5IE8A 4P71A 4DK3C 2AMCB 3ULJA 4OX9Q 3HOUH 1L1OA 3K8AA 2CFMA 4HJ7A 2K5VA 1B2OA 1PH4A 1VQNA 3HKZG 1R0JA 2N49A 3RLFA 2QA4A 4Y52H 3GTKH 2OWOA 1HZAA 1E1TA 3I55A 1VQLA 3ICEA 3GD7A 3JC63 4UP9A 4JI8L 2JA9A 4JI0Q 1RDVA 1PH3A 3MXNB 4A93H 1X3FA 1O7IA 2A19A 2L15A 4P72A 1G51A 2ES2A 1B70B 3CC2A 3PO2G 1JB7A 3I4OA 2YTYA 3UDIA 3HKZE 5C44H 1PYSB 2CWAA 4TQUS 1OXTA 3M7NA 2OCEA 4POFA 4A75A 1C7YA 1ZRPA 4LF8Q 1YHBA 4R4QA 3KYHC 5JJLA 1PYBA 1J5EL 4LF7Q 2UXDL 1CUKA 3CD6A 2OTJA 2N8NA 3HOZH 1E3PA 1TWFH 3NELA 1SE8A 2ZTDA 2BH2A 1S2ZA 4BBRG 2D0PA 4IJLA 3PIOA 3F2BA 4LF6L 3I4MG 5JJIA 1YHAA 5J3BA 5AI3A 2QL0A 5M5YH 1BFYA 1L1OB 3GDEA 1PA6A 1HR0Q 4JI4Q 4JI5Q 4B3RQ 3CAMA 4KHZA 1HJPA 4R4IA 5FLMG 4DR1L 3S2DH 1QYBA 3HOXH 4A3MG 1YZ6A 4GS3A 2PVEA 2Q2TA 4JBMA 4YCUA 4DV7Q 1QVGA 1V1QA 2UXCL 3CQZH 3QVDA 1OXUA 3EIVA 3RN2A 4WJ4A 3PIPA 4L5QA 4JI3Q 2UU9L 4A3GH 1SFOH 3CCVA 3ERSX 2ZJPA 3E9IA 1CKNA 1HZ9A 1S72A 5AI2A 2JK8A 2RHQB 4LUVA 3CXCA 1E1OA 4HJ8A 4A3JG 3CC7A 4YY3L 1Q86C 1J5EQ 2MO0A 1N9WA 4LF7L 4DUYQ 1YVCA 2RHSB 5IYCG 4C2MH 3FKIH 2FXQA 1SRUA 2JQOA 1KC8C 2Q2UA 3UE1A 2NVQH 1AE2A 1HR0W 4X62L 3J81c 1IU6A 3PO2H 4R4TA 3HOZG 5IYDH 1KRSA 3UE0A 3K7UC 1ASYA 4B3TQ 3PF4A 3TS2A 4DR3Q 3Q8DA 1RYTA 3GTOH 5JEAG 4POGA 3SS2A 1LUZA 2B29A 2LXJA 1JJCB 3K0XA 5FLMH 5IYBG 3PO3H 2BA1A 3BU2A 1VQDA 4A3EG 3ULLA 3S17H 3E9HA 2CWPA 3L7ZC 1MJCA 4LUZA 1Q7YC 3U50C 4P74A 1NJIC 4QY7A 1CKOA 1N33Q 4AR5A 4DR2L 1Q81C 1IZ6A 1TWAH 1RIPA 4NXNL 3UDGA 1M90C 4B3ML 4JI6L 3PUZA 4A3DH 5C4XG 3CC4A 2KHIA 3KF6B 4DR1Q 4LF6Q 3HOXG 2JA6G 4IFDI 4DR7Q 4DV4Q 2CCZA 3CPFA 3AQQA 1LTLA 3CMAA 2PI2A 1YI2A 1RDGA 3BZCA 2ZM6L 1I94Q 3L2PA 2Q2IA 2YTXA 2ZJRA 1LM0A 4HJ5A 1IROA 1A8VA 1YUXA 1KRTA 4JBKA 4AR4A 3PF5A 4IFDJ 1IL2A 1I94L 1X55A 3AFQA
chains in the Genus database with same CATH superfamily
3QOLA 2D5DA 4AI3A 1W3SA 2PI2E 4Q5VA 2M6PA 4JI2Q 1Y8OB 2F0TA 2HQLA 3IRBA 3KBGA 3BZKA 4DV5Q 2JE6I 1VZHA 2R7ZB 1Q90A 1PXUA 3BYYB 3RMHA 4RXNA 3HKSA 1I50B 3I56A 2R93G 4FDBA 4GKKL 3BDCA 5LMUQ 3HOZL 2WKCA 4RMFA 2JA7G 2IW3A 5G3LD 4AQYL 2UUCQ 4FYDA 3WWLA 1JYBA 1DX8A 1MSGA 2R61A 3PUVA 1C0AA 1PZKD 2YU9H 3C46A 1VMCA 2MPMA 2ERSA 4GZYC 2WAQP 2NVXL 4LWCA 3K59A 1I50L 1QQTA 3S1RH 3HOYH 3HOVL 4OO1I 4O2DA 1CA6A 2RDHA 2IY5B 2PCFB 4DR4L 4FF4A 2IX1A 4KN4C 1H9RA 1Y8PB 2AQCA 3PIP1 2CKZB 4UPAA 4JI5L 1FHMA 1EZ6A 4N9PA 1EIGA 5IGGA 1D2BA 1XMQL 1SNMA 2N55A 2CQOA 2IHFA 5C44G 4NB3A 2LKVA 4DK0A 1X3EA 4GKJQ 4C3JB 3NBHB 1VF5C 4JYAQ 2B3GA 5T1GA 3J81i 2E2JL 4YHHL 2B2VC 1X32A 1YIJA 2I0QA 4GLVB 5FLXE 4A3DG 2KCCA 2G9HD 4A3FB 2MS3A 4LHNA 2F03A 4B3TL 3P20A 2V1CC 3BVGA 4I7AA 2XJQA 4IOAA 1KDBA 3RZDH 2L0CA 1SNOA 5FOBB 2JN4A 4JI7L 1W2BA 1CZWA 4DNIA 2K4KA 4C56C 2NVXB 5C4HA 1PH2A 1LYLA 1H9SA 5J22A 3S1NL 3DWAA 3A8KE 3BVZA 4KK7A 4ME3A 1PMRA 1U0LA 1D7QA 5IT9E 5I9PA 5I4DA 1NBWA 4RG1A 1WCMH 1SROA 2R6GA 2EYOA 2B63G 3GTLL 4LFBQ 2EY4E 5C3EB 2Z6BA 5ELFA 3GTPB 3CF5A 2I07B 1BNZA 5H1Sc 2NB0A 3S15B 2L11A 4WRDA 2GVAA 4X64L 2WB1E 4NDXA 3ZYYX 4APVA 3S1NB 1WJVA 3DM3A 5BN4A 2HHHL 2E8GA 5EQ0A 3VR3A 1S30A 1Y14B 1WD0A 3CCUA 2KBNA 5D3DA 4DAYB 5MFPA 2K2DA 5C6AA 5LMNL 3FEWX 1F2ZA 5AJ3L 2XJTA 1X9NA 1ENAA 5D65A 2NBFA 2J0TD 5M5XH 1HQMC 1JCKB 3J80L 2WAQE 2NVXH 2UUAQ 4Z9CB 1HCZA 1NCVA 3I4NG 4JOIC 1WTWA 4TVAB 2AQ3B 4ZYSA 5M3MB 5C0XJ 4OO1H 2WAQG 3ZJYC 3JAMi 1B1ZA 4KD4A 4A3CG 4KJOA 1VF7A 1VDZA 3FP9A 1XTDA 2DJFC 1II3A 1Q46A 2JA5L 2Z6KA 1SE2A 2IX0A 3ITPA 3GTQL 2N78A 4GNXA 4BWGB 3RZOB 1T9OA 2GMGA 2UUBQ 3CCLA 4JOIA 2JA8G 4TKOB 2KECA 1VMPA 2O5IC 1N34Q 3OOCA 2A8VA 2R7ZL 3GTGB 1X6OA 1PTOH 4RGNA 2A68C 4RFBA 2EJMA 2H5XA 4LFAL 5EIOC 3A8IE 4X3TA 1V43A 1YJNA 1VQ5A 1TWHL 1JOKA 2EYLA 4RA8A 4FF2A 1S5FD 4DV4L 5JJKA 3D3RA 3LWEA 4GKKQ 4IPGA 2H12A 4JBJA 3CU7A 5M5WH 4JG2A 4KY5A 4DV7L 3HOUB 2SNMA 1CADA 2C5CA 1IHZA 4EX5A 3I72A 4C3JG 1SNDA 1RTNA 1ENFA 4UP7A 5C44B 1BCPC 1GUGA 2XWBB 1K9MC 5FLML 1D5XC 2F3WA 3FRPB 1DYQA 4F7XA 2JSOA 4OIKA 5M3MG 1EUJA 1U4RA 2Q8IB 3BDLA 4ZKCB 3A44A 1R0HA 2NYZD 3I70A 4K8IA 5EBCA 5BN3A 1PH8A 4X3UA 1NXGA 3CPWA 3G71A 2JA8L 1PDQA 4MZ9A 3FKIL 4RKLA 1HXYD 1N33L 5IYCH 5BR8Q 4B8CD 4B3MQ 1LKPA 5C3XA 3VYSA 1VCIA 1KTKA 3PIP3 2KOLA 5L37A 5IGBA 3CRKC 5JEAH 4JI0L 2B2YC 5ELEA 1NE3A 3HAXC 2FFKB 1YUZA 4HJ9A 3PL5A 2IPKD 1JQYD 1SYEA 1B7YB 2K05A 2EOTA 3STBD 4PMWA 2BA0A 4KTAA 1QZHA 5GADC 1KD1C 2F0EA 1QG7A 4IUNA 2J7ZA 1F9QA 3K80C 1V1OA 3GTQB 1LO5D 1QJOA 2YYZA 2UU9Q 3HOXL 1XNRL 1JE5A 1XPUA 4M8AA 2AUKA 2NZOA 5ELDA 1TWCL 1H7VA 1WJJA 5TSSA 3S2HH 1I6HB 3HOVG 2VZAA 1MHWC 4HIMA 2NN6G 4CBVA 1H9MA 1A15A 5AN9H 1ZYRC 3PKJA 4DPGA 4H02A 3MXNA 4A3CL 1VQHA 4GN5A 1FD7D 2K5NA 4A3EH 1CK1A 5CBAE 4B3SL 2J4XA 3KF6A 2L5TA 3HRZC 4CJ2C 4DR3L 5CV9A 1BCPF 4X62Q 4BY7H 2F0OA 2C6BA 4LF5Q 1P16A 1N36L 4KV6A 4B3SQ 1GKHA 1MJEA 1F2LA 2A74C 1K0SA 2Q2HA 3TP6A 3HJYB 1BO0A 1JJ2A 2DGYA 5M3FG 4K0KQ 3HOUL 7RXNA 4JAFA 2NVTL 1ICFB 2ID0A 1OWBA 2F4VL 3J7AF 2EQSA 3MSUA 1OTCA 2JI3A 1EFWA 1AP0A 1RB9A 4WFN1 3UI2A 2A6ED 1D6EC 3S24A 2EYHA 2F0GA 5C4JB 2OXPA 4IPHA 4A3MH 2HDLA 2BDNA 1X3GA 4XQJA 3IU3I 1FL0A 1J6QA 1V9PA 3H0GL 1BQ9A 2EYPA 4JW0A 3H3VH 1WVLA 2N88A 3K7AH 4O0AA 1CQFA 1LTBD 4JC0A 2PQAB 2D62A 1T5XD 4P71A 3A7LA 3HOUH 1PH4A 3K8AA 2EYFA 1W6JA 4CGYB 3E6ZX 3HKZG 2QA4A 1WTXA 4IUQA 3RZOL 4KKSA 4JI8L 1O7IA 1Y1VL 3PO2G 1B70B 1MSHA 1WD1A 3I4OA 3UDIA 2CWAA 4TQUS 1OXTA 3Q6SA 3V05A 1ZRPA 5JJLA 4A3EL 5J1ZA 2ERJA 3VYRA 1B50A 3H6MA 2NTSA 4ME5A 1EWCA 4A3MB 2KVMA 2PSMC 1CUKA 2OTJA 2N8NA 4ZK9B 3EROA 1TWFH 3HOZH 3NELA 2ICIA 1TWHB 3F2BA 1ET6A 3J7Y1 1L1OB 4JI4Q 4JI5Q 4R4IA 5FLMG 3VR2A 1QYBA 5ISRA 3HOXH 2F0UA 4IZ8A 4BY1B 3IFTA 4C2M1 4XXEA 2UXCL 4IUPA 3EIVA 3RN2A 2K28A 3PIPA 4A3GH 3CCVA 4XDXA 1O78A 5C44L 1S72A 2JK8A 2PYKA 4LUVA 2H1EA 1A2UA 1OWCA 1J5EQ 2MO0A 3GV6A 4C3HB 5J39A 3T51B 3VR4A 1NUCA 1BDOA 4C2MH 1HR0W 1HUMA 1LLRD 1PFBA 3T53B 1IU6A 1Y1WB 3UE0A 3K7UC 3HKZP 1ASYA 1STGA 4B3TQ 3PO2L 3PF4A 4CHTB 3WDNA 4ZLTF 2VXWA 3GTOH 5IYCL 4AYBB 4POGA 5M5WB 2B29A 3C2PA 1JJCB 3D8GA 5IYBG 3PO3H 1AN8A 3HOXB 3MFGA 3BU2A 4QMGA 4X3KA 2YU9B 1SEBD 3S17H 3N52A 3D4DA 2VUML 4J6HA 2XJVA 1OO9B 1NJIC 1N33Q 1Q81C 1TWAH 1M90C 4A3DH 4QCLA 3WOFA 4B3ML 2K5QA 4IUVA 4K14A 4FVMA 4JVZA 2WB1B 3J81E 3HOXG 2CCZA 4NMZA 1K3BC 3AQQA 3CMAA 4IUUA 2PI2A 3BZCA 2SDFA 2QDLA 2YTXA 4CDDC 1UEAB 4HJ5A 3K5LA 1YUXA 4LMQD 4JBKA 3PF5A 1I94L 5M5WL 4A3KL 1AEXA 3K81C 4A93G 1C9OA 3Q22A 1PZID 2WIIB 3S2DB 2B2WA 3AFPA 5E7NA 4XT1B 2L0ZA 2F52A 4K9FA 1R4QB 4DK1A 2ZTCA 3FVQA 5KNDA 1I6HL 3H0GG 1I50H 3L0OA 4RCNA 1SFOB 3NE5B 4LF4L 2HHHQ 1ZXTA 4FXDA 3SR1A 2IT1A 4DK6C 3CHBD 1EIYB 2RCFA 1NXEA 1CAAA 2HQEA 4AR3A 5FO9B 3B08B 3Q0AA 3S17B 4GOPC 2F0HA 4YY3Q 1Q82C 1N8RC 1YV1A 2Z6KC 1D8LA 2FJ2A 4IUTA 3CQZB 4OWWB 1YNNC 1FJGL 1MI2A 1VQ7A 1SFOL 4AR6A 5JOBA 3S1MB 4CKBA 3RN5A 4EGVA 4DV5L 1FNWA 3NK9A 5RXNA 5FO7B 3S16H 4OL7A 2QKIC 2ENBA 1B2JA 4LAAA 5KRUA 2I5MX 4NKLA 1TWGB 4MHEA 1TY0A 2HIXA 3NQIA 3GTMH 3VYTA 3U58A 1GO3E 2JA7H 5KEEA 1CM9A 3RZDL 2LMCB 3F8TA 4JI6Q 3S16B 3M4OL 3S14H 3OW7A 4LF5L 1AW7A 4P73A 5DEHA 1FGUA 3GTKL 3F2UA 4A93B 2KJXA 3CCSA 4O1NA 1EOTA 1JB3A 4CJ1B 1PTOC 2CVRA 5C4XH 4HMIA 4CKEA 1X65A 1K8MA 4XXBB 3K57A 4JI2L 5EGTA 4X65Q 1I4RA 2ZTEA 1A2TA 3NENA 3RZDB 3A56A 1RHPA 4LW1A 5IP7H 5ELCA 4DUZQ 1QE6A 2RFKB 2VS1A 5ELNA 2GVBA 3PKIA 1JT8A 2V4DA 2F3IA 1BCPB 1JWSD 1VQEA 3TEHB 2OTLA 2VUMG 2VL6A 2NN6I 1LTAD 1IBML 3C1EA 1PZXA 4BY7B 1X3QA 4A3IG 1VQMA 3HOYL 4DFAA 1LT5D 1SMYC 3G6EA 1I3QL 3D4WA 1TS2A 3HKZB 3CMEA 2PNHA 3ONAB 5FJ8L 2AQ2B 2EY2A 3UDXA 1MKHA 3K7AB 2IX3A 4X66Q 3LGJA 3IAYA 3S16L 1F2YA 5K36G 1Q1EA 2PMZE 4KLKA 4FO2A 3GTKB 3B6YA 5K2ME 5GQOA 1B13A 1UE5A 2XIWA 1K8OA 1C4QA 3J80E 2WB1P 1YK4A 3I4ML 3HGBA 5CR3A 1T9HA 3OTOL 2R92G 1JOOA 3E3XA 1IW7D 2E2JH 1Y1WL 1R0GA 1YNND 1VCXA 1KQSA 2WB1G 3QJYA 5GAGC 3AU7A 3OPOA 2ICEC 2Z9HA 1W6KA 4QIWP 4HSPA 1L0YB 1IKLA 1MIUA 4OX9L 4MN3A 4QUCA 5MFZA 4DAMA 3SEBA 4EQ5A 3H15A 4UY8C 3OMGA 1WTQA 1BR9A 2F1MA 4TPUA 3M4QA 2JJQA 1XNQQ 3LWRB 1DCZA 2R7ZG 1HUNA 4OXPA 1SLJA 5MLC3 1HNWQ 2KA7A 1EQRA 2E2HH 3NEMA 4A3GB 3KF8A 2IWHA 3V96A 1Y1WH 2F0FA 1IBLQ 2CHBD 1EIHA 1ESFA 1HZBA 3BDOA 4JI1L 2PPTA 3BVMA 2F4VQ 2LCQA 3H94A 5HGQA 2B8GA 1TWCH 3KLSX 2XRSD 1VQCA 2VB2X 3BYTB 2B63H 4LF9L 1EIFA 4L6TB 2GA4B 3SXHA 1I4HA 1TWAL 4A3DL 1KNEA 4AIMA 2YTVA 3QG1A 1N34L 2ZJQA 1G6PA 5IP7L 5KYLA 3AEVA 2K6AA 5I2YA 1XWEA 1I4GA 4HIOA 1B3AA 1PH6A 3I4NB 2Z4IA 3S1QB 3H3VM 2B2VA 3SGIA 1B4OA 1UE1A 5M9OA 2JYOA 3W2DA 4GN3B 1N32L 5GROA 2FMMA 4GOPA 1VQIA 4R4CA 2KKDA 5MF6A 2E2IB 4NW2A 4R9WA 5IODA 2KCTA 1XPRA 1SMYD 4PZ7A 1QCVA 2O4XA 4HSVA 1PFVA 1G2TA 2DSXA 3KUPA 2NVYL 1ICWA 4G57A 4Y7NB 2MGSA 1XMOQ 3WWNB 1F2MA 4AYBE 2V0EA 2F0VA 2F0QA 4A3GL 3PQIA 1KAWA 3RLNA 4YWLA 2E75C 2K14A 4I7ZC 1HNXL 3I4NH 4DV1Q 1LT4D 3KDFB 3HOVB 4A3BL 5IP9H 5C4ZA 2CKAA 4DUYL 2X69A 1KLUD 1Z7TA 2MFIA 4BY7G 3MA2B 1TS3A 4TVMA 1SNCA 2AYJA 1EWIA 4QL5A 4IOCA 4A93L 5LL6S 1RODA 4C1NK 4A3BB 4DV6L 5D14A 3NQTA 1IL8A 1R4PB 5LMNW 2SNSA 3PUYA 1ET9A 2M6OA 4DKAC 4E6IA 4BS9A 5E4XA 3IKJA 3EQLC 4ZAIA 1HNXQ 4JI4L 1VQ4A 4A3BG 1PTOF 4Q0FA 4A3EB 2BDOA 4UAIA 2SOBA 1E24A 2KENA 1BF4A 3PO2B 4DR4Q 3S14B 2PQAA 1SMXA 3OWFA 2JA6H 3JAMc 1JR0D 1O80A 1OXSC 3SVMA 3H09A 4R4OA 4TRDA 5M3FB 5DM73 2UUAL 3G4SA 1BOSA 2KEDA 4CDEC 1DVBA 2NZ1D 3GO5A 3U9OA 3NPPA 5CV5A 1XPOA 1XTCD 1BQQT 1HTPA 2KUMA 2EZVA 1DGSA 4KKUA 2MP1A 3NXWA 1I6HH 1SJHD 2OF1A 2KN9A 2BCOA 1EQVA 1FHHA 1Q1BA 4HTHA 3OYYA 4PG3A 3I4MB 3DWPA 3KF8B 2QCPX 4YCWA 3HOYG 3ERQA 1KABA 3R93A 5IWAL 5IP7G 1OXVA 1FGBD 3PZAA 1S5BD 1PFWA 1B71A 1GXDC 4DNTB 3OWEB 3J7A5 4GNXB 3R3OA 4B9XA 4PZ6A 2L55A 5DM63 3KJPA 1ODHA 3CRLC 4RGTA 1BCPD 1QVFA 4N8FA 2Z3QB 4JI1Q 3K5MA 4JBWA 1GOZA 2Z4HA 2WFWA 3I7FA 5JAVA 3FPPA 1CKNB 1TKWB 3TBIB 2QEXA 4QF4A 2M4VA 3KYVA 2KEEA 2EE1A 2MQHA 3O13A 1EQTA 4OX9Q 2TSSA 1RJTA 1SNPA 4HJ7A 1GUTA 1DONA 1R0JA 2EXZA 5IGEA 3GTKH 2OWOA 1HZAA 1E1TA 3ICEA 1RDPD 2E2IL 3P1HA 2JA9A 4QIWB 3VA7A 1ONLA 1X3FA 2L15A 2A19A 2K04A 5C4JL 4RAUC 2ES2A 3CC2A 3SE0A 1PRTF 4C3IL 1HTLD 5C44H 1PYSB 1A6XA 1E0BA 3M3YL 3GTML 3M7NA 4POFA 1C7YA 1JOQA 1YHBA 4R4QA 4ULLA 4F88A 3SK4A 1JORA 5CV8A 4LF7Q 1PTOB 4FNFA 4XYQA 2UXDL 3CD6A 2R92L 4HCSA 3X3NA 1HRJA 2XJUA 1TWAB 2ZTDA 4A3DB 1S2ZA 4IJLA 4V190 1ZEQX 3I4MG 5JJIA 1YHAA 5AI3A 2QL0A 4KN7C 4DNRB 3HOYB 5E3FA 4B3RQ 4DR1L 5FO8B 1I4PA 4GS3A 4LJZC 2PVEA 1F9PA 1LTID 3QVDA 5CGKA 2F3VA 2IJ0A 1TU2B 5DM61 3LWQB 4JI3Q 5EINC 5IGDA 3GTLB 2LS01 3E9IA 1CKNA 4A3ML 1E1OA 2O5JD 1LT6D 1Z92B 1E2VA 4YY3L 5IYCG 2PZUA 2FXQA 2Q2UA 3MEHA 1XXGA 3UE1A 1AE2A 1V1PA 1V8QA 2NVQH 4R4TA 1KDCA 5IYDL 5IYDH 1JWMD 4K8JA 4AI1A 3Q8DA 1C8CA 3MXGA 1LUZA 3K0XA 2SEBD 3MFYA 2EDGA 1I6VC 2IL8A 1MBYA 2EJGC 3ULLA 2NUCA 2CWPA 3GTPL 1EY5A 1SJED 3HEJA 1Q7YC 2XJRA 4P74A 1NNXA 4QY7A 1CKOA 4AR5A 1G91A 3UDGA 1RIPA 2M00A 3GP7A 3K58A 2KHIA 3J7Z1 1E2WA 2Q8RE 4IN3A 1YI2A 1ILPA 4RCOA 5A35A 1LM0A 1WCMB 3W3AA 4L63B 1GUNA 1X55A 3URYA 2NVQB 4KMUC 2DNCA 3TS0A 1H95A 1GUSA 1A62A 1L1OC 3R8BA 3GTOL 4IQZA 5IP9L 4A3BH 5EPKA 3NBHA 1EEID 1VQGA 4DV3L 1BRFA 4EQPA 2PPBC 3S15H 4AHZA 1KDAA 1I5FA 3IFDA 2VB3X 4I65A 3GTPH 3NHHA 1STAA 1X54A 4IURA 1ASZA 2HIVA 4PMBA 4IO9A 1HR0L 3AMUA 2CH4A 1SE3A 1CHQD 2E74C 5A2QL 4DV6Q 4K5VA 3M3YH 4KKTA 1RYQA 1B9NA 4A3CH 1EYDA 1Y1VG 4C3IH 2QF7A 1YJ9A 1HQRD 4PMCA 2K5HA 3L3OC 2R7FA 1N36Q 5M3MH 3CKIB 4A3FL 1PRTC 1V1PB 5CMDA 2EY5A 3HOUG 3CW2C 1C48A 5JJZA 4WORA 4DV0Q 2ZXOA 5M5YB 1U4MA 1AFPA 1B53A 3WWVA 2Y0SB 3OHXC 1D1KA 2RDVA 3TZDA 5CC4A 4G7HC 2ATWA 4R8IA 3PIO3 1PFNA 2PZWA 3HOZB 2R7DA 3J80i 1BVSA 1TS5A 5IYBL 1EY9A 1G2SA 1QNUA 3H97A 2Z1CA 2K5WA 5GAEC 3RR5A 1XNRQ 1F9SA 2FHTA 1UEBA 5BN5A 1LACA 3KOJA 4S3SA 1VQPA 2CKCA 1UWVA 5EBDA 1WCML 1GD7A 1IBLL 3TZUA 4O42A 2WP8J 3NP8A 5JVG1 2RF4A 3MXPA 4FF1A 2AWNA 2MUYA 2R92H 4HCEA 5M3ML 3C3LA 4XGHA 3CCQA 5HURA 3TRZA 3NTIA 1VS0A 2L1BA 1TY2A 4GOPB 2K75A 2DUDA 4X65L 1NSNS 2WINB 3NWTA 1J9OA 4A3IB 3SK8A 1R0IA 5LMUL 1SMUA 3T1YQ 2E5LQ 1AH9A 5AJ3Q 1HNZQ 1SR3A 3HOWH 3MHBA 4NXML 1WFQA 3VA5A 1C09A 1SYCA 3KBXA 2AUSB 3Q24A 1EYCA 3NSWA 5HY6A 3SK6A 5K5PA 5IT9c 3H99A 2OQKA 3U9SA 1A3TA 4FXGC 3RD4A 1CTMA 2N3SA 1JWUD 1IRNA 1LV9A 4BBSH 1HH2P 5KYIA 4AI0A 1LT3D 3KYYA 2AWOA 3FMCA 3D6WA 3BZDB 4R1JA 4XT3B 4DUZL 2R92B 4BA2I 4DR7Q 1Z6HA 2NVTH 4XTCS 2UXBL 4DR6Q 4XYOA 2V0FA 4AYBP 4H44C 1PH5A 2JEAI 1E7ZA 1MGSA 4NXNQ 5GAHc 5G3LF 4OWTB 3A5UA 2A69C 5IYDG 2BE5C 3KLRA 1Q8KA 4FXKC 4B3RL 1K28A 1UNSA 1F4LA 4A3JB 1STBA 3M4YA 1PH1A 1Q8IA 2MO1A 2R7ZH 4DV2L 4KY7A 1IU5A 5M3FH 1T9QA 5M5XL 3GV3A 3P2AA 1SN8A 3W1BA 5JVG3 3HG9A 4DU9A 3QOJA 1E2ZA 5F2DA 3GTQH 2HCCA 3I4LA 2AKWB 3DUZA 3FHWA 4JADA 3P7JA 2XGTA 3PO3B 1LTGD 2CW0D 4JAGA 3TP5A 3GTJB 3SHLA 3GTMB 3PWFA 1JMCA 4XQNA 3A5ZB 2OQ0A 4P75A 4CDFC 4NPSA 4RHSA 2XJPA 1T5EA 2EVBA 3BJUA 3MWYW 4QIWE 4HIKA 5C5LA 4FF3A 1RKNA 1AZPA 5JEAJ 3TMEA 3AYHB 3HS0C 1EY0A 1XMQQ 1XNQL 3SK5A 3DWQA 2L9HA 3BS1A 4N8X1 3KYUA 1E8JA 3NWSA 1JC7A 1CSPA 1PH9A 1BBWA 1L0WA 2TMPA 1FNUA 3RZ6A 2E2IH 1CKMA 4LF4Q 2I5HA 2DJGC 3P8BA 2PMZP 1PLFA 3AB9A 3KYXA 4AH6A 1GUWA 1KXLA 4K0KL 4DAVA 1GVPA 1L0XB 2ZIXA 4LF9Q 3JR7A 4EQOA 2RDGA 3OMCA 2HT1A 3MEFA 3HOWG 4LHLA 3GQBA 5K36H 5GAEc 1SMMA 3LNLA 3BG3A 1LTTD 1K8GA 2VQEQ 2R93H 1UE6A 3S1NH 2F0IA 1FVIA 3VR5A 1HNWL 1HFNA 1B9MA 1QILA 2K1BA 1SYDA 1NNQA 2DY7A 1S5ED 4ZQ3A 1YHQA 4AYBG 3I2ZA 2L4NA 3F2CA 2VY3A 3LPEB 3RUZA 4ABNA 3VDYA 3CQZL 2Z0SA 3PUWA 4ALPA 4X6AH 4DV3Q 1DOLA 2NVYH 3E5SA 3KLWA 3M9BA 3M85A 1QVCA 1DD2A 4ZUJA 2V3BB 4RKBA 3A54A 1VQ8A 1KLGD 3B0AB 4JCVE 1DZ1A 2HUGA 2B2TA 1A3UA 3F1ZA 4GLAC 4JI7Q 2F0WA 3H9BA 2ZM6Q 2EYMA 3RLOA 3PSIA 1STNA 2HR5A 3ND9A 2JA6G 1QUQA 2AHOB 3W5OA 4A76A 3OW2A 4X64Q 4ZUIA 4A3KH 3U4ZA 3H0GH 3PGZA 3DM1A 3J81j 2JP1A 5NUCA 1NY4A 1EYGA 4DAYA 3CCEA 3DEPA 2VW9A 1QZGA 5FKAC 2ALYB 3E0JA 4AHYA 4DN4M 2AUJD 3T13A 5C4XB 3HOWB 2EIFA 1RCVD 3S17L 3S1ML 5C3EH 4BBSG 2HCIA 1PVOA 1J8IA 1VQ6A 4BXXG 4KD3A 4UHVA 4UP8A 2KCMA 4MTKA 2PVXA 4A3FG 1B2TA 1Y8NB 2PO4A 3U4VA 1B3QA 4OEMB 4Y7NL 4IALA 3S2DL 4CDCC 3MTSA 5C0XG 2C9OA 1LABA 3IL8A 3CP0A 2K52A 3MPSA 5C3EG 3S1QH 3QR8A 5AFWA 1O7YA 1TWGL 1IYVA 2JA6B 2WV6D 1JJGA 4KHPL 1WCMG 2UXBQ 3MVVA 2NYDA 3WOEA 3H3VC 4DR7L 5CYUA 2RSNA 3A74A 1TQOA 4ODGA 4OWXB 1QUQB 2EY6A 4QGUA 1SMWA 4A3IL 3KJOA 2NVTB 4YIJA 3EJIA 4K5WA 3I4MH 1EY6A 3I90A 4DXGA 4A3LH 2M9VA 3QB3A 4Y52L 4DV2Q 1G291 4J15A 3FDTA 1LKMA 3R2IA 3M4OH 1SDFA 3ER0A 1K83L 4IJHA 3MAQA 1KHIA 3DHQA 4BY1H 3HOWL 1HNZL 2B8FA 1G6ZA 4C1NI 2A6HC 1NMGA 3CCMA 3FPUB 2P5ZX 1L2FA 2RQXA 1HFGA 4C3JL 1KNAA 2CR8A 1CHPD 3I73A 5H1SE 4IPCA 1TWFB 4V0BA 1R9TB 1GJXA 1EYAA 2VQFL 4V196 3ND8A 4F8MA 1LTSD 3K5OA 4KJNA 1Y69U 2WACA 1FNVA 2JA8B 2OEOA 4C3IG 1EOVA 5KNBA 4ZRZA 4LUOA 5IE8A 2AMCB 2NTTA 2RKSA 3K7AL 2CFMA 2K5VA 1B2OA 1SBBB 2N49A 1ENCA 3RLFA 4Y52H 4C3HG 1CA5A 2WAQB 3LWPB 3GD7A 5IGFA 4G7ZC 4JI0Q 3MXNB 3S9WA 2NWGA 5C4XL 1JB7A 3HKZE 4JAEA 4DF7A 2H4OA 2OCEA 1QB5D 4TSSA 3I91A 2C6AA 5EPLA 3S14L 2G9DA 2X6LA 1LTRD 2R3ZA 3QIAA 2BH2A 4LF6L 5M3FL 5ELBA 2PNRC 1EY4A 5J3BA 5M5YH 1BFYA 3GDEA 1PA6A 1HR0Q 1IKMA 3CAMA 4KHZA 4QQBX 1IW7C 3S2DH 4A3MG 1R9TL 1YZ6A 1O7LA 4XQQA 4JBMA 1QVGA 1V1QA 3CQZH 1UAPA 4R8NA 3H0GB 1SFOH 3ERSX 4K2LA 3FDJA 2ZJPA 5C3EL 3LWVB 5AI2A 2RHQB 5DNFA 4HJ8A 4A3JG 2R93L 1SYBA 4ILWA 3CC7A 3GTJL 1ILQA 4LF7L 4DUYQ 2RHSB 4OIJA 2JQOA 1SRUA 5I9OA 3TDQA 4X62L 1MD2D 3J81c 3PO2H 3ZG6A 2ZXRA 1SAPA 2FINB 1VZIA 4X3SA 5JVH3 2JXMB 4ZN1B 5JPNC 1S5DD 4P2CB 4KY6A 1NR4A 2XSCA 5JEAG 5M5YL 1WTHA 2LXJA 5IIFA 2O2LD 1VQDA 4BXXL 2K01A 3E9HA 3L7ZC 1F77A 3MXUA 5E1FA 2BE5D 1ZKOA 2JI2A 3U50C 5LL6X 1DOKA 3KF6B 4DV4Q 2ZM6L 3QQCE 1H9KA 1IROA 4IFDJ 4G7OC 1IL2A 1DM0B 1Q3LA 4DXFA 2JA5B 4K6LA 1S24A 4LNQA 1VQ9A 3J7AV 2LSSA 3DLLA 4B08A 4HJAA 1YITA 1Z47A 4H13C 3J81L 1KIXA 3D0FA 5GADc 3T1HL 1M8AA 3M3YB 4U68A 4A3KB 4U671 1XX8A 2B39A 4ZN3B 2RBMA 1YNXA 1RD9D 3D31A 2F0MA 1UE7A 4L8JA 5EPJA 2JI1A 1A0IA 4MTNA 1G8ZD 4RHRA 5BR8L 2B2YA 4RGMA 4GKJL 2VNUD 2E2HL 4H0LC 1HHVA 2F4IA 4AHXA 2I5LX 2VQFQ 2CH4W 1X56A 1XJVA 4UDUC 2VUMB 3T4AC 4BXXH 2Y0SE 1PRTB 4YCVA 2F0LA 2K50A 2RSOA 1R0FA 2KHJA 2PMZB 3A8JE 3LX0A 2A69D 4LFCL 2YV5A 2R93B 4C3HH 4HIDA 1T9PA 3JC62 4DGZA 4KHVA 3GTJH 4BBSL 4N9TA 3A55A 4A3LG 4PZ8A 4U673 1QWYA 2PW7A 1PHJA 4RH6A 3EN2A 2EXDA 1XYIA 4L5SA 3EVQA 1VQOA 2D2CC 4LFAQ 1GM5A 1PFMA 2D9UA 1K73C 1D1IA 1WI5A 1P8LA 2QEJC 1Y1VH 1R9TH 2RDFA 1BUVT 2Y0SG 3MZ5A 4KHPQ 3S1RL 5HGTA 4JPBW 5IWAQ 1RTOA 5FJ8H 2LY7A 1YBYA 3VYUA 1EL0A 1BXTA 2KHSA 3FKIG 4BY1G 3JC66 4RWSC 5IT9L 4OO1G 2A73B 3W1GA 1EWHA 3NUCA 1HA5A 3S1MH 5CORA 4BBSB 1K3RA 1GUOA 1SE4A 4GNXC 2LXKA 5GAHC 1AE3A 2NVQL 1CQVA 4K2KA 4JV5L 5MGNA 1NTGA 4XIGS 5KIXA 3C1FA 1IBKL 3E0EA 1DJRD 2WKDA 2NZHA 3J80c 2X6GA 4QB4A 1HPCA 2XN9C 2B2WC 1ESRA 2LFNA 1PFSA 3PO3L 2XWJB 4L5RC 2G5DA 1FJGQ 5LMNQ 4A3GG 2O5JC 6RXNA 1UUPA 2VQEL 1YNJD 1TT2A 2QILA 2OT2A 3I3CA 1BBXC 2A1AA 3RZTA 1VZGA 4OELB 1D5ZC 3EFXD 4JV5Q 1OXXK 2BOSA 4NP5A 3H91A 1WOCA 3HP3A 1I4XA 4JK1C 2Y0SP 4BY7L 4L5TA 3X3MA 2K03A 5FJ8G 3CCJA 2JA7L 4MNOA 5COYA 2M4YA 1H9SB 4LFBL 1CSQA 2JA8H 3UDFA 1CFMA 1HA6A 2UUBL 2J9UB 4LFCQ 2F0SA 1K83H 5C4JH 1JE4A 4UY81 3T56B 3M4PA 1YK5A 4JYAL 2JEBI 1VQKA 2L12A 2B2UA 1Y1WG 1Q12A 1B44D 3A0JA 5JVH1 4HN7A 3NFPI 5IY0A 1A3VA 3PV0A 3K5NA 5IOCA 4AI2A 4DV1L 2I46A 4A3IH 3EA6A 1TXYA 2E2DC 4G4KA 5DLQE 1K8AC 3M4OB 4DR6L 1RWDA 4A3KG 4B9WA 5KGUA 1NAPA 4IFDH 1NR2A 2ZT9C 1U9RA 3KDFA 4IFDG 3S2HB 1SYGA 4CJ0B 5I6WA 1EQQA 1TWGH 1PFUA 4LF8L 5I6YA 3S1QL 3P75A 4BA1I 3RZOH 3H3VI 2A6HD 2M2LA 4C3IB 4WFN3 4ID6A 2XJSA 1ZYRD 3KLSA 1Z9FA 2JA5G 1M4VA 3OTOQ 4YWMA 2NVYB 3HOVH 2K5DA 1EY7A 3KYWA 1O7ZA 3N6RA 4DV0L 4YWKA 4H7BA 4YHHQ 2A68D 3DXJC 3K35A 4AQYQ 2UUCL 2EJFC 1QCBD 4QJFA 2F0KA 4KI0A 4J1MA 2F0PA 5KNCA 2PYAA 5EJWA 2JA5H 2YU9L 4OONA 1S5CD 1E22A 2MNAA 2FMCA 2F0JA 1EY8A 3HZXA 3SDZA 1VQAA 2DNEA 3NBIA 4HAEA 1WTRA 2VUMH 3G7LA 1S40A 1KL9A 4CKCA 3H9CA 2KQ3A 1QNKA 3FKIB 2XNAC 4C2MB 2Z8LA 1IYJB 1TWCB 2B2TC 1EU4A 5EKLA 4C3HL 3J7ZC 5C5MA 1M1KC 2DY8A 3Q23A 1RL2A 4DR5Q 3EBEA 4A3JH 3RYGA 1TWHH 2GN5A 4MIUA 5C0XI 1STYA 5IP9G 3HFZB 5A2QE 2DN8A 2CW0C 3GTGH 1X3PA 4NXMQ 2EY1A 1HZCA 4X66L 4X6AL 1VQFA 4ZCKA 1WYDA 3JAME 5DAUA 5D3IB 4M1UB 1PV4A 4BBRL 3KFUA 3ULPA 4LK1C 1LKOA 2BH8A 3GTLH 2QGQA 2ZXPA 3PCOB 4PV1C 2ASBA 1BBUA 3GTOB 1SXTA 4DR5L 2K7VA 5CV6A 3QO2A 5ELOA 2IHEA 1PRTD 2RA4A 5LHY1 1TWFL 2XTIA 1A63A 3DMUA 3G48A 3TQYA 4DR2Q 1BE7A 4J8QA 3MQKB 1EU3A 1I3QH 3LNNA 4OGQC 3D6CA 1YJWA 2UXCQ 3NTKA 1YNJC 3D4RA 4A4IA 4GLXA 3T1YL 3R2TA 2E5LL 4HR7B 1AZQA 2E2HB 3G6JB 4FP5D 4C3JH 1PH7A 1IBKQ 2B5ID 8RXNA 1U4PA 2B63B 3QWNA 2UXDQ 1I3QB 1TR5A 2A5HA 3PUXA 1TVXA 1N32Q 2HVYC 4GN4B 4RGOS 5M5XB 3TN2A 3OIQA 4WJ3M 1P7PA 1DOMA 1STHA 1GHJA 4BBRB 1BKBA 4A3LL 3S1RB 3CCRA 1U5KA 5IYBH 3PO3G 3T1HQ 5T1IA 3F2DA 1S3OA 1YEZA 4JI3L 1SNQA 3VR6A 1K0RA 5EKIA 4JI8Q 3TREA 4EVOA 3RNUA 4PNYA 1XMOL 2RCNA 2B63L 4BBRH 3I8ZA 5C3WA 1BQ8A 4IPDA 3PIO1 3STBC 2K32A 5FLXc 1IXRA 2C35B 2A6EC 4A3FH 1SYFA 1K83B 4QUFA 1B8AA 1FR3A 1Y1VB 2F0DA 5JPMC 3PMFA 2D0OA 1IBMQ 1SSOA 1CI3M 1VQJA 1CT1D 1VQBA 1NMFA 2PZTA 5EKKA 1QOHA 1S4ZA 5EAYA 5E4WC 4A3JL 4EQNA 4Y7NH 4F87A 4DK3C 3ULJA 2Q8TA 3V2TA 1L1OA 1VQNA 3S15L 2Z3RB 1JICA 3LWUA 3T16A 2QW7A 1VQLA 4GS7D 5C0XH 3I55A 3JC63 4K5XA 4UP9A 1RDVA 1PH3A 4A93H 4P72A 1PTOD 2EPBA 1I4QA 1G51A 1IYUA 2YTYA 3MC0B 3S2HL 3TSSA 5CV4A 4A75A 4AHWA 4LF8Q 3KYHC 2RVLA 1PYBA 1J5EL 5FLXL 3I4NL 4DA2A 1E3PA 1H9JA 1PYWD 1SE8A 4BBRG 2D0PA 1ML0D 3PIOA 2HDMA 2APOB 1WTVA 2CQAA 3OSOA 1HJPA 4WJWA 3VPBE 3J7YW 1PZJD 2E76C 2PQEA 4PQXA 2Q2TA 1WTOA 2JA6L 2HD3A 4YCUA 3OIPA 4DV7Q 3TP8A 1STEA 1OXUA 4WJ4A 3L9AX 3LWOB 4L5QA 2UU9L 4HEDA 2XVSA 1EZ8A 1U4LA 2NN6H 5CBEE 3TP7A 1HZ9A 2JA7B 2F0NA 1TS4A 1FYCA 3CXCA 2QDBA 1EFID 2KCNA 5IGCA 4ZKBB 1Q86C 5CV7A 1N9WA 3K0YA 3M7GA 1YVCA 3FKIH 1KC8C 3KK7A 4HMJA 1D5MC 1RF2D 3HOZG 4BY1L 1KRSA 3HJWB 2MJ8A 4K6DA 3TS2A 5I2XA 4DR3Q 3DEOA 1RYTA 2PW5A 3SS2A 4OHJA 5FLMH 1WTPA 2E2JB 2BA1A 3K6OA 4A3EG 1MJCA 2EYJA 4LUZA 3A7AB 2XRQD 2AQ1B 2MHVA 1IZ6A 4DAPA 4DR2L 4NXNL 4E6YA 5C4XG 3JAML 4JI6L 3PUZA 3CC4A 5DM71 2B2UC 4DR1Q 4G6BA 1PFYA 3NTHA 1DXMA 5FK9C 4LF6Q 4IFDI 3CPFA 1LTLA 5GAGc 1EEFD 1F9RA 1RDGA 1TIID 1I94Q 1KAAA 1CZGA 2Q2IA 3L2PA 2ZJRA 1A8VA 1KRTA 1GHKA 4AR4A 2K33A 3GTGL 3AFQA
chains in the Genus database with same CATH topology
3TS0A 1S24A 3K81C 4LNQA 1H95A 1A62A 1L1OC 1VQ9A 4A93G 4AI3A 2LSSA 1C9OA 4A3BH 3DLLA 1W3SA 2PI2E 1VQGA 2M6PA 4DV3L 4HJAA 1BRFA 3AFPA 4JI2Q 1YITA 4AHZA 1Z47A 1I5FA 2HQLA 3IRBA 3S15H 3BZKA 5E7NA 2JE6I 4DV5Q 1KIXA 3D0FA 2L0ZA 2F52A 1VZHA 4K9FA 3GTPH 5GADc 1X54A 2ZTCA 3T1HL 1ASZA 2HIVA 3H0GG 4IO9A 1I50H 3L0OA 1HR0L 4RXNA 4U671 3HKSA 4LF4L 4DV6Q 2HHHQ 4ZN3B 3I56A 3M3YH 1YNXA 4FDBA 1RYQA 4GKKL 4A3CH 2R93G 4DK6C 1Y1VG 2IT1A 3D31A 4C3IH 1YJ9A 5LMUQ 1UE7A 1EIYB 2K5HA 4RMFA 2R7FA 1N36Q 5M3MH 2JA7G 1NXEA 2JI1A 1A0IA 4AQYL 2UUCQ 4MTNA 1CAAA 3HOUG 3WWLA 1JYBA 3CW2C 5BR8L 1DX8A 4DV0Q 4GKJL 2VNUD 4AR3A 3PUVA 3WWVA 1C0AA 2RDVA 3B08B 2YU9H 2ATWA 4AHXA 2I5LX 2VQFQ 1X56A 4GOPC 4YY3Q 1XJVA 1Q82C 1N8RC 1YV1A 2Z6KC 2ERSA 1D8LA 2R7DA 3J80i 1BVSA 4BXXH 2Y0SE 4OWWB 1FJGL 1VQ7A 4LWCA 4YCVA 4AR6A 2K50A 5GAEC 3RR5A 1XNRQ 3RN5A 4DV5L 1UEBA 3S1RH 3HOYH 1R0FA 2KHJA 5RXNA 3KOJA 1VQPA 4OO1I 4O2DA 3S16H 2A69D 2CKCA 1UWVA 2YV5A 4LFCL 2IY5B 4DR4L 1B2JA 1GD7A 4C3HH 4HIDA 2I5MX 2IX1A 2CKZB 3PIP1 1IBLL 4UPAA 4JI5L 2HIXA 1FHMA 1T9PA 2WP8J 3GTMH 3JC62 5JVG1 2RF4A 1GO3E 3U58A 1XMQL 2JA7H 3GTJH 2AWNA 2R92H 2CQOA 3F8TA 2IHFA 4XGHA 5C44G 4NB3A 3CCQA 4JI6Q 3TRZA 3S14H 4A3LG 1VS0A 4PZ8A 1X3EA 4GKJQ 4LF5L 4GOPB 4P73A 1PHJA 3NBHB 2K75A 1FGUA 2DUDA 3EN2A 2EXDA 4X65L 1G6PA 4JYAQ 4L5SA 1VQOA 2B3GA 4LFAQ 3J81i 3CCSA 1GM5A 4YHHL 1R0IA 5LMUL 1SMUA 1K73C 3T1YQ 2E5LQ 1AH9A 5AJ3Q 1YIJA 1WI5A 1P8LA 4GLVB 2I0QA 1HNZQ 1SR3A 5C4XH 3HOWH 1Y1VH 1R9TH 4NXML 4A3DG 1WFQA 1C09A 1X65A 2Y0SG 4KHPQ 4XXBB 5IWAQ 5HY6A 5FJ8H 4JI2L 2MS3A 4LHNA 1YBYA 4X65Q 4B3TL 5IT9c 2ZTEA 2OQKA 2V1CC 3FKIG 4BY1G 3JC66 3NENA 4OO1G 2XJQA 2N3SA 4LW1A 3W1GA 3S1MH 4IOAA 1IRNA 5IP7H 1K3RA 3RZDH 1HH2P 4BBSH 4AI0A 4B3RQ 4GNXC 2LXKA 5GAHC 4DUZQ 1AE3A 3KYYA 2AWOA 2VS1A 5ELNA 2GVBA 4JI7L 1W2BA 3PKIA 5MGNA 2K4KA 4DNIA 4JV5L 1NTGA 2F3IA 1JT8A 4R1JA 1VQEA 4XIGS 4DUZL 3TEHB 1PH2A 1IBKL 4BA2I 3E0EA 2OTLA 1LYLA 2VL6A 2NN6I 1IBML 2NVTH 4XTCS 2VUMG 2UXBL 4DR6Q 2NZHA 3J80c 2V0FA 4A3IG 1VQMA 1PH5A 2JEAI 1E7ZA 3G6EA 4ME3A 1U0LA 1D7QA 1PFSA 4NXNQ 3CMEA 5GAHc 2PNHA 4L5RC 4QQBX 3UDXA 1FJGQ 5LMNQ 4OWTB 1MKHA 3A5UA 5IYDG 4A3GG 1NBWA 1Q8KA 4RG1A 1WCMH 4X66Q 6RXNA 3LGJA 4B3RL 1SROA 2VQEL 2R6GA 2B63G 5K36G 1Q1EA 2PMZE 4KLKA 2A1AA 2MO1A 1PH1A 3RZTA 1VZGA 4DV2L 2R7ZH 3CF5A 1IU5A 4LFBQ 3B6YA 1T9QA 5K2ME 5GQOA 5H1Sc 5M3FH 1B13A 3P2AA 1OXXK 1SN8A 1UE5A 3W1BA 4JV5Q 2GVAA 1YK4A 2WB1E 4X64L 1WOCA 1T9HA 4L5TA 4APVA 3OTOL 3GTQH 2AKWB 1WJVA 5FJ8G 3CCJA 3FHWA 2R92G 3DM3A 4MNOA 4JADA 2HHHL 1IW7D 2M4YA 2XGTA 2E2JH 2E8GA 4LFBL 1R0GA 1CSQA 2JA8H 4JAGA 1VCXA 1S30A 3UDFA 1Y14B 1KQSA 3CCUA 2WB1G 2UUBL 2J9UB 2KBNA 3PWFA 1JMCA 5GAGC 4DAYB 4LFCQ 5MFPA 2K2DA 1K83H 3A5ZB 5C4JH 5LMNL 4UY81 3M4PA 1YK5A 2XJTA 5AJ3L 2OQ0A 4P75A 4JYAL 1X9NA 1MIUA 2JEBI 1VQKA 4OX9L 5M5XH 1Y1WG 1Q12A 4NPSA 5MFZA 4DAMA 4EQ5A 2WAQE 2NVXH 2XJPA 3BJUA 3H15A 4QIWE 4HIKA 3A0JA 5JVH1 2UUAQ 3NFPI 4UY8C 5IY0A 3PV0A 5JEAJ 3I4NG 4AI2A 4JOIC 4DV1L 4TPUA 3M4QA 2JJQA 3AYHB 4A3IH 4TVAB 1XNQQ 1TXYA 5C0XJ 1K8AC 5DLQE 2R7ZG 2WAQG 3ZJYC 4DR6L 3JAMi 4OXPA 1RWDA 1SLJA 4A3KG 5MLC3 1HNWQ 1XMQQ 1EQRA 2E2HH 1XNQL 3NEMA 4A3CG 3FP9A 1XTDA 1Y1WH 3KYUA 3KDFA 1E8JA 1IBLQ 1Q46A 4IFDG 1CSPA 2Z6KA 1HZBA 2IX0A 1PH9A 1BBWA 1L0WA 2PPTA 4JI1L 2N78A 4GNXA 2F4VQ 1EQQA 1TWGH 1T9OA 2GMGA 2UUBQ 2LCQA 3CCLA 4LF8L 4JOIA 3RZ6A 5HGQA 2JA8G 2E2IH 1CKMA 1TWCH 4BA1I 1VQCA 2I5HA 4LF4Q 2B63H 3H3VI 1N34Q 4LF9L 2A6HD 3P8BA 1EIFA 3KYXA 4AH6A 2A8VA 2XJSA 1KXLA 4K0KL 2ZJQA 1X6OA 1Z9FA 1GVPA 2YTVA 2ZIXA 4YWMA 4AIMA 3OTOQ 1N34L 2JA5G 4LF9Q 3AEVA 3HOVH 4HIOA 1PH6A 3KYWA 3MEFA 2HT1A 4LHLA 4DV0L 4YWKA 3HOWG 4YHHQ 2A68D 3SGIA 2H5XA 4AQYQ 3K35A 2UUCL 4LFAL 5EIOC 1UE1A 4QJFA 4KI0A 1V43A 4GN3B 5GAEc 1YJNA 1SMMA 1VQ5A 3LNLA 5GROA 4GOPA 1N32L 2PYAA 2VQEQ 1K8GA 2R93H 1UE6A 1VQIA 4R4CA 2KKDA 3S1NH 1HNWL 1FVIA 2JA5H 1NNQA 4OONA 5MF6A 4DV4L 1YHQA 5JJKA 4GKKQ 4IPGA 4AYBG 2H12A 1E22A 3I2ZA 2KCTA 4JBJA 2MNAA 3F2CA 1XPRA 2VY3A 4PZ7A 1QCVA 5M5WH 3LPEB 4JG2A 3VDYA 2Z0SA 1VQAA 3PUWA 4ALPA 4DV7L 4X6AH 2DSXA 4DV3Q 1CADA 4EX5A 2VUMH 2NVYH 3KLWA 3M9BA 3M85A 1QVCA 1S40A 2V3BB 4UP7A 3WWNB 4AYBE 1KL9A 2V0EA 1XMOQ 1VQ8A 1K9MC 3B0AB 4JCVE 3F1ZA 4JI7Q 4GLAC 1IYJB 1KAWA 3J7ZC 3RLNA 2ZM6Q 1M1KC 5M3MG 4YWLA 3RLOA 2K14A 1EUJA 3PSIA 3A44A 2HR5A 1R0HA 1RL2A 4DR5Q 1HNXL 3I4NH 3EBEA 4DV1Q 4A3JH 3RYGA 1PH8A 1TWHH 1QUQA 2AHOB 1NXGA 2GN5A 3KDFB 3W5OA 5IP9H 3G71A 3CPWA 4A76A 2CKAA 4MZ9A 4X64Q 5C0XI 3OW2A 4A3KH 3U4ZA 3H0GH 3PGZA 5IP9G 3HFZB 4DUYL 1N33L 5IYCH 5BR8Q 4B8CD 3GTGH 4B3MQ 2MFIA 4BY7G 1LKPA 4NXMQ 1HZCA 1VCIA 3J81j 4X66L 4TVMA 2AYJA 1EWIA 1NY4A 1VQFA 4QL5A 1WYDA 4IOCA 1EYGA 4JI0L 3CCEA 2VW9A 1PV4A 1QZGA 1NE3A 4DV6L 3KFUA 3ULPA 2ALYB 1LKOA 2BH8A 5LMNW 1YUZA 4AHYA 4HJ9A 3GTLH 2QGQA 3PUYA 1B7YB 3PCOB 2M6OA 4DKAC 2ASBA 3STBD 2EIFA 1BBUA 4PMWA 4DR5L 1HNXQ 5C3EH 4JI4L 4BBSG 1PVOA 2BA0A 1VQ4A 1QZHA 1VQ6A 4A3BG 5ELOA 4BXXG 2IHEA 5GADC 4UP8A 2KCMA 1KD1C 1E24A 2KENA 2PVXA 4A3FG 4DR4Q 2PQAA 1SMXA 3U4VA 2XTIA 3K80C 2JA6H 1A63A 3JAMc 2YYZA 1OXSC 2UU9Q 3G48A 4R4OA 1XNRL 3TQYA 5C0XG 1JE5A 1XPUA 2UUAL 2K52A 3CP0A 1BE7A 3MPSA 5C3EG 2NZOA 3G4SA 4DR2Q 1H7VA 3S1QH 1WJJA 1DVBA 1I3QH 3S2HH 3HOVG 3GO5A 2VZAA 4HIMA 2NN6G 1YJWA 2UXCQ 1JJGA 1XPOA 5AN9H 4A4IA 4GLXA 3PKJA 1WCMG 3T1YL 4DPGA 1JJ2A 4H02A 2E5LL 4KHPL 1PH7A 4C3JH 2UXBQ 2NYDA 1IBKQ 4DR7L 1VQHA 1DGSA 4GN5A 2K5NA 2B5ID 4A3EH 8RXNA 4B3SL 3KF6A 2UXDQ 3A74A 1I6HH 4OWXB 4DR3L 3PUXA 1QUQB 1N32Q 2KN9A 4X62Q 4QGUA 1SMWA 2C6BA 3KJOA 4LF5Q 1FHHA 4GN4B 4BY7H 1Q1BA 3I4MH 1P16A 1N36L 3OYYA 4B3SQ 1GKHA 4PG3A 1MJEA 4A3LH 4WJ3M 3KF8B 4YCWA 3HOYG 2Q2HA 1BKBA 4DV2Q 1G291 2DGYA 4J15A 5IP7G 1U5KA 1OXVA 5IWAL 1LKMA 3PZAA 5IYBH 3CCRA 5M3FG 3PO3G 3ER0A 3M4OH 4K0KQ 4IJHA 1KHIA 7RXNA 1B71A 4JAFA 3T1HQ 1HNZL 4BY1H 3J7A5 3F2DA 1S3OA 4GNXB 1YEZA 2ID0A 4PZ6A 4JI3L 1OWBA 2F4VL 1NMGA 3CCMA 1K0RA 2EQSA 4JI8Q 3TREA 3MSUA 3KJPA 2JI3A 3RNUA 1XMOL 1ODHA 1OTCA 2RCNA 1EFWA 4BBRH 1QVFA 2Z3QB 1L2FA 1RB9A 4WFN1 4JI1Q 1BQ8A 4IPDA 3PIO1 4JBWA 3STBC 2CR8A 5H1SE 1IXRA 2A6ED 2C35B 2WFWA 3I7FA 4IPCA 3S24A 5FLXc 4A3FH 1B8AA 4IPHA 2VQFL 4A3MH 1CKNB 4V196 2D0OA 1IBMQ 2QEXA 1X3GA 3IU3I 2M4VA 1FL0A 1J6QA 1VQJA 1V9PA 1VQBA 1BQ9A 1NMFA 3H3VH 3KYVA 1EOVA 2MQHA 3K7AH 4O0AA 5EAYA 4JC0A 2PQAB 4Y7NH 2D62A 4LUOA 5IE8A 4P71A 4DK3C 2AMCB 3ULJA 4OX9Q 3HOUH 1L1OA 3K8AA 2CFMA 4HJ7A 2K5VA 1B2OA 2Z3RB 1PH4A 1VQNA 3HKZG 1R0JA 2N49A 3RLFA 2QA4A 4Y52H 3GTKH 2OWOA 1HZAA 1E1TA 4GS7D 3I55A 1VQLA 3GD7A 3ICEA 3JC63 4UP9A 4JI8L 2JA9A 4JI0Q 1RDVA 1PH3A 3MXNB 4A93H 1X3FA 1O7IA 2A19A 2L15A 4P72A 1G51A 2ES2A 1B70B 3CC2A 3PO2G 1JB7A 3I4OA 2YTYA 3UDIA 3HKZE 5C44H 1PYSB 4JAEA 2CWAA 4TQUS 1OXTA 3M7NA 2OCEA 4POFA 4A75A 1C7YA 1ZRPA 4AHWA 4LF8Q 1YHBA 4R4QA 3KYHC 5JJLA 2ERJA 1PYBA 1J5EL 2C6AA 4LF7Q 2PSMC 2UXDL 1CUKA 3CD6A 2OTJA 2N8NA 3HOZH 5C4XG 1E3PA 1TWFH 3NELA 2XJUA 1SE8A 2ZTDA 2BH2A 1S2ZA 4BBRG 2D0PA 4IJLA 3PIOA 3F2BA 4LF6L 3I4MG 5JJIA 1YHAA 5J3BA 5AI3A 2QL0A 3J7Y1 1BFYA 1L1OB 3GDEA 5M5YH 1PA6A 1HR0Q 4JI4Q 4JI5Q 3CAMA 4KHZA 1HJPA 4R4IA 5FLMG 4DR1L 3S2DH 1QYBA 3VPBE 3HOXH 1YZ6A 4GS3A 4A3MG 2PVEA 2Q2TA 4JBMA 4YCUA 4DV7Q 1QVGA 1V1QA 2UXCL 3CQZH 3QVDA 1OXUA 3EIVA 3RN2A 4WJ4A 5DM61 3PIPA 4L5QA 4JI3Q 2UU9L 5EINC 1SFOH 3CCVA 3ERSX 4A3GH 2ZJPA 3E9IA 1CKNA 1HZ9A 1S72A 5AI2A 2JK8A 2RHQB 4LUVA 3CXCA 1E1OA 2O5JD 4HJ8A 4A3JG 3RZOH 1OWCA 3CC7A 1Z92B 4YY3L 1Q86C 1J5EQ 2MO0A 1N9WA 4LF7L 4DUYQ 1YVCA 2RHSB 5IYCG 4C2MH 3FKIH 2FXQA 1SRUA 2JQOA 1KC8C 2Q2UA 3UE1A 2NVQH 1AE2A 1HR0W 4X62L 3J81c 1IU6A 3PO2H 4R4TA 3ZG6A 3HOZG 5IYDH 1VZIA 1KRSA 3UE0A 3K7UC 1ASYA 4ZN1B 4B3TQ 4AI1A 3PF4A 3TS2A 4DR3Q 3Q8DA 1RYTA 3GTOH 5JEAG 4POGA 3SS2A 1LUZA 2B29A 2LXJA 1JJCB 3K0XA 5FLMH 5IYBG 3PO3H 2BA1A 3BU2A 1VQDA 4A3EG 3ULLA 3S17H 3E9HA 2CWPA 3L7ZC 1MJCA 4LUZA 2BE5D 2JI2A 1Q7YC 2XJVA 2XJRA 4P74A 3U50C 1NJIC 4QY7A 1CKOA 1N33Q 4AR5A 4DR2L 1Q81C 1IZ6A 1TWAH 1RIPA 4NXNL 4E6YA 3UDGA 1M90C 4B3ML 3PUZA 4JI6L 4A3DH 3CC4A 5DM71 2KHIA 3KF6B 4G6BA 4DR1Q 3HOXG 4LF6Q 2JA6G 4DR7Q 4DV4Q 2CCZA 4IFDI 3J7Z1 3AQQA 1LTLA 5GAGc 2PI2A 3CPFA 1RDGA 3BZCA 2ZM6L 3CMAA 1YI2A 1I94Q 3L2PA 2Q2IA 3QQCE 2YTXA 1LM0A 2ZJRA 4HJ5A 1IROA 1A8VA 1YUXA 1KRTA 4JBKA 4AR4A 3PF5A 4IFDJ 1IL2A 1I94L 1X55A 3AFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS0 A;  1S24 A;  3K81 C;  4LNQ A;  1H95 A;  1A62 A;  1L1O C;  1VQ9 A;  4A93 G;  2LSS A;  1C9O A;  4A3B H;  3DLL A;  1W3S A;  2PI2 E;  1VQG A;  4HJA A;  4DV3 L;  1YIT A;  1BRF A;  3AFP A;  4JI2 Q;  3S15 H;  1Z47 A;  1I5F A;  2HQL A;  3IRB A;  3BZK A;  5E7N A;  2JE6 I;  4DV5 Q;  1KIX A;  3D0F A;  2F52 A;  4K9F A;  3GTP H;  1X54 A;  2ZTC A;  3T1H L;  1ASZ A;  2HIV A;  3H0G G;  4IO9 A;  1I50 H;  3L0O A;  1HR0 L;  4RXN A;  3HKS A;  4LF4 L;  4DV6 Q;  2HHH Q;  3M3Y H;  3I56 A;  2R93 G;  1YNX A;  4FDB A;  4GKK L;  4A3C H;  4DK6 C;  1Y1V G;  2IT1 A;  3D31 A;  4C3I H;  1YJ9 A;  5LMU Q;  1UE7 A;  1EIY B;  2K5H A;  4RMF A;  2R7F A;  1N36 Q;  5M3M H;  2JA7 G;  1A0I A;  4AQY L;  2UUC Q;  4MTN A;  1CAA A;  3HOU G;  3CW2 C;  1JYB A;  5BR8 L;  1DX8 A;  4DV0 Q;  4GKJ L;  2VNU D;  4AR3 A;  3PUV A;  3WWV A;  1C0A A;  2RDV A;  2YU9 H;  2ATW A;  2I5L X;  2VQF Q;  1X56 A;  4GOP C;  4YY3 Q;  1XJV A;  1Q82 C;  1N8R C;  1YV1 A;  2Z6K C;  1D8L A;  2R7D A;  3J80 i;  1BVS A;  4BXX H;  2Y0S E;  4OWW B;  1FJG L;  1VQ7 A;  4LWC A;  4YCV A;  4AR6 A;  2K50 A;  5GAE C;  3RR5 A;  1XNR Q;  3RN5 A;  4DV5 L;  1UEB A;  3S1R H;  3HOY H;  1R0F A;  2KHJ A;  5RXN A;  3KOJ A;  1VQP A;  4OO1 I;  4O2D A;  3S16 H;  4LFC L;  1UWV A;  2YV5 A;  2IY5 B;  4DR4 L;  1B2J A;  1GD7 A;  4C3H H;  4HID A;  2I5M X;  2IX1 A;  2CKZ B;  1IBL L;  4UPA A;  4JI5 L;  2HIX A;  1FHM A;  1T9P A;  2WP8 J;  3GTM H;  3JC6 2;  2RF4 A;  1GO3 E;  3U58 A;  1XMQ L;  2JA7 H;  3GTJ H;  2AWN A;  2R92 H;  2CQO A;  3F8T A;  2IHF A;  5C44 G;  3CCQ A;  4NB3 A;  4JI6 Q;  3TRZ A;  3S14 H;  4A3L G;  1VS0 A;  4PZ8 A;  1X3E A;  4GKJ Q;  4LF5 L;  4GOP B;  4P73 A;  1PHJ A;  3NBH B;  2K75 A;  1FGU A;  2DUD A;  3EN2 A;  2EXD A;  4X65 L;  1G6P A;  4JYA Q;  4L5S A;  1VQO A;  2B3G A;  4LFA Q;  3J81 i;  3CCS A;  1GM5 A;  4YHH L;  1R0I A;  5LMU L;  1SMU A;  1K73 C;  3T1Y Q;  2E5L Q;  1AH9 A;  5AJ3 Q;  1YIJ A;  1WI5 A;  1P8L A;  4GLV B;  2I0Q A;  1HNZ Q;  1SR3 A;  5C4X H;  3HOW H;  1Y1V H;  1R9T H;  4NXM L;  4A3D G;  1WFQ A;  1C09 A;  1X65 A;  2Y0S G;  4KHP Q;  5IWA Q;  5HY6 A;  5FJ8 H;  4JI2 L;  2MS3 A;  1YBY A;  4X65 Q;  4B3T L;  5IT9 c;  2ZTE A;  2OQK A;  2V1C C;  3FKI G;  4BY1 G;  3JC6 6;  3NEN A;  4OO1 G;  2N3S A;  4LW1 A;  3W1G A;  3S1M H;  4IOA A;  1IRN A;  5IP7 H;  1K3R A;  3RZD H;  1HH2 P;  4BBS H;  4GNX C;  2LXK A;  5GAH C;  4DUZ Q;  1AE3 A;  3KYY A;  2AWO A;  2VS1 A;  5ELN A;  2GVB A;  4JI7 L;  1W2B A;  4DNI A;  4JV5 L;  2K4K A;  1JT8 A;  1NTG A;  2F3I A;  4R1J A;  1VQE A;  4XIG S;  4DUZ L;  3TEH B;  1PH2 A;  1IBK L;  4BA2 I;  3E0E A;  2OTL A;  1LYL A;  2VL6 A;  2NN6 I;  1IBM L;  2NVT H;  4XTC S;  2VUM G;  2UXB L;  4DR6 Q;  2NZH A;  3J80 c;  4A3I G;  1VQM A;  1PH5 A;  2JEA I;  1E7Z A;  3G6E A;  4ME3 A;  1U0L A;  1D7Q A;  1PFS A;  4NXN Q;  3CME A;  2PNH A;  4L5R C;  4QQB X;  3UDX A;  1FJG Q;  5LMN Q;  4OWT B;  1MKH A;  3A5U A;  5IYD G;  4A3G G;  1NBW A;  1Q8K A;  4RG1 A;  1WCM H;  4X66 Q;  6RXN A;  3LGJ A;  4B3R L;  1SRO A;  2VQE L;  2R6G A;  2B63 G;  5K36 G;  1Q1E A;  2PMZ E;  4KLK A;  2A1A A;  2MO1 A;  1PH1 A;  3RZT A;  4DV2 L;  2R7Z H;  4LFB Q;  3CF5 A;  1IU5 A;  3B6Y A;  1T9Q A;  5GQO A;  5M3F H;  4JV5 Q;  1B13 A;  1OXX K;  1UE5 A;  1SN8 A;  3W1B A;  2GVA A;  1YK4 A;  2WB1 E;  4X64 L;  1WOC A;  1T9H A;  4L5T A;  4APV A;  3OTO L;  3GTQ H;  2AKW B;  5FJ8 G;  3CCJ A;  2R92 G;  3FHW A;  3DM3 A;  4MNO A;  2HHH L;  2XGT A;  2M4Y A;  2E2J H;  2E8G A;  4LFB L;  1R0G A;  1CSQ A;  2JA8 H;  1VCX A;  1S30 A;  3UDF A;  1Y14 B;  1KQS A;  3CCU A;  2WB1 G;  2UUB L;  2KBN A;  3PWF A;  1JMC A;  5GAG C;  4DAY B;  4LFC Q;  2K2D A;  1K83 H;  3A5Z B;  5C4J H;  5LMN L;  3M4P A;  1YK5 A;  5AJ3 L;  2OQ0 A;  4P75 A;  4JYA L;  1X9N A;  1MIU A;  2JEB I;  1VQK A;  4OX9 L;  5M5X H;  1Y1W G;  1Q12 A;  4NPS A;  4DAM A;  4EQ5 A;  2WAQ E;  2NVX H;  3BJU A;  3H15 A;  4QIW E;  4HIK A;  3A0J A;  2UUA Q;  4UY8 C;  5IY0 A;  3PV0 A;  5JEA J;  3I4N G;  4A3I H;  4JOI C;  4DV1 L;  4TPU A;  3M4Q A;  2JJQ A;  3AYH B;  1XNQ Q;  4TVA B;  1TXY A;  5C0X J;  1K8A C;  5DLQ E;  2R7Z G;  2WAQ G;  3ZJY C;  4DR6 L;  3JAM i;  4OXP A;  1RWD A;  1SLJ A;  4A3K G;  1HNW Q;  1XMQ Q;  1EQR A;  2E2H H;  1XNQ L;  3NEM A;  4A3C G;  3FP9 A;  1XTD A;  1Y1W H;  3KYU A;  3KDF A;  1E8J A;  1IBL Q;  1Q46 A;  4IFD G;  1CSP A;  2Z6K A;  1HZB A;  2IX0 A;  1PH9 A;  1BBW A;  1L0W A;  4JI1 L;  2N78 A;  4GNX A;  2F4V Q;  1EQQ A;  1TWG H;  1T9O A;  2GMG A;  2UUB Q;  2LCQ A;  3CCL A;  4LF8 L;  4JOI A;  3RZ6 A;  5HGQ A;  2JA8 G;  2E2I H;  1CKM A;  1TWC H;  4BA1 I;  1VQC A;  2I5H A;  4LF4 Q;  2B63 H;  3H3V I;  1N34 Q;  4LF9 L;  3RZO H;  1EIF A;  3KYX A;  4AH6 A;  2A8V A;  1KXL A;  4K0K L;  2ZJQ A;  1X6O A;  1Z9F A;  1GVP A;  2YTV A;  4AIM A;  4YWM A;  3OTO Q;  1N34 L;  2JA5 G;  4LF9 Q;  3AEV A;  3HOV H;  4HIO A;  1PH6 A;  3KYW A;  3MEF A;  2HT1 A;  4DV0 L;  3HOW G;  4YWK A;  4YHH Q;  3SGI A;  2H5X A;  4AQY Q;  2UUC L;  4LFA L;  1UE1 A;  4QJF A;  4KI0 A;  1V43 A;  4GN3 B;  1N32 L;  1YJN A;  1SMM A;  1VQ5 A;  5GRO A;  4GOP A;  2PYA A;  2VQE Q;  1K8G A;  2R93 H;  1UE6 A;  1VQI A;  4R4C A;  2KKD A;  3S1N H;  1HNW L;  1FVI A;  2JA5 H;  1NNQ A;  4OON A;  4DV4 L;  1YHQ A;  5JJK A;  4GKK Q;  4IPG A;  4AYB G;  1E22 A;  3I2Z A;  2KCT A;  4JBJ A;  2MNA A;  3F2C A;  1XPR A;  2VY3 A;  4PZ7 A;  1QCV A;  5M5W H;  4JG2 A;  3VDY A;  2Z0S A;  1VQA A;  3PUW A;  4ALP A;  4DV7 L;  4X6A H;  2DSX A;  4DV3 Q;  1CAD A;  4EX5 A;  2VUM H;  2NVY H;  3KLW A;  3M9B A;  3M85 A;  1QVC A;  1S40 A;  2V3B B;  4UP7 A;  4AYB E;  1XMO Q;  1KL9 A;  1VQ8 A;  1K9M C;  4JCV E;  3F1Z A;  4JI7 Q;  4GLA C;  1IYJ B;  1KAW A;  3J7Z C;  3RLN A;  2ZM6 Q;  1M1K C;  5M3M G;  4YWL A;  3RLO A;  2K14 A;  1EUJ A;  3PSI A;  3A44 A;  2HR5 A;  1R0H A;  1RL2 A;  4DR5 Q;  1HNX L;  3I4N H;  3EBE A;  4DV1 Q;  4A3J H;  3RYG A;  1PH8 A;  1TWH H;  1QUQ A;  2AHO B;  2GN5 A;  3KDF B;  3W5O A;  5IP9 H;  3G71 A;  3CPW A;  4A76 A;  3OW2 A;  4X64 Q;  4MZ9 A;  5C0X I;  4A3K H;  1N33 L;  3U4Z A;  3H0G H;  3PGZ A;  5IP9 G;  3HFZ B;  4DUY L;  5IYC H;  5BR8 Q;  3GTG H;  4B3M Q;  2MFI A;  4BY7 G;  1LKP A;  4NXM Q;  1HZC A;  1VCI A;  3J81 j;  4X66 L;  4IOC A;  1EWI A;  1NY4 A;  1VQF A;  4QL5 A;  1WYD A;  1EYG A;  4JI0 L;  3CCE A;  2VW9 A;  1PV4 A;  1QZG A;  1NE3 A;  4DV6 L;  3KFU A;  3ULP A;  2ALY B;  1LKO A;  2BH8 A;  5LMN W;  1YUZ A;  4HJ9 A;  3GTL H;  2QGQ A;  3PUY A;  1B7Y B;  3PCO B;  4DKA C;  2ASB A;  3STB D;  2EIF A;  1BBU A;  4PMW A;  4DR5 L;  1HNX Q;  5C3E H;  4JI4 L;  4BBS G;  1PVO A;  2BA0 A;  1VQ4 A;  1QZH A;  1VQ6 A;  4A3B G;  5ELO A;  4BXX G;  2IHE A;  5GAD C;  4UP8 A;  2KCM A;  1KD1 C;  1E24 A;  2KEN A;  2PVX A;  4A3F G;  4DR4 Q;  2PQA A;  1SMX A;  3U4V A;  2XTI A;  3K80 C;  2JA6 H;  1A63 A;  3JAM c;  2YYZ A;  1OXS C;  2UU9 Q;  3G48 A;  4R4O A;  1XNR L;  3TQY A;  5C0X G;  1JE5 A;  1XPU A;  2UUA L;  2K52 A;  3CP0 A;  1BE7 A;  3MPS A;  5C3E G;  2NZO A;  3G4S A;  4DR2 Q;  1H7V A;  3S1Q H;  1WJJ A;  1DVB A;  1I3Q H;  3S2H H;  3HOV G;  3GO5 A;  2VZA A;  4HIM A;  2NN6 G;  1YJW A;  2UXC Q;  1JJG A;  1XPO A;  4A4I A;  4GLX A;  4KHP L;  3T1Y L;  1WCM G;  1JJ2 A;  4DPG A;  2E5L L;  4H02 A;  2UXB Q;  1PH7 A;  4C3J H;  1IBK Q;  4DR7 L;  1VQH A;  1DGS A;  4GN5 A;  2K5N A;  4A3E H;  8RXN A;  4B3S L;  3KF6 A;  2UXD Q;  3A74 A;  1I6H H;  4OWX B;  4DR3 L;  3PUX A;  1QUQ B;  1N32 Q;  2KN9 A;  4X62 Q;  4QGU A;  1SMW A;  3KJO A;  4LF5 Q;  4BY7 H;  1FHH A;  4GN4 B;  1Q1B A;  3I4M H;  1P16 A;  1N36 L;  3OYY A;  4B3S Q;  1GKH A;  4PG3 A;  1MJE A;  4A3L H;  4WJ3 M;  3KF8 B;  4YCW A;  3HOY G;  2Q2H A;  1BKB A;  4DV2 Q;  1G29 1;  2DGY A;  4J15 A;  5IP7 G;  1U5K A;  1OXV A;  5IWA L;  1LKM A;  3PZA A;  5IYB H;  3CCR A;  5M3F G;  3PO3 G;  3ER0 A;  3M4O H;  4K0K Q;  4IJH A;  7RXN A;  1KHI A;  1B71 A;  3T1H Q;  4BY1 H;  1HNZ L;  3J7A 5;  3F2D A;  1S3O A;  4GNX B;  1YEZ A;  2ID0 A;  4PZ6 A;  4JI3 L;  2F4V L;  1NMG A;  3CCM A;  1K0R A;  2EQS A;  4JI8 Q;  3TRE A;  3KJP A;  3RNU A;  1OTC A;  1EFW A;  1XMO L;  2RCN A;  4BBR H;  1QVF A;  1L2F A;  1RB9 A;  4JI1 Q;  1BQ8 A;  4IPD A;  4JBW A;  3STB C;  5H1S E;  5FLX c;  1IXR A;  2C35 B;  2WFW A;  3I7F A;  4IPC A;  3S24 A;  4A3F H;  1B8A A;  4IPH A;  2VQF L;  4A3M H;  1CKN B;  2D0O A;  1IBM Q;  2QEX A;  1X3G A;  1FL0 A;  1J6Q A;  1VQJ A;  1V9P A;  1VQB A;  1BQ9 A;  1NMF A;  3H3V H;  3KYV A;  1EOV A;  2MQH A;  3K7A H;  4O0A A;  5EAY A;  4JC0 A;  2PQA B;  4Y7N H;  2D62 A;  4LUO A;  5IE8 A;  4P71 A;  4DK3 C;  2AMC B;  3ULJ A;  4OX9 Q;  3HOU H;  1L1O A;  3K8A A;  2CFM A;  4HJ7 A;  2K5V A;  1B2O A;  1PH4 A;  1VQN A;  3HKZ G;  1R0J A;  2N49 A;  3RLF A;  2QA4 A;  4Y52 H;  3GTK H;  2OWO A;  1HZA A;  1E1T A;  3I55 A;  1VQL A;  3ICE A;  3GD7 A;  3JC6 3;  4UP9 A;  4JI8 L;  2JA9 A;  4JI0 Q;  1RDV A;  1PH3 A;  3MXN B;  4A93 H;  1X3F A;  1O7I A;  2A19 A;  2L15 A;  4P72 A;  1G51 A;  2ES2 A;  1B70 B;  3CC2 A;  3PO2 G;  1JB7 A;  3I4O A;  2YTY A;  3UDI A;  3HKZ E;  5C44 H;  1PYS B;  2CWA A;  4TQU S;  1OXT A;  3M7N A;  2OCE A;  4POF A;  4A75 A;  1C7Y A;  1ZRP A;  4LF8 Q;  1YHB A;  4R4Q A;  3KYH C;  5JJL A;  1PYB A;  1J5E L;  4LF7 Q;  2UXD L;  1CUK A;  3CD6 A;  2OTJ A;  2N8N A;  3HOZ H;  1E3P A;  1TWF H;  3NEL A;  1SE8 A;  2ZTD A;  2BH2 A;  1S2Z A;  4BBR G;  2D0P A;  4IJL A;  3PIO A;  3F2B A;  4LF6 L;  3I4M G;  5JJI A;  1YHA A;  5J3B A;  5AI3 A;  2QL0 A;  5M5Y H;  1BFY A;  1L1O B;  3GDE A;  1PA6 A;  1HR0 Q;  4JI4 Q;  4JI5 Q;  4B3R Q;  3CAM A;  4KHZ A;  1HJP A;  4R4I A;  5FLM G;  4DR1 L;  3S2D H;  1QYB A;  3HOX H;  4A3M G;  1YZ6 A;  4GS3 A;  2PVE A;  2Q2T A;  4JBM A;  4YCU A;  4DV7 Q;  1QVG A;  1V1Q A;  2UXC L;  3CQZ H;  3QVD A;  1OXU A;  3EIV A;  3RN2 A;  4WJ4 A;  3PIP A;  4L5Q A;  4JI3 Q;  2UU9 L;  4A3G H;  1SFO H;  3CCV A;  3ERS X;  2ZJP A;  3E9I A;  1CKN A;  1HZ9 A;  1S72 A;  5AI2 A;  2JK8 A;  2RHQ B;  4LUV A;  3CXC A;  1E1O A;  4HJ8 A;  4A3J G;  3CC7 A;  4YY3 L;  1Q86 C;  1J5E Q;  2MO0 A;  1N9W A;  4LF7 L;  4DUY Q;  1YVC A;  2RHS B;  5IYC G;  4C2M H;  3FKI H;  2FXQ A;  1SRU A;  2JQO A;  1KC8 C;  2Q2U A;  3UE1 A;  2NVQ H;  1AE2 A;  1HR0 W;  4X62 L;  3J81 c;  1IU6 A;  3PO2 H;  4R4T A;  3HOZ G;  5IYD H;  1KRS A;  3UE0 A;  3K7U C;  1ASY A;  4B3T Q;  3PF4 A;  3TS2 A;  4DR3 Q;  3Q8D A;  1RYT A;  3GTO H;  5JEA G;  4POG A;  3SS2 A;  1LUZ A;  2B29 A;  2LXJ A;  1JJC B;  3K0X A;  5FLM H;  5IYB G;  3PO3 H;  2BA1 A;  3BU2 A;  1VQD A;  4A3E G;  3ULL A;  3S17 H;  3E9H A;  2CWP A;  3L7Z C;  1MJC A;  4LUZ A;  1Q7Y C;  3U50 C;  4P74 A;  1NJI C;  4QY7 A;  1CKO A;  1N33 Q;  4AR5 A;  4DR2 L;  1Q81 C;  1IZ6 A;  1TWA H;  1RIP A;  4NXN L;  3UDG A;  1M90 C;  4B3M L;  4JI6 L;  3PUZ A;  4A3D H;  5C4X G;  3CC4 A;  2KHI A;  3KF6 B;  4DR1 Q;  4LF6 Q;  3HOX G;  2JA6 G;  4IFD I;  4DR7 Q;  4DV4 Q;  2CCZ A;  3CPF A;  3AQQ A;  1LTL A;  3CMA A;  2PI2 A;  1YI2 A;  1RDG A;  3BZC A;  2ZM6 L;  1I94 Q;  3L2P A;  2Q2I A;  2YTX A;  2ZJR A;  1LM0 A;  4HJ5 A;  1IRO A;  1A8V A;  1YUX A;  1KRT A;  4JBK A;  4AR4 A;  3PF5 A;  4IFD J;  1IL2 A;  1I94 L;  1X55 A;  3AFQ A; 
#chains in the Genus database with same CATH topology
 3QOL A;  2D5D A;  4AI3 A;  1W3S A;  2PI2 E;  4Q5V A;  2M6P A;  4JI2 Q;  1Y8O B;  2F0T A;  2HQL A;  3IRB A;  3KBG A;  3BZK A;  4DV5 Q;  2JE6 I;  1VZH A;  2R7Z B;  1Q90 A;  1PXU A;  3BYY B;  3RMH A;  4RXN A;  3HKS A;  1I50 B;  3I56 A;  2R93 G;  4FDB A;  4GKK L;  3BDC A;  5LMU Q;  3HOZ L;  2WKC A;  4RMF A;  2JA7 G;  2IW3 A;  5G3L D;  4AQY L;  2UUC Q;  4FYD A;  3WWL A;  1JYB A;  1DX8 A;  1MSG A;  2R61 A;  3PUV A;  1C0A A;  1PZK D;  2YU9 H;  3C46 A;  1VMC A;  2MPM A;  2ERS A;  4GZY C;  2WAQ P;  2NVX L;  4LWC A;  3K59 A;  1I50 L;  1QQT A;  3S1R H;  3HOY H;  3HOV L;  4OO1 I;  4O2D A;  1CA6 A;  2RDH A;  2IY5 B;  2PCF B;  4DR4 L;  4FF4 A;  2IX1 A;  4KN4 C;  1H9R A;  1Y8P B;  2AQC A;  3PIP 1;  2CKZ B;  4UPA A;  4JI5 L;  1FHM A;  1EZ6 A;  4N9P A;  1EIG A;  5IGG A;  1D2B A;  1XMQ L;  1SNM A;  2N55 A;  2CQO A;  2IHF A;  5C44 G;  4NB3 A;  2LKV A;  4DK0 A;  1X3E A;  4GKJ Q;  4C3J B;  3NBH B;  1VF5 C;  4JYA Q;  2B3G A;  5T1G A;  3J81 i;  2E2J L;  4YHH L;  2B2V C;  1X32 A;  1YIJ A;  2I0Q A;  4GLV B;  5FLX E;  4A3D G;  2KCC A;  2G9H D;  4A3F B;  2MS3 A;  4LHN A;  2F03 A;  4B3T L;  3P20 A;  2V1C C;  3BVG A;  4I7A A;  2XJQ A;  4IOA A;  1KDB A;  3RZD H;  2L0C A;  1SNO A;  5FOB B;  2JN4 A;  4JI7 L;  1W2B A;  1CZW A;  4DNI A;  2K4K A;  4C56 C;  2NVX B;  5C4H A;  1PH2 A;  1LYL A;  1H9S A;  5J22 A;  3S1N L;  3DWA A;  3A8K E;  3BVZ A;  4KK7 A;  4ME3 A;  1PMR A;  1U0L A;  1D7Q A;  5IT9 E;  5I9P A;  5I4D A;  1NBW A;  4RG1 A;  1WCM H;  1SRO A;  2R6G A;  2EYO A;  2B63 G;  3GTL L;  4LFB Q;  2EY4 E;  5C3E B;  2Z6B A;  5ELF A;  3GTP B;  3CF5 A;  2I07 B;  1BNZ A;  5H1S c;  2NB0 A;  3S15 B;  2L11 A;  4WRD A;  2GVA A;  4X64 L;  2WB1 E;  4NDX A;  3ZYY X;  4APV A;  3S1N B;  1WJV A;  3DM3 A;  5BN4 A;  2HHH L;  2E8G A;  5EQ0 A;  3VR3 A;  1S30 A;  1Y14 B;  1WD0 A;  3CCU A;  2KBN A;  5D3D A;  4DAY B;  5MFP A;  2K2D A;  5C6A A;  5LMN L;  3FEW X;  1F2Z A;  5AJ3 L;  2XJT A;  1X9N A;  1ENA A;  5D65 A;  2NBF A;  2J0T D;  5M5X H;  1HQM C;  1JCK B;  3J80 L;  2WAQ E;  2NVX H;  2UUA Q;  4Z9C B;  1HCZ A;  1NCV A;  3I4N G;  4JOI C;  1WTW A;  4TVA B;  2AQ3 B;  4ZYS A;  5M3M B;  5C0X J;  4OO1 H;  2WAQ G;  3ZJY C;  3JAM i;  1B1Z A;  4KD4 A;  4A3C G;  4KJO A;  1VF7 A;  1VDZ A;  3FP9 A;  1XTD A;  2DJF C;  1II3 A;  1Q46 A;  2JA5 L;  2Z6K A;  1SE2 A;  2IX0 A;  3ITP A;  3GTQ L;  2N78 A;  4GNX A;  4BWG B;  3RZO B;  1T9O A;  2GMG A;  2UUB Q;  3CCL A;  4JOI A;  2JA8 G;  4TKO B;  2KEC A;  1VMP A;  2O5I C;  1N34 Q;  3OOC A;  2A8V A;  2R7Z L;  3GTG B;  1X6O A;  1PTO H;  4RGN A;  2A68 C;  4RFB A;  2EJM A;  2H5X A;  4LFA L;  5EIO C;  3A8I E;  4X3T A;  1V43 A;  1YJN A;  1VQ5 A;  1TWH L;  1JOK A;  2EYL A;  4RA8 A;  4FF2 A;  1S5F D;  4DV4 L;  5JJK A;  3D3R A;  3LWE A;  4GKK Q;  4IPG A;  2H12 A;  4JBJ A;  3CU7 A;  5M5W H;  4JG2 A;  4KY5 A;  4DV7 L;  3HOU B;  2SNM A;  1CAD A;  2C5C A;  1IHZ A;  4EX5 A;  3I72 A;  4C3J G;  1SND A;  1RTN A;  1ENF A;  4UP7 A;  5C44 B;  1BCP C;  1GUG A;  2XWB B;  1K9M C;  5FLM L;  1D5X C;  2F3W A;  3FRP B;  1DYQ A;  4F7X A;  2JSO A;  4OIK A;  5M3M G;  1EUJ A;  1U4R A;  2Q8I B;  3BDL A;  4ZKC B;  3A44 A;  1R0H A;  2NYZ D;  3I70 A;  4K8I A;  5EBC A;  5BN3 A;  1PH8 A;  4X3U A;  1NXG A;  3CPW A;  3G71 A;  2JA8 L;  1PDQ A;  4MZ9 A;  3FKI L;  4RKL A;  1HXY D;  1N33 L;  5IYC H;  5BR8 Q;  4B8C D;  4B3M Q;  1LKP A;  5C3X A;  3VYS A;  1VCI A;  1KTK A;  3PIP 3;  2KOL A;  5L37 A;  5IGB A;  3CRK C;  5JEA H;  4JI0 L;  2B2Y C;  5ELE A;  1NE3 A;  3HAX C;  2FFK B;  1YUZ A;  4HJ9 A;  3PL5 A;  2IPK D;  1JQY D;  1SYE A;  1B7Y B;  2K05 A;  2EOT A;  3STB D;  4PMW A;  2BA0 A;  4KTA A;  1QZH A;  5GAD C;  1KD1 C;  2F0E A;  1QG7 A;  4IUN A;  2J7Z A;  1F9Q A;  3K80 C;  1V1O A;  3GTQ B;  1LO5 D;  1QJO A;  2YYZ A;  2UU9 Q;  3HOX L;  1XNR L;  1JE5 A;  1XPU A;  4M8A A;  2AUK A;  2NZO A;  5ELD A;  1TWC L;  1H7V A;  1WJJ A;  5TSS A;  3S2H H;  1I6H B;  3HOV G;  2VZA A;  1MHW C;  4HIM A;  2NN6 G;  4CBV A;  1H9M A;  1A15 A;  5AN9 H;  1ZYR C;  3PKJ A;  4DPG A;  4H02 A;  3MXN A;  4A3C L;  1VQH A;  4GN5 A;  1FD7 D;  2K5N A;  4A3E H;  1CK1 A;  5CBA E;  4B3S L;  2J4X A;  3KF6 A;  2L5T A;  3HRZ C;  4CJ2 C;  4DR3 L;  5CV9 A;  1BCP F;  4X62 Q;  4BY7 H;  2F0O A;  2C6B A;  4LF5 Q;  1P16 A;  1N36 L;  4KV6 A;  4B3S Q;  1GKH A;  1MJE A;  1F2L A;  2A74 C;  1K0S A;  2Q2H A;  3TP6 A;  3HJY B;  1BO0 A;  1JJ2 A;  2DGY A;  5M3F G;  4K0K Q;  3HOU L;  7RXN A;  4JAF A;  2NVT L;  1ICF B;  2ID0 A;  1OWB A;  2F4V L;  3J7A F;  2EQS A;  3MSU A;  1OTC A;  2JI3 A;  1EFW A;  1AP0 A;  1RB9 A;  4WFN 1;  3UI2 A;  2A6E D;  1D6E C;  3S24 A;  2EYH A;  2F0G A;  5C4J B;  2OXP A;  4IPH A;  4A3M H;  2HDL A;  2BDN A;  1X3G A;  4XQJ A;  3IU3 I;  1FL0 A;  1J6Q A;  1V9P A;  3H0G L;  1BQ9 A;  2EYP A;  4JW0 A;  3H3V H;  1WVL A;  2N88 A;  3K7A H;  4O0A A;  1CQF A;  1LTB D;  4JC0 A;  2PQA B;  2D62 A;  1T5X D;  4P71 A;  3A7L A;  3HOU H;  1PH4 A;  3K8A A;  2EYF A;  1W6J A;  4CGY B;  3E6Z X;  3HKZ G;  2QA4 A;  1WTX A;  4IUQ A;  3RZO L;  4KKS A;  4JI8 L;  1O7I A;  1Y1V L;  3PO2 G;  1B70 B;  1MSH A;  1WD1 A;  3I4O A;  3UDI A;  2CWA A;  4TQU S;  1OXT A;  3Q6S A;  3V05 A;  1ZRP A;  5JJL A;  4A3E L;  5J1Z A;  2ERJ A;  3VYR A;  1B50 A;  3H6M A;  2NTS A;  4ME5 A;  1EWC A;  4A3M B;  2KVM A;  2PSM C;  1CUK A;  2OTJ A;  2N8N A;  4ZK9 B;  3ERO A;  1TWF H;  3HOZ H;  3NEL A;  2ICI A;  1TWH B;  3F2B A;  1ET6 A;  3J7Y 1;  1L1O B;  4JI4 Q;  4JI5 Q;  4R4I A;  5FLM G;  3VR2 A;  1QYB A;  5ISR A;  3HOX H;  2F0U A;  4IZ8 A;  4BY1 B;  3IFT A;  4C2M 1;  4XXE A;  2UXC L;  4IUP A;  3EIV A;  3RN2 A;  2K28 A;  3PIP A;  4A3G H;  3CCV A;  4XDX A;  1O78 A;  5C44 L;  1S72 A;  2JK8 A;  2PYK A;  4LUV A;  2H1E A;  1A2U A;  1OWC A;  1J5E Q;  2MO0 A;  3GV6 A;  4C3H B;  5J39 A;  3T51 B;  3VR4 A;  1NUC A;  1BDO A;  4C2M H;  1HR0 W;  1HUM A;  1LLR D;  1PFB A;  3T53 B;  1IU6 A;  1Y1W B;  3UE0 A;  3K7U C;  3HKZ P;  1ASY A;  1STG A;  4B3T Q;  3PO2 L;  3PF4 A;  4CHT B;  3WDN A;  4ZLT F;  2VXW A;  3GTO H;  5IYC L;  4AYB B;  4POG A;  5M5W B;  2B29 A;  3C2P A;  1JJC B;  3D8G A;  5IYB G;  3PO3 H;  1AN8 A;  3HOX B;  3MFG A;  3BU2 A;  4QMG A;  4X3K A;  2YU9 B;  1SEB D;  3S17 H;  3N52 A;  3D4D A;  2VUM L;  4J6H A;  2XJV A;  1OO9 B;  1NJI C;  1N33 Q;  1Q81 C;  1TWA H;  1M90 C;  4A3D H;  4QCL A;  3WOF A;  4B3M L;  2K5Q A;  4IUV A;  4K14 A;  4FVM A;  4JVZ A;  2WB1 B;  3J81 E;  3HOX G;  2CCZ A;  4NMZ A;  1K3B C;  3AQQ A;  3CMA A;  4IUU A;  2PI2 A;  3BZC A;  2SDF A;  2QDL A;  2YTX A;  4CDD C;  1UEA B;  4HJ5 A;  3K5L A;  1YUX A;  4LMQ D;  4JBK A;  3PF5 A;  1I94 L;  5M5W L;  4A3K L;  1AEX A;  3K81 C;  4A93 G;  1C9O A;  3Q22 A;  1PZI D;  2WII B;  3S2D B;  2B2W A;  3AFP A;  5E7N A;  4XT1 B;  2L0Z A;  2F52 A;  4K9F A;  1R4Q B;  4DK1 A;  2ZTC A;  3FVQ A;  5KND A;  1I6H L;  3H0G G;  1I50 H;  3L0O A;  4RCN A;  1SFO B;  3NE5 B;  4LF4 L;  2HHH Q;  1ZXT A;  4FXD A;  3SR1 A;  2IT1 A;  4DK6 C;  3CHB D;  1EIY B;  2RCF A;  1NXE A;  1CAA A;  2HQE A;  4AR3 A;  5FO9 B;  3B08 B;  3Q0A A;  3S17 B;  4GOP C;  2F0H A;  4YY3 Q;  1Q82 C;  1N8R C;  1YV1 A;  2Z6K C;  1D8L A;  2FJ2 A;  4IUT A;  3CQZ B;  4OWW B;  1YNN C;  1FJG L;  1MI2 A;  1VQ7 A;  1SFO L;  4AR6 A;  5JOB A;  3S1M B;  4CKB A;  3RN5 A;  4EGV A;  4DV5 L;  1FNW A;  3NK9 A;  5RXN A;  5FO7 B;  3S16 H;  4OL7 A;  2QKI C;  2ENB A;  1B2J A;  4LAA A;  5KRU A;  2I5M X;  4NKL A;  1TWG B;  4MHE A;  1TY0 A;  2HIX A;  3NQI A;  3GTM H;  3VYT A;  3U58 A;  1GO3 E;  2JA7 H;  5KEE A;  1CM9 A;  3RZD L;  2LMC B;  3F8T A;  4JI6 Q;  3S16 B;  3M4O L;  3S14 H;  3OW7 A;  4LF5 L;  1AW7 A;  4P73 A;  5DEH A;  1FGU A;  3GTK L;  3F2U A;  4A93 B;  2KJX A;  3CCS A;  4O1N A;  1EOT A;  1JB3 A;  4CJ1 B;  1PTO C;  2CVR A;  5C4X H;  4HMI A;  4CKE A;  1X65 A;  1K8M A;  4XXB B;  3K57 A;  4JI2 L;  5EGT A;  4X65 Q;  1I4R A;  2ZTE A;  1A2T A;  3NEN A;  3RZD B;  3A56 A;  1RHP A;  4LW1 A;  5IP7 H;  5ELC A;  4DUZ Q;  1QE6 A;  2RFK B;  2VS1 A;  5ELN A;  2GVB A;  3PKI A;  1JT8 A;  2V4D A;  2F3I A;  1BCP B;  1JWS D;  1VQE A;  3TEH B;  2OTL A;  2VUM G;  2VL6 A;  2NN6 I;  1LTA D;  1IBM L;  3C1E A;  1PZX A;  4BY7 B;  1X3Q A;  4A3I G;  1VQM A;  3HOY L;  4DFA A;  1LT5 D;  1SMY C;  3G6E A;  1I3Q L;  3D4W A;  1TS2 A;  3HKZ B;  3CME A;  2PNH A;  3ONA B;  5FJ8 L;  2AQ2 B;  2EY2 A;  3UDX A;  1MKH A;  3K7A B;  2IX3 A;  4X66 Q;  3LGJ A;  3IAY A;  3S16 L;  1F2Y A;  5K36 G;  1Q1E A;  2PMZ E;  4KLK A;  4FO2 A;  3GTK B;  3B6Y A;  5K2M E;  5GQO A;  1B13 A;  1UE5 A;  2XIW A;  1K8O A;  1C4Q A;  3J80 E;  2WB1 P;  1YK4 A;  3I4M L;  3HGB A;  5CR3 A;  1T9H A;  3OTO L;  2R92 G;  1JOO A;  3E3X A;  1IW7 D;  2E2J H;  1Y1W L;  1R0G A;  1YNN D;  1VCX A;  1KQS A;  2WB1 G;  3QJY A;  5GAG C;  3AU7 A;  3OPO A;  2ICE C;  2Z9H A;  1W6K A;  4QIW P;  4HSP A;  1L0Y B;  1IKL A;  1MIU A;  4OX9 L;  4MN3 A;  4QUC A;  5MFZ A;  4DAM A;  3SEB A;  4EQ5 A;  3H15 A;  4UY8 C;  3OMG A;  1WTQ A;  1BR9 A;  2F1M A;  4TPU A;  3M4Q A;  2JJQ A;  1XNQ Q;  3LWR B;  1DCZ A;  2R7Z G;  1HUN A;  4OXP A;  1SLJ A;  5MLC 3;  1HNW Q;  2KA7 A;  1EQR A;  2E2H H;  3NEM A;  4A3G B;  3KF8 A;  2IWH A;  3V96 A;  1Y1W H;  2F0F A;  1IBL Q;  2CHB D;  1EIH A;  1ESF A;  1HZB A;  3BDO A;  4JI1 L;  2PPT A;  3BVM A;  2F4V Q;  2LCQ A;  3H94 A;  5HGQ A;  2B8G A;  1TWC H;  3KLS X;  2XRS D;  1VQC A;  2VB2 X;  3BYT B;  2B63 H;  4LF9 L;  1EIF A;  4L6T B;  2GA4 B;  3SXH A;  1I4H A;  1TWA L;  4A3D L;  1KNE A;  4AIM A;  2YTV A;  3QG1 A;  1N34 L;  2ZJQ A;  1G6P A;  5IP7 L;  5KYL A;  3AEV A;  2K6A A;  5I2Y A;  1XWE A;  1I4G A;  4HIO A;  1B3A A;  1PH6 A;  3I4N B;  2Z4I A;  3S1Q B;  3H3V M;  2B2V A;  3SGI A;  1B4O A;  1UE1 A;  5M9O A;  2JYO A;  3W2D A;  4GN3 B;  1N32 L;  5GRO A;  2FMM A;  4GOP A;  1VQI A;  4R4C A;  2KKD A;  5MF6 A;  2E2I B;  4NW2 A;  4R9W A;  5IOD A;  2KCT A;  1XPR A;  1SMY D;  4PZ7 A;  1QCV A;  2O4X A;  4HSV A;  1PFV A;  1G2T A;  2DSX A;  3KUP A;  2NVY L;  1ICW A;  4G57 A;  4Y7N B;  2MGS A;  1XMO Q;  3WWN B;  1F2M A;  4AYB E;  2V0E A;  2F0V A;  2F0Q A;  4A3G L;  3PQI A;  1KAW A;  3RLN A;  4YWL A;  2E75 C;  2K14 A;  4I7Z C;  1HNX L;  3I4N H;  4DV1 Q;  1LT4 D;  3KDF B;  3HOV B;  4A3B L;  5IP9 H;  5C4Z A;  2CKA A;  4DUY L;  2X69 A;  1KLU D;  1Z7T A;  2MFI A;  4BY7 G;  3MA2 B;  1TS3 A;  4TVM A;  1SNC A;  2AYJ A;  1EWI A;  4QL5 A;  4IOC A;  4A93 L;  5LL6 S;  1ROD A;  4C1N K;  4A3B B;  4DV6 L;  5D14 A;  3NQT A;  1IL8 A;  1R4P B;  5LMN W;  2SNS A;  3PUY A;  1ET9 A;  2M6O A;  4DKA C;  4E6I A;  4BS9 A;  5E4X A;  3IKJ A;  3EQL C;  4ZAI A;  1HNX Q;  4JI4 L;  1VQ4 A;  4A3B G;  1PTO F;  4Q0F A;  4A3E B;  2BDO A;  4UAI A;  2SOB A;  1E24 A;  2KEN A;  1BF4 A;  3PO2 B;  4DR4 Q;  3S14 B;  2PQA A;  1SMX A;  3OWF A;  2JA6 H;  3JAM c;  1JR0 D;  1O80 A;  1OXS C;  3SVM A;  3H09 A;  4R4O A;  4TRD A;  5M3F B;  5DM7 3;  2UUA L;  3G4S A;  1BOS A;  2KED A;  4CDE C;  1DVB A;  2NZ1 D;  3GO5 A;  3U9O A;  3NPP A;  5CV5 A;  1XPO A;  1XTC D;  1BQQ T;  1HTP A;  2KUM A;  2EZV A;  1DGS A;  4KKU A;  2MP1 A;  3NXW A;  1I6H H;  1SJH D;  2OF1 A;  2KN9 A;  2BCO A;  1EQV A;  1FHH A;  1Q1B A;  4HTH A;  3OYY A;  4PG3 A;  3I4M B;  3DWP A;  3KF8 B;  2QCP X;  4YCW A;  3HOY G;  3ERQ A;  1KAB A;  3R93 A;  5IWA L;  5IP7 G;  1OXV A;  1FGB D;  3PZA A;  1S5B D;  1PFW A;  1B71 A;  1GXD C;  4DNT B;  3OWE B;  3J7A 5;  4GNX B;  3R3O A;  4B9X A;  4PZ6 A;  2L55 A;  5DM6 3;  3KJP A;  1ODH A;  3CRL C;  4RGT A;  1BCP D;  1QVF A;  4N8F A;  2Z3Q B;  4JI1 Q;  3K5M A;  4JBW A;  1GOZ A;  2Z4H A;  2WFW A;  3I7F A;  5JAV A;  3FPP A;  1CKN B;  1TKW B;  3TBI B;  2QEX A;  4QF4 A;  2M4V A;  3KYV A;  2KEE A;  2EE1 A;  2MQH A;  3O13 A;  1EQT A;  4OX9 Q;  2TSS A;  1RJT A;  1SNP A;  4HJ7 A;  1GUT A;  1DON A;  1R0J A;  2EXZ A;  5IGE A;  3GTK H;  2OWO A;  1HZA A;  1E1T A;  3ICE A;  1RDP D;  2E2I L;  3P1H A;  2JA9 A;  4QIW B;  3VA7 A;  1ONL A;  1X3F A;  2L15 A;  2A19 A;  2K04 A;  5C4J L;  4RAU C;  2ES2 A;  3CC2 A;  3SE0 A;  1PRT F;  4C3I L;  1HTL D;  5C44 H;  1PYS B;  1A6X A;  1E0B A;  3M3Y L;  3GTM L;  3M7N A;  4POF A;  1C7Y A;  1JOQ A;  1YHB A;  4R4Q A;  4ULL A;  4F88 A;  3SK4 A;  1JOR A;  5CV8 A;  4LF7 Q;  1PTO B;  4FNF A;  4XYQ A;  2UXD L;  3CD6 A;  2R92 L;  4HCS A;  3X3N A;  1HRJ A;  2XJU A;  1TWA B;  2ZTD A;  4A3D B;  1S2Z A;  4IJL A;  4V19 0;  1ZEQ X;  3I4M G;  5JJI A;  1YHA A;  5AI3 A;  2QL0 A;  4KN7 C;  4DNR B;  3HOY B;  5E3F A;  4B3R Q;  4DR1 L;  5FO8 B;  1I4P A;  4GS3 A;  4LJZ C;  2PVE A;  1F9P A;  1LTI D;  3QVD A;  5CGK A;  2F3V A;  2IJ0 A;  1TU2 B;  5DM6 1;  3LWQ B;  4JI3 Q;  5EIN C;  5IGD A;  3GTL B;  2LS0 1;  3E9I A;  1CKN A;  4A3M L;  1E1O A;  2O5J D;  1LT6 D;  1Z92 B;  1E2V A;  4YY3 L;  5IYC G;  2PZU A;  2FXQ A;  2Q2U A;  3MEH A;  1XXG A;  3UE1 A;  1AE2 A;  1V1P A;  1V8Q A;  2NVQ H;  4R4T A;  1KDC A;  5IYD L;  5IYD H;  1JWM D;  4K8J A;  4AI1 A;  3Q8D A;  1C8C A;  3MXG A;  1LUZ A;  3K0X A;  2SEB D;  3MFY A;  2EDG A;  1I6V C;  2IL8 A;  1MBY A;  2EJG C;  3ULL A;  2NUC A;  2CWP A;  3GTP L;  1EY5 A;  1SJE D;  3HEJ A;  1Q7Y C;  2XJR A;  4P74 A;  1NNX A;  4QY7 A;  1CKO A;  4AR5 A;  1G91 A;  3UDG A;  1RIP A;  2M00 A;  3GP7 A;  3K58 A;  2KHI A;  3J7Z 1;  1E2W A;  2Q8R E;  4IN3 A;  1YI2 A;  1ILP A;  4RCO A;  5A35 A;  1LM0 A;  1WCM B;  3W3A A;  4L63 B;  1GUN A;  1X55 A;  3URY A;  2NVQ B;  4KMU C;  2DNC A;  3TS0 A;  1H95 A;  1GUS A;  1A62 A;  1L1O C;  3R8B A;  3GTO L;  4IQZ A;  5IP9 L;  4A3B H;  5EPK A;  3NBH A;  1EEI D;  1VQG A;  4DV3 L;  1BRF A;  4EQP A;  2PPB C;  3S15 H;  4AHZ A;  1KDA A;  1I5F A;  3IFD A;  2VB3 X;  4I65 A;  3GTP H;  3NHH A;  1STA A;  1X54 A;  4IUR A;  1ASZ A;  2HIV A;  4PMB A;  4IO9 A;  1HR0 L;  3AMU A;  2CH4 A;  1SE3 A;  1CHQ D;  2E74 C;  5A2Q L;  4DV6 Q;  4K5V A;  3M3Y H;  4KKT A;  1RYQ A;  1B9N A;  4A3C H;  1EYD A;  1Y1V G;  4C3I H;  2QF7 A;  1YJ9 A;  1HQR D;  4PMC A;  2K5H A;  3L3O C;  2R7F A;  1N36 Q;  5M3M H;  3CKI B;  4A3F L;  1PRT C;  1V1P B;  5CMD A;  2EY5 A;  3HOU G;  3CW2 C;  1C48 A;  5JJZ A;  4WOR A;  4DV0 Q;  2ZXO A;  5M5Y B;  1U4M A;  1AFP A;  1B53 A;  3WWV A;  2Y0S B;  3OHX C;  1D1K A;  2RDV A;  3TZD A;  5CC4 A;  4G7H C;  2ATW A;  4R8I A;  3PIO 3;  1PFN A;  2PZW A;  3HOZ B;  2R7D A;  3J80 i;  1BVS A;  1TS5 A;  5IYB L;  1EY9 A;  1G2S A;  1QNU A;  3H97 A;  2Z1C A;  2K5W A;  5GAE C;  3RR5 A;  1XNR Q;  1F9S A;  2FHT A;  1UEB A;  5BN5 A;  1LAC A;  3KOJ A;  4S3S A;  1VQP A;  2CKC A;  1UWV A;  5EBD A;  1WCM L;  1GD7 A;  1IBL L;  3TZU A;  4O42 A;  2WP8 J;  3NP8 A;  5JVG 1;  2RF4 A;  3MXP A;  4FF1 A;  2AWN A;  2MUY A;  2R92 H;  4HCE A;  5M3M L;  3C3L A;  4XGH A;  3CCQ A;  5HUR A;  3TRZ A;  3NTI A;  1VS0 A;  2L1B A;  1TY2 A;  4GOP B;  2K75 A;  2DUD A;  4X65 L;  1NSN S;  2WIN B;  3NWT A;  1J9O A;  4A3I B;  3SK8 A;  1R0I A;  5LMU L;  1SMU A;  3T1Y Q;  2E5L Q;  1AH9 A;  5AJ3 Q;  1HNZ Q;  1SR3 A;  3HOW H;  3MHB A;  4NXM L;  1WFQ A;  3VA5 A;  1C09 A;  1SYC A;  3KBX A;  2AUS B;  3Q24 A;  1EYC A;  3NSW A;  5HY6 A;  3SK6 A;  5K5P A;  5IT9 c;  3H99 A;  2OQK A;  3U9S A;  1A3T A;  4FXG C;  3RD4 A;  1CTM A;  2N3S A;  1JWU D;  1IRN A;  1LV9 A;  4BBS H;  1HH2 P;  5KYI A;  4AI0 A;  1LT3 D;  3KYY A;  2AWO A;  3FMC A;  3D6W A;  3BZD B;  4R1J A;  4XT3 B;  4DUZ L;  2R92 B;  4BA2 I;  4DR7 Q;  1Z6H A;  2NVT H;  4XTC S;  2UXB L;  4DR6 Q;  4XYO A;  2V0F A;  4AYB P;  4H44 C;  1PH5 A;  2JEA I;  1E7Z A;  1MGS A;  4NXN Q;  5GAH c;  5G3L F;  4OWT B;  3A5U A;  2A69 C;  5IYD G;  2BE5 C;  3KLR A;  1Q8K A;  4FXK C;  4B3R L;  1K28 A;  1UNS A;  1F4L A;  4A3J B;  1STB A;  3M4Y A;  1PH1 A;  1Q8I A;  2MO1 A;  2R7Z H;  4DV2 L;  4KY7 A;  1IU5 A;  5M3F H;  1T9Q A;  5M5X L;  3GV3 A;  3P2A A;  1SN8 A;  3W1B A;  5JVG 3;  3HG9 A;  4DU9 A;  3QOJ A;  1E2Z A;  5F2D A;  3GTQ H;  2HCC A;  3I4L A;  2AKW B;  3DUZ A;  3FHW A;  4JAD A;  3P7J A;  2XGT A;  3PO3 B;  1LTG D;  2CW0 D;  4JAG A;  3TP5 A;  3GTJ B;  3SHL A;  3GTM B;  3PWF A;  1JMC A;  4XQN A;  3A5Z B;  2OQ0 A;  4P75 A;  4CDF C;  4NPS A;  4RHS A;  2XJP A;  1T5E A;  2EVB A;  3BJU A;  3MWY W;  4QIW E;  4HIK A;  5C5L A;  4FF3 A;  1RKN A;  1AZP A;  5JEA J;  3TME A;  3AYH B;  3HS0 C;  1EY0 A;  1XMQ Q;  1XNQ L;  3SK5 A;  3DWQ A;  2L9H A;  3BS1 A;  4N8X 1;  3KYU A;  1E8J A;  3NWS A;  1JC7 A;  1CSP A;  1PH9 A;  1BBW A;  1L0W A;  2TMP A;  1FNU A;  3RZ6 A;  2E2I H;  1CKM A;  4LF4 Q;  2I5H A;  2DJG C;  3P8B A;  2PMZ P;  1PLF A;  3AB9 A;  3KYX A;  4AH6 A;  1GUW A;  1KXL A;  4K0K L;  4DAV A;  1GVP A;  1L0X B;  2ZIX A;  4LF9 Q;  3JR7 A;  4EQO A;  2RDG A;  3OMC A;  2HT1 A;  3MEF A;  3HOW G;  4LHL A;  3GQB A;  5K36 H;  5GAE c;  1SMM A;  3LNL A;  3BG3 A;  1LTT D;  1K8G A;  2VQE Q;  2R93 H;  1UE6 A;  3S1N H;  2F0I A;  1FVI A;  3VR5 A;  1HNW L;  1HFN A;  1B9M A;  1QIL A;  2K1B A;  1SYD A;  1NNQ A;  2DY7 A;  1S5E D;  4ZQ3 A;  1YHQ A;  4AYB G;  3I2Z A;  2L4N A;  3F2C A;  2VY3 A;  3LPE B;  3RUZ A;  4ABN A;  3VDY A;  3CQZ L;  2Z0S A;  3PUW A;  4ALP A;  4X6A H;  4DV3 Q;  1DOL A;  2NVY H;  3E5S A;  3KLW A;  3M9B A;  3M85 A;  1QVC A;  1DD2 A;  4ZUJ A;  2V3B B;  4RKB A;  3A54 A;  1VQ8 A;  1KLG D;  3B0A B;  4JCV E;  1DZ1 A;  2HUG A;  2B2T A;  1A3U A;  3F1Z A;  4GLA C;  4JI7 Q;  2F0W A;  3H9B A;  2ZM6 Q;  2EYM A;  3RLO A;  3PSI A;  1STN A;  2HR5 A;  3ND9 A;  2JA6 G;  1QUQ A;  2AHO B;  3W5O A;  4A76 A;  3OW2 A;  4X64 Q;  4ZUI A;  4A3K H;  3U4Z A;  3H0G H;  3PGZ A;  3DM1 A;  3J81 j;  2JP1 A;  5NUC A;  1NY4 A;  1EYG A;  4DAY A;  3CCE A;  3DEP A;  2VW9 A;  1QZG A;  5FKA C;  2ALY B;  3E0J A;  4AHY A;  4DN4 M;  2AUJ D;  3T13 A;  5C4X B;  3HOW B;  2EIF A;  1RCV D;  3S17 L;  3S1M L;  5C3E H;  4BBS G;  2HCI A;  1PVO A;  1J8I A;  1VQ6 A;  4BXX G;  4KD3 A;  4UHV A;  4UP8 A;  2KCM A;  4MTK A;  2PVX A;  4A3F G;  1B2T A;  1Y8N B;  2PO4 A;  3U4V A;  1B3Q A;  4OEM B;  4Y7N L;  4IAL A;  3S2D L;  4CDC C;  3MTS A;  5C0X G;  2C9O A;  1LAB A;  3IL8 A;  3CP0 A;  2K52 A;  3MPS A;  5C3E G;  3S1Q H;  3QR8 A;  5AFW A;  1O7Y A;  1TWG L;  1IYV A;  2JA6 B;  2WV6 D;  1JJG A;  4KHP L;  1WCM G;  2UXB Q;  3MVV A;  2NYD A;  3WOE A;  3H3V C;  4DR7 L;  5CYU A;  2RSN A;  3A74 A;  1TQO A;  4ODG A;  4OWX B;  1QUQ B;  2EY6 A;  4QGU A;  1SMW A;  4A3I L;  3KJO A;  2NVT B;  4YIJ A;  3EJI A;  4K5W A;  3I4M H;  1EY6 A;  3I90 A;  4DXG A;  4A3L H;  2M9V A;  3QB3 A;  4Y52 L;  4DV2 Q;  1G29 1;  4J15 A;  3FDT A;  1LKM A;  3R2I A;  3M4O H;  1SDF A;  3ER0 A;  1K83 L;  4IJH A;  3MAQ A;  1KHI A;  3DHQ A;  4BY1 H;  3HOW L;  1HNZ L;  2B8F A;  1G6Z A;  4C1N I;  2A6H C;  1NMG A;  3CCM A;  3FPU B;  2P5Z X;  1L2F A;  2RQX A;  1HFG A;  4C3J L;  1KNA A;  2CR8 A;  1CHP D;  3I73 A;  5H1S E;  4IPC A;  1TWF B;  4V0B A;  1R9T B;  1GJX A;  1EYA A;  2VQF L;  4V19 6;  3ND8 A;  4F8M A;  1LTS D;  3K5O A;  4KJN A;  1Y69 U;  2WAC A;  1FNV A;  2JA8 B;  2OEO A;  4C3I G;  1EOV A;  5KNB A;  4ZRZ A;  4LUO A;  5IE8 A;  2AMC B;  2NTT A;  2RKS A;  3K7A L;  2CFM A;  2K5V A;  1B2O A;  1SBB B;  2N49 A;  1ENC A;  3RLF A;  4Y52 H;  4C3H G;  1CA5 A;  2WAQ B;  3LWP B;  3GD7 A;  5IGF A;  4G7Z C;  4JI0 Q;  3MXN B;  3S9W A;  2NWG A;  5C4X L;  1JB7 A;  3HKZ E;  4JAE A;  4DF7 A;  2H4O A;  2OCE A;  1QB5 D;  4TSS A;  3I91 A;  2C6A A;  5EPL A;  3S14 L;  2G9D A;  2X6L A;  1LTR D;  2R3Z A;  3QIA A;  2BH2 A;  4LF6 L;  5M3F L;  5ELB A;  2PNR C;  1EY4 A;  5J3B A;  5M5Y H;  1BFY A;  3GDE A;  1PA6 A;  1HR0 Q;  1IKM A;  3CAM A;  4KHZ A;  4QQB X;  1IW7 C;  3S2D H;  4A3M G;  1R9T L;  1YZ6 A;  1O7L A;  4XQQ A;  4JBM A;  1QVG A;  1V1Q A;  3CQZ H;  1UAP A;  4R8N A;  3H0G B;  1SFO H;  3ERS X;  4K2L A;  3FDJ A;  2ZJP A;  5C3E L;  3LWV B;  5AI2 A;  2RHQ B;  5DNF A;  4HJ8 A;  4A3J G;  2R93 L;  1SYB A;  4ILW A;  3CC7 A;  3GTJ L;  1ILQ A;  4LF7 L;  4DUY Q;  2RHS B;  4OIJ A;  2JQO A;  1SRU A;  5I9O A;  3TDQ A;  4X62 L;  1MD2 D;  3J81 c;  3PO2 H;  3ZG6 A;  2ZXR A;  1SAP A;  2FIN B;  1VZI A;  4X3S A;  5JVH 3;  2JXM B;  4ZN1 B;  5JPN C;  1S5D D;  4P2C B;  4KY6 A;  1NR4 A;  2XSC A;  5JEA G;  5M5Y L;  1WTH A;  2LXJ A;  5IIF A;  2O2L D;  1VQD A;  4BXX L;  2K01 A;  3E9H A;  3L7Z C;  1F77 A;  3MXU A;  5E1F A;  2BE5 D;  1ZKO A;  2JI2 A;  3U50 C;  5LL6 X;  1DOK A;  3KF6 B;  4DV4 Q;  2ZM6 L;  3QQC E;  1H9K A;  1IRO A;  4IFD J;  4G7O C;  1IL2 A;  1DM0 B;  1Q3L A;  4DXF A;  2JA5 B;  4K6L A;  1S24 A;  4LNQ A;  1VQ9 A;  3J7A V;  2LSS A;  3DLL A;  4B08 A;  4HJA A;  1YIT A;  1Z47 A;  4H13 C;  3J81 L;  1KIX A;  3D0F A;  5GAD c;  3T1H L;  1M8A A;  3M3Y B;  4U68 A;  4A3K B;  4U67 1;  1XX8 A;  2B39 A;  4ZN3 B;  2RBM A;  1YNX A;  1RD9 D;  3D31 A;  2F0M A;  1UE7 A;  4L8J A;  5EPJ A;  2JI1 A;  1A0I A;  4MTN A;  1G8Z D;  4RHR A;  5BR8 L;  2B2Y A;  4RGM A;  4GKJ L;  2VNU D;  2E2H L;  4H0L C;  1HHV A;  2F4I A;  4AHX A;  2I5L X;  2VQF Q;  2CH4 W;  1X56 A;  1XJV A;  4UDU C;  2VUM B;  3T4A C;  4BXX H;  2Y0S E;  1PRT B;  4YCV A;  2F0L A;  2K50 A;  2RSO A;  1R0F A;  2KHJ A;  2PMZ B;  3A8J E;  3LX0 A;  2A69 D;  4LFC L;  2YV5 A;  2R93 B;  4C3H H;  4HID A;  1T9P A;  3JC6 2;  4DGZ A;  4KHV A;  3GTJ H;  4BBS L;  4N9T A;  3A55 A;  4A3L G;  4PZ8 A;  4U67 3;  1QWY A;  2PW7 A;  1PHJ A;  4RH6 A;  3EN2 A;  2EXD A;  1XYI A;  4L5S A;  3EVQ A;  1VQO A;  2D2C C;  4LFA Q;  1GM5 A;  1PFM A;  2D9U A;  1K73 C;  1D1I A;  1WI5 A;  1P8L A;  2QEJ C;  1Y1V H;  1R9T H;  2RDF A;  1BUV T;  2Y0S G;  3MZ5 A;  4KHP Q;  3S1R L;  5HGT A;  4JPB W;  5IWA Q;  1RTO A;  5FJ8 H;  2LY7 A;  1YBY A;  3VYU A;  1EL0 A;  1BXT A;  2KHS A;  3FKI G;  4BY1 G;  3JC6 6;  4RWS C;  5IT9 L;  4OO1 G;  2A73 B;  3W1G A;  1EWH A;  3NUC A;  1HA5 A;  3S1M H;  5COR A;  4BBS B;  1K3R A;  1GUO A;  1SE4 A;  4GNX C;  2LXK A;  5GAH C;  1AE3 A;  2NVQ L;  1CQV A;  4K2K A;  4JV5 L;  5MGN A;  1NTG A;  4XIG S;  5KIX A;  3C1F A;  1IBK L;  3E0E A;  1DJR D;  2WKD A;  2NZH A;  3J80 c;  2X6G A;  4QB4 A;  1HPC A;  2XN9 C;  2B2W C;  1ESR A;  2LFN A;  1PFS A;  3PO3 L;  2XWJ B;  4L5R C;  2G5D A;  1FJG Q;  5LMN Q;  4A3G G;  2O5J C;  6RXN A;  1UUP A;  2VQE L;  1YNJ D;  1TT2 A;  2QIL A;  2OT2 A;  3I3C A;  1BBX C;  2A1A A;  3RZT A;  1VZG A;  4OEL B;  1D5Z C;  3EFX D;  4JV5 Q;  1OXX K;  2BOS A;  4NP5 A;  3H91 A;  1WOC A;  3HP3 A;  1I4X A;  4JK1 C;  2Y0S P;  4BY7 L;  4L5T A;  3X3M A;  2K03 A;  5FJ8 G;  3CCJ A;  2JA7 L;  4MNO A;  5COY A;  2M4Y A;  1H9S B;  4LFB L;  1CSQ A;  2JA8 H;  3UDF A;  1CFM A;  1HA6 A;  2UUB L;  2J9U B;  4LFC Q;  2F0S A;  1K83 H;  5C4J H;  1JE4 A;  4UY8 1;  3T56 B;  3M4P A;  1YK5 A;  4JYA L;  2JEB I;  1VQK A;  2L12 A;  2B2U A;  1Y1W G;  1Q12 A;  1B44 D;  3A0J A;  5JVH 1;  4HN7 A;  3NFP I;  5IY0 A;  1A3V A;  3PV0 A;  3K5N A;  5IOC A;  4AI2 A;  4DV1 L;  2I46 A;  4A3I H;  3EA6 A;  1TXY A;  2E2D C;  4G4K A;  5DLQ E;  1K8A C;  3M4O B;  4DR6 L;  1RWD A;  4A3K G;  4B9W A;  5KGU A;  1NAP A;  4IFD H;  1NR2 A;  2ZT9 C;  1U9R A;  3KDF A;  4IFD G;  3S2H B;  1SYG A;  4CJ0 B;  5I6W A;  1EQQ A;  1TWG H;  1PFU A;  4LF8 L;  5I6Y A;  3S1Q L;  3P75 A;  4BA1 I;  3RZO H;  3H3V I;  2A6H D;  2M2L A;  4C3I B;  4WFN 3;  4ID6 A;  2XJS A;  1ZYR D;  3KLS A;  1Z9F A;  2JA5 G;  1M4V A;  3OTO Q;  4YWM A;  2NVY B;  3HOV H;  2K5D A;  1EY7 A;  3KYW A;  1O7Z A;  3N6R A;  4DV0 L;  4YWK A;  4H7B A;  4YHH Q;  2A68 D;  3DXJ C;  3K35 A;  4AQY Q;  2UUC L;  2EJF C;  1QCB D;  4QJF A;  2F0K A;  4KI0 A;  4J1M A;  2F0P A;  5KNC A;  2PYA A;  5EJW A;  2JA5 H;  2YU9 L;  4OON A;  1S5C D;  1E22 A;  2MNA A;  2FMC A;  2F0J A;  1EY8 A;  3HZX A;  3SDZ A;  1VQA A;  2DNE A;  3NBI A;  4HAE A;  1WTR A;  2VUM H;  3G7L A;  1S40 A;  1KL9 A;  4CKC A;  3H9C A;  2KQ3 A;  1QNK A;  3FKI B;  2XNA C;  4C2M B;  2Z8L A;  1IYJ B;  1TWC B;  2B2T C;  1EU4 A;  5EKL A;  4C3H L;  3J7Z C;  5C5M A;  1M1K C;  2DY8 A;  3Q23 A;  1RL2 A;  4DR5 Q;  3EBE A;  4A3J H;  3RYG A;  1TWH H;  2GN5 A;  4MIU A;  5C0X I;  1STY A;  5IP9 G;  3HFZ B;  5A2Q E;  2DN8 A;  2CW0 C;  3GTG H;  1X3P A;  4NXM Q;  2EY1 A;  1HZC A;  4X66 L;  4X6A L;  1VQF A;  4ZCK A;  1WYD A;  3JAM E;  5DAU A;  5D3I B;  4M1U B;  1PV4 A;  4BBR L;  3KFU A;  3ULP A;  4LK1 C;  1LKO A;  2BH8 A;  3GTL H;  2QGQ A;  2ZXP A;  3PCO B;  4PV1 C;  2ASB A;  1BBU A;  3GTO B;  1SXT A;  4DR5 L;  2K7V A;  5CV6 A;  3QO2 A;  5ELO A;  2IHE A;  1PRT D;  2RA4 A;  5LHY 1;  1TWF L;  2XTI A;  1A63 A;  3DMU A;  3G48 A;  3TQY A;  4DR2 Q;  1BE7 A;  4J8Q A;  3MQK B;  1EU3 A;  1I3Q H;  3LNN A;  4OGQ C;  3D6C A;  1YJW A;  2UXC Q;  3NTK A;  1YNJ C;  3D4R A;  4A4I A;  4GLX A;  3T1Y L;  3R2T A;  2E5L L;  4HR7 B;  1AZQ A;  2E2H B;  3G6J B;  4FP5 D;  4C3J H;  1PH7 A;  1IBK Q;  2B5I D;  8RXN A;  1U4P A;  2B63 B;  3QWN A;  2UXD Q;  1I3Q B;  1TR5 A;  2A5H A;  3PUX A;  1TVX A;  1N32 Q;  2HVY C;  4GN4 B;  4RGO S;  5M5X B;  3TN2 A;  3OIQ A;  4WJ3 M;  1P7P A;  1DOM A;  1STH A;  1GHJ A;  4BBR B;  1BKB A;  4A3L L;  3S1R B;  3CCR A;  1U5K A;  5IYB H;  3PO3 G;  3T1H Q;  5T1I A;  3F2D A;  1S3O A;  1YEZ A;  4JI3 L;  1SNQ A;  3VR6 A;  1K0R A;  5EKI A;  4JI8 Q;  3TRE A;  4EVO A;  3RNU A;  4PNY A;  1XMO L;  2RCN A;  2B63 L;  4BBR H;  3I8Z A;  5C3W A;  1BQ8 A;  4IPD A;  3PIO 1;  3STB C;  2K32 A;  5FLX c;  1IXR A;  2C35 B;  2A6E C;  4A3F H;  1SYF A;  1K83 B;  4QUF A;  1B8A A;  1FR3 A;  1Y1V B;  2F0D A;  5JPM C;  3PMF A;  2D0O A;  1IBM Q;  1SSO A;  1CI3 M;  1VQJ A;  1CT1 D;  1VQB A;  1NMF A;  2PZT A;  5EKK A;  1QOH A;  1S4Z A;  5EAY A;  5E4W C;  4A3J L;  4EQN A;  4Y7N H;  4F87 A;  4DK3 C;  3ULJ A;  2Q8T A;  3V2T A;  1L1O A;  1VQN A;  3S15 L;  2Z3R B;  1JIC A;  3LWU A;  3T16 A;  2QW7 A;  1VQL A;  4GS7 D;  5C0X H;  3I55 A;  3JC6 3;  4K5X A;  4UP9 A;  1RDV A;  1PH3 A;  4A93 H;  4P72 A;  1PTO D;  2EPB A;  1I4Q A;  1G51 A;  1IYU A;  2YTY A;  3MC0 B;  3S2H L;  3TSS A;  5CV4 A;  4A75 A;  4AHW A;  4LF8 Q;  3KYH C;  2RVL A;  1PYB A;  1J5E L;  5FLX L;  3I4N L;  4DA2 A;  1E3P A;  1H9J A;  1PYW D;  1SE8 A;  4BBR G;  2D0P A;  1ML0 D;  3PIO A;  2HDM A;  2APO B;  1WTV A;  2CQA A;  3OSO A;  1HJP A;  4WJW A;  3VPB E;  3J7Y W;  1PZJ D;  2E76 C;  2PQE A;  4PQX A;  2Q2T A;  1WTO A;  2JA6 L;  2HD3 A;  4YCU A;  3OIP A;  4DV7 Q;  3TP8 A;  1STE A;  1OXU A;  4WJ4 A;  3L9A X;  3LWO B;  4L5Q A;  2UU9 L;  4HED A;  2XVS A;  1EZ8 A;  1U4L A;  2NN6 H;  5CBE E;  3TP7 A;  1HZ9 A;  2JA7 B;  2F0N A;  1TS4 A;  1FYC A;  3CXC A;  2QDB A;  1EFI D;  2KCN A;  5IGC A;  4ZKB B;  1Q86 C;  5CV7 A;  1N9W A;  3K0Y A;  3M7G A;  1YVC A;  3FKI H;  1KC8 C;  3KK7 A;  4HMJ A;  1D5M C;  1RF2 D;  3HOZ G;  4BY1 L;  1KRS A;  3HJW B;  2MJ8 A;  4K6D A;  3TS2 A;  5I2X A;  4DR3 Q;  3DEO A;  1RYT A;  2PW5 A;  3SS2 A;  4OHJ A;  5FLM H;  1WTP A;  2E2J B;  2BA1 A;  3K6O A;  4A3E G;  1MJC A;  2EYJ A;  4LUZ A;  3A7A B;  2XRQ D;  2AQ1 B;  2MHV A;  1IZ6 A;  4DAP A;  4DR2 L;  4NXN L;  4E6Y A;  5C4X G;  3JAM L;  4JI6 L;  3PUZ A;  3CC4 A;  5DM7 1;  2B2U C;  4DR1 Q;  4G6B A;  1PFY A;  3NTH A;  1DXM A;  5FK9 C;  4LF6 Q;  4IFD I;  3CPF A;  1LTL A;  5GAG c;  1EEF D;  1F9R A;  1RDG A;  1TII D;  1I94 Q;  1KAA A;  1CZG A;  2Q2I A;  3L2P A;  2ZJR A;  1A8V A;  1KRT A;  1GHK A;  4AR4 A;  2K33 A;  3GTG L;  3AFQ A; 
#chains in the Genus database with same CATH homology
 3TS0 A;  1S24 A;  3K81 C;  4LNQ A;  1H95 A;  1A62 A;  1L1O C;  1VQ9 A;  4A93 G;  4AI3 A;  2LSS A;  1C9O A;  4A3B H;  3DLL A;  1W3S A;  2PI2 E;  1VQG A;  2M6P A;  4DV3 L;  4HJA A;  1BRF A;  3AFP A;  4JI2 Q;  1YIT A;  4AHZ A;  1Z47 A;  1I5F A;  2HQL A;  3IRB A;  3S15 H;  3BZK A;  5E7N A;  2JE6 I;  4DV5 Q;  1KIX A;  3D0F A;  2L0Z A;  2F52 A;  1VZH A;  4K9F A;  3GTP H;  5GAD c;  1X54 A;  2ZTC A;  3T1H L;  1ASZ A;  2HIV A;  3H0G G;  4IO9 A;  1I50 H;  3L0O A;  1HR0 L;  4RXN A;  4U67 1;  3HKS A;  4LF4 L;  4DV6 Q;  2HHH Q;  4ZN3 B;  3I56 A;  3M3Y H;  1YNX A;  4FDB A;  1RYQ A;  4GKK L;  4A3C H;  2R93 G;  4DK6 C;  1Y1V G;  2IT1 A;  3D31 A;  4C3I H;  1YJ9 A;  5LMU Q;  1UE7 A;  1EIY B;  2K5H A;  4RMF A;  2R7F A;  1N36 Q;  5M3M H;  2JA7 G;  1NXE A;  2JI1 A;  1A0I A;  4AQY L;  2UUC Q;  4MTN A;  1CAA A;  3HOU G;  3WWL A;  1JYB A;  3CW2 C;  5BR8 L;  1DX8 A;  4DV0 Q;  4GKJ L;  2VNU D;  4AR3 A;  3PUV A;  3WWV A;  1C0A A;  2RDV A;  3B08 B;  2YU9 H;  2ATW A;  4AHX A;  2I5L X;  2VQF Q;  1X56 A;  4GOP C;  4YY3 Q;  1XJV A;  1Q82 C;  1N8R C;  1YV1 A;  2Z6K C;  2ERS A;  1D8L A;  2R7D A;  3J80 i;  1BVS A;  4BXX H;  2Y0S E;  4OWW B;  1FJG L;  1VQ7 A;  4LWC A;  4YCV A;  4AR6 A;  2K50 A;  5GAE C;  3RR5 A;  1XNR Q;  3RN5 A;  4DV5 L;  1UEB A;  3S1R H;  3HOY H;  1R0F A;  2KHJ A;  5RXN A;  3KOJ A;  1VQP A;  4OO1 I;  4O2D A;  3S16 H;  2A69 D;  2CKC A;  1UWV A;  2YV5 A;  4LFC L;  2IY5 B;  4DR4 L;  1B2J A;  1GD7 A;  4C3H H;  4HID A;  2I5M X;  2IX1 A;  2CKZ B;  3PIP 1;  1IBL L;  4UPA A;  4JI5 L;  2HIX A;  1FHM A;  1T9P A;  2WP8 J;  3GTM H;  3JC6 2;  5JVG 1;  2RF4 A;  1GO3 E;  3U58 A;  1XMQ L;  2JA7 H;  3GTJ H;  2AWN A;  2R92 H;  2CQO A;  3F8T A;  2IHF A;  4XGH A;  5C44 G;  4NB3 A;  3CCQ A;  4JI6 Q;  3TRZ A;  3S14 H;  4A3L G;  1VS0 A;  4PZ8 A;  1X3E A;  4GKJ Q;  4LF5 L;  4GOP B;  4P73 A;  1PHJ A;  3NBH B;  2K75 A;  1FGU A;  2DUD A;  3EN2 A;  2EXD A;  4X65 L;  1G6P A;  4JYA Q;  4L5S A;  1VQO A;  2B3G A;  4LFA Q;  3J81 i;  3CCS A;  1GM5 A;  4YHH L;  1R0I A;  5LMU L;  1SMU A;  1K73 C;  3T1Y Q;  2E5L Q;  1AH9 A;  5AJ3 Q;  1YIJ A;  1WI5 A;  1P8L A;  4GLV B;  2I0Q A;  1HNZ Q;  1SR3 A;  5C4X H;  3HOW H;  1Y1V H;  1R9T H;  4NXM L;  4A3D G;  1WFQ A;  1C09 A;  1X65 A;  2Y0S G;  4KHP Q;  4XXB B;  5IWA Q;  5HY6 A;  5FJ8 H;  4JI2 L;  2MS3 A;  4LHN A;  1YBY A;  4X65 Q;  4B3T L;  5IT9 c;  2ZTE A;  2OQK A;  2V1C C;  3FKI G;  4BY1 G;  3JC6 6;  3NEN A;  4OO1 G;  2XJQ A;  2N3S A;  4LW1 A;  3W1G A;  3S1M H;  4IOA A;  1IRN A;  5IP7 H;  1K3R A;  3RZD H;  1HH2 P;  4BBS H;  4AI0 A;  4B3R Q;  4GNX C;  2LXK A;  5GAH C;  4DUZ Q;  1AE3 A;  3KYY A;  2AWO A;  2VS1 A;  5ELN A;  2GVB A;  4JI7 L;  1W2B A;  3PKI A;  5MGN A;  2K4K A;  4DNI A;  4JV5 L;  1NTG A;  2F3I A;  1JT8 A;  4R1J A;  1VQE A;  4XIG S;  4DUZ L;  3TEH B;  1PH2 A;  1IBK L;  4BA2 I;  3E0E A;  2OTL A;  1LYL A;  2VL6 A;  2NN6 I;  1IBM L;  2NVT H;  4XTC S;  2VUM G;  2UXB L;  4DR6 Q;  2NZH A;  3J80 c;  2V0F A;  4A3I G;  1VQM A;  1PH5 A;  2JEA I;  1E7Z A;  3G6E A;  4ME3 A;  1U0L A;  1D7Q A;  1PFS A;  4NXN Q;  3CME A;  5GAH c;  2PNH A;  4L5R C;  4QQB X;  3UDX A;  1FJG Q;  5LMN Q;  4OWT B;  1MKH A;  3A5U A;  5IYD G;  4A3G G;  1NBW A;  1Q8K A;  4RG1 A;  1WCM H;  4X66 Q;  6RXN A;  3LGJ A;  4B3R L;  1SRO A;  2VQE L;  2R6G A;  2B63 G;  5K36 G;  1Q1E A;  2PMZ E;  4KLK A;  2A1A A;  2MO1 A;  1PH1 A;  3RZT A;  1VZG A;  4DV2 L;  2R7Z H;  3CF5 A;  1IU5 A;  4LFB Q;  3B6Y A;  1T9Q A;  5K2M E;  5GQO A;  5H1S c;  5M3F H;  1B13 A;  3P2A A;  1OXX K;  1SN8 A;  1UE5 A;  3W1B A;  4JV5 Q;  2GVA A;  1YK4 A;  2WB1 E;  4X64 L;  1WOC A;  1T9H A;  4L5T A;  4APV A;  3OTO L;  3GTQ H;  2AKW B;  1WJV A;  5FJ8 G;  3CCJ A;  3FHW A;  2R92 G;  3DM3 A;  4MNO A;  4JAD A;  2HHH L;  1IW7 D;  2M4Y A;  2XGT A;  2E2J H;  2E8G A;  4LFB L;  1R0G A;  1CSQ A;  2JA8 H;  4JAG A;  1VCX A;  1S30 A;  3UDF A;  1Y14 B;  1KQS A;  3CCU A;  2WB1 G;  2UUB L;  2J9U B;  2KBN A;  3PWF A;  1JMC A;  5GAG C;  4DAY B;  4LFC Q;  5MFP A;  2K2D A;  1K83 H;  3A5Z B;  5C4J H;  5LMN L;  4UY8 1;  3M4P A;  1YK5 A;  2XJT A;  5AJ3 L;  2OQ0 A;  4P75 A;  4JYA L;  1X9N A;  1MIU A;  2JEB I;  1VQK A;  4OX9 L;  5M5X H;  1Y1W G;  1Q12 A;  4NPS A;  5MFZ A;  4DAM A;  4EQ5 A;  2WAQ E;  2NVX H;  2XJP A;  3BJU A;  3H15 A;  4QIW E;  4HIK A;  3A0J A;  5JVH 1;  2UUA Q;  3NFP I;  4UY8 C;  5IY0 A;  3PV0 A;  5JEA J;  3I4N G;  4AI2 A;  4JOI C;  4DV1 L;  4TPU A;  3M4Q A;  2JJQ A;  3AYH B;  4A3I H;  4TVA B;  1XNQ Q;  1TXY A;  5C0X J;  1K8A C;  5DLQ E;  2R7Z G;  2WAQ G;  3ZJY C;  4DR6 L;  3JAM i;  4OXP A;  1RWD A;  1SLJ A;  4A3K G;  5MLC 3;  1HNW Q;  1XMQ Q;  1EQR A;  2E2H H;  1XNQ L;  3NEM A;  4A3C G;  3FP9 A;  1XTD A;  1Y1W H;  3KYU A;  3KDF A;  1E8J A;  1IBL Q;  1Q46 A;  4IFD G;  1CSP A;  2Z6K A;  1HZB A;  2IX0 A;  1PH9 A;  1BBW A;  1L0W A;  2PPT A;  4JI1 L;  2N78 A;  4GNX A;  2F4V Q;  1EQQ A;  1TWG H;  1T9O A;  2GMG A;  2UUB Q;  2LCQ A;  3CCL A;  4LF8 L;  4JOI A;  3RZ6 A;  5HGQ A;  2JA8 G;  2E2I H;  1CKM A;  1TWC H;  4BA1 I;  1VQC A;  2I5H A;  4LF4 Q;  2B63 H;  3H3V I;  1N34 Q;  4LF9 L;  2A6H D;  3P8B A;  1EIF A;  3KYX A;  4AH6 A;  2A8V A;  2XJS A;  1KXL A;  4K0K L;  2ZJQ A;  1X6O A;  1Z9F A;  1GVP A;  2YTV A;  2ZIX A;  4YWM A;  4AIM A;  3OTO Q;  1N34 L;  2JA5 G;  4LF9 Q;  3AEV A;  3HOV H;  4HIO A;  1PH6 A;  3KYW A;  3MEF A;  2HT1 A;  4LHL A;  4DV0 L;  4YWK A;  3HOW G;  4YHH Q;  2A68 D;  3SGI A;  2H5X A;  4AQY Q;  3K35 A;  2UUC L;  4LFA L;  5EIO C;  1UE1 A;  4QJF A;  4KI0 A;  1V43 A;  4GN3 B;  5GAE c;  1YJN A;  1SMM A;  1VQ5 A;  3LNL A;  5GRO A;  4GOP A;  1N32 L;  2PYA A;  2VQE Q;  1K8G A;  2R93 H;  1UE6 A;  1VQI A;  4R4C A;  2KKD A;  3S1N H;  1HNW L;  1FVI A;  2JA5 H;  1NNQ A;  4OON A;  5MF6 A;  4DV4 L;  1YHQ A;  5JJK A;  4GKK Q;  4IPG A;  4AYB G;  2H12 A;  1E22 A;  3I2Z A;  2KCT A;  4JBJ A;  2MNA A;  3F2C A;  1XPR A;  2VY3 A;  4PZ7 A;  1QCV A;  5M5W H;  3LPE B;  4JG2 A;  3VDY A;  2Z0S A;  1VQA A;  3PUW A;  4ALP A;  4DV7 L;  4X6A H;  2DSX A;  4DV3 Q;  1CAD A;  4EX5 A;  2VUM H;  2NVY H;  3KLW A;  3M9B A;  3M85 A;  1QVC A;  1S40 A;  2V3B B;  4UP7 A;  3WWN B;  4AYB E;  1KL9 A;  2V0E A;  1XMO Q;  1VQ8 A;  1K9M C;  3B0A B;  4JCV E;  3F1Z A;  4JI7 Q;  4GLA C;  1IYJ B;  1KAW A;  3J7Z C;  3RLN A;  2ZM6 Q;  1M1K C;  5M3M G;  4YWL A;  3RLO A;  2K14 A;  1EUJ A;  3PSI A;  3A44 A;  2HR5 A;  1R0H A;  1RL2 A;  4DR5 Q;  1HNX L;  3I4N H;  3EBE A;  4DV1 Q;  4A3J H;  3RYG A;  1PH8 A;  1TWH H;  1QUQ A;  2AHO B;  1NXG A;  2GN5 A;  3KDF B;  3W5O A;  5IP9 H;  3G71 A;  3CPW A;  4A76 A;  2CKA A;  4MZ9 A;  4X64 Q;  5C0X I;  3OW2 A;  4A3K H;  3U4Z A;  3H0G H;  3PGZ A;  5IP9 G;  3HFZ B;  4DUY L;  1N33 L;  5IYC H;  5BR8 Q;  4B8C D;  3GTG H;  4B3M Q;  2MFI A;  4BY7 G;  1LKP A;  4NXM Q;  1HZC A;  1VCI A;  3J81 j;  4X66 L;  4TVM A;  2AYJ A;  1EWI A;  1NY4 A;  1VQF A;  4QL5 A;  1WYD A;  4IOC A;  1EYG A;  4JI0 L;  3CCE A;  2VW9 A;  1PV4 A;  1QZG A;  1NE3 A;  4DV6 L;  3KFU A;  3ULP A;  2ALY B;  1LKO A;  2BH8 A;  5LMN W;  1YUZ A;  4AHY A;  4HJ9 A;  3GTL H;  2QGQ A;  3PUY A;  1B7Y B;  3PCO B;  2M6O A;  4DKA C;  2ASB A;  3STB D;  2EIF A;  1BBU A;  4PMW A;  4DR5 L;  1HNX Q;  5C3E H;  4JI4 L;  4BBS G;  1PVO A;  2BA0 A;  1VQ4 A;  1QZH A;  1VQ6 A;  4A3B G;  5ELO A;  4BXX G;  2IHE A;  5GAD C;  4UP8 A;  2KCM A;  1KD1 C;  1E24 A;  2KEN A;  2PVX A;  4A3F G;  4DR4 Q;  2PQA A;  1SMX A;  3U4V A;  2XTI A;  3K80 C;  2JA6 H;  1A63 A;  3JAM c;  2YYZ A;  1OXS C;  2UU9 Q;  3G48 A;  4R4O A;  1XNR L;  3TQY A;  5C0X G;  1JE5 A;  1XPU A;  2UUA L;  2K52 A;  3CP0 A;  1BE7 A;  3MPS A;  5C3E G;  2NZO A;  3G4S A;  4DR2 Q;  1H7V A;  3S1Q H;  1WJJ A;  1DVB A;  1I3Q H;  3S2H H;  3HOV G;  3GO5 A;  2VZA A;  4HIM A;  2NN6 G;  1YJW A;  2UXC Q;  1JJG A;  1XPO A;  5AN9 H;  4A4I A;  4GLX A;  3PKJ A;  1WCM G;  3T1Y L;  4DPG A;  1JJ2 A;  4H02 A;  2E5L L;  4KHP L;  1PH7 A;  4C3J H;  2UXB Q;  2NYD A;  1IBK Q;  4DR7 L;  1VQH A;  1DGS A;  4GN5 A;  2K5N A;  2B5I D;  4A3E H;  8RXN A;  4B3S L;  3KF6 A;  2UXD Q;  3A74 A;  1I6H H;  4OWX B;  4DR3 L;  3PUX A;  1QUQ B;  1N32 Q;  2KN9 A;  4X62 Q;  4QGU A;  1SMW A;  2C6B A;  3KJO A;  4LF5 Q;  1FHH A;  4GN4 B;  4BY7 H;  1Q1B A;  3I4M H;  1P16 A;  1N36 L;  3OYY A;  4B3S Q;  1GKH A;  4PG3 A;  1MJE A;  4A3L H;  4WJ3 M;  3KF8 B;  4YCW A;  3HOY G;  2Q2H A;  1BKB A;  4DV2 Q;  1G29 1;  2DGY A;  4J15 A;  5IP7 G;  1U5K A;  1OXV A;  5IWA L;  1LKM A;  3PZA A;  5IYB H;  3CCR A;  5M3F G;  3PO3 G;  3ER0 A;  3M4O H;  4K0K Q;  4IJH A;  1KHI A;  7RXN A;  1B71 A;  4JAF A;  3T1H Q;  1HNZ L;  4BY1 H;  3J7A 5;  3F2D A;  1S3O A;  4GNX B;  1YEZ A;  2ID0 A;  4PZ6 A;  4JI3 L;  1OWB A;  2F4V L;  1NMG A;  3CCM A;  1K0R A;  2EQS A;  4JI8 Q;  3TRE A;  3MSU A;  3KJP A;  2JI3 A;  3RNU A;  1XMO L;  1ODH A;  1OTC A;  2RCN A;  1EFW A;  4BBR H;  1QVF A;  2Z3Q B;  1L2F A;  1RB9 A;  4WFN 1;  4JI1 Q;  1BQ8 A;  4IPD A;  3PIO 1;  4JBW A;  3STB C;  2CR8 A;  5H1S E;  1IXR A;  2A6E D;  2C35 B;  2WFW A;  3I7F A;  4IPC A;  3S24 A;  5FLX c;  4A3F H;  1B8A A;  4IPH A;  2VQF L;  4A3M H;  1CKN B;  4V19 6;  2D0O A;  1IBM Q;  2QEX A;  1X3G A;  3IU3 I;  2M4V A;  1FL0 A;  1J6Q A;  1VQJ A;  1V9P A;  1VQB A;  1BQ9 A;  1NMF A;  3H3V H;  3KYV A;  1EOV A;  2MQH A;  3K7A H;  4O0A A;  5EAY A;  4JC0 A;  2PQA B;  4Y7N H;  2D62 A;  4LUO A;  5IE8 A;  4P71 A;  4DK3 C;  2AMC B;  3ULJ A;  4OX9 Q;  3HOU H;  1L1O A;  3K8A A;  2CFM A;  4HJ7 A;  2K5V A;  1B2O A;  2Z3R B;  1PH4 A;  1VQN A;  3HKZ G;  1R0J A;  2N49 A;  3RLF A;  2QA4 A;  4Y52 H;  3GTK H;  2OWO A;  1HZA A;  1E1T A;  4GS7 D;  3I55 A;  1VQL A;  3GD7 A;  3ICE A;  3JC6 3;  4UP9 A;  4JI8 L;  2JA9 A;  4JI0 Q;  1RDV A;  1PH3 A;  3MXN B;  4A93 H;  1X3F A;  1O7I A;  2A19 A;  2L15 A;  4P72 A;  1G51 A;  2ES2 A;  1B70 B;  3CC2 A;  3PO2 G;  1JB7 A;  3I4O A;  2YTY A;  3UDI A;  3HKZ E;  5C44 H;  1PYS B;  4JAE A;  2CWA A;  4TQU S;  1OXT A;  3M7N A;  2OCE A;  4POF A;  4A75 A;  1C7Y A;  1ZRP A;  4AHW A;  4LF8 Q;  1YHB A;  4R4Q A;  3KYH C;  5JJL A;  2ERJ A;  1PYB A;  1J5E L;  2C6A A;  4LF7 Q;  2PSM C;  2UXD L;  1CUK A;  3CD6 A;  2OTJ A;  2N8N A;  3HOZ H;  5C4X G;  1E3P A;  1TWF H;  3NEL A;  2XJU A;  1SE8 A;  2ZTD A;  2BH2 A;  1S2Z A;  4BBR G;  2D0P A;  4IJL A;  3PIO A;  3F2B A;  4LF6 L;  3I4M G;  5JJI A;  1YHA A;  5J3B A;  5AI3 A;  2QL0 A;  3J7Y 1;  1BFY A;  1L1O B;  3GDE A;  5M5Y H;  1PA6 A;  1HR0 Q;  4JI4 Q;  4JI5 Q;  3CAM A;  4KHZ A;  1HJP A;  4R4I A;  5FLM G;  4DR1 L;  3S2D H;  1QYB A;  3VPB E;  3HOX H;  1YZ6 A;  4GS3 A;  4A3M G;  2PVE A;  2Q2T A;  4JBM A;  4YCU A;  4DV7 Q;  1QVG A;  1V1Q A;  2UXC L;  3CQZ H;  3QVD A;  1OXU A;  3EIV A;  3RN2 A;  4WJ4 A;  5DM6 1;  3PIP A;  4L5Q A;  4JI3 Q;  2UU9 L;  5EIN C;  1SFO H;  3CCV A;  3ERS X;  4A3G H;  2ZJP A;  3E9I A;  1CKN A;  1HZ9 A;  1S72 A;  5AI2 A;  2JK8 A;  2RHQ B;  4LUV A;  3CXC A;  1E1O A;  2O5J D;  4HJ8 A;  4A3J G;  3RZO H;  1OWC A;  3CC7 A;  1Z92 B;  4YY3 L;  1Q86 C;  1J5E Q;  2MO0 A;  1N9W A;  4LF7 L;  4DUY Q;  1YVC A;  2RHS B;  5IYC G;  4C2M H;  3FKI H;  2FXQ A;  1SRU A;  2JQO A;  1KC8 C;  2Q2U A;  3UE1 A;  2NVQ H;  1AE2 A;  1HR0 W;  4X62 L;  3J81 c;  1IU6 A;  3PO2 H;  4R4T A;  3ZG6 A;  3HOZ G;  5IYD H;  1VZI A;  1KRS A;  3UE0 A;  3K7U C;  1ASY A;  4ZN1 B;  4B3T Q;  4AI1 A;  3PF4 A;  3TS2 A;  4DR3 Q;  3Q8D A;  1RYT A;  3GTO H;  5JEA G;  4POG A;  3SS2 A;  1LUZ A;  2B29 A;  2LXJ A;  1JJC B;  3K0X A;  5FLM H;  5IYB G;  3PO3 H;  2BA1 A;  3BU2 A;  1VQD A;  4A3E G;  3ULL A;  3S17 H;  3E9H A;  2CWP A;  3L7Z C;  1MJC A;  4LUZ A;  2BE5 D;  2JI2 A;  1Q7Y C;  2XJV A;  2XJR A;  4P74 A;  3U50 C;  1NJI C;  4QY7 A;  1CKO A;  1N33 Q;  4AR5 A;  4DR2 L;  1Q81 C;  1IZ6 A;  1TWA H;  1RIP A;  4NXN L;  4E6Y A;  3UDG A;  1M90 C;  4B3M L;  3PUZ A;  4JI6 L;  4A3D H;  3CC4 A;  5DM7 1;  2KHI A;  3KF6 B;  4G6B A;  4DR1 Q;  3HOX G;  4LF6 Q;  2JA6 G;  4DR7 Q;  4DV4 Q;  2CCZ A;  4IFD I;  3J7Z 1;  3AQQ A;  1LTL A;  5GAG c;  2PI2 A;  3CPF A;  1RDG A;  3BZC A;  2ZM6 L;  3CMA A;  1YI2 A;  1I94 Q;  3L2P A;  2Q2I A;  3QQC E;  2YTX A;  1LM0 A;  2ZJR A;  4HJ5 A;  1IRO A;  1A8V A;  1YUX A;  1KRT A;  4JBK A;  4AR4 A;  3PF5 A;  4IFD J;  1IL2 A;  1I94 L;  1X55 A;  3AFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...