4YWMA

Pyrococcus furiosus mcm n-terminal domain beta-turn triple mutant pentameric ring
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEAAEATPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 67
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ywmA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywmA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywmA01
2N49A 1L1OB 1WOCA 5M5YH 4A3JG 1Q82C 3PUYA 1SMXA 3STBC 3W1GA 3AEVA 4NXML 3PV0A 4JV5Q 1EIYB 1V9PA 4TVAB 3F2CA 5LMNL 4JYAL 3UDGA 4KHPL 4L5TA 1E1TA 4A3JH 4B3SL 3H0GG 2QGQA 1BKBA 1AE3A 1EUJA 4IPGA 4R4QA 3U50C 1JMCA 1X56A 4XTCS 1T9QA 5JEAG 4TPUA 5AI3A 3H0GH 2ZTCA 4GOPB 4BXXG 4A3BH 2R92H 1LYLA 2AMCB 4GS3A 3CCVA 1NTGA 2K5HA 2RCNA 4B3RL 1IYJB 3CCMA 2I0QA 3GTJH 4LFCQ 4BXXH 3HKSA 1XPOA 1IBKL 1IBML 4DR1Q 4JOIC 3GTKH 1VQ4A 3TEHB 1PH5A 4IFDJ 3JAMi 1L1OA 1VS0A 3G71A 4LF6Q 5FLXc 3RZTA 4A3DG 1X65A 1NMGA 5IP9H 1N36Q 4IJLA 1KC8C 3KYHC 3GD7A 4DV3L 3U4ZA 3KJPA 1K9MC 4MNOA 3GTLH 1BQ9A 2RDVA 2D0OA 4A3DH 1B8AA 1GM5A 3TS0A 4IO9A 1NJIC 1YJWA 4NXNL 4BY7H 4LWCA 4X62Q 3UE1A 5C3EG 2R6GA 4GOPA 1R0GA 4X6AH 5AJ3L 4R4OA 1HZ9A 4LF8L 2BH8A 1XMQQ 5FJ8H 1X3GA 3S2DH 4GN4B 5JEAJ 3U4VA 1VQ7A 1JE5A 1Y1WH 2GN5A 2R93G 1CUKA 2YTXA 4LFAL 4MZ9A 3TRZA 2E5LL 1EFWA 3MEFA 1HNWQ 2NZHA 4DUZL 4BA1I 1GKHA 2AKWB 2PVXA 1JYBA 5C0XI 4DV7Q 1VQLA 1SE8A 1YUXA 3BZKA 2A19A 2ZTEA 3G48A 3KDFB 5C44H 3PUWA 2GVAA 4DV6L 4DV1L 5C4XG 2YTVA 3UDIA 3I4NH 2UXBQ 3M85A 5M5WH 4DR2Q 2KHJA 1IBLQ 2IY5B 3B6YA 3BZCA 3KF8B 3S16H 2K5NA 1SFOH 3AYHB 1VQBA 5C4XH 2KBNA 1I94L 1LM0A 2ZM6L 1HR0Q 1VQGA 4B3MQ 4GKKL 4BBSG 5HY6A 1VQAA 3I2ZA 4A3GG 4LF4Q 3HFZB 1S72A 4LF9Q 2JA6H 1G6PA 1OXVA 2JQOA 4DV5L 4LFBL 3NELA 4BBSH 1VQPA 1YZ6A 1A8VA 2AWNA 2OCEA 3K7UC 4UP7A 1WYDA 3SGIA 1XMOQ 2UUAQ 1VQDA 3DM3A 1PH7A 2VNUD 2KN9A 3KDFA 2NN6I 4O0AA 1SR3A 4DV2L 4IOCA 1UE1A 3H3VH 2JA5G 3HOVG 4P73A 5JJLA 5LMUQ 4A3MH 1H95A 1VQFA 4YWMA 2R7DA 1XJVA 3TREA 4X65Q 2IT1A 2CQOA 2MQHA 2F52A 1M90C 5GROA 3AQQA 1LKMA 2F3IA 2UUBL 2ZJQA 2OWOA 3RR5A 2F4VQ 3HOVH 1N9WA 3PO3G 1QVFA 3T1HQ 1TXYA 1E8JA 1YI2A 2LXJA 4UY8C 4AYBG 3E0EA 4DR6Q 4OWWB 3PO3H 4AR4A 4JI6Q 1X9NA 1RYTA 1BQ8A 3EBEA 3HKZE 4IPCA 1FHHA 1TWFH 3A44A 1WCMG 2ZTDA 5EAYA 4C3IH 2NVQH 1YK5A 1PH3A 1YHAA 2Q2TA 2UUCQ 1XNRQ 3S14H 2Y0SE 1N34Q 1QZHA 3M4OH 3CCJA 4JOIA 4JBWA 4JYAQ 1XPUA 1YUZA 4LNQA 4OX9L 4KHPQ 1E7ZA 1IRNA 2QA4A 1VQOA 1HNZL 5IYDH 2XTIA 1D8LA 4DK3C 4H02A 1W2BA 1Z47A 2PYAA 1FVIA 4JI1Q 4UPAA 3KFUA 2MFIA 4Y7NH 4HJ9A 4YCVA 1RDGA 3RLOA 4TQUS 5C0XG 2LCQA 4FDBA 3PCOB 1J5EL 2JA7G 1PYSB 1IBKQ 4K0KL 3A74A 5GAEC 3RYGA 2MO1A 1HH2P 4JI7Q 2B63H 1FJGL 1M1KC 1R0HA 4JI4L 3S1NH 1BE7A 3EIVA 3L0OA 1S40A 4NPSA 2HR5A 2KCTA 1I6HH 4GKJQ 1LUZA 2K5VA 4QJFA 4R4IA 1VQCA 3M4PA 1CKNB 1YNXA 5LMNW 4LW1A 1WFQA 1PYBA 3K0XA 3HOXH 4L5SA 4NXNQ 1OXSC 4JI5L 5M3FH 3GTMH 4PG3A 4YCWA 4EQ5A 1YVCA 5M5XH 2VQEL 1GD7A 1DGSA 5BR8L 4DR3L 3H3VI 5HGQA 2R92G 4A3FH 4GLAC 4A3BG 1VQJA 1PH8A 5AJ3Q 2OTJA 1B7YB 4DV0L 3M9BA 1S30A 1J6QA 4ME3A 3CPWA 4LUVA 2NN6G 1ASYA 3T1YL 2NZOA 3MXNB 1DVBA 2CKZB 1O7IA 2BH2A 5C0XJ 1Q46A 4K9FA 3MPSA 1FHMA 4IPDA 3CC4A 2ES2A 2UXCQ 2AWOA 5IP9G 4DUYQ 2HHHL 4DR7Q 2CWPA 4JI8L 3RN2A 2L15A 3FHWA 1HNXQ 1UE7A 1WJJA 4DV6Q 4AH6A 3PF4A 1SLJA 1CKNA 1PH9A 1A63A 1IZ6A 4BY7G 1C7YA 4QGUA 4OO1I 5RXNA 1AE2A 5IP7H 2JE6I 2Q2UA 3J81i 1XPRA 5IY0A 1PH6A 1N33L 1I50H 2NVYH 4A76A 4HIMA 3K7AH 3KJOA 1IU5A 1KL9A 5FJ8G 4MTNA 2K75A 2UXDL 1L2FA 2JEAI 1Q12A 1Y1WG 2UU9Q 4JI0Q 3CD6A 4DR5Q 3NENA 2WB1E 1MIUA 4OONA 3UDFA 5GAGC 3F2DA 3E9HA 4B3TQ 4QL5A 4DV4L 3FKIH 3I4OA 2M4YA 4XIGS 1C9OA 5M3MG 4GNXB 5C44G 3RZDH 1XTDA 3PWFA 4DV2Q 4KI0A 3ERSX 3I4NG 2VQFL 1U0LA 4A3EG 1OXXK 3F2BA 1KRSA 5M3MH 4JV5L 7RXNA 3S17H 1G291 4X64Q 4YHHQ 4AQYQ 4J15A 4DKAC 4YY3Q 3ULJA 4A3EH 1EQQA 5ELOA 2A1AA 1W3SA 1K3RA 3K81C 3TQYA 1MKHA 3L7ZC 3BJUA 4O2DA 4R4TA 3CQZH 1VQ8A 3NEMA 2GMGA 2WAQG 1C09A 2GVBA 2K4KA 5IYCH 2JA6G 3CW2C 1KD1C 1VCXA 4A3CH 2Q2HA 1Q1BA 4DR4Q 2Q2IA 3IRBA 3SS2A 2HQLA 1R9TH 3CP0A 3KLWA 3CC7A 1N32Q 5FLMG 4JI3Q 2D62A 5IWAQ 3KYUA 4LFCL 4GNXA 3PF5A 3L2PA 4PZ8A 2ZJRA 1PV4A 4POFA 3J80c 1Z9FA 3STBD 5FLMH 4ALPA 1CKOA 4A3MG 1HNZQ 3I7FA 2EQSA 1QYBA 4LF7Q 4LF6L 1YJ9A 1V1QA 8RXNA 1EQRA 3CC2A 2HT1A 1U5KA 2B3GA 1RL2A 4DPGA 2QL0A 1HZBA 1BFYA 1V43A 1EWIA 1UWVA 3CPFA 3PGZA 2ATWA 2VW9A 4JBMA 1B2JA 1TWGH 1EYGA 1BVSA 4A4IA 1KIXA 1VQ9A 4BA2I 1K0RA 1VQHA 1E24A 3ULLA 2BA0A 1B70B 4IPHA 2A8VA 3E9IA 4X62L 4GLXA 3HOZG 1J5EQ 3UDXA 4K0KQ 1X55A 3HOWG 1D7QA 3ER0A 4DAMA 4HIOA 2K50A 1GVPA 3JC62 1RDVA 1VCIA 5ELNA 1R0FA 2PQAB 3HOZH 4OO1G 1L1OC 1Q1EA 2JJQA 5E7NA 2RF4A 3FP9A 2B29A 3GO5A 3KYYA 1UE6A 4BY1H 4JI2L 2R7ZG 4PZ6A 2VL6A 1CSPA 1EOVA 1VQEA 2PI2E 2ALYB 2RHQB 3D0FA 4UP8A 1HJPA 1QZGA 5IYDG 1K8AC 4NXMQ 2R7ZH 3S2HH 4LFBQ 4IOAA 4JI5Q 3OTOL 5LMNQ 4DV7L 1C0AA 4DR3Q 3GTQH 2DUDA 3HOYG 4B3SQ 2H5XA 3D31A 2JA8G 1YEZA 4DR2L 2KENA 4DV0Q 2V3BB 1GO3E 1KHIA 1X3FA 1YJNA 3WWVA 1UEBA 3HOYH 1YIJA 1TWHH 1S3OA 3G6EA 1HR0L 4JC0A 4B3ML 2JA8H 4B3RQ 5IE8A 1OXUA 4HJ8A 1P16A 3ZJYC 2B63G 4LF4L 4LF9L 2MNAA 3JAMc 1YK4A 1PH1A 1IBMQ 1MJCA 3AFPA 4JI8Q 3F1ZA 1X3EA 2NVTH 3RZOH 1SMWA 4R1JA 2CFMA 2PMZE 2OTLA 1XMOL 4C3HH 3VDYA 1YHQA 3PO2H 1B13A 1IXRA 2AHOB 4LUZA 3W1BA 2K52A 3HOXG 4A75A 4AR6A 1LKPA 5M3FG 4DV3Q 3PUZA 4NB3A 1T9PA 4R4CA 1VQKA 1N33Q 1IROA 1H7VA 1FGUA 4APVA 5JJKA 5LMUL 4A3FG 1AH9A 3TS2A 1N8RC 4X65L 2N3SA 3KYXA 3A5ZB 3ICEA 4JBJA 5GQOA 4GN3B 3I55A 1IU6A 1VQ5A 2E2JH 2WFWA 2YTYA 1A62A 4P72A 4LF5L 2F4VL 1SN8A 3T1HL 2BA1A 3W5OA 2MS3A 2ZJPA 4LF8Q 2IX1A 4PMWA 4P71A 4JBKA 4A3IH 4X66L 4DV4Q 4LFAQ 4A3KG 2YU9H 4JI6L 2VUMH 3CCSA 4HJ5A 5K36G 2E5LQ 2RHSB 1YV1A 4DUZQ 2UUCL 1Q81C 2VQFQ 1E3PA 4A3KH 1N34L 1HZCA 3K80C 3G4SA 5IP7G 1LKOA 4POGA 3U58A 3GTPH 4PZ7A 4DV1Q 3PIPA 3JC66 3J7ZC 3HKZG 1S24A 4AR5A 1CADA 4DAYB 5GAHC 3CMEA 3CCRA 2IHEA 2PNHA 1NE3A 4HIKA 2ZM6Q 1I94Q 3RZ6A 4GKKQ 1PHJA 3EN2A 4JI1L 2Y0SG 4HIDA 1NMFA 1ZRPA 3QVDA 2EIFA 4OWTB 1JJ2A 1JB7A 4AR3A 1EIFA 4DV5Q 2PVEA 1YBYA 2KCMA 3CXCA 3KOJA 3RLNA 3KF6B 4KLKA 5IT9c 2D0PA 3FKIG 1PH4A 1SRUA 1OTCA 1BRFA 4OXPA 5DLQE 1VQ6A 5GADC 2VS1A 1Y1VG 1XNQL 1I3QH 5JJIA 3LGJA 3Q8DA 4JI7L 2CWAA 2EXDA 2K14A 3CAMA 4LUOA 1R0IA 1PVOA 1B2OA 3CCEA 2E2IH 4AYBE 3M7NA 1Y1VH 1X54A 2HIVA 2OQ0A 4GKJL 4Y52H 1G51A 2R7FA 1Q86C 2K2DA 6RXNA 4RG1A 4WJ3M 2KHIA 3KYVA 2UUBQ 1S2ZA 3PUVA 5IYCG 1JJGA 3KYWA 2DSXA 3AFQA 4A3CG 1JT8A 2E8GA 1K83H 1VQIA 2N8NA 1QVGA 1T9OA 2JA9A 3PSIA 1MJEA 4JG2A 3KF6A 3M3YH 1LTLA 5C3EH 4RMFA 1KRTA 2Z6KC 4JI2Q 3CCQA 1BBWA 3H15A 2KKDA 3DLLA 4WJ4A 4P75A 1E22A 1WI5A 2WP8J 3S1QH 2IX0A 2UXCL 1KQSA 2R93H 3A0JA 4HJAA 3RNUA 3HOUG 1CKMA 2OQKA 4DUYL 1P8LA 4BBRG 3OTOQ 4DR1L 2LXKA 1PA6A 1HNXL 4OX9Q 4DR7L 5J3BA 2LSSA 1QUQB 1QCVA 1L0WA 2PI2A 4DNIA 3NBHB 3HOUH 2I5MX 4A3LG 4IFDI 4BBRH 1R0JA 3RN5A 1N36L 3GTGH 4YCUA 2Z0SA 4A3LH 1YHBA 1PH2A 1RIPA 1RWDA 3A5UA 3ULPA 2UU9L 4JI0L 4BY1G 5H1SE 1CAAA 2YYZA 1NNQA 1BBUA 2V1CC 2YV5A 4GN5A 4UP9A 4DR5L 1K8GA 1XMQL 4JI4Q 1FJGQ 4A3GH 4B3TL 2QEXA 3I56A 3S1RH 3S15H 2MO0A 3GTOH 1HNWL 4L5RC 1QUQA 1JJCB 1Q8KA 4EX5A 4YWKA 3M4QA 1KXLA 4RXNA 2JEBI 4P74A 1IL2A 3F8TA 1PFSA 2VQEQ 4X64L 2WB1G 3GDEA 5BR8Q 4YHHL 4AQYL 4GOPC 1VQMA 2JA5H 4YY3L 1SMMA 4KHZA 1FL0A 4LF5Q 2UXBL 4IJHA 1TWCH 3PZAA 4QY7A 4QIWE 1IBLL 1SROA 2XGTA 1HR0W 3JC63 5IYBG 1K73C 1SMUA 1YITA 5AI2A 4X66Q 3T1YQ 1B71A 1Q7YC 4DR4L 4C2MH 3HOWH 4JCVE 2PQAA 2I5LX 1NY4A 4DK6C 2VZAA 5IYBH 4QQBX 1N32L 3CCLA 4JI3L 3J7A5 2DGYA 1OXTA 4HJ7A 5IWAL 2HHHQ 3PO2G 1WCMH 2ID0A 4YWLA 3K8AA 4OWXB 1E1OA 1T9HA 1TWAH 3I4MG 3J81c 2FXQA 3RLFA 1VQNA 1CSQA 2UUAL 5C4JH 1A0IA 4LF7L 3J80i 3S24A 3I4MH 1HZAA 2IHFA 2ASBA 3PUXA 1Y14B 2VY3A 4C3JH 3PIOA 3CMAA 3OW2A 4A93G 3S1MH 1ASZA 1I5FA 2UXDQ 3J81j 2C35B 2HIXA 4A93H 4A3IG 2VUMG 3BU2A 4GNXC 2E2HH 1RB9A 1XNQQ 4GLVB 2JK8A 1KAWA 2I5HA 4L5QA 3UE0A 3CCUA 4DR6L 4IFDG 3CF5A 4AIMA 3OYYA 2JA7H 2WAQE 1UE5A 1DX8A 1QVCA 2Z6KA 2CCZA 2NVXH 1XNRL 1NBWA 1X6OA 2N78A
chains in the Genus database with same CATH superfamily
5M5YH 4Y7NB 1SMXA 1YNNC 3PV0A 1V9PA 3F2CA 1KTKA 5LMNL 3C2PA 5EKKA 5DNFA 3M7GA 4L5TA 3X3NA 2NB0A 2NVTB 2EYJA 3U50C 1LTBD 2DJFC 2JN4A 3SDZA 4XTCS 2NVXL 5D65A 5J22A 4A3BH 3SHLA 3SEBA 1Z92B 5M5YL 2K5HA 2EYOA 2RCNA 4B3RL 1IYJB 4DFAA 1GOZA 5M5XB 1D5XC 3GTKH 1H9MA 4DF7A 1PH5A 4IFDJ 4KD3A 5FLXc 3RZTA 3KLSX 1VQ6A 1K9MC 4A3BL 3KYHC 3KJPA 5MFZA 1BQ9A 1RF2D 2RA4A 1NJIC 1JOQA 2PZWA 4U68A 3GTKL 4K2KA 4FF1A 5AJ3L 3EJIA 3S2DH 1X3GA 4CDCC 1VQ7A 1JE5A 2GN5A 4ZKBB 4Y52L 1CUKA 4EQOA 1J8IA 1MGSA 4JPBW 4DUZL 3HKZB 2AKWB 2PVXA 2EJMA 1JYBA 3GV6A 4DV7Q 1SE8A 1YUXA 2EPBA 2A19A 5KNDA 2Y0SB 5C5MA 3TDQA 1CA5A 5DAUA 4DXFA 3AU7A 3UDIA 1LT4D 3S2DL 3I4NH 5C4XG 2IY5B 3MFYA 5M5WH 5H1Sc 1DXMA 5GAEc 3BZCA 3S16H 2F0HA 3RZDB 1I94L 5C4XH 2C5CA 2KBNA 2ZM6L 1SNDA 1VQGA 5HY6A 3BVMA 5NUCA 1ODHA 3EQLC 4LFBL 3PQIA 3J81L 2AWNA 2J7ZA 3K7UC 1ESFA 2B2UC 2F0VA 3T4AC 3S16L 1VQDA 5C4XL 4ILWA 4MN3A 1PH7A 2O4XA 3KDFA 1TY2A 4O0AA 4IOCA 3H3VH 2JA5G 3HOVG 5JJLA 5LMUQ 1VQFA 2R7DA 1F9RA 3TREA 5I4DA 3LWQB 4XQNA 3MFGA 5GROA 2OWOA 3HOVH 3RR5A 1QVFA 1TXYA 1E8JA 2AQ3B 2EOTA 2EYFA 4AYBG 4FNFA 4DR6Q 3DUZA 4RAUC 2E76C 4G4KA 1FHHA 1TWFH 3A44A 4AI3A 2A6EC 3MAQA 1TWGB 1YK5A 1PH3A 2Q2TA 3GTGB 2CW0D 2R61A 5CORA 1QZHA 2HVYC 2JA5L 3HOVL 1MSGA 1UNSA 3QB3A 2K03A 1YUZA 2BDNA 1HNZL 3K59A 2XTIA 3HOZB 2APOB 1D8LA 5ELDA 1TWFL 1Z47A 2PYAA 5GAGc 3WWNB 3IKJA 4HJ9A 1D6EC 2KECA 4K0KL 3A74A 5C4JL 1HH2P 3FVQA 4JI7Q 5FLXL 3N6RA 2B63H 1M1KC 1EEID 1CFMA 2QEJC 3S1NH 1BE7A 4N9PA 4K5WA 5KEEA 2JA8B 4GKJQ 4R4IA 1HA5A 3BVZA 1CKNB 1YNXA 2XJUA 4L5SA 3K0XA 2F0PA 3HOXH 3GTMH 3K58A 1S5CD 1QILA 1EEFD 4A3FH 4GLAC 2IWHA 3S1NL 5AJ3Q 4OHJA 4C3HB 2N88A 5E3FA 4ME3A 2PW7A 2AUSB 1DVBA 1CHPD 2MJ8A 2E2DC 3CC4A 3GTML 2AWOA 3T16A 5IP9G 3SXHA 2HHHL 3P20A 3DHQA 2CWPA 4JI8L 3OWFA 1EY6A 1PRTB 1S5BD 1A63A 1STEA 1C7YA 5CGKA 4QGUA 3J81i 1XPRA 3VR6A 4RGMA 2ZXPA 1GUSA 2NVXB 1GUNA 2K75A 1L2FA 2UXDL 1EY5A 5M5YB 3GTPB 1MD2D 4O42A 5IP9L 1I6VC 1XYIA 1JCKB 3E9HA 3HJYB 4B3TQ 3VR2A 2OF1A 4GNXB 1C9OA 5C44G 4KTAA 3ERSX 4CJ0B 1H9SA 2VQFL 1U0LA 2K5WA 1OXXK 1RDPD 3F2BA 4JV5L 4RCNA 1G291 1ML0D 4YY3Q 2I07B 1BOSA 5ELOA 1W3SA 1K3RA 4JVZA 1VQNA 4R4TA 3NEMA 2WAQG 1C09A 4TVMA 5IGDA 1Q1BA 3QO2A 2HQLA 5K5PA 2B8FA 1N32Q 5C44L 1I4GA 5EQ0A 2F0IA 3LNNA 3HRZC 3L2PA 1PV4A 2ZJRA 1WTRA 3STBD 4IQZA 1HNZQ 3I7FA 1SFOL 2HUGA 1V43A 1C48A 2EYPA 4V0BA 3V96A 2Z3RB 1EU4A 3CKIB 1KIXA 1VQ9A 3KF8A 5MGNA 1A2TA 4IPHA 3VYTA 3E9IA 1I4RA 4K0KQ 4UY81 5IGGA 1SJED 1GVPA 3JC62 2N55A 3HOUB 1R0FA 4OO1G 1Q1EA 5E7NA 3E0JA 3S16B 3KYYA 1U4RA 1UE6A 3BG3A 4JI2L 4PZ6A 2VL6A 3D0FA 3SK8A 4ZRZA 5IYDG 4NXMQ 3S2HH 5I2XA 1PDQA 3GTQH 3PKJA 2DUDA 4Q5VA 3QJYA 2Z4HA 2F0WA 5GADc 1TWHH 3MTSA 3G6EA 2XJPA 1HR0L 4B3ML 4PQXA 3S2HL 4LF4L 2F0JA 1PH1A 1IBMQ 3J7Y1 2F0LA 3GTQL 2PW5A 4IZ8A 5IYDL 4JI8Q 2JA5B 4CKBA 5IGBA 1SMWA 2PMZE 2OTLA 3VDYA 1B13A 1SYDA 3A54A 2K52A 4AR6A 5M3FG 4R8NA 1U9RA 3PUZA 4R4CA 1SNOA 1TWFB 1BCPF 5JJKA 4AYBB 1IKMA 1AH9A 4KMUC 3ICEA 4JBJA 5GQOA 4GN3B 5IOCA 1VQ5A 3VR3A 2F4VL 3ND9A 1TWAB 4RFBA 3L9AX 4LF8Q 2ZJPA 2MS3A 4FXDA 4AHZA 2KHSA 1STHA 5C4JB 1I6HL 1CTMA 2PQEA 2F0DA 4P71A 4LFAQ 2VUMH 1SAPA 4HJ5A 3HKZP 2E5LQ 3FPUB 5M3FL 1QG7A 2VQFQ 2FINB 2Y0SP 1N34L 4A93B 3VYSA 2F0NA 3PKIA 2E2HB 1Q3LA 3PIPA 1F9QA 1SNPA 4F7XA 2PZTA 1OWCA 3CMEA 3S1NB 2IHEA 5C3WA 4NW2A 1PHJA 4JI1L 3HS0C 3QVDA 1JB7A 1G91A 5I9OA 4AR3A 1GUGA 1D7QA 1EIGA 5JEAH 3MXNA 1SRUA 3BDLA 3LGJA 3Q8DA 2CWAA 2CW0C 3CCEA 5BN3A 2E2IH 1EY0A 1PZID 1X54A 2K5QA 2IL8A 1O7LA 2CR8A 2RSNA 2K2DA 6RXNA 4RG1A 4DAYA 2F0KA 1HTPA 5CV5A 3KYWA 3MC0B 1RCVD 1JT8A 2E8GA 1QVGA 2E2IL 3PSIA 4XDXA 4F8MA 3KF6A 3M3YH 1TS3A 1PZXA 1TS2A 4QIWB 4JI2Q 1O78A 4A3DB 2QCPX 2QW7A 3T53B 5IGEA 1UUPA 2R93H 2M00A 3A0JA 3PIP1 1CKMA 3J7AV 1P8LA 4DR7L 3TMEA 3K5MA 2BOSA 1JORA 1QUQB 1E2ZA 3NBHB 4IFDI 1Y8OB 3OWEB 1R0JA 4RHSA 3RN5A 3H99A 4NDXA 2ZT9C 1W6JA 4CGYB 1TY0A 4X3TA 4ZN3B 2F0SA 4JW0A 1MBYA 4K6DA 5C44B 1HXYD 4BY1G 3I3CA 3TBIB 3R2TA 2XJRA 1NNQA 1FNWA 2RCFA 2YYZA 1K8GA 1FJGQ 4AHWA 2B2TA 4WJWA 3J7AF 2QF7A 4K5XA 1SFOB 3S1RH 3S15H 3OMGA 1SYBA 1HNWL 1EIHA 1EY8A 4EX5A 2WAQB 1KXLA 2QDBA 1M4VA 2RFKB 2VQEQ 4X64L 4AQYL 3MVVA 5IGCA 5EGTA 4QY7A 4BY1L 2XGTA 1QNUA 3QIAA 1STAA 3S1RL 3S15L 4G7HC 4ME5A 5D3DA 3TP6A 4C2MH 3BYTB 2I5LX 4JI3L 5L37A 4HTHA 1WCMH 2KQ3A 2K05A 3I4MG 1F9SA 2F0UA 4DK1A 3PO3B 3LWRB 4LF7L 4DA2A 3I4MH 1MI2A 4P2CB 4JAFA 1Y14B 1HFNA 2F0OA 1ZEQX 4K8IA 4A3IG 4FXGC 1KAWA 1FR3A 2HCIA 3I4ML 5E4WC 1OO9B 1STYA 1D1KA 1PLFA 2PPTA 2ZXRA 3A7AB 2YTYA 3DEPA 3K5OA 1L1OB 4A3JG 1Q82C 3PUYA 3STBC 1EY4A 1NR4A 1EIYB 4TVAB 3J7Z1 3K35A 2FMMA 5JAVA 4A3JH 4B3SL 4A3IL 1VMPA 1EUJA 1JMCA 4IPGA 2ERJA 2MP1A 4H44C 3HEJA 1I6HB 5CV8A 3A8IE 2F0GA 2R92H 4J8QA 2B2WC 5EBCA 2EY6A 1ZYRD 3GTJH 4AI2A 5M3FB 3HKSA 1XPOA 4A3JL 4JOIC 1JR0D 3TEHB 5EPKA 5IGFA 3BVGA 1X32A 3G71A 2EZVA 4LF6Q 1Q90A 3SE0A 1NMGA 4N8X1 3NHHA 5COYA 1KC8C 2R92L 4B8CD 5T1GA 4DV3L 3GTLH 1A3TA 2A6HD 3TS0A 3GTJL 3W2DA 4BY7H 4LWCA 1RODA 4X62Q 3UE1A 4OEMB 5C3EG 2RSOA 1HZ9A 2BH8A 5FJ8H 1L0YB 1HHVA 4GN4B 3U4VA 1Y1WH 3OPOA 3GTLL 4KV6A 2YTXA 1A15A 2JI2A 2NVYB 1G2SA 3MEFA 1JWMD 4BY7L 1HNWQ 1GKHA 2DJGC 3VA5A 2NYDA 2ZTEA 3G48A 3M4YA 2GVAA 5CMDA 1FD7D 3NBIA 2WV6D 1V1PB 1JC7A 5C3EL 3ERQA 4DR2Q 5JVH3 1LM0A 5C4ZA 4BBSG 3T13A 4KKUA 2F0MA 1S72A 2JA6H 4DV5L 4L6TB 4BBSH 1BUVT 1I4HA 2OCEA 4UP7A 1WYDA 1XMOQ 1HUMA 2EYMA 2XJQA 2KN9A 4AYBP 1UE1A 4OELB 1H95A 4YWMA 4X65Q 3D8GA 1BBXC 4BBSL 2NZ1D 1LKMA 1B1ZA 2F3IA 2EJFC 5C4HA 1N9WA 2L9HA 3UI2A 1YI2A 4ABNA 4KD4A 3D6WA 3E0EA 1BCPD 4HN7A 1LTAD 1WTHA 1TKWB 4JI6Q 1EWCA 2TSSA 2ZTDA 5EAYA 2UUCQ 3R93A 3M4OH 3CCJA 1KNAA 4JBWA 3AMUA 1PTOF 1E7ZA 1IRNA 2QA4A 1VQOA 1KAAA 1DONA 1BR9A 3MZ5A 1PFUA 3HAXC 3HOWB 1SBBB 3NTKA 4UAIA 4BY1B 4UPAA 5CR3A 5JVG3 3KFUA 3M4OL 2K01A 2R7ZB 1RDGA 1IYUA 4TQUS 5C0XG 2EY1A 2JA7G 2FHTA 3PCOB 4FDBA 1PYSB 3HP3A 1K0SA 3H91A 4QF4A 4FF4A 2B8GA 4AHXA 3H9CA 3EIVA 3VYRA 4NPSA 5DM61 2XJTA 2NBFA 4CJ2C 1STNA 2MPMA 4QJFA 2B2YA 5E4XA 2VB3X 4H0LC 1XX8A 4XXEA 4C1NK 1OXSC 1YVCA 5BR8L 1VF7A 4A3BG 3RZOB 2JA7L 1VQJA 1EZ8A 2OTJA 1PZJD 2XNAC 2L1BA 4XYQA 4QIWP 1J6QA 1F77A 1D5MC 1S5ED 4RGOS 3CPWA 4LUVA 2NN6G 1ASYA 3T1YL 4QUFA 5C0XJ 1FHMA 2NN6H 3MSUA 4WFN1 4DK0A 3OIPA 4LHNA 3FHWA 3RN2A 1HNXQ 3J7YW 4TRDA 2E75C 4AH6A 1SLJA 1CKNA 4OO1I 1E2WA 5IP7H 4A3IB 2L55A 1N33L 1I50H 3K7AH 4DGZA 2AQCA 4J1MA 3KJOA 2FMCA 4A3KB 4MTNA 2JEAI 4JI0Q 3MQKB 4DR5Q 2MGSA 2WB1E 1MIUA 4OONA 3I70A 1NAPA 4QL5A 4DV4L 3FKIH 2V0FA 1V1OA 3G7LA 2WAQP 2J9UB 1RTOA 1CHQD 3I4NG 4A3EG 1PFNA 1KRSA 1LLRD 3S17H 3GTJB 4J15A 4DKAC 5HURA 3ULJA 4A3EH 1I3QB 1T5XD 1TU2B 3TQYA 1MKHA 3L7ZC 3CQZH 1VQ8A 4XXBB 2GVBA 2DN8A 3QOLA 3QWNA 1KD1C 5FO8B 1VCXA 4A3CH 1LT6D 1R9TH 3CP0A 3KLWA 3KK7A 3QOJA 5FLMG 2L4NA 5IWAQ 3KYUA 4LFCL 4GNXA 3PF5A 3I4NL 4A3EL 5G3LF 5M5WL 1Z9FA 5FLMH 4ALPA 3CQZL 5F2DA 1QYBA 4PV1C 1U5KA 2B3GA 4DPGA 5C3EB 2ATWA 2PMZB 4JBMA 5KGUA 1BVSA 4A4IA 5TSSA 5FO9B 4HMIA 2A8VA 4GLXA 5FLML 1X55A 1LTRD 3ER0A 4DAMA 1VCIA 5ELNA 2X6GA 2PQAB 1WTOA 2JJQA 4KK7A 4KN7C 1ZYRC 1VQEA 2RHQB 4MTKA 2ALYB 1UAPA 1QZGA 4NKLA 1K8AC 3NWTA 4IOAA 3OTOL 4G57A 4IUTA 5M9OA 5LMNQ 3HOYG 1NXEA 3D31A 3BS1A 1EOTA 1YJNA 5CV6A 3EVQA 1UEBA 2A6HC 3HOYH 1YIJA 2RDFA 4B3RQ 2B63G 4LF9L 2MNAA 4I7AA 3LWVB 2WKDA 3OW7A 1MJCA 3F1ZA 4K8JA 4FVMA 1YHQA 3HOYL 3PMFA 4ZKCB 3PO2H 1IXRA 3W1BA 4LUZA 3HOXG 4A75A 2RDHA 3QR8A 1WTPA 3OSOA 4OGQC 4JAGA 1N33Q 2F0EA 4A3FG 3ONAB 3I8ZA 3I55A 2B63L 2E2JH 4LF5L 2WFWA 5CYUA 3T1HL 2IX1A 3W5OA 3SK5A 4PMWA 2RVLA 4DV4Q 5ELCA 3JC63 2F0TA 2YU9H 4U671 2P5ZX 4HCEA 3LWOB 4DUZQ 3HOXL 1QQTA 4JAEA 3G4SA 2JP1A 4A3FL 4POGA 1WJVA 4PZ7A 2A74C 3NTHA 3I91A 2ICIA 1S5FD 1S24A 4KY7A 5BN5A 5GAHC 1I94Q 2JA7B 2ZM6Q 1JJ2A 4N9TA 2XJSA 1HCZA 1YBYA 1PH4A 4LFBQ 4XYOA 2SDFA 1OTCA 1BRFA 1BCPC 4OXPA 1RJTA 1PVOA 2K14A 1R0IA 3T56B 4IURA 3MA2B 3PIO1 1DOMA 3NFPI 4A3BB 2OQ0A 1Q86C 1BO0A 4FF3A 2KCNA 1B3AA 2D2CC 3L3OC 2DSXA 2ICEC 4XT1B 3H3VC 3GTKB 1K83H 1A3UA 1VQIA 2EE1A 1MSHA 1AEXA 4JG2A 2Z6KC 2EVBA 2V4DA 5EKLA 4XGHA 2KKDA 4I65A 1WI5A 4ZUIA 1VDZA 3S1QH 2UXCL 2PO4A 4HJAA 3RNUA 2CVRA 4DUYL 4BBRG 3OTOQ 1QCVA 3S2DB 3D4RA 2I5MX 4BBRH 3V2TA 3NSWA 1P7PA 1PRTF 4HSPA 1N36L 2JI1A 2Z8LA 2G9HD 3NWSA 3S1QL 3CRLC 3SK4A 1PTOD 1RIPA 4WORA 2UU9L 4XQQA 4B08A 1CAAA 3OMCA 3I4NB 4UP9A 4A3EB 4A3GH 1XMQL 5M5WB 4BBRL 1SNCA 4ZUJA 3TP8A 1EY7A 5C4XB 3BDCA 2MO0A 3GTOH 2M2LA 1AN8A 1QUQA 3M4QA 4RXNA 1U4LA 4ODGA 3J80E 1CT1D 2WB1G 3D6CA 4YHHL 4BA2I 4LF5Q 4GOPC 3ZYYX 1FL0A 2UXBL 1TWCH 3EROA 1IBLL 1SROA 3C46A 5LL6S 3GTOL 1YITA 5AI2A 1VF5C 1KNEA 2M6PA 4RH6A 4DR4L 5ELFA 2VZAA 3VA7A 3NPPA 3CCLA 1G8ZD 2HD3A 4HJ7A 2HHHQ 3I72A 3HOVB 1E1OA 3MHBA 3HG9A 1TWCL 3RLFA 2IW3A 4C3JG 3OOCA 1TWHL 2UUAL 2EYHA 1A0IA 1F2YA 4IN3A 1PFYA 1SYGA 3DMUA 2IHFA 3PUXA 2VY3A 4C3JH 3CMAA 3OW2A 4FP5D 3S1MH 3D4DA 5BN4A 2UXDQ 3J81j 2MHVA 2F03A 4UDUC 1F4LA 2VUMG 1D2BA 1SDFA 2IX3A 4GLVB 2JK8A 3CCUA 2I5HA 4L5QA 3MWYW 2XRQD 3OYYA 4C3JL 3S1ML 2WKCA 2EY2A 1XNRL 1X6OA 1H9RA 5DM73 2N49A 1WOCA 4JV5Q 2M9VA 3JR7A 3K5NA 2LKVA 2A5HA 2SOBA 2OT2A 1ICFB 4CJ1B 4EVOA 3UDGA 4KHPL 2B63B 3H0GG 2VUML 1BKBA 1AE3A 3G6JB 3A8JE 1HQMC 2TMPA 1X56A 5D3IB 3P8BA 5JEAG 4TPUA 3H0GH 2ZTCA 4GOPB 4BXXG 5FOBB 1LYLA 2AMCB 4GS3A 2EDGA 4BS9A 2C9OA 1KDAA 2ZXOA 3CCMA 2AQ2B 2I0QA 3HOXB 4NP5A 3GTMB 4BXXH 3EA6A 1DOLA 4IUPA 4A3FB 1L1OA 1STGA 3LWEA 2PMZP 1WTWA 3H0GL 1N36Q 2VB2X 5CV7A 3GD7A 3U4ZA 1EYCA 3NK9A 1DD2A 5I2YA 2RDVA 2D0OA 5EPJA 5G3LD 1B8AA 1GM5A 4BXXL 1YJWA 2KA7A 1PTOH 4RCOA 4E6IA 5IODA 4HR7B 3SK6A 1U4MA 5T1IA 1R0GA 2D9UA 2EYLA 4JK1C 1XMQQ 2KEDA 1AFPA 5JEAJ 2R93G 1SMYD 2K32A 5IIFA 3MEHA 4MZ9A 3TRZA 1EFWA 2NZHA 1LV9A 5DEHA 2M6OA 3E3XA 5IT9E 2CQAA 5A35A 5C0XI 4NMZA 4RHRA 4KN4C 1VQLA 1IL8A 3BDOA 3PUWA 4DV6L 4DV1L 2UXBQ 3M3YL 2KHJA 1IBLQ 2PZUA 1RTNA 3B6YA 4O1NA 3KF8B 3AYHB 1H9JA 1HR0Q 4GKKL 4B3MQ 4AI0A 3W3AA 2B2VC 1GUWA 2R93L 2EXZA 1G6ZA 4LF4Q 1F9PA 1G6PA 4IUUA 1VQPA 1YZ6A 1A8VA 1K3BC 1ILQA 4V196 1JOOA 3P1HA 2UUAQ 3DM3A 4C56C 2VNUD 3HGBA 3WOFA 2NN6I 1KDBA 3A7LA 4OIKA 1X3QA 4EQPA 4A3MH 4Z9CB 1V1PA 2IT1A 2F52A 2SEBD 1B50A 3AQQA 1TT2A 2UUBL 2ZJQA 2F4VQ 4C3IG 3P2AA 3E5SA 3TZDA 1EYDA 3SR1A 1ONLA 3BZDB 4H13C 4AR4A 1EQTA 1X9NA 1RYTA 1BQ8A 2C6AA 1QJOA 3EBEA 1WCMG 4IPCA 1PYWD 4C3IH 2NVQH 3F2UA 1XNRQ 3S14H 1N34Q 2O2LD 3KBGA 4JOIA 1WTVA 1Y8PB 4LNQA 4OX9L 4KHPQ 2VXWA 5JOBA 5CC4A 2LMCB 4H02A 4C3IL 1D1IA 1FVIA 4JI1Q 2L11A 3PL5A 1WCML 4Y7NH 1YNJD 3S2HB 3VPBE 2LCQA 1J5EL 3I73A 3K6OA 3GTQB 2MO1A 4WRDA 2Z4IA 2H12A 1R0HA 4JI4L 1TWCB 3C3LA 5EKIA 1S40A 1TWHB 2WB1B 2KCTA 4F88A 1Q8IA 2SNMA 3BYYB 1KDCA 2K5VA 3JAME 4L63B 4Y7NL 1QNKA 2XJVA 5LMNW 1S4ZA 1WFQA 1DCZA 1PYBA 2D5DA 5M5XH 4YCWA 1D5ZC 5LL6X 1DGSA 3H3VI 2CHBD 2A73B 4ZK9B 2R92G 2V0EA 2BDOA 1B7YB 4RGTA 1RYQA 3M9BA 1S30A 1HRJA 2B2TC 1K8OA 1PTOC 2NZOA 3MXNB 2CKZB 2Q8TA 1Q46A 4K9FA 4QMGA 1EQVA 4ZCKA 3U9OA 3S9WA 2ES2A 5E1FA 4DR7Q 4G7ZC 1WD0A 1VMCA 1KLUD 2L15A 4DV6Q 3PF4A 5LHY1 1PH9A 1II3A 2DNEA 1QE6A 4BY7G 5RXNA 1AE2A 2Q2UA 2B5ID 3DWAA 2VUMB 4CDDC 4DAPA 1PZKD 4N8FA 3LPEB 5FJ8G 1Q12A 1Y1WG 1CM9A 3J80L 3NENA 1PRTD 4RWSC 3UDFA 3F2DA 1I4XA 3C1EA 4XIGS 2M4YA 3R2IA 3RZDH 5M3MG 1XTDA 3PWFA 4KI0A 1WD1A 4K5VA 2XVSA 4RKBA 1Z7TA 5M3MH 2DY8A 7RXNA 4X64Q 4AQYQ 5FJ8L 3K81C 1Y1WL 2DY7A 3BJUA 5CV9A 5FK9C 2GMGA 2JA6G 2K4KA 4TKOB 5IYCH 2E2IB 4HCSA 1EY9A 4DXGA 2Q2IA 3IRBA 5I9PA 3MXUA 3CC7A 5M3ML 1SE2A 3K0YA 4JI3Q 2D62A 5CBEE 4K2LA 4PZ8A 5J1ZA 2Z9HA 2JSOA 1JQYD 1CKOA 2EQSA 1H9KA 1KABA 1R4QB 5ISRA 1A2UA 4TSSA 4LF7Q 8RXNA 4LK1C 4ZAIA 2L12A 2X6LA 3CC2A 3M3YB 2QL0A 1HZBA 1BFYA 1EWIA 2PPBC 3CPFA 1TWGH 2JA6L 2NWGA 4K14A 1Z6HA 1K0RA 1VQHA 1E24A 2R93B 1LTTD 3U9SA 3HOZG 1J5EQ 4HIOA 3HOZH 3MXGA 3GO5A 1TWGL 1B44D 2HDLA 1CSPA 1EOVA 4UP8A 5GAHc 4CDFC 5AFWA 1AZPA 1ILPA 1HJPA 2L5TA 1PFBA 1BQQT 2SNSA 4DV7L 1C0AA 1E0BA 1PFMA 4B3SQ 1WVLA 2JA8G 3HOZL 1YEZA 2KENA 1O80A 2V3BB 1X3FA 1EU3A 3WWVA 3S1RB 3S15B 2R3ZA 2JA8H 1RHPA 1OXUA 3ZJYC 3JAMc 3GQBA 2K5DA 3AFPA 3FDJA 1X3EA 4KY5A 3B08B 1LT3D 3NXWA 1SMYC 2A69D 2CFMA 1GJXA 4C3HH 2JA8L 4DV3Q 3FPPA 3DXJC 4X3UA 1VQKA 4C2MB 1H7VA 4APVA 3NQIA 5LMUL 1LTID 5JPNC 2ZIXA 1ZKOA 4HMJA 3A5ZB 5IT9L 1WCMB 1IU6A 1LT5D 1A62A 4G7OC 2C6BA 1V8QA 4G6BA 4J6HA 3I4MB 5EIOC 4LHLA 1LO5D 4X66L 3CCSA 3R3OA 1NXGA 1Q81C 1E3PA 4IFDH 3K80C 5IP7G 1LKOA 3U58A 3GTPH 5A2QE 2B2UA 2LY7A 3JC66 3WOEA 4EQNA 1I4PA 4AR5A 3CCRA 2PNHA 1I4QA 1NE3A 2RQXA 4HIKA 1CA6A 1HUNA 3EN2A 1DYQA 3TSSA 4HIDA 1NMFA 1ZRPA 1M8AA 1GUTA 2AQ1B 2EY5A 5JPMC 1EIFA 4DV5Q 2PVEA 3GTPL 2KCMA 3CXCA 1TIID 2D0PA 3FKIG 3Q23A 1JE4A 2VS1A 1Y1VG 4HSVA 4A3JB 5JJIA 5IP7L 4JI7L 1DJRD 1C8CA 3OIQA 3QG1A 4LUOA 2PSMC 1SYCA 1I50L 1RKNA 1IW7D 3K7AL 5MFPA 1Y1VH 1LTGD 1DOKA 2R92B 4GKJL 4Y52H 3CU7A 3OHXC 3I90A 4WJ3M 2KHIA 3PUVA 4A3CG 1BDOA 3FKIL 2XSCA 1Y1VL 4RMFA 3GTLB 1YNJC 1KRTA 1JWUD 1SNQA 3CCQA 1G2TA 3S17L 2B2YC 4BY7B 1B4OA 5C6AA 3HOUG 4DR1L 2LXKA 2LSSA 1AP0A 1L0WA 2PI2A 5D14A 3HOUH 4A3LG 4A3CL 2K04A 1Y1WB 1SEBD 4GZYC 1R9TL 4A3LH 4X3KA 1PH2A 3JAML 1RWDA 3ULPA 2OXPA 5M3MB 5MLC3 3Q6SA 2V1CC 2YV5A 3HOUL 2K1BA 2K33A 2WB1P 2A68D 4B3TL 2QEXA 4A3LL 3HZXA 1JJCB 4YWKA 2JA6B 2JYOA 1IL2A 3F8TA 1PFSA 1VQMA 4BBSB 5BR8Q 2JA5H 3IFDA 4YY3L 2MUYA 3PZAA 4RGNA 4XQJA 4EGVA 1HR0W 1K73C 1SMUA 3PIP3 4X66Q 3T1YQ 3SVMA 4F87A 3RUZA 1DZ1A 1U4PA 1EYAA 1NY4A 4DK6C 1N32L 1PRTC 3J7A5 3PO2G 4IUQA 5C3XA 2NTSA 1AZQA 3N52A 1T9HA 1TWAH 4QCLA 1QWYA 1R4PB 5C4JH 4M8AA 2EJGC 3S24A 3B0AB 1HZAA 2L0CA 3LX0A 3PIOA 2FFKB 2NYZD 4A93G 3WWLA 2CKAA 1ASZA 1I5FA 2XN9C 3M4OB 2HIXA 4A93H 1O7ZA 3KLSA 1TWAL 2BCOA 5KYLA 4GNXC 2E2HH 1RB9A 3PO2L 3WDNA 2ENBA 3H9BA 3T51B 3CF5A 2Z6KA 1DX8A 3VR4A 4UHVA 1NBWA 2E2JL 3IFTA 1WTQA 4A93L 3W1GA 3AEVA 4NXML 1ENFA 3H94A 2E2HL 1SYEA 4JYAL 2G5DA 3NUCA 1E1TA 2F4IA 2QGQA 2YU9L 4R4QA 1K28A 4MHEA 1T9QA 2F0FA 5AI3A 1PMRA 3CCVA 1NTGA 1Y8NB 5JVH1 5EPLA 2KJXA 4LFCQ 1IBKL 1IBML 2K6AA 4DR1Q 1SYFA 5C5LA 1VQ4A 3JAMi 1VS0A 2NUCA 4A3DG 2Z3QB 1X65A 3K57A 5IP9H 1BNZA 4IJLA 1ZXTA 1TR5A 4MNOA 4A3DH 1EFID 4IO9A 4NXNL 3TP7A 3V05A 3ND8A 2R6GA 4GOPA 4X6AH 4OIJA 4R4OA 4LF8L 3C1FA 1VZGA 5KNCA 4LFAL 4A3DL 3TP5A 1I50B 2E5LL 3K5LA 3K7AB 3RD4A 1VZHA 5EINC 1F2MA 4BA1I 2H4OA 4KJOA 2A69C 1K83L 5C44H 3BZKA 4X6AL 3KDFB 2YTVA 4QB4A 1FYCA 3M85A 2K5NA 3FKIB 1SFOH 1VQBA 1Y1VB 1VQAA 3I2ZA 3H09A 4A3GG 4LF9Q 3HFZB 1OXVA 2JQOA 1TS5A 3S17B 3NELA 3A56A 4L8JA 2Z1CA 5JVG1 1GHJA 3CQZB 3SGIA 1VZIA 1BCPB 2J4XA 4DV2L 1SR3A 4P73A 1R9TB 3NBHA 1WTXA 1XJVA 1ICWA 2CQOA 2MQHA 3URYA 4CHTB 1M90C 3CRKC 3PO3G 4A3GL 5AN9H 3T1HQ 5A2QL 4UY8C 2LXJA 3NP8A 1JWSD 1FGBD 4R8IA 4OWWB 3PO3H 2JI3A 1TS4A 2B39A 3HKZE 2QDLA 1PFWA 3IU3I 1YHAA 4RKLA 4B9WA 2Y0SE 2EY4E 4OO1H 1A6XA 4FF2A 1SSOA 4JYAQ 1XPUA 1IW7C 2BE5D 3PO3L 2O5JD 5IYDH 5EJWA 1PFVA 4YIJA 1W2BA 4DK3C 2F0QA 1XWEA 4HAEA 2MFIA 4AI1A 1HQRD 4YCVA 3RLOA 3HJWB 1IBKQ 5GAEC 3RYGA 1O7YA 1FJGL 5JJZA 1HTLD 1TVXA 3L0OA 1EZ6A 3KBXA 3HOYB 2HR5A 5HGTA 2DNCA 2LFNA 1I6HH 1LUZA 1VQCA 3M4PA 4ZYSA 4LW1A 5KNBA 4NXNQ 4JI5L 5M3FH 3FRPB 4PG3A 4EQ5A 4DR3L 2VQEL 1GD7A 4ZQ3A 5I6WA 5HGQA 3DWQA 5K2ME 1JICA 1PH8A 4DV0L 1SE3A 2NTTA 2LS01 4LMQD 3PO2B 4PNYA 2B2VA 1O7IA 2BH2A 4IPDA 3MPSA 2UXCQ 2AYJA 2IJ0A 4DUYQ 2E2JB 2A68C 3FDTA 5FO7B 1UE7A 1WJJA 1H9SB 4CKEA 1IZ6A 1CK1A 2JE6I 2YU9B 1STBA 4ZN1B 5IY0A 1PH6A 2NVYH 4A76A 4HIMA 4K6LA 1GUOA 2K7VA 2PYKA 1IU5A 1KL9A 4DNRB 5DM63 2UU9Q 3CD6A 1S5DD 1DM0B 1NCVA 3D3RA 5GAGC 4KHVA 2XRSD 3I4OA 2NVYL 3D4WA 1HFGA 4DV2Q 2XIWA 3TN2A 4FYDA 1EWHA 2CH4W 4YHHQ 2F3WA 3DWPA 1EQQA 1UEAB 2A1AA 2HQEA 2QKIC 4O2DA 4DAVA 1ENCA 1CZGA 4WFN3 3CW2C 4BWGB 4FXKC 5J39A 4JADA 2Q2HA 4DR4Q 3SS2A 1FNVA 3LWUA 4AHYA 4QUCA 4POFA 3J80c 4R9WA 1ET6A 1YNND 1K83B 5FKAC 4A3MG 1B9MA 2WACA 5KRUA 5EBDA 4LF6L 3LWPB 1V1QA 1EQRA 1YJ9A 2HT1A 1RL2A 1UWVA 2H1EA 3AB9A 3PGZA 4CDEC 1CI3M 1B2JA 2VW9A 1OWBA 1EYGA 2M4VA 3KUPA 2KCCA 3ULLA 2BA0A 1B70B 4HEDA 3S1QB 2KOLA 3X3MA 4X62L 4IUVA 3UDXA 3HOWG 3NE5B 3GP7A 3Q24A 4B9XA 2K50A 4KKSA 1RDVA 1Y69U 1L1OC 4BBRB 3QQCE 4KKTA 3HOWH 2RF4A 4A3ML 2B29A 3FP9A 4BY1H 2R7ZG 4FO2A 1IKLA 2B2WA 1SNMA 2PI2E 4DU9A 3IL8A 3DEOA 4PMCA 2R7ZH 1F2LA 3MXPA 4JI5Q 3CHBD 4S3SA 4DR3Q 5KYIA 4I7ZC 4CKCA 2H5XA 1K8MA 4A3GB 4DR2L 4DV0Q 3HOWL 1GO3E 2NVQL 1KHIA 3A55A 2Z6BA 5CBAE 1PXUA 4H7BA 3S14L 1AW7A 1J9OA 2J0TD 3I4LA 3KLRA 4V190 1S3OA 3GTOB 4JC0A 1BF4A 5IE8A 4HJ8A 2R7ZL 1P16A 3GV3A 5KIXA 1YK4A 2RDGA 1X3PA 2QILA 1B9NA 2NVTH 4LJZC 3RZOH 4R1JA 1NR2A 4ULLA 1XMOL 5I6YA 2AHOB 2F1MA 3ZG6A 1ET9A 1LKPA 1JOKA 4NB3A 1T9PA 3LNLA 1IROA 2XWJB 1FGUA 4OL7A 3TS2A 2KEEA 4X65L 2N3SA 3KYXA 3J81E 3O13A 2CKCA 1LACA 1EL0A 2NVTL 4P72A 3RZOL 4M1UB 1SN8A 1A3VA 1NUCA 2BA1A 3VR5A 1SJHD 4JBKA 4A3IH 4A3KG 4JI6L 4C3JB 5K36G 2RHSB 1XTCD 1YV1A 3S1MB 3E6ZX 2UUCL 1ENAA 2XWBB 4MIUA 5M5XL 4A3KH 2KUMA 3IAYA 1HZCA 3P75A 5K36H 1IHZA 5ELBA 4DV1Q 2WIIB 3J7ZC 2OEOA 3HKZG 4DAYB 1N8RC 1CADA 1IYVA 4GKKQ 3FMCA 3RZ6A 1FNUA 1E2VA 1TQOA 4ID6A 1LTSD 2Y0SG 2PNRC 4OWTB 2EIFA 4A3KL 2GA4B 2A6ED 1CQFA 1L0XB 1NNXA 3KF6B 3KOJA 4KLKA 3RLNA 5IT9c 1GHKA 4RA8A 5DLQE 5GADC 1XNQL 1I3QH 2EXDA 3CAMA 2IPKD 1B2OA 1C4QA 4AYBE 4ZLTF 3M7NA 4GS7D 2HIVA 3H0GB 2RKSA 2G9DA 1G51A 2R7FA 3KYVA 2UUBQ 1S2ZA 2BE5C 5IYCG 2O5JC 1JJGA 4U673 2PCFB 1I3QL 2AUJD 3AFQA 5FLXE 3FEWX 3H6MA 2N8NA 3RZDL 1HPCA 1T9OA 2JA9A 1MJEA 2O5IC 1LTLA 5C3EH 1CQVA 2FJ2A 1QB5D 1BBWA 3H15A 3DLLA 4WJ4A 1ESRA 1E22A 4KY6A 4P75A 2WP8J 2IX0A 1KQSA 1PTOB 5CV4A 1W6KA 2OQKA 1PA6A 4C2M1 3H3VM 1SXTA 4IALA 4KJNA 3R8BA 1HNXL 4OX9Q 3NTIA 5J3BA 3VYUA 5IYCL 2E74C 1HA6A 4DNIA 3NQTA 3TZUA 2RBMA 3GTGH 3RMHA 4YCUA 1KLGD 2Z0SA 4PMBA 1YHBA 3A8KE 1B3QA 4C1NI 3Q0AA 3A5UA 1NSNS 1F2ZA 4DNTB 3PIO3 4JI0L 4DN4M 5H1SE 4GN5A 4DR5L 1BBUA 1CZWA 1T5EA 2Q8RE 4JI4Q 1MHWC 3Q22A 3EFXD 4E6YA 3GTGL 1XXGA 3I56A 1B53A 3H97A 4LAAA 4L5RC 1B2TA 5MF6A 1Q8KA 2CH4A 2I46A 4IUNA 1GXDC 4Q0FA 2JEBI 4P74A 3P7JA 3GDEA 2K28A 4CBVA 1SMMA 4KHZA 2WINB 4IJHA 5DM71 4QIWE 5IYBG 4XT3B 1RD9D 1Q7YC 1B71A 2ERSA 1QCBD 4A3MB 4JCVE 2PQAA 1LABA 5IYBH 2L0ZA 4QQBX 2DGYA 4C3HG 1OXTA 5IWAL 2AUKA 1BXTA 2ID0A 4YWLA 3K8AA 4OWXB 3J81c 2FXQA 1CSQA 3J80i 2ASBA 4C3IB 2NVQB 3DM1A 5IYBL 3S14B 2F3VA 2C35B 2HDMA 2JXMB 2Q8IB 1SE4A 5ELEA 3BU2A 1JB3A 4C3HL 3ITPA 1XNQQ 2KVMA 3UE0A 2HCCA 4DR6L 4IFDG 5C0XH 4X3SA 4AIMA 2JA7H 2WAQE 1QVCA 2CCZA 2X69A 2NVXH 1QOHA 1UE5A 2N78A
chains in the Genus database with same CATH topology
5M5YH 1SMXA 3PV0A 1V9PA 3F2CA 5LMNL 4L5TA 3U50C 4XTCS 4A3BH 1Z92B 2K5HA 2RCNA 4B3RL 1IYJB 3GTKH 1PH5A 4IFDJ 5FLXc 3RZTA 1VQ6A 1K9MC 3KYHC 3KJPA 5MFZA 1BQ9A 1NJIC 5AJ3L 3S2DH 1X3GA 1VQ7A 1JE5A 2GN5A 1CUKA 4DUZL 2AKWB 2PVXA 1JYBA 4DV7Q 1SE8A 1YUXA 2A19A 5C4XG 3UDIA 3I4NH 2IY5B 5M5WH 5H1Sc 5GAEc 3BZCA 3S16H 1I94L 5C4XH 2KBNA 2ZM6L 1VQGA 5HY6A 1ODHA 4LFBL 2AWNA 3K7UC 1VQDA 1PH7A 3KDFA 4O0AA 4IOCA 3H3VH 2JA5G 3HOVG 5JJLA 5LMUQ 1VQFA 2R7DA 3TREA 5GROA 2OWOA 3HOVH 3RR5A 1QVFA 1TXYA 1E8JA 4AYBG 4DR6Q 1FHHA 1TWFH 3A44A 4AI3A 1YK5A 1PH3A 2Q2TA 1QZHA 1YUZA 1HNZL 2XTIA 1D8LA 1Z47A 2PYAA 5GAGc 3WWNB 4HJ9A 4K0KL 3A74A 1HH2P 4JI7Q 2B63H 1M1KC 3S1NH 1BE7A 4GKJQ 4R4IA 1CKNB 1YNXA 2XJUA 4L5SA 3K0XA 3HOXH 3GTMH 4A3FH 4GLAC 5AJ3Q 4ME3A 1DVBA 3CC4A 2AWOA 5IP9G 2HHHL 2CWPA 4JI8L 1A63A 1C7YA 4QGUA 3J81i 1XPRA 2K75A 2UXDL 1L2FA 3E9HA 4B3TQ 4GNXB 1C9OA 5C44G 3ERSX 2VQFL 1U0LA 1OXXK 3F2BA 4JV5L 1G291 4YY3Q 5ELOA 1W3SA 1K3RA 1VQNA 4R4TA 3NEMA 2WAQG 1C09A 4TVMA 1Q1BA 2HQLA 1N32Q 3L2PA 1PV4A 2ZJRA 3STBD 1HNZQ 3I7FA 1V43A 2Z3RB 1KIXA 1VQ9A 5MGNA 4IPHA 3E9IA 4K0KQ 4UY81 1GVPA 3JC62 1R0FA 4OO1G 1Q1EA 5E7NA 3KYYA 1UE6A 4JI2L 4PZ6A 2VL6A 3D0FA 5IYDG 4NXMQ 3S2HH 3GTQH 3PKJA 2DUDA 5GADc 1TWHH 3G6EA 2XJPA 1HR0L 4B3ML 4LF4L 1PH1A 1IBMQ 3J7Y1 4JI8Q 1SMWA 2PMZE 2OTLA 3VDYA 1B13A 2K52A 4AR6A 5M3FG 3PUZA 4R4CA 5JJKA 1AH9A 3ICEA 4JBJA 5GQOA 4GN3B 1VQ5A 2F4VL 4LF8Q 2ZJPA 2MS3A 4AHZA 4P71A 4LFAQ 2VUMH 4HJ5A 2E5LQ 2VQFQ 1N34L 3PKIA 3PIPA 1OWCA 3CMEA 2IHEA 1PHJA 4JI1L 3QVDA 1JB7A 4AR3A 1D7QA 1SRUA 3LGJA 3Q8DA 2CWAA 3CCEA 2E2IH 1X54A 2CR8A 2K2DA 6RXNA 4RG1A 3KYWA 1JT8A 2E8GA 1QVGA 3PSIA 3KF6A 3M3YH 4JI2Q 2R93H 3A0JA 3PIP1 1CKMA 1P8LA 4DR7L 1QUQB 3NBHB 4IFDI 1R0JA 3RN5A 4ZN3B 4BY1G 2XJRA 1NNQA 1FJGQ 2YYZA 1K8GA 4AHWA 3S1RH 3S15H 1HNWL 4EX5A 1KXLA 2VQEQ 4X64L 4AQYL 4QY7A 2XGTA 4C2MH 2I5LX 4JI3L 1WCMH 3I4MG 4LF7L 3I4MH 4JAFA 1Y14B 4A3IG 1KAWA 2PPTA 2YTYA 1L1OB 4A3JG 1Q82C 3PUYA 3STBC 1EIYB 4TVAB 3J7Z1 3K35A 4A3JH 4B3SL 1EUJA 1JMCA 4IPGA 2ERJA 2R92H 3GTJH 4AI2A 3HKSA 1XPOA 4JOIC 3TEHB 3G71A 4LF6Q 1NMGA 1KC8C 4B8CD 4DV3L 3GTLH 2A6HD 3TS0A 4BY7H 4LWCA 4X62Q 3UE1A 5C3EG 1HZ9A 2BH8A 5FJ8H 4GN4B 3U4VA 1Y1WH 2YTXA 2JI2A 3MEFA 1HNWQ 1GKHA 2NYDA 2ZTEA 3G48A 2GVAA 4DR2Q 1LM0A 4BBSG 1S72A 2JA6H 4DV5L 4BBSH 2OCEA 4UP7A 1WYDA 1XMOQ 2XJQA 2KN9A 1UE1A 1H95A 4YWMA 4X65Q 1LKMA 2F3IA 1N9WA 1YI2A 3E0EA 4JI6Q 2ZTDA 5EAYA 2UUCQ 3M4OH 3CCJA 4JBWA 1E7ZA 1IRNA 2QA4A 1VQOA 4UPAA 3KFUA 1RDGA 4TQUS 5C0XG 2JA7G 4FDBA 3PCOB 1PYSB 4AHXA 3EIVA 4NPSA 5DM61 2XJTA 4QJFA 1OXSC 1YVCA 5BR8L 4A3BG 1VQJA 2OTJA 1J6QA 3CPWA 4LUVA 2NN6G 1ASYA 3T1YL 5C0XJ 1FHMA 3MSUA 4WFN1 3RN2A 4LHNA 3FHWA 1HNXQ 4AH6A 1SLJA 1CKNA 4OO1I 5IP7H 1N33L 1I50H 3K7AH 3KJOA 4MTNA 2JEAI 4JI0Q 4DR5Q 2WB1E 1MIUA 4OONA 4QL5A 4DV4L 3FKIH 2V0FA 2J9UB 3I4NG 4A3EG 1KRSA 3S17H 4J15A 4DKAC 3ULJA 4A3EH 3TQYA 1MKHA 3L7ZC 3CQZH 1VQ8A 4XXBB 2GVBA 1KD1C 1VCXA 4A3CH 1R9TH 3CP0A 3KLWA 5FLMG 5IWAQ 3KYUA 4LFCL 4GNXA 3PF5A 1Z9FA 5FLMH 4ALPA 1QYBA 1U5KA 2B3GA 4DPGA 2ATWA 4JBMA 1BVSA 4A4IA 2A8VA 4GLXA 1X55A 3ER0A 4DAMA 1VCIA 5ELNA 2PQAB 2JJQA 1VQEA 2RHQB 2ALYB 1QZGA 1K8AC 4IOAA 3OTOL 5LMNQ 3HOYG 1NXEA 3D31A 1YJNA 1UEBA 3HOYH 1YIJA 4B3RQ 2B63G 4LF9L 2MNAA 1MJCA 3F1ZA 1YHQA 3PO2H 1IXRA 3W1BA 4LUZA 3HOXG 4A75A 4JAGA 1N33Q 4A3FG 3I55A 2E2JH 4LF5L 2WFWA 3T1HL 2IX1A 3W5OA 4PMWA 4DV4Q 3JC63 2YU9H 4U671 4DUZQ 4JAEA 3G4SA 4POGA 1WJVA 4PZ7A 1S24A 5GAHC 1I94Q 2ZM6Q 1JJ2A 2XJSA 1YBYA 1PH4A 4LFBQ 1OTCA 1BRFA 4OXPA 1PVOA 2K14A 1R0IA 3PIO1 3NFPI 2OQ0A 1Q86C 2DSXA 1K83H 1VQIA 4JG2A 2Z6KC 4XGHA 2KKDA 1WI5A 3S1QH 2UXCL 4HJAA 3RNUA 4DUYL 4BBRG 3OTOQ 1QCVA 2I5MX 4BBRH 1N36L 2JI1A 1RIPA 2UU9L 1CAAA 4UP9A 4A3GH 1XMQL 2MO0A 3GTOH 1QUQA 3M4QA 4RXNA 4BA2I 2WB1G 4YHHL 4LF5Q 4GOPC 1FL0A 2UXBL 1TWCH 1IBLL 1SROA 1YITA 5AI2A 2M6PA 4DR4L 2VZAA 3CCLA 4HJ7A 2HHHQ 1E1OA 3RLFA 2UUAL 1A0IA 2IHFA 3PUXA 2VY3A 4C3JH 3CMAA 3OW2A 3S1MH 2UXDQ 3J81j 2VUMG 4GLVB 2JK8A 3CCUA 2I5HA 4L5QA 3OYYA 1XNRL 1X6OA 2N49A 1WOCA 4JV5Q 3UDGA 4KHPL 3H0GG 1BKBA 1AE3A 1X56A 3P8BA 5JEAG 4TPUA 3H0GH 2ZTCA 4GOPB 4BXXG 1LYLA 2AMCB 4GS3A 3CCMA 2I0QA 4BXXH 1L1OA 1N36Q 3GD7A 3U4ZA 2RDVA 2D0OA 1B8AA 1GM5A 1YJWA 1R0GA 1XMQQ 5JEAJ 2R93G 4MZ9A 3TRZA 1EFWA 2NZHA 2M6OA 5C0XI 1VQLA 3PUWA 4DV6L 4DV1L 2UXBQ 2KHJA 1IBLQ 3B6YA 3KF8B 3AYHB 1HR0Q 4GKKL 4B3MQ 4AI0A 4LF4Q 1G6PA 1VQPA 1YZ6A 1A8VA 4V196 2UUAQ 3DM3A 2VNUD 2NN6I 4A3MH 2IT1A 2F52A 3AQQA 2ZJQA 2UUBL 2F4VQ 3P2AA 4AR4A 1X9NA 1RYTA 1BQ8A 2C6AA 3EBEA 4IPCA 1WCMG 4C3IH 2NVQH 1XNRQ 3S14H 1N34Q 4JOIA 4LNQA 4OX9L 4KHPQ 4H02A 1FVIA 4JI1Q 4Y7NH 3VPBE 2LCQA 1J5EL 2MO1A 2H12A 1R0HA 4JI4L 1S40A 2KCTA 2K5VA 2XJVA 5LMNW 1WFQA 1PYBA 5M5XH 4YCWA 1DGSA 3H3VI 2R92G 2V0EA 1B7YB 1RYQA 3M9BA 1S30A 2NZOA 3MXNB 2CKZB 1Q46A 4K9FA 2ES2A 4DR7Q 2L15A 4DV6Q 3PF4A 1PH9A 4BY7G 5RXNA 1AE2A 2Q2UA 2B5ID 3LPEB 5FJ8G 1Q12A 1Y1WG 3NENA 3UDFA 3F2DA 4XIGS 2M4YA 3RZDH 5M3MG 1XTDA 3PWFA 4KI0A 5M3MH 7RXNA 4X64Q 4AQYQ 3K81C 3BJUA 2GMGA 2JA6G 2K4KA 5IYCH 2Q2IA 3IRBA 3CC7A 4JI3Q 2D62A 4PZ8A 1CKOA 2EQSA 4LF7Q 8RXNA 3CC2A 2QL0A 1HZBA 1BFYA 1EWIA 3CPFA 1TWGH 1K0RA 1VQHA 1E24A 3HOZG 1J5EQ 4HIOA 3HOZH 3GO5A 1CSPA 1EOVA 4UP8A 5GAHc 1HJPA 4DV7L 1C0AA 4B3SQ 2JA8G 1YEZA 2KENA 2V3BB 1X3FA 3WWVA 2JA8H 1OXUA 3ZJYC 3JAMc 3AFPA 1X3EA 3B08B 2A69D 2CFMA 4C3HH 4DV3Q 1VQKA 1H7VA 4APVA 5LMUL 2ZIXA 3A5ZB 1IU6A 1A62A 2C6BA 4G6BA 5EIOC 4LHLA 4X66L 3CCSA 1NXGA 1Q81C 1E3PA 3K80C 5IP7G 1LKOA 3U58A 3GTPH 3JC66 4AR5A 3CCRA 2PNHA 1NE3A 4HIKA 3EN2A 4HIDA 1NMFA 1ZRPA 1EIFA 4DV5Q 2PVEA 3CXCA 2KCMA 2D0PA 3FKIG 2VS1A 1Y1VG 5JJIA 4JI7L 4LUOA 2PSMC 1IW7D 5MFPA 1Y1VH 4GKJL 4Y52H 4WJ3M 2KHIA 3PUVA 4A3CG 4RMFA 1KRTA 3CCQA 3HOUG 4DR1L 2LXKA 2LSSA 1L0WA 2PI2A 3HOUH 4A3LG 4A3LH 1PH2A 1RWDA 3ULPA 5MLC3 2V1CC 2YV5A 2A68D 4B3TL 2QEXA 1JJCB 4YWKA 1IL2A 3F8TA 1PFSA 1VQMA 5BR8Q 2JA5H 4YY3L 3PZAA 1HR0W 1K73C 1SMUA 4X66Q 3T1YQ 1NY4A 4DK6C 1N32L 3J7A5 3PO2G 1T9HA 1TWAH 5C4JH 3S24A 3B0AB 1HZAA 3PIOA 4A93G 3WWLA 2CKAA 1ASZA 1I5FA 2HIXA 4A93H 4GNXC 2E2HH 1RB9A 3CF5A 2Z6KA 1DX8A 1NBWA 3W1GA 3AEVA 4NXML 4JYAL 1E1TA 2QGQA 4R4QA 1T9QA 5AI3A 3CCVA 1NTGA 5JVH1 4LFCQ 1IBKL 1IBML 4DR1Q 1VQ4A 3JAMi 1VS0A 4A3DG 2Z3QB 1X65A 5IP9H 4IJLA 4MNOA 4A3DH 4IO9A 4NXNL 2R6GA 4GOPA 4X6AH 4R4OA 4LF8L 1VZGA 4LFAL 2E5LL 1VZHA 5EINC 4BA1I 5C44H 3BZKA 3KDFB 2YTVA 3M85A 2K5NA 1SFOH 1VQBA 1VQAA 3I2ZA 4A3GG 4LF9Q 3HFZB 1OXVA 2JQOA 3NELA 5JVG1 3SGIA 1VZIA 4DV2L 1SR3A 4P73A 1XJVA 2CQOA 2MQHA 1M90C 3PO3G 5AN9H 3T1HQ 4UY8C 2LXJA 4OWWB 3PO3H 2JI3A 3HKZE 3IU3I 1YHAA 2Y0SE 4JYAQ 1XPUA 2BE5D 2O5JD 5IYDH 1W2BA 4DK3C 2MFIA 4AI1A 4YCVA 3RLOA 1IBKQ 5GAEC 3RYGA 1FJGL 3L0OA 2HR5A 1I6HH 1LUZA 1VQCA 3M4PA 4LW1A 4NXNQ 4JI5L 5M3FH 4PG3A 4EQ5A 4DR3L 2VQEL 1GD7A 5HGQA 5K2ME 1PH8A 4DV0L 1O7IA 2BH2A 4IPDA 3MPSA 2UXCQ 2AYJA 4DUYQ 1UE7A 1WJJA 1IZ6A 2JE6I 4ZN1B 5IY0A 1PH6A 2NVYH 4A76A 4HIMA 1IU5A 1KL9A 2UU9Q 3CD6A 5GAGC 3I4OA 4DV2Q 4YHHQ 1EQQA 2A1AA 4O2DA 3CW2C 4JADA 2Q2HA 4DR4Q 3SS2A 4AHYA 4POFA 3J80c 4A3MG 4LF6L 1YJ9A 1V1QA 1EQRA 2HT1A 1RL2A 1UWVA 3PGZA 2VW9A 1B2JA 1OWBA 1EYGA 2M4VA 3ULLA 2BA0A 1B70B 4X62L 3UDXA 3HOWG 2K50A 1RDVA 1L1OC 3QQCE 3HOWH 2RF4A 3FP9A 2B29A 4BY1H 2R7ZG 2PI2E 2R7ZH 4JI5Q 4DR3Q 2H5XA 4DR2L 4DV0Q 1GO3E 1KHIA 1S3OA 4JC0A 5IE8A 4HJ8A 1P16A 1YK4A 2NVTH 3RZOH 4R1JA 1XMOL 2AHOB 3ZG6A 1LKPA 4NB3A 1T9PA 3LNLA 1IROA 1FGUA 3TS2A 4X65L 2N3SA 3KYXA 2CKCA 4P72A 1SN8A 2BA1A 4JBKA 4A3IH 4A3KG 4JI6L 5K36G 2RHSB 1YV1A 2UUCL 4A3KH 1HZCA 4DV1Q 3J7ZC 3HKZG 1N8RC 4DAYB 1CADA 4GKKQ 3RZ6A 2Y0SG 4OWTB 2EIFA 2A6ED 3KOJA 3RLNA 3KF6B 4KLKA 5IT9c 5DLQE 5GADC 1XNQL 1I3QH 2EXDA 3CAMA 1B2OA 4AYBE 3M7NA 4GS7D 2HIVA 1G51A 2R7FA 3KYVA 2UUBQ 1S2ZA 5IYCG 1JJGA 3AFQA 2N8NA 1T9OA 2JA9A 1MJEA 1LTLA 5C3EH 1BBWA 3H15A 3DLLA 4WJ4A 4P75A 1E22A 2WP8J 2IX0A 1KQSA 2OQKA 1PA6A 4OX9Q 1HNXL 5J3BA 4DNIA 3GTGH 4YCUA 2Z0SA 1YHBA 3A5UA 4JI0L 5H1SE 4GN5A 4DR5L 1BBUA 4JI4Q 4E6YA 3I56A 4L5RC 5MF6A 1Q8KA 2JEBI 4P74A 3GDEA 1SMMA 4KHZA 4IJHA 5DM71 4QIWE 5IYBG 1Q7YC 1B71A 2ERSA 4JCVE 2PQAA 5IYBH 2L0ZA 4QQBX 2DGYA 1OXTA 5IWAL 2ID0A 4YWLA 3K8AA 4OWXB 3J81c 2FXQA 1CSQA 3J80i 2ASBA 2C35B 3BU2A 1XNQQ 3UE0A 4DR6L 4IFDG 4AIMA 2JA7H 2WAQE 1QVCA 2CCZA 2NVXH 1UE5A 2N78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N49 A;  1L1O B;  1WOC A;  5M5Y H;  4A3J G;  1Q82 C;  3PUY A;  1SMX A;  3STB C;  3W1G A;  3AEV A;  4NXM L;  3PV0 A;  4JV5 Q;  1EIY B;  1V9P A;  4TVA B;  3F2C A;  5LMN L;  4JYA L;  3UDG A;  4KHP L;  4L5T A;  1E1T A;  4A3J H;  4B3S L;  3H0G G;  2QGQ A;  1BKB A;  1AE3 A;  1EUJ A;  4IPG A;  4R4Q A;  3U50 C;  1JMC A;  1X56 A;  4XTC S;  1T9Q A;  5JEA G;  4TPU A;  5AI3 A;  3H0G H;  2ZTC A;  4GOP B;  4BXX G;  4A3B H;  2R92 H;  1LYL A;  2AMC B;  4GS3 A;  3CCV A;  1NTG A;  2K5H A;  2RCN A;  4B3R L;  1IYJ B;  3CCM A;  2I0Q A;  3GTJ H;  4LFC Q;  4BXX H;  3HKS A;  1XPO A;  1IBK L;  1IBM L;  4DR1 Q;  4JOI C;  3GTK H;  1VQ4 A;  3TEH B;  1PH5 A;  4IFD J;  3JAM i;  1L1O A;  1VS0 A;  3G71 A;  4LF6 Q;  5FLX c;  3RZT A;  4A3D G;  1X65 A;  1NMG A;  5IP9 H;  1N36 Q;  4IJL A;  1KC8 C;  3KYH C;  3GD7 A;  4DV3 L;  3U4Z A;  3KJP A;  1K9M C;  4MNO A;  3GTL H;  1BQ9 A;  2RDV A;  2D0O A;  4A3D H;  1B8A A;  1GM5 A;  3TS0 A;  4IO9 A;  1NJI C;  1YJW A;  4NXN L;  4BY7 H;  4LWC A;  4X62 Q;  3UE1 A;  5C3E G;  2R6G A;  4GOP A;  1R0G A;  4X6A H;  5AJ3 L;  4R4O A;  1HZ9 A;  4LF8 L;  2BH8 A;  1XMQ Q;  5FJ8 H;  1X3G A;  3S2D H;  4GN4 B;  5JEA J;  3U4V A;  1VQ7 A;  1JE5 A;  1Y1W H;  2GN5 A;  2R93 G;  1CUK A;  2YTX A;  4LFA L;  4MZ9 A;  3TRZ A;  2E5L L;  1EFW A;  3MEF A;  1HNW Q;  2NZH A;  4DUZ L;  4BA1 I;  1GKH A;  2AKW B;  2PVX A;  1JYB A;  5C0X I;  4DV7 Q;  1VQL A;  1SE8 A;  1YUX A;  3BZK A;  2A19 A;  2ZTE A;  3G48 A;  3KDF B;  5C44 H;  3PUW A;  2GVA A;  4DV6 L;  4DV1 L;  5C4X G;  2YTV A;  3UDI A;  3I4N H;  2UXB Q;  3M85 A;  5M5W H;  4DR2 Q;  2KHJ A;  1IBL Q;  2IY5 B;  3B6Y A;  3BZC A;  3KF8 B;  3S16 H;  2K5N A;  1SFO H;  3AYH B;  1VQB A;  5C4X H;  2KBN A;  1I94 L;  1LM0 A;  2ZM6 L;  1HR0 Q;  1VQG A;  4B3M Q;  4GKK L;  4BBS G;  5HY6 A;  1VQA A;  3I2Z A;  4A3G G;  4LF4 Q;  3HFZ B;  1S72 A;  4LF9 Q;  2JA6 H;  1G6P A;  1OXV A;  2JQO A;  4DV5 L;  4LFB L;  3NEL A;  4BBS H;  1VQP A;  1YZ6 A;  1A8V A;  2AWN A;  2OCE A;  3K7U C;  4UP7 A;  1WYD A;  3SGI A;  1XMO Q;  2UUA Q;  1VQD A;  3DM3 A;  1PH7 A;  2VNU D;  2KN9 A;  3KDF A;  2NN6 I;  4O0A A;  1SR3 A;  4DV2 L;  4IOC A;  1UE1 A;  3H3V H;  2JA5 G;  3HOV G;  4P73 A;  5JJL A;  5LMU Q;  4A3M H;  1H95 A;  1VQF A;  4YWM A;  2R7D A;  1XJV A;  3TRE A;  4X65 Q;  2IT1 A;  2CQO A;  2MQH A;  2F52 A;  1M90 C;  5GRO A;  3AQQ A;  1LKM A;  2F3I A;  2UUB L;  2ZJQ A;  2OWO A;  3RR5 A;  2F4V Q;  3HOV H;  1N9W A;  3PO3 G;  1QVF A;  3T1H Q;  1TXY A;  1E8J A;  1YI2 A;  2LXJ A;  4UY8 C;  4AYB G;  3E0E A;  4DR6 Q;  4OWW B;  3PO3 H;  4AR4 A;  4JI6 Q;  1X9N A;  1RYT A;  1BQ8 A;  3EBE A;  3HKZ E;  4IPC A;  1FHH A;  1TWF H;  3A44 A;  1WCM G;  2ZTD A;  5EAY A;  4C3I H;  2NVQ H;  1YK5 A;  1PH3 A;  1YHA A;  2Q2T A;  2UUC Q;  1XNR Q;  3S14 H;  2Y0S E;  1N34 Q;  1QZH A;  3M4O H;  3CCJ A;  4JOI A;  4JBW A;  4JYA Q;  1XPU A;  1YUZ A;  4LNQ A;  4OX9 L;  4KHP Q;  1E7Z A;  1IRN A;  2QA4 A;  1VQO A;  1HNZ L;  5IYD H;  2XTI A;  1D8L A;  4DK3 C;  4H02 A;  1W2B A;  1Z47 A;  2PYA A;  1FVI A;  4JI1 Q;  4UPA A;  3KFU A;  2MFI A;  4Y7N H;  4HJ9 A;  4YCV A;  1RDG A;  3RLO A;  4TQU S;  5C0X G;  2LCQ A;  4FDB A;  3PCO B;  1J5E L;  2JA7 G;  1PYS B;  1IBK Q;  4K0K L;  3A74 A;  5GAE C;  3RYG A;  2MO1 A;  1HH2 P;  4JI7 Q;  2B63 H;  1FJG L;  1M1K C;  1R0H A;  4JI4 L;  3S1N H;  1BE7 A;  3EIV A;  3L0O A;  1S40 A;  4NPS A;  2HR5 A;  2KCT A;  1I6H H;  4GKJ Q;  1LUZ A;  2K5V A;  4QJF A;  4R4I A;  1VQC A;  3M4P A;  1CKN B;  1YNX A;  5LMN W;  4LW1 A;  1WFQ A;  1PYB A;  3K0X A;  3HOX H;  4L5S A;  4NXN Q;  1OXS C;  4JI5 L;  5M3F H;  3GTM H;  4PG3 A;  4YCW A;  4EQ5 A;  1YVC A;  5M5X H;  2VQE L;  1GD7 A;  1DGS A;  5BR8 L;  4DR3 L;  3H3V I;  5HGQ A;  2R92 G;  4A3F H;  4GLA C;  4A3B G;  1VQJ A;  1PH8 A;  5AJ3 Q;  2OTJ A;  1B7Y B;  4DV0 L;  3M9B A;  1S30 A;  1J6Q A;  4ME3 A;  3CPW A;  4LUV A;  2NN6 G;  1ASY A;  3T1Y L;  2NZO A;  3MXN B;  1DVB A;  2CKZ B;  1O7I A;  2BH2 A;  5C0X J;  1Q46 A;  4K9F A;  3MPS A;  1FHM A;  4IPD A;  3CC4 A;  2ES2 A;  2UXC Q;  2AWO A;  5IP9 G;  4DUY Q;  2HHH L;  4DR7 Q;  2CWP A;  4JI8 L;  3RN2 A;  2L15 A;  3FHW A;  1HNX Q;  1UE7 A;  1WJJ A;  4DV6 Q;  4AH6 A;  3PF4 A;  1SLJ A;  1CKN A;  1PH9 A;  1A63 A;  1IZ6 A;  4BY7 G;  1C7Y A;  4QGU A;  4OO1 I;  5RXN A;  1AE2 A;  5IP7 H;  2JE6 I;  2Q2U A;  3J81 i;  1XPR A;  5IY0 A;  1PH6 A;  1N33 L;  1I50 H;  2NVY H;  4A76 A;  4HIM A;  3K7A H;  3KJO A;  1IU5 A;  1KL9 A;  5FJ8 G;  4MTN A;  2K75 A;  2UXD L;  1L2F A;  2JEA I;  1Q12 A;  1Y1W G;  2UU9 Q;  4JI0 Q;  3CD6 A;  4DR5 Q;  3NEN A;  2WB1 E;  1MIU A;  4OON A;  3UDF A;  5GAG C;  3F2D A;  3E9H A;  4B3T Q;  4QL5 A;  4DV4 L;  3FKI H;  3I4O A;  2M4Y A;  4XIG S;  1C9O A;  5M3M G;  4GNX B;  5C44 G;  3RZD H;  1XTD A;  3PWF A;  4DV2 Q;  4KI0 A;  3ERS X;  3I4N G;  2VQF L;  1U0L A;  4A3E G;  1OXX K;  3F2B A;  1KRS A;  5M3M H;  4JV5 L;  7RXN A;  3S17 H;  1G29 1;  4X64 Q;  4YHH Q;  4AQY Q;  4J15 A;  4DKA C;  4YY3 Q;  3ULJ A;  4A3E H;  1EQQ A;  5ELO A;  2A1A A;  1W3S A;  1K3R A;  3K81 C;  3TQY A;  1MKH A;  3L7Z C;  3BJU A;  4O2D A;  4R4T A;  3CQZ H;  1VQ8 A;  3NEM A;  2GMG A;  2WAQ G;  1C09 A;  2GVB A;  2K4K A;  5IYC H;  2JA6 G;  3CW2 C;  1KD1 C;  1VCX A;  4A3C H;  2Q2H A;  1Q1B A;  4DR4 Q;  2Q2I A;  3IRB A;  3SS2 A;  2HQL A;  1R9T H;  3CP0 A;  3KLW A;  3CC7 A;  1N32 Q;  5FLM G;  4JI3 Q;  2D62 A;  5IWA Q;  3KYU A;  4LFC L;  4GNX A;  3PF5 A;  3L2P A;  4PZ8 A;  2ZJR A;  1PV4 A;  4POF A;  3J80 c;  1Z9F A;  3STB D;  5FLM H;  4ALP A;  1CKO A;  4A3M G;  1HNZ Q;  3I7F A;  2EQS A;  1QYB A;  4LF7 Q;  4LF6 L;  1YJ9 A;  1V1Q A;  8RXN A;  1EQR A;  3CC2 A;  2HT1 A;  1U5K A;  2B3G A;  1RL2 A;  4DPG A;  2QL0 A;  1HZB A;  1BFY A;  1V43 A;  1EWI A;  1UWV A;  3CPF A;  3PGZ A;  2ATW A;  2VW9 A;  4JBM A;  1B2J A;  1TWG H;  1EYG A;  1BVS A;  4A4I A;  1KIX A;  1VQ9 A;  4BA2 I;  1K0R A;  1VQH A;  1E24 A;  3ULL A;  2BA0 A;  1B70 B;  4IPH A;  2A8V A;  3E9I A;  4X62 L;  4GLX A;  3HOZ G;  1J5E Q;  3UDX A;  4K0K Q;  1X55 A;  3HOW G;  1D7Q A;  3ER0 A;  4DAM A;  4HIO A;  2K50 A;  1GVP A;  3JC6 2;  1RDV A;  1VCI A;  5ELN A;  1R0F A;  2PQA B;  3HOZ H;  4OO1 G;  1L1O C;  1Q1E A;  2JJQ A;  5E7N A;  2RF4 A;  3FP9 A;  2B29 A;  3GO5 A;  3KYY A;  1UE6 A;  4BY1 H;  4JI2 L;  2R7Z G;  4PZ6 A;  2VL6 A;  1CSP A;  1EOV A;  1VQE A;  2PI2 E;  2ALY B;  2RHQ B;  3D0F A;  4UP8 A;  1HJP A;  1QZG A;  5IYD G;  1K8A C;  4NXM Q;  2R7Z H;  3S2H H;  4LFB Q;  4IOA A;  4JI5 Q;  3OTO L;  5LMN Q;  4DV7 L;  1C0A A;  4DR3 Q;  3GTQ H;  2DUD A;  3HOY G;  4B3S Q;  2H5X A;  3D31 A;  2JA8 G;  1YEZ A;  4DR2 L;  2KEN A;  4DV0 Q;  2V3B B;  1GO3 E;  1KHI A;  1X3F A;  1YJN A;  3WWV A;  1UEB A;  3HOY H;  1YIJ A;  1TWH H;  1S3O A;  3G6E A;  1HR0 L;  4JC0 A;  4B3M L;  2JA8 H;  4B3R Q;  5IE8 A;  1OXU A;  4HJ8 A;  1P16 A;  3ZJY C;  2B63 G;  4LF4 L;  4LF9 L;  2MNA A;  3JAM c;  1YK4 A;  1PH1 A;  1IBM Q;  1MJC A;  3AFP A;  4JI8 Q;  3F1Z A;  1X3E A;  2NVT H;  3RZO H;  1SMW A;  4R1J A;  2CFM A;  2PMZ E;  2OTL A;  1XMO L;  4C3H H;  3VDY A;  1YHQ A;  3PO2 H;  1B13 A;  1IXR A;  2AHO B;  4LUZ A;  3W1B A;  2K52 A;  3HOX G;  4A75 A;  4AR6 A;  1LKP A;  5M3F G;  4DV3 Q;  3PUZ A;  4NB3 A;  1T9P A;  4R4C A;  1VQK A;  1N33 Q;  1IRO A;  1H7V A;  1FGU A;  4APV A;  5JJK A;  5LMU L;  4A3F G;  1AH9 A;  3TS2 A;  1N8R C;  4X65 L;  2N3S A;  3KYX A;  3A5Z B;  3ICE A;  4JBJ A;  5GQO A;  4GN3 B;  3I55 A;  1IU6 A;  1VQ5 A;  2E2J H;  2WFW A;  2YTY A;  1A62 A;  4P72 A;  4LF5 L;  2F4V L;  1SN8 A;  3T1H L;  2BA1 A;  3W5O A;  2MS3 A;  2ZJP A;  4LF8 Q;  2IX1 A;  4PMW A;  4P71 A;  4JBK A;  4A3I H;  4X66 L;  4DV4 Q;  4LFA Q;  4A3K G;  2YU9 H;  4JI6 L;  2VUM H;  3CCS A;  4HJ5 A;  5K36 G;  2E5L Q;  2RHS B;  1YV1 A;  4DUZ Q;  2UUC L;  1Q81 C;  2VQF Q;  1E3P A;  4A3K H;  1N34 L;  1HZC A;  3K80 C;  3G4S A;  5IP7 G;  1LKO A;  4POG A;  3U58 A;  3GTP H;  4PZ7 A;  4DV1 Q;  3PIP A;  3JC6 6;  3J7Z C;  3HKZ G;  1S24 A;  4AR5 A;  1CAD A;  4DAY B;  5GAH C;  3CME A;  3CCR A;  2IHE A;  2PNH A;  1NE3 A;  4HIK A;  2ZM6 Q;  1I94 Q;  3RZ6 A;  4GKK Q;  1PHJ A;  3EN2 A;  4JI1 L;  2Y0S G;  4HID A;  1NMF A;  1ZRP A;  3QVD A;  2EIF A;  4OWT B;  1JJ2 A;  1JB7 A;  4AR3 A;  1EIF A;  4DV5 Q;  2PVE A;  1YBY A;  2KCM A;  3CXC A;  3KOJ A;  3RLN A;  3KF6 B;  4KLK A;  5IT9 c;  2D0P A;  3FKI G;  1PH4 A;  1SRU A;  1OTC A;  1BRF A;  4OXP A;  5DLQ E;  1VQ6 A;  5GAD C;  2VS1 A;  1Y1V G;  1XNQ L;  1I3Q H;  5JJI A;  3LGJ A;  3Q8D A;  4JI7 L;  2CWA A;  2EXD A;  2K14 A;  3CAM A;  4LUO A;  1R0I A;  1PVO A;  1B2O A;  3CCE A;  2E2I H;  4AYB E;  3M7N A;  1Y1V H;  1X54 A;  2HIV A;  2OQ0 A;  4GKJ L;  4Y52 H;  1G51 A;  2R7F A;  1Q86 C;  2K2D A;  6RXN A;  4RG1 A;  4WJ3 M;  2KHI A;  3KYV A;  2UUB Q;  1S2Z A;  3PUV A;  5IYC G;  1JJG A;  3KYW A;  2DSX A;  3AFQ A;  4A3C G;  1JT8 A;  2E8G A;  1K83 H;  1VQI A;  2N8N A;  1QVG A;  1T9O A;  2JA9 A;  3PSI A;  1MJE A;  4JG2 A;  3KF6 A;  3M3Y H;  1LTL A;  5C3E H;  4RMF A;  1KRT A;  2Z6K C;  4JI2 Q;  3CCQ A;  1BBW A;  3H15 A;  2KKD A;  3DLL A;  4WJ4 A;  4P75 A;  1E22 A;  1WI5 A;  2WP8 J;  3S1Q H;  2IX0 A;  2UXC L;  1KQS A;  2R93 H;  3A0J A;  4HJA A;  3RNU A;  3HOU G;  1CKM A;  2OQK A;  4DUY L;  1P8L A;  4BBR G;  3OTO Q;  4DR1 L;  2LXK A;  1PA6 A;  1HNX L;  4OX9 Q;  4DR7 L;  5J3B A;  2LSS A;  1QUQ B;  1QCV A;  1L0W A;  2PI2 A;  4DNI A;  3NBH B;  3HOU H;  2I5M X;  4A3L G;  4IFD I;  4BBR H;  1R0J A;  3RN5 A;  1N36 L;  3GTG H;  4YCU A;  2Z0S A;  4A3L H;  1YHB A;  1PH2 A;  1RIP A;  1RWD A;  3A5U A;  3ULP A;  2UU9 L;  4JI0 L;  4BY1 G;  5H1S E;  1CAA A;  2YYZ A;  1NNQ A;  1BBU A;  2V1C C;  2YV5 A;  4GN5 A;  4UP9 A;  4DR5 L;  1K8G A;  1XMQ L;  4JI4 Q;  1FJG Q;  4A3G H;  4B3T L;  2QEX A;  3I56 A;  3S1R H;  3S15 H;  2MO0 A;  3GTO H;  1HNW L;  4L5R C;  1QUQ A;  1JJC B;  1Q8K A;  4EX5 A;  4YWK A;  3M4Q A;  1KXL A;  4RXN A;  2JEB I;  4P74 A;  1IL2 A;  3F8T A;  1PFS A;  2VQE Q;  4X64 L;  2WB1 G;  3GDE A;  5BR8 Q;  4YHH L;  4AQY L;  4GOP C;  1VQM A;  2JA5 H;  4YY3 L;  1SMM A;  4KHZ A;  1FL0 A;  4LF5 Q;  2UXB L;  4IJH A;  1TWC H;  3PZA A;  4QY7 A;  4QIW E;  1IBL L;  1SRO A;  2XGT A;  1HR0 W;  3JC6 3;  5IYB G;  1K73 C;  1SMU A;  1YIT A;  5AI2 A;  4X66 Q;  3T1Y Q;  1B71 A;  1Q7Y C;  4DR4 L;  4C2M H;  3HOW H;  4JCV E;  2PQA A;  2I5L X;  1NY4 A;  4DK6 C;  2VZA A;  5IYB H;  4QQB X;  1N32 L;  3CCL A;  4JI3 L;  3J7A 5;  2DGY A;  1OXT A;  4HJ7 A;  5IWA L;  2HHH Q;  3PO2 G;  1WCM H;  2ID0 A;  4YWL A;  3K8A A;  4OWX B;  1E1O A;  1T9H A;  1TWA H;  3I4M G;  3J81 c;  2FXQ A;  3RLF A;  1VQN A;  1CSQ A;  2UUA L;  5C4J H;  1A0I A;  4LF7 L;  3J80 i;  3S24 A;  3I4M H;  1HZA A;  2IHF A;  2ASB A;  3PUX A;  1Y14 B;  2VY3 A;  4C3J H;  3PIO A;  3CMA A;  3OW2 A;  4A93 G;  3S1M H;  1ASZ A;  1I5F A;  2UXD Q;  3J81 j;  2C35 B;  2HIX A;  4A93 H;  4A3I G;  2VUM G;  3BU2 A;  4GNX C;  2E2H H;  1RB9 A;  1XNQ Q;  4GLV B;  2JK8 A;  1KAW A;  2I5H A;  4L5Q A;  3UE0 A;  3CCU A;  4DR6 L;  4IFD G;  3CF5 A;  4AIM A;  3OYY A;  2JA7 H;  2WAQ E;  1UE5 A;  1DX8 A;  1QVC A;  2Z6K A;  2CCZ A;  2NVX H;  1XNR L;  1NBW A;  1X6O A;  2N78 A; 
#chains in the Genus database with same CATH topology
 5M5Y H;  4Y7N B;  1SMX A;  1YNN C;  3PV0 A;  1V9P A;  3F2C A;  1KTK A;  5LMN L;  3C2P A;  5EKK A;  5DNF A;  3M7G A;  4L5T A;  3X3N A;  2NB0 A;  2NVT B;  2EYJ A;  3U50 C;  1LTB D;  2DJF C;  2JN4 A;  3SDZ A;  4XTC S;  2NVX L;  5D65 A;  5J22 A;  4A3B H;  3SHL A;  3SEB A;  1Z92 B;  5M5Y L;  2K5H A;  2EYO A;  2RCN A;  4B3R L;  1IYJ B;  4DFA A;  1GOZ A;  5M5X B;  1D5X C;  3GTK H;  1H9M A;  4DF7 A;  1PH5 A;  4IFD J;  4KD3 A;  5FLX c;  3RZT A;  3KLS X;  1VQ6 A;  1K9M C;  4A3B L;  3KYH C;  3KJP A;  5MFZ A;  1BQ9 A;  1RF2 D;  2RA4 A;  1NJI C;  1JOQ A;  2PZW A;  4U68 A;  3GTK L;  4K2K A;  4FF1 A;  5AJ3 L;  3EJI A;  3S2D H;  1X3G A;  4CDC C;  1VQ7 A;  1JE5 A;  2GN5 A;  4ZKB B;  4Y52 L;  1CUK A;  4EQO A;  1J8I A;  1MGS A;  4JPB W;  4DUZ L;  3HKZ B;  2AKW B;  2PVX A;  2EJM A;  1JYB A;  3GV6 A;  4DV7 Q;  1SE8 A;  1YUX A;  2EPB A;  2A19 A;  5KND A;  2Y0S B;  5C5M A;  3TDQ A;  1CA5 A;  5DAU A;  4DXF A;  3AU7 A;  3UDI A;  1LT4 D;  3S2D L;  3I4N H;  5C4X G;  2IY5 B;  3MFY A;  5M5W H;  5H1S c;  1DXM A;  5GAE c;  3BZC A;  3S16 H;  2F0H A;  3RZD B;  1I94 L;  5C4X H;  2C5C A;  2KBN A;  2ZM6 L;  1SND A;  1VQG A;  5HY6 A;  3BVM A;  5NUC A;  1ODH A;  3EQL C;  4LFB L;  3PQI A;  3J81 L;  2AWN A;  2J7Z A;  3K7U C;  1ESF A;  2B2U C;  2F0V A;  3T4A C;  3S16 L;  1VQD A;  5C4X L;  4ILW A;  4MN3 A;  1PH7 A;  2O4X A;  3KDF A;  1TY2 A;  4O0A A;  4IOC A;  3H3V H;  2JA5 G;  3HOV G;  5JJL A;  5LMU Q;  1VQF A;  2R7D A;  1F9R A;  3TRE A;  5I4D A;  3LWQ B;  4XQN A;  3MFG A;  5GRO A;  2OWO A;  3HOV H;  3RR5 A;  1QVF A;  1TXY A;  1E8J A;  2AQ3 B;  2EOT A;  2EYF A;  4AYB G;  4FNF A;  4DR6 Q;  3DUZ A;  4RAU C;  2E76 C;  4G4K A;  1FHH A;  1TWF H;  3A44 A;  4AI3 A;  2A6E C;  3MAQ A;  1TWG B;  1YK5 A;  1PH3 A;  2Q2T A;  3GTG B;  2CW0 D;  2R61 A;  5COR A;  1QZH A;  2HVY C;  2JA5 L;  3HOV L;  1MSG A;  1UNS A;  3QB3 A;  2K03 A;  1YUZ A;  2BDN A;  1HNZ L;  3K59 A;  2XTI A;  3HOZ B;  2APO B;  1D8L A;  5ELD A;  1TWF L;  1Z47 A;  2PYA A;  5GAG c;  3WWN B;  3IKJ A;  4HJ9 A;  1D6E C;  2KEC A;  4K0K L;  3A74 A;  5C4J L;  1HH2 P;  3FVQ A;  4JI7 Q;  5FLX L;  3N6R A;  2B63 H;  1M1K C;  1EEI D;  1CFM A;  2QEJ C;  3S1N H;  1BE7 A;  4N9P A;  4K5W A;  5KEE A;  2JA8 B;  4GKJ Q;  4R4I A;  1HA5 A;  3BVZ A;  1CKN B;  1YNX A;  2XJU A;  4L5S A;  3K0X A;  2F0P A;  3HOX H;  3GTM H;  3K58 A;  1S5C D;  1QIL A;  1EEF D;  4A3F H;  4GLA C;  2IWH A;  3S1N L;  5AJ3 Q;  4OHJ A;  4C3H B;  2N88 A;  5E3F A;  4ME3 A;  2PW7 A;  2AUS B;  1DVB A;  1CHP D;  2MJ8 A;  2E2D C;  3CC4 A;  3GTM L;  2AWO A;  3T16 A;  5IP9 G;  3SXH A;  2HHH L;  3P20 A;  3DHQ A;  2CWP A;  4JI8 L;  3OWF A;  1EY6 A;  1PRT B;  1S5B D;  1A63 A;  1STE A;  1C7Y A;  5CGK A;  4QGU A;  3J81 i;  1XPR A;  3VR6 A;  4RGM A;  2ZXP A;  1GUS A;  2NVX B;  1GUN A;  2K75 A;  1L2F A;  2UXD L;  1EY5 A;  5M5Y B;  3GTP B;  1MD2 D;  4O42 A;  5IP9 L;  1I6V C;  1XYI A;  1JCK B;  3E9H A;  3HJY B;  4B3T Q;  3VR2 A;  2OF1 A;  4GNX B;  1C9O A;  5C44 G;  4KTA A;  3ERS X;  4CJ0 B;  1H9S A;  2VQF L;  1U0L A;  2K5W A;  1OXX K;  1RDP D;  3F2B A;  4JV5 L;  4RCN A;  1G29 1;  1ML0 D;  4YY3 Q;  2I07 B;  1BOS A;  5ELO A;  1W3S A;  1K3R A;  4JVZ A;  1VQN A;  4R4T A;  3NEM A;  2WAQ G;  1C09 A;  4TVM A;  5IGD A;  1Q1B A;  3QO2 A;  2HQL A;  5K5P A;  2B8F A;  1N32 Q;  5C44 L;  1I4G A;  5EQ0 A;  2F0I A;  3LNN A;  3HRZ C;  3L2P A;  1PV4 A;  2ZJR A;  1WTR A;  3STB D;  4IQZ A;  1HNZ Q;  3I7F A;  1SFO L;  2HUG A;  1V43 A;  1C48 A;  2EYP A;  4V0B A;  3V96 A;  2Z3R B;  1EU4 A;  3CKI B;  1KIX A;  1VQ9 A;  3KF8 A;  5MGN A;  1A2T A;  4IPH A;  3VYT A;  3E9I A;  1I4R A;  4K0K Q;  4UY8 1;  5IGG A;  1SJE D;  1GVP A;  3JC6 2;  2N55 A;  3HOU B;  1R0F A;  4OO1 G;  1Q1E A;  5E7N A;  3E0J A;  3S16 B;  3KYY A;  1U4R A;  1UE6 A;  3BG3 A;  4JI2 L;  4PZ6 A;  2VL6 A;  3D0F A;  3SK8 A;  4ZRZ A;  5IYD G;  4NXM Q;  3S2H H;  5I2X A;  1PDQ A;  3GTQ H;  3PKJ A;  2DUD A;  4Q5V A;  3QJY A;  2Z4H A;  2F0W A;  5GAD c;  1TWH H;  3MTS A;  3G6E A;  2XJP A;  1HR0 L;  4B3M L;  4PQX A;  3S2H L;  4LF4 L;  2F0J A;  1PH1 A;  1IBM Q;  3J7Y 1;  2F0L A;  3GTQ L;  2PW5 A;  4IZ8 A;  5IYD L;  4JI8 Q;  2JA5 B;  4CKB A;  5IGB A;  1SMW A;  2PMZ E;  2OTL A;  3VDY A;  1B13 A;  1SYD A;  3A54 A;  2K52 A;  4AR6 A;  5M3F G;  4R8N A;  1U9R A;  3PUZ A;  4R4C A;  1SNO A;  1TWF B;  1BCP F;  5JJK A;  4AYB B;  1IKM A;  1AH9 A;  4KMU C;  3ICE A;  4JBJ A;  5GQO A;  4GN3 B;  5IOC A;  1VQ5 A;  3VR3 A;  2F4V L;  3ND9 A;  1TWA B;  4RFB A;  3L9A X;  4LF8 Q;  2ZJP A;  2MS3 A;  4FXD A;  4AHZ A;  2KHS A;  1STH A;  5C4J B;  1I6H L;  1CTM A;  2PQE A;  2F0D A;  4P71 A;  4LFA Q;  2VUM H;  1SAP A;  4HJ5 A;  3HKZ P;  2E5L Q;  3FPU B;  5M3F L;  1QG7 A;  2VQF Q;  2FIN B;  2Y0S P;  1N34 L;  4A93 B;  3VYS A;  2F0N A;  3PKI A;  2E2H B;  1Q3L A;  3PIP A;  1F9Q A;  1SNP A;  4F7X A;  2PZT A;  1OWC A;  3CME A;  3S1N B;  2IHE A;  5C3W A;  4NW2 A;  1PHJ A;  4JI1 L;  3HS0 C;  3QVD A;  1JB7 A;  1G91 A;  5I9O A;  4AR3 A;  1GUG A;  1D7Q A;  1EIG A;  5JEA H;  3MXN A;  1SRU A;  3BDL A;  3LGJ A;  3Q8D A;  2CWA A;  2CW0 C;  3CCE A;  5BN3 A;  2E2I H;  1EY0 A;  1PZI D;  1X54 A;  2K5Q A;  2IL8 A;  1O7L A;  2CR8 A;  2RSN A;  2K2D A;  6RXN A;  4RG1 A;  4DAY A;  2F0K A;  1HTP A;  5CV5 A;  3KYW A;  3MC0 B;  1RCV D;  1JT8 A;  2E8G A;  1QVG A;  2E2I L;  3PSI A;  4XDX A;  4F8M A;  3KF6 A;  3M3Y H;  1TS3 A;  1PZX A;  1TS2 A;  4QIW B;  4JI2 Q;  1O78 A;  4A3D B;  2QCP X;  2QW7 A;  3T53 B;  5IGE A;  1UUP A;  2R93 H;  2M00 A;  3A0J A;  3PIP 1;  1CKM A;  3J7A V;  1P8L A;  4DR7 L;  3TME A;  3K5M A;  2BOS A;  1JOR A;  1QUQ B;  1E2Z A;  3NBH B;  4IFD I;  1Y8O B;  3OWE B;  1R0J A;  4RHS A;  3RN5 A;  3H99 A;  4NDX A;  2ZT9 C;  1W6J A;  4CGY B;  1TY0 A;  4X3T A;  4ZN3 B;  2F0S A;  4JW0 A;  1MBY A;  4K6D A;  5C44 B;  1HXY D;  4BY1 G;  3I3C A;  3TBI B;  3R2T A;  2XJR A;  1NNQ A;  1FNW A;  2RCF A;  2YYZ A;  1K8G A;  1FJG Q;  4AHW A;  2B2T A;  4WJW A;  3J7A F;  2QF7 A;  4K5X A;  1SFO B;  3S1R H;  3S15 H;  3OMG A;  1SYB A;  1HNW L;  1EIH A;  1EY8 A;  4EX5 A;  2WAQ B;  1KXL A;  2QDB A;  1M4V A;  2RFK B;  2VQE Q;  4X64 L;  4AQY L;  3MVV A;  5IGC A;  5EGT A;  4QY7 A;  4BY1 L;  2XGT A;  1QNU A;  3QIA A;  1STA A;  3S1R L;  3S15 L;  4G7H C;  4ME5 A;  5D3D A;  3TP6 A;  4C2M H;  3BYT B;  2I5L X;  4JI3 L;  5L37 A;  4HTH A;  1WCM H;  2KQ3 A;  2K05 A;  3I4M G;  1F9S A;  2F0U A;  4DK1 A;  3PO3 B;  3LWR B;  4LF7 L;  4DA2 A;  3I4M H;  1MI2 A;  4P2C B;  4JAF A;  1Y14 B;  1HFN A;  2F0O A;  1ZEQ X;  4K8I A;  4A3I G;  4FXG C;  1KAW A;  1FR3 A;  2HCI A;  3I4M L;  5E4W C;  1OO9 B;  1STY A;  1D1K A;  1PLF A;  2PPT A;  2ZXR A;  3A7A B;  2YTY A;  3DEP A;  3K5O A;  1L1O B;  4A3J G;  1Q82 C;  3PUY A;  3STB C;  1EY4 A;  1NR4 A;  1EIY B;  4TVA B;  3J7Z 1;  3K35 A;  2FMM A;  5JAV A;  4A3J H;  4B3S L;  4A3I L;  1VMP A;  1EUJ A;  1JMC A;  4IPG A;  2ERJ A;  2MP1 A;  4H44 C;  3HEJ A;  1I6H B;  5CV8 A;  3A8I E;  2F0G A;  2R92 H;  4J8Q A;  2B2W C;  5EBC A;  2EY6 A;  1ZYR D;  3GTJ H;  4AI2 A;  5M3F B;  3HKS A;  1XPO A;  4A3J L;  4JOI C;  1JR0 D;  3TEH B;  5EPK A;  5IGF A;  3BVG A;  1X32 A;  3G71 A;  2EZV A;  4LF6 Q;  1Q90 A;  3SE0 A;  1NMG A;  4N8X 1;  3NHH A;  5COY A;  1KC8 C;  2R92 L;  4B8C D;  5T1G A;  4DV3 L;  3GTL H;  1A3T A;  2A6H D;  3TS0 A;  3GTJ L;  3W2D A;  4BY7 H;  4LWC A;  1ROD A;  4X62 Q;  3UE1 A;  4OEM B;  5C3E G;  2RSO A;  1HZ9 A;  2BH8 A;  5FJ8 H;  1L0Y B;  1HHV A;  4GN4 B;  3U4V A;  1Y1W H;  3OPO A;  3GTL L;  4KV6 A;  2YTX A;  1A15 A;  2JI2 A;  2NVY B;  1G2S A;  3MEF A;  1JWM D;  4BY7 L;  1HNW Q;  1GKH A;  2DJG C;  3VA5 A;  2NYD A;  2ZTE A;  3G48 A;  3M4Y A;  2GVA A;  5CMD A;  1FD7 D;  3NBI A;  2WV6 D;  1V1P B;  1JC7 A;  5C3E L;  3ERQ A;  4DR2 Q;  5JVH 3;  1LM0 A;  5C4Z A;  4BBS G;  3T13 A;  4KKU A;  2F0M A;  1S72 A;  2JA6 H;  4DV5 L;  4L6T B;  4BBS H;  1BUV T;  1I4H A;  2OCE A;  4UP7 A;  1WYD A;  1XMO Q;  1HUM A;  2EYM A;  2XJQ A;  2KN9 A;  4AYB P;  1UE1 A;  4OEL B;  1H95 A;  4YWM A;  4X65 Q;  3D8G A;  1BBX C;  4BBS L;  2NZ1 D;  1LKM A;  1B1Z A;  2F3I A;  2EJF C;  5C4H A;  1N9W A;  2L9H A;  3UI2 A;  1YI2 A;  4ABN A;  4KD4 A;  3D6W A;  3E0E A;  1BCP D;  4HN7 A;  1LTA D;  1WTH A;  1TKW B;  4JI6 Q;  1EWC A;  2TSS A;  2ZTD A;  5EAY A;  2UUC Q;  3R93 A;  3M4O H;  3CCJ A;  1KNA A;  4JBW A;  3AMU A;  1PTO F;  1E7Z A;  1IRN A;  2QA4 A;  1VQO A;  1KAA A;  1DON A;  1BR9 A;  3MZ5 A;  1PFU A;  3HAX C;  3HOW B;  1SBB B;  3NTK A;  4UAI A;  4BY1 B;  4UPA A;  5CR3 A;  5JVG 3;  3KFU A;  3M4O L;  2K01 A;  2R7Z B;  1RDG A;  1IYU A;  4TQU S;  5C0X G;  2EY1 A;  2JA7 G;  2FHT A;  3PCO B;  4FDB A;  1PYS B;  3HP3 A;  1K0S A;  3H91 A;  4QF4 A;  4FF4 A;  2B8G A;  4AHX A;  3H9C A;  3EIV A;  3VYR A;  4NPS A;  5DM6 1;  2XJT A;  2NBF A;  4CJ2 C;  1STN A;  2MPM A;  4QJF A;  2B2Y A;  5E4X A;  2VB3 X;  4H0L C;  1XX8 A;  4XXE A;  4C1N K;  1OXS C;  1YVC A;  5BR8 L;  1VF7 A;  4A3B G;  3RZO B;  2JA7 L;  1VQJ A;  1EZ8 A;  2OTJ A;  1PZJ D;  2XNA C;  2L1B A;  4XYQ A;  4QIW P;  1J6Q A;  1F77 A;  1D5M C;  1S5E D;  4RGO S;  3CPW A;  4LUV A;  2NN6 G;  1ASY A;  3T1Y L;  4QUF A;  5C0X J;  1FHM A;  2NN6 H;  3MSU A;  4WFN 1;  4DK0 A;  3OIP A;  4LHN A;  3FHW A;  3RN2 A;  1HNX Q;  3J7Y W;  4TRD A;  2E75 C;  4AH6 A;  1SLJ A;  1CKN A;  4OO1 I;  1E2W A;  5IP7 H;  4A3I B;  2L55 A;  1N33 L;  1I50 H;  3K7A H;  4DGZ A;  2AQC A;  4J1M A;  3KJO A;  2FMC A;  4A3K B;  4MTN A;  2JEA I;  4JI0 Q;  3MQK B;  4DR5 Q;  2MGS A;  2WB1 E;  1MIU A;  4OON A;  3I70 A;  1NAP A;  4QL5 A;  4DV4 L;  3FKI H;  2V0F A;  1V1O A;  3G7L A;  2WAQ P;  2J9U B;  1RTO A;  1CHQ D;  3I4N G;  4A3E G;  1PFN A;  1KRS A;  1LLR D;  3S17 H;  3GTJ B;  4J15 A;  4DKA C;  5HUR A;  3ULJ A;  4A3E H;  1I3Q B;  1T5X D;  1TU2 B;  3TQY A;  1MKH A;  3L7Z C;  3CQZ H;  1VQ8 A;  4XXB B;  2GVB A;  2DN8 A;  3QOL A;  3QWN A;  1KD1 C;  5FO8 B;  1VCX A;  4A3C H;  1LT6 D;  1R9T H;  3CP0 A;  3KLW A;  3KK7 A;  3QOJ A;  5FLM G;  2L4N A;  5IWA Q;  3KYU A;  4LFC L;  4GNX A;  3PF5 A;  3I4N L;  4A3E L;  5G3L F;  5M5W L;  1Z9F A;  5FLM H;  4ALP A;  3CQZ L;  5F2D A;  1QYB A;  4PV1 C;  1U5K A;  2B3G A;  4DPG A;  5C3E B;  2ATW A;  2PMZ B;  4JBM A;  5KGU A;  1BVS A;  4A4I A;  5TSS A;  5FO9 B;  4HMI A;  2A8V A;  4GLX A;  5FLM L;  1X55 A;  1LTR D;  3ER0 A;  4DAM A;  1VCI A;  5ELN A;  2X6G A;  2PQA B;  1WTO A;  2JJQ A;  4KK7 A;  4KN7 C;  1ZYR C;  1VQE A;  2RHQ B;  4MTK A;  2ALY B;  1UAP A;  1QZG A;  4NKL A;  1K8A C;  3NWT A;  4IOA A;  3OTO L;  4G57 A;  4IUT A;  5M9O A;  5LMN Q;  3HOY G;  1NXE A;  3D31 A;  3BS1 A;  1EOT A;  1YJN A;  5CV6 A;  3EVQ A;  1UEB A;  2A6H C;  3HOY H;  1YIJ A;  2RDF A;  4B3R Q;  2B63 G;  4LF9 L;  2MNA A;  4I7A A;  3LWV B;  2WKD A;  3OW7 A;  1MJC A;  3F1Z A;  4K8J A;  4FVM A;  1YHQ A;  3HOY L;  3PMF A;  4ZKC B;  3PO2 H;  1IXR A;  3W1B A;  4LUZ A;  3HOX G;  4A75 A;  2RDH A;  3QR8 A;  1WTP A;  3OSO A;  4OGQ C;  4JAG A;  1N33 Q;  2F0E A;  4A3F G;  3ONA B;  3I8Z A;  3I55 A;  2B63 L;  2E2J H;  4LF5 L;  2WFW A;  5CYU A;  3T1H L;  2IX1 A;  3W5O A;  3SK5 A;  4PMW A;  2RVL A;  4DV4 Q;  5ELC A;  3JC6 3;  2F0T A;  2YU9 H;  4U67 1;  2P5Z X;  4HCE A;  3LWO B;  4DUZ Q;  3HOX L;  1QQT A;  4JAE A;  3G4S A;  2JP1 A;  4A3F L;  4POG A;  1WJV A;  4PZ7 A;  2A74 C;  3NTH A;  3I91 A;  2ICI A;  1S5F D;  1S24 A;  4KY7 A;  5BN5 A;  5GAH C;  1I94 Q;  2JA7 B;  2ZM6 Q;  1JJ2 A;  4N9T A;  2XJS A;  1HCZ A;  1YBY A;  1PH4 A;  4LFB Q;  4XYO A;  2SDF A;  1OTC A;  1BRF A;  1BCP C;  4OXP A;  1RJT A;  1PVO A;  2K14 A;  1R0I A;  3T56 B;  4IUR A;  3MA2 B;  3PIO 1;  1DOM A;  3NFP I;  4A3B B;  2OQ0 A;  1Q86 C;  1BO0 A;  4FF3 A;  2KCN A;  1B3A A;  2D2C C;  3L3O C;  2DSX A;  2ICE C;  4XT1 B;  3H3V C;  3GTK B;  1K83 H;  1A3U A;  1VQI A;  2EE1 A;  1MSH A;  1AEX A;  4JG2 A;  2Z6K C;  2EVB A;  2V4D A;  5EKL A;  4XGH A;  2KKD A;  4I65 A;  1WI5 A;  4ZUI A;  1VDZ A;  3S1Q H;  2UXC L;  2PO4 A;  4HJA A;  3RNU A;  2CVR A;  4DUY L;  4BBR G;  3OTO Q;  1QCV A;  3S2D B;  3D4R A;  2I5M X;  4BBR H;  3V2T A;  3NSW A;  1P7P A;  1PRT F;  4HSP A;  1N36 L;  2JI1 A;  2Z8L A;  2G9H D;  3NWS A;  3S1Q L;  3CRL C;  3SK4 A;  1PTO D;  1RIP A;  4WOR A;  2UU9 L;  4XQQ A;  4B08 A;  1CAA A;  3OMC A;  3I4N B;  4UP9 A;  4A3E B;  4A3G H;  1XMQ L;  5M5W B;  4BBR L;  1SNC A;  4ZUJ A;  3TP8 A;  1EY7 A;  5C4X B;  3BDC A;  2MO0 A;  3GTO H;  2M2L A;  1AN8 A;  1QUQ A;  3M4Q A;  4RXN A;  1U4L A;  4ODG A;  3J80 E;  1CT1 D;  2WB1 G;  3D6C A;  4YHH L;  4BA2 I;  4LF5 Q;  4GOP C;  3ZYY X;  1FL0 A;  2UXB L;  1TWC H;  3ERO A;  1IBL L;  1SRO A;  3C46 A;  5LL6 S;  3GTO L;  1YIT A;  5AI2 A;  1VF5 C;  1KNE A;  2M6P A;  4RH6 A;  4DR4 L;  5ELF A;  2VZA A;  3VA7 A;  3NPP A;  3CCL A;  1G8Z D;  2HD3 A;  4HJ7 A;  2HHH Q;  3I72 A;  3HOV B;  1E1O A;  3MHB A;  3HG9 A;  1TWC L;  3RLF A;  2IW3 A;  4C3J G;  3OOC A;  1TWH L;  2UUA L;  2EYH A;  1A0I A;  1F2Y A;  4IN3 A;  1PFY A;  1SYG A;  3DMU A;  2IHF A;  3PUX A;  2VY3 A;  4C3J H;  3CMA A;  3OW2 A;  4FP5 D;  3S1M H;  3D4D A;  5BN4 A;  2UXD Q;  3J81 j;  2MHV A;  2F03 A;  4UDU C;  1F4L A;  2VUM G;  1D2B A;  1SDF A;  2IX3 A;  4GLV B;  2JK8 A;  3CCU A;  2I5H A;  4L5Q A;  3MWY W;  2XRQ D;  3OYY A;  4C3J L;  3S1M L;  2WKC A;  2EY2 A;  1XNR L;  1X6O A;  1H9R A;  5DM7 3;  2N49 A;  1WOC A;  4JV5 Q;  2M9V A;  3JR7 A;  3K5N A;  2LKV A;  2A5H A;  2SOB A;  2OT2 A;  1ICF B;  4CJ1 B;  4EVO A;  3UDG A;  4KHP L;  2B63 B;  3H0G G;  2VUM L;  1BKB A;  1AE3 A;  3G6J B;  3A8J E;  1HQM C;  2TMP A;  1X56 A;  5D3I B;  3P8B A;  5JEA G;  4TPU A;  3H0G H;  2ZTC A;  4GOP B;  4BXX G;  5FOB B;  1LYL A;  2AMC B;  4GS3 A;  2EDG A;  4BS9 A;  2C9O A;  1KDA A;  2ZXO A;  3CCM A;  2AQ2 B;  2I0Q A;  3HOX B;  4NP5 A;  3GTM B;  4BXX H;  3EA6 A;  1DOL A;  4IUP A;  4A3F B;  1L1O A;  1STG A;  3LWE A;  2PMZ P;  1WTW A;  3H0G L;  1N36 Q;  2VB2 X;  5CV7 A;  3GD7 A;  3U4Z A;  1EYC A;  3NK9 A;  1DD2 A;  5I2Y A;  2RDV A;  2D0O A;  5EPJ A;  5G3L D;  1B8A A;  1GM5 A;  4BXX L;  1YJW A;  2KA7 A;  1PTO H;  4RCO A;  4E6I A;  5IOD A;  4HR7 B;  3SK6 A;  1U4M A;  5T1I A;  1R0G A;  2D9U A;  2EYL A;  4JK1 C;  1XMQ Q;  2KED A;  1AFP A;  5JEA J;  2R93 G;  1SMY D;  2K32 A;  5IIF A;  3MEH A;  4MZ9 A;  3TRZ A;  1EFW A;  2NZH A;  1LV9 A;  5DEH A;  2M6O A;  3E3X A;  5IT9 E;  2CQA A;  5A35 A;  5C0X I;  4NMZ A;  4RHR A;  4KN4 C;  1VQL A;  1IL8 A;  3BDO A;  3PUW A;  4DV6 L;  4DV1 L;  2UXB Q;  3M3Y L;  2KHJ A;  1IBL Q;  2PZU A;  1RTN A;  3B6Y A;  4O1N A;  3KF8 B;  3AYH B;  1H9J A;  1HR0 Q;  4GKK L;  4B3M Q;  4AI0 A;  3W3A A;  2B2V C;  1GUW A;  2R93 L;  2EXZ A;  1G6Z A;  4LF4 Q;  1F9P A;  1G6P A;  4IUU A;  1VQP A;  1YZ6 A;  1A8V A;  1K3B C;  1ILQ A;  4V19 6;  1JOO A;  3P1H A;  2UUA Q;  3DM3 A;  4C56 C;  2VNU D;  3HGB A;  3WOF A;  2NN6 I;  1KDB A;  3A7L A;  4OIK A;  1X3Q A;  4EQP A;  4A3M H;  4Z9C B;  1V1P A;  2IT1 A;  2F52 A;  2SEB D;  1B50 A;  3AQQ A;  1TT2 A;  2UUB L;  2ZJQ A;  2F4V Q;  4C3I G;  3P2A A;  3E5S A;  3TZD A;  1EYD A;  3SR1 A;  1ONL A;  3BZD B;  4H13 C;  4AR4 A;  1EQT A;  1X9N A;  1RYT A;  1BQ8 A;  2C6A A;  1QJO A;  3EBE A;  1WCM G;  4IPC A;  1PYW D;  4C3I H;  2NVQ H;  3F2U A;  1XNR Q;  3S14 H;  1N34 Q;  2O2L D;  3KBG A;  4JOI A;  1WTV A;  1Y8P B;  4LNQ A;  4OX9 L;  4KHP Q;  2VXW A;  5JOB A;  5CC4 A;  2LMC B;  4H02 A;  4C3I L;  1D1I A;  1FVI A;  4JI1 Q;  2L11 A;  3PL5 A;  1WCM L;  4Y7N H;  1YNJ D;  3S2H B;  3VPB E;  2LCQ A;  1J5E L;  3I73 A;  3K6O A;  3GTQ B;  2MO1 A;  4WRD A;  2Z4I A;  2H12 A;  1R0H A;  4JI4 L;  1TWC B;  3C3L A;  5EKI A;  1S40 A;  1TWH B;  2WB1 B;  2KCT A;  4F88 A;  1Q8I A;  2SNM A;  3BYY B;  1KDC A;  2K5V A;  3JAM E;  4L63 B;  4Y7N L;  1QNK A;  2XJV A;  5LMN W;  1S4Z A;  1WFQ A;  1DCZ A;  1PYB A;  2D5D A;  5M5X H;  4YCW A;  1D5Z C;  5LL6 X;  1DGS A;  3H3V I;  2CHB D;  2A73 B;  4ZK9 B;  2R92 G;  2V0E A;  2BDO A;  1B7Y B;  4RGT A;  1RYQ A;  3M9B A;  1S30 A;  1HRJ A;  2B2T C;  1K8O A;  1PTO C;  2NZO A;  3MXN B;  2CKZ B;  2Q8T A;  1Q46 A;  4K9F A;  4QMG A;  1EQV A;  4ZCK A;  3U9O A;  3S9W A;  2ES2 A;  5E1F A;  4DR7 Q;  4G7Z C;  1WD0 A;  1VMC A;  1KLU D;  2L15 A;  4DV6 Q;  3PF4 A;  5LHY 1;  1PH9 A;  1II3 A;  2DNE A;  1QE6 A;  4BY7 G;  5RXN A;  1AE2 A;  2Q2U A;  2B5I D;  3DWA A;  2VUM B;  4CDD C;  4DAP A;  1PZK D;  4N8F A;  3LPE B;  5FJ8 G;  1Q12 A;  1Y1W G;  1CM9 A;  3J80 L;  3NEN A;  1PRT D;  4RWS C;  3UDF A;  3F2D A;  1I4X A;  3C1E A;  4XIG S;  2M4Y A;  3R2I A;  3RZD H;  5M3M G;  1XTD A;  3PWF A;  4KI0 A;  1WD1 A;  4K5V A;  2XVS A;  4RKB A;  1Z7T A;  5M3M H;  2DY8 A;  7RXN A;  4X64 Q;  4AQY Q;  5FJ8 L;  3K81 C;  1Y1W L;  2DY7 A;  3BJU A;  5CV9 A;  5FK9 C;  2GMG A;  2JA6 G;  2K4K A;  4TKO B;  5IYC H;  2E2I B;  4HCS A;  1EY9 A;  4DXG A;  2Q2I A;  3IRB A;  5I9P A;  3MXU A;  3CC7 A;  5M3M L;  1SE2 A;  3K0Y A;  4JI3 Q;  2D62 A;  5CBE E;  4K2L A;  4PZ8 A;  5J1Z A;  2Z9H A;  2JSO A;  1JQY D;  1CKO A;  2EQS A;  1H9K A;  1KAB A;  1R4Q B;  5ISR A;  1A2U A;  4TSS A;  4LF7 Q;  8RXN A;  4LK1 C;  4ZAI A;  2L12 A;  2X6L A;  3CC2 A;  3M3Y B;  2QL0 A;  1HZB A;  1BFY A;  1EWI A;  2PPB C;  3CPF A;  1TWG H;  2JA6 L;  2NWG A;  4K14 A;  1Z6H A;  1K0R A;  1VQH A;  1E24 A;  2R93 B;  1LTT D;  3U9S A;  3HOZ G;  1J5E Q;  4HIO A;  3HOZ H;  3MXG A;  3GO5 A;  1TWG L;  1B44 D;  2HDL A;  1CSP A;  1EOV A;  4UP8 A;  5GAH c;  4CDF C;  5AFW A;  1AZP A;  1ILP A;  1HJP A;  2L5T A;  1PFB A;  1BQQ T;  2SNS A;  4DV7 L;  1C0A A;  1E0B A;  1PFM A;  4B3S Q;  1WVL A;  2JA8 G;  3HOZ L;  1YEZ A;  2KEN A;  1O80 A;  2V3B B;  1X3F A;  1EU3 A;  3WWV A;  3S1R B;  3S15 B;  2R3Z A;  2JA8 H;  1RHP A;  1OXU A;  3ZJY C;  3JAM c;  3GQB A;  2K5D A;  3AFP A;  3FDJ A;  1X3E A;  4KY5 A;  3B08 B;  1LT3 D;  3NXW A;  1SMY C;  2A69 D;  2CFM A;  1GJX A;  4C3H H;  2JA8 L;  4DV3 Q;  3FPP A;  3DXJ C;  4X3U A;  1VQK A;  4C2M B;  1H7V A;  4APV A;  3NQI A;  5LMU L;  1LTI D;  5JPN C;  2ZIX A;  1ZKO A;  4HMJ A;  3A5Z B;  5IT9 L;  1WCM B;  1IU6 A;  1LT5 D;  1A62 A;  4G7O C;  2C6B A;  1V8Q A;  4G6B A;  4J6H A;  3I4M B;  5EIO C;  4LHL A;  1LO5 D;  4X66 L;  3CCS A;  3R3O A;  1NXG A;  1Q81 C;  1E3P A;  4IFD H;  3K80 C;  5IP7 G;  1LKO A;  3U58 A;  3GTP H;  5A2Q E;  2B2U A;  2LY7 A;  3JC6 6;  3WOE A;  4EQN A;  1I4P A;  4AR5 A;  3CCR A;  2PNH A;  1I4Q A;  1NE3 A;  2RQX A;  4HIK A;  1CA6 A;  1HUN A;  3EN2 A;  1DYQ A;  3TSS A;  4HID A;  1NMF A;  1ZRP A;  1M8A A;  1GUT A;  2AQ1 B;  2EY5 A;  5JPM C;  1EIF A;  4DV5 Q;  2PVE A;  3GTP L;  2KCM A;  3CXC A;  1TII D;  2D0P A;  3FKI G;  3Q23 A;  1JE4 A;  2VS1 A;  1Y1V G;  4HSV A;  4A3J B;  5JJI A;  5IP7 L;  4JI7 L;  1DJR D;  1C8C A;  3OIQ A;  3QG1 A;  4LUO A;  2PSM C;  1SYC A;  1I50 L;  1RKN A;  1IW7 D;  3K7A L;  5MFP A;  1Y1V H;  1LTG D;  1DOK A;  2R92 B;  4GKJ L;  4Y52 H;  3CU7 A;  3OHX C;  3I90 A;  4WJ3 M;  2KHI A;  3PUV A;  4A3C G;  1BDO A;  3FKI L;  2XSC A;  1Y1V L;  4RMF A;  3GTL B;  1YNJ C;  1KRT A;  1JWU D;  1SNQ A;  3CCQ A;  1G2T A;  3S17 L;  2B2Y C;  4BY7 B;  1B4O A;  5C6A A;  3HOU G;  4DR1 L;  2LXK A;  2LSS A;  1AP0 A;  1L0W A;  2PI2 A;  5D14 A;  3HOU H;  4A3L G;  4A3C L;  2K04 A;  1Y1W B;  1SEB D;  4GZY C;  1R9T L;  4A3L H;  4X3K A;  1PH2 A;  3JAM L;  1RWD A;  3ULP A;  2OXP A;  5M3M B;  5MLC 3;  3Q6S A;  2V1C C;  2YV5 A;  3HOU L;  2K1B A;  2K33 A;  2WB1 P;  2A68 D;  4B3T L;  2QEX A;  4A3L L;  3HZX A;  1JJC B;  4YWK A;  2JA6 B;  2JYO A;  1IL2 A;  3F8T A;  1PFS A;  1VQM A;  4BBS B;  5BR8 Q;  2JA5 H;  3IFD A;  4YY3 L;  2MUY A;  3PZA A;  4RGN A;  4XQJ A;  4EGV A;  1HR0 W;  1K73 C;  1SMU A;  3PIP 3;  4X66 Q;  3T1Y Q;  3SVM A;  4F87 A;  3RUZ A;  1DZ1 A;  1U4P A;  1EYA A;  1NY4 A;  4DK6 C;  1N32 L;  1PRT C;  3J7A 5;  3PO2 G;  4IUQ A;  5C3X A;  2NTS A;  1AZQ A;  3N52 A;  1T9H A;  1TWA H;  4QCL A;  1QWY A;  1R4P B;  5C4J H;  4M8A A;  2EJG C;  3S24 A;  3B0A B;  1HZA A;  2L0C A;  3LX0 A;  3PIO A;  2FFK B;  2NYZ D;  4A93 G;  3WWL A;  2CKA A;  1ASZ A;  1I5F A;  2XN9 C;  3M4O B;  2HIX A;  4A93 H;  1O7Z A;  3KLS A;  1TWA L;  2BCO A;  5KYL A;  4GNX C;  2E2H H;  1RB9 A;  3PO2 L;  3WDN A;  2ENB A;  3H9B A;  3T51 B;  3CF5 A;  2Z6K A;  1DX8 A;  3VR4 A;  4UHV A;  1NBW A;  2E2J L;  3IFT A;  1WTQ A;  4A93 L;  3W1G A;  3AEV A;  4NXM L;  1ENF A;  3H94 A;  2E2H L;  1SYE A;  4JYA L;  2G5D A;  3NUC A;  1E1T A;  2F4I A;  2QGQ A;  2YU9 L;  4R4Q A;  1K28 A;  4MHE A;  1T9Q A;  2F0F A;  5AI3 A;  1PMR A;  3CCV A;  1NTG A;  1Y8N B;  5JVH 1;  5EPL A;  2KJX A;  4LFC Q;  1IBK L;  1IBM L;  2K6A A;  4DR1 Q;  1SYF A;  5C5L A;  1VQ4 A;  3JAM i;  1VS0 A;  2NUC A;  4A3D G;  2Z3Q B;  1X65 A;  3K57 A;  5IP9 H;  1BNZ A;  4IJL A;  1ZXT A;  1TR5 A;  4MNO A;  4A3D H;  1EFI D;  4IO9 A;  4NXN L;  3TP7 A;  3V05 A;  3ND8 A;  2R6G A;  4GOP A;  4X6A H;  4OIJ A;  4R4O A;  4LF8 L;  3C1F A;  1VZG A;  5KNC A;  4LFA L;  4A3D L;  3TP5 A;  1I50 B;  2E5L L;  3K5L A;  3K7A B;  3RD4 A;  1VZH A;  5EIN C;  1F2M A;  4BA1 I;  2H4O A;  4KJO A;  2A69 C;  1K83 L;  5C44 H;  3BZK A;  4X6A L;  3KDF B;  2YTV A;  4QB4 A;  1FYC A;  3M85 A;  2K5N A;  3FKI B;  1SFO H;  1VQB A;  1Y1V B;  1VQA A;  3I2Z A;  3H09 A;  4A3G G;  4LF9 Q;  3HFZ B;  1OXV A;  2JQO A;  1TS5 A;  3S17 B;  3NEL A;  3A56 A;  4L8J A;  2Z1C A;  5JVG 1;  1GHJ A;  3CQZ B;  3SGI A;  1VZI A;  1BCP B;  2J4X A;  4DV2 L;  1SR3 A;  4P73 A;  1R9T B;  3NBH A;  1WTX A;  1XJV A;  1ICW A;  2CQO A;  2MQH A;  3URY A;  4CHT B;  1M90 C;  3CRK C;  3PO3 G;  4A3G L;  5AN9 H;  3T1H Q;  5A2Q L;  4UY8 C;  2LXJ A;  3NP8 A;  1JWS D;  1FGB D;  4R8I A;  4OWW B;  3PO3 H;  2JI3 A;  1TS4 A;  2B39 A;  3HKZ E;  2QDL A;  1PFW A;  3IU3 I;  1YHA A;  4RKL A;  4B9W A;  2Y0S E;  2EY4 E;  4OO1 H;  1A6X A;  4FF2 A;  1SSO A;  4JYA Q;  1XPU A;  1IW7 C;  2BE5 D;  3PO3 L;  2O5J D;  5IYD H;  5EJW A;  1PFV A;  4YIJ A;  1W2B A;  4DK3 C;  2F0Q A;  1XWE A;  4HAE A;  2MFI A;  4AI1 A;  1HQR D;  4YCV A;  3RLO A;  3HJW B;  1IBK Q;  5GAE C;  3RYG A;  1O7Y A;  1FJG L;  5JJZ A;  1HTL D;  1TVX A;  3L0O A;  1EZ6 A;  3KBX A;  3HOY B;  2HR5 A;  5HGT A;  2DNC A;  2LFN A;  1I6H H;  1LUZ A;  1VQC A;  3M4P A;  4ZYS A;  4LW1 A;  5KNB A;  4NXN Q;  4JI5 L;  5M3F H;  3FRP B;  4PG3 A;  4EQ5 A;  4DR3 L;  2VQE L;  1GD7 A;  4ZQ3 A;  5I6W A;  5HGQ A;  3DWQ A;  5K2M E;  1JIC A;  1PH8 A;  4DV0 L;  1SE3 A;  2NTT A;  2LS0 1;  4LMQ D;  3PO2 B;  4PNY A;  2B2V A;  1O7I A;  2BH2 A;  4IPD A;  3MPS A;  2UXC Q;  2AYJ A;  2IJ0 A;  4DUY Q;  2E2J B;  2A68 C;  3FDT A;  5FO7 B;  1UE7 A;  1WJJ A;  1H9S B;  4CKE A;  1IZ6 A;  1CK1 A;  2JE6 I;  2YU9 B;  1STB A;  4ZN1 B;  5IY0 A;  1PH6 A;  2NVY H;  4A76 A;  4HIM A;  4K6L A;  1GUO A;  2K7V A;  2PYK A;  1IU5 A;  1KL9 A;  4DNR B;  5DM6 3;  2UU9 Q;  3CD6 A;  1S5D D;  1DM0 B;  1NCV A;  3D3R A;  5GAG C;  4KHV A;  2XRS D;  3I4O A;  2NVY L;  3D4W A;  1HFG A;  4DV2 Q;  2XIW A;  3TN2 A;  4FYD A;  1EWH A;  2CH4 W;  4YHH Q;  2F3W A;  3DWP A;  1EQQ A;  1UEA B;  2A1A A;  2HQE A;  2QKI C;  4O2D A;  4DAV A;  1ENC A;  1CZG A;  4WFN 3;  3CW2 C;  4BWG B;  4FXK C;  5J39 A;  4JAD A;  2Q2H A;  4DR4 Q;  3SS2 A;  1FNV A;  3LWU A;  4AHY A;  4QUC A;  4POF A;  3J80 c;  4R9W A;  1ET6 A;  1YNN D;  1K83 B;  5FKA C;  4A3M G;  1B9M A;  2WAC A;  5KRU A;  5EBD A;  4LF6 L;  3LWP B;  1V1Q A;  1EQR A;  1YJ9 A;  2HT1 A;  1RL2 A;  1UWV A;  2H1E A;  3AB9 A;  3PGZ A;  4CDE C;  1CI3 M;  1B2J A;  2VW9 A;  1OWB A;  1EYG A;  2M4V A;  3KUP A;  2KCC A;  3ULL A;  2BA0 A;  1B70 B;  4HED A;  3S1Q B;  2KOL A;  3X3M A;  4X62 L;  4IUV A;  3UDX A;  3HOW G;  3NE5 B;  3GP7 A;  3Q24 A;  4B9X A;  2K50 A;  4KKS A;  1RDV A;  1Y69 U;  1L1O C;  4BBR B;  3QQC E;  4KKT A;  3HOW H;  2RF4 A;  4A3M L;  2B29 A;  3FP9 A;  4BY1 H;  2R7Z G;  4FO2 A;  1IKL A;  2B2W A;  1SNM A;  2PI2 E;  4DU9 A;  3IL8 A;  3DEO A;  4PMC A;  2R7Z H;  1F2L A;  3MXP A;  4JI5 Q;  3CHB D;  4S3S A;  4DR3 Q;  5KYI A;  4I7Z C;  4CKC A;  2H5X A;  1K8M A;  4A3G B;  4DR2 L;  4DV0 Q;  3HOW L;  1GO3 E;  2NVQ L;  1KHI A;  3A55 A;  2Z6B A;  5CBA E;  1PXU A;  4H7B A;  3S14 L;  1AW7 A;  1J9O A;  2J0T D;  3I4L A;  3KLR A;  4V19 0;  1S3O A;  3GTO B;  4JC0 A;  1BF4 A;  5IE8 A;  4HJ8 A;  2R7Z L;  1P16 A;  3GV3 A;  5KIX A;  1YK4 A;  2RDG A;  1X3P A;  2QIL A;  1B9N A;  2NVT H;  4LJZ C;  3RZO H;  4R1J A;  1NR2 A;  4ULL A;  1XMO L;  5I6Y A;  2AHO B;  2F1M A;  3ZG6 A;  1ET9 A;  1LKP A;  1JOK A;  4NB3 A;  1T9P A;  3LNL A;  1IRO A;  2XWJ B;  1FGU A;  4OL7 A;  3TS2 A;  2KEE A;  4X65 L;  2N3S A;  3KYX A;  3J81 E;  3O13 A;  2CKC A;  1LAC A;  1EL0 A;  2NVT L;  4P72 A;  3RZO L;  4M1U B;  1SN8 A;  1A3V A;  1NUC A;  2BA1 A;  3VR5 A;  1SJH D;  4JBK A;  4A3I H;  4A3K G;  4JI6 L;  4C3J B;  5K36 G;  2RHS B;  1XTC D;  1YV1 A;  3S1M B;  3E6Z X;  2UUC L;  1ENA A;  2XWB B;  4MIU A;  5M5X L;  4A3K H;  2KUM A;  3IAY A;  1HZC A;  3P75 A;  5K36 H;  1IHZ A;  5ELB A;  4DV1 Q;  2WII B;  3J7Z C;  2OEO A;  3HKZ G;  4DAY B;  1N8R C;  1CAD A;  1IYV A;  4GKK Q;  3FMC A;  3RZ6 A;  1FNU A;  1E2V A;  1TQO A;  4ID6 A;  1LTS D;  2Y0S G;  2PNR C;  4OWT B;  2EIF A;  4A3K L;  2GA4 B;  2A6E D;  1CQF A;  1L0X B;  1NNX A;  3KF6 B;  3KOJ A;  4KLK A;  3RLN A;  5IT9 c;  1GHK A;  4RA8 A;  5DLQ E;  5GAD C;  1XNQ L;  1I3Q H;  2EXD A;  3CAM A;  2IPK D;  1B2O A;  1C4Q A;  4AYB E;  4ZLT F;  3M7N A;  4GS7 D;  2HIV A;  3H0G B;  2RKS A;  2G9D A;  1G51 A;  2R7F A;  3KYV A;  2UUB Q;  1S2Z A;  2BE5 C;  5IYC G;  2O5J C;  1JJG A;  4U67 3;  2PCF B;  1I3Q L;  2AUJ D;  3AFQ A;  5FLX E;  3FEW X;  3H6M A;  2N8N A;  3RZD L;  1HPC A;  1T9O A;  2JA9 A;  1MJE A;  2O5I C;  1LTL A;  5C3E H;  1CQV A;  2FJ2 A;  1QB5 D;  1BBW A;  3H15 A;  3DLL A;  4WJ4 A;  1ESR A;  1E22 A;  4KY6 A;  4P75 A;  2WP8 J;  2IX0 A;  1KQS A;  1PTO B;  5CV4 A;  1W6K A;  2OQK A;  1PA6 A;  4C2M 1;  3H3V M;  1SXT A;  4IAL A;  4KJN A;  3R8B A;  1HNX L;  4OX9 Q;  3NTI A;  5J3B A;  3VYU A;  5IYC L;  2E74 C;  1HA6 A;  4DNI A;  3NQT A;  3TZU A;  2RBM A;  3GTG H;  3RMH A;  4YCU A;  1KLG D;  2Z0S A;  4PMB A;  1YHB A;  3A8K E;  1B3Q A;  4C1N I;  3Q0A A;  3A5U A;  1NSN S;  1F2Z A;  4DNT B;  3PIO 3;  4JI0 L;  4DN4 M;  5H1S E;  4GN5 A;  4DR5 L;  1BBU A;  1CZW A;  1T5E A;  2Q8R E;  4JI4 Q;  1MHW C;  3Q22 A;  3EFX D;  4E6Y A;  3GTG L;  1XXG A;  3I56 A;  1B53 A;  3H97 A;  4LAA A;  4L5R C;  1B2T A;  5MF6 A;  1Q8K A;  2CH4 A;  2I46 A;  4IUN A;  1GXD C;  4Q0F A;  2JEB I;  4P74 A;  3P7J A;  3GDE A;  2K28 A;  4CBV A;  1SMM A;  4KHZ A;  2WIN B;  4IJH A;  5DM7 1;  4QIW E;  5IYB G;  4XT3 B;  1RD9 D;  1Q7Y C;  1B71 A;  2ERS A;  1QCB D;  4A3M B;  4JCV E;  2PQA A;  1LAB A;  5IYB H;  2L0Z A;  4QQB X;  2DGY A;  4C3H G;  1OXT A;  5IWA L;  2AUK A;  1BXT A;  2ID0 A;  4YWL A;  3K8A A;  4OWX B;  3J81 c;  2FXQ A;  1CSQ A;  3J80 i;  2ASB A;  4C3I B;  2NVQ B;  3DM1 A;  5IYB L;  3S14 B;  2F3V A;  2C35 B;  2HDM A;  2JXM B;  2Q8I B;  1SE4 A;  5ELE A;  3BU2 A;  1JB3 A;  4C3H L;  3ITP A;  1XNQ Q;  2KVM A;  3UE0 A;  2HCC A;  4DR6 L;  4IFD G;  5C0X H;  4X3S A;  4AIM A;  2JA7 H;  2WAQ E;  1QVC A;  2CCZ A;  2X69 A;  2NVX H;  1QOH A;  1UE5 A;  2N78 A; 
#chains in the Genus database with same CATH homology
 5M5Y H;  1SMX A;  3PV0 A;  1V9P A;  3F2C A;  5LMN L;  4L5T A;  3U50 C;  4XTC S;  4A3B H;  1Z92 B;  2K5H A;  2RCN A;  4B3R L;  1IYJ B;  3GTK H;  1PH5 A;  4IFD J;  5FLX c;  3RZT A;  1VQ6 A;  1K9M C;  3KYH C;  3KJP A;  5MFZ A;  1BQ9 A;  1NJI C;  5AJ3 L;  3S2D H;  1X3G A;  1VQ7 A;  1JE5 A;  2GN5 A;  1CUK A;  4DUZ L;  2AKW B;  2PVX A;  1JYB A;  4DV7 Q;  1SE8 A;  1YUX A;  2A19 A;  5C4X G;  3UDI A;  3I4N H;  2IY5 B;  5M5W H;  5H1S c;  5GAE c;  3BZC A;  3S16 H;  1I94 L;  5C4X H;  2KBN A;  2ZM6 L;  1VQG A;  5HY6 A;  1ODH A;  4LFB L;  2AWN A;  3K7U C;  1VQD A;  1PH7 A;  3KDF A;  4O0A A;  4IOC A;  3H3V H;  2JA5 G;  3HOV G;  5JJL A;  5LMU Q;  1VQF A;  2R7D A;  3TRE A;  5GRO A;  2OWO A;  3HOV H;  3RR5 A;  1QVF A;  1TXY A;  1E8J A;  4AYB G;  4DR6 Q;  1FHH A;  1TWF H;  3A44 A;  4AI3 A;  1YK5 A;  1PH3 A;  2Q2T A;  1QZH A;  1YUZ A;  1HNZ L;  2XTI A;  1D8L A;  1Z47 A;  2PYA A;  5GAG c;  3WWN B;  4HJ9 A;  4K0K L;  3A74 A;  1HH2 P;  4JI7 Q;  2B63 H;  1M1K C;  3S1N H;  1BE7 A;  4GKJ Q;  4R4I A;  1CKN B;  1YNX A;  2XJU A;  4L5S A;  3K0X A;  3HOX H;  3GTM H;  4A3F H;  4GLA C;  5AJ3 Q;  4ME3 A;  1DVB A;  3CC4 A;  2AWO A;  5IP9 G;  2HHH L;  2CWP A;  4JI8 L;  1A63 A;  1C7Y A;  4QGU A;  3J81 i;  1XPR A;  2K75 A;  2UXD L;  1L2F A;  3E9H A;  4B3T Q;  4GNX B;  1C9O A;  5C44 G;  3ERS X;  2VQF L;  1U0L A;  1OXX K;  3F2B A;  4JV5 L;  1G29 1;  4YY3 Q;  5ELO A;  1W3S A;  1K3R A;  1VQN A;  4R4T A;  3NEM A;  2WAQ G;  1C09 A;  4TVM A;  1Q1B A;  2HQL A;  1N32 Q;  3L2P A;  1PV4 A;  2ZJR A;  3STB D;  1HNZ Q;  3I7F A;  1V43 A;  2Z3R B;  1KIX A;  1VQ9 A;  5MGN A;  4IPH A;  3E9I A;  4K0K Q;  4UY8 1;  1GVP A;  3JC6 2;  1R0F A;  4OO1 G;  1Q1E A;  5E7N A;  3KYY A;  1UE6 A;  4JI2 L;  4PZ6 A;  2VL6 A;  3D0F A;  5IYD G;  4NXM Q;  3S2H H;  3GTQ H;  3PKJ A;  2DUD A;  5GAD c;  1TWH H;  3G6E A;  2XJP A;  1HR0 L;  4B3M L;  4LF4 L;  1PH1 A;  1IBM Q;  3J7Y 1;  4JI8 Q;  1SMW A;  2PMZ E;  2OTL A;  3VDY A;  1B13 A;  2K52 A;  4AR6 A;  5M3F G;  3PUZ A;  4R4C A;  5JJK A;  1AH9 A;  3ICE A;  4JBJ A;  5GQO A;  4GN3 B;  1VQ5 A;  2F4V L;  4LF8 Q;  2ZJP A;  2MS3 A;  4AHZ A;  4P71 A;  4LFA Q;  2VUM H;  4HJ5 A;  2E5L Q;  2VQF Q;  1N34 L;  3PKI A;  3PIP A;  1OWC A;  3CME A;  2IHE A;  1PHJ A;  4JI1 L;  3QVD A;  1JB7 A;  4AR3 A;  1D7Q A;  1SRU A;  3LGJ A;  3Q8D A;  2CWA A;  3CCE A;  2E2I H;  1X54 A;  2CR8 A;  2K2D A;  6RXN A;  4RG1 A;  3KYW A;  1JT8 A;  2E8G A;  1QVG A;  3PSI A;  3KF6 A;  3M3Y H;  4JI2 Q;  2R93 H;  3A0J A;  3PIP 1;  1CKM A;  1P8L A;  4DR7 L;  1QUQ B;  3NBH B;  4IFD I;  1R0J A;  3RN5 A;  4ZN3 B;  4BY1 G;  2XJR A;  1NNQ A;  1FJG Q;  2YYZ A;  1K8G A;  4AHW A;  3S1R H;  3S15 H;  1HNW L;  4EX5 A;  1KXL A;  2VQE Q;  4X64 L;  4AQY L;  4QY7 A;  2XGT A;  4C2M H;  2I5L X;  4JI3 L;  1WCM H;  3I4M G;  4LF7 L;  3I4M H;  4JAF A;  1Y14 B;  4A3I G;  1KAW A;  2PPT A;  2YTY A;  1L1O B;  4A3J G;  1Q82 C;  3PUY A;  3STB C;  1EIY B;  4TVA B;  3J7Z 1;  3K35 A;  4A3J H;  4B3S L;  1EUJ A;  1JMC A;  4IPG A;  2ERJ A;  2R92 H;  3GTJ H;  4AI2 A;  3HKS A;  1XPO A;  4JOI C;  3TEH B;  3G71 A;  4LF6 Q;  1NMG A;  1KC8 C;  4B8C D;  4DV3 L;  3GTL H;  2A6H D;  3TS0 A;  4BY7 H;  4LWC A;  4X62 Q;  3UE1 A;  5C3E G;  1HZ9 A;  2BH8 A;  5FJ8 H;  4GN4 B;  3U4V A;  1Y1W H;  2YTX A;  2JI2 A;  3MEF A;  1HNW Q;  1GKH A;  2NYD A;  2ZTE A;  3G48 A;  2GVA A;  4DR2 Q;  1LM0 A;  4BBS G;  1S72 A;  2JA6 H;  4DV5 L;  4BBS H;  2OCE A;  4UP7 A;  1WYD A;  1XMO Q;  2XJQ A;  2KN9 A;  1UE1 A;  1H95 A;  4YWM A;  4X65 Q;  1LKM A;  2F3I A;  1N9W A;  1YI2 A;  3E0E A;  4JI6 Q;  2ZTD A;  5EAY A;  2UUC Q;  3M4O H;  3CCJ A;  4JBW A;  1E7Z A;  1IRN A;  2QA4 A;  1VQO A;  4UPA A;  3KFU A;  1RDG A;  4TQU S;  5C0X G;  2JA7 G;  4FDB A;  3PCO B;  1PYS B;  4AHX A;  3EIV A;  4NPS A;  5DM6 1;  2XJT A;  4QJF A;  1OXS C;  1YVC A;  5BR8 L;  4A3B G;  1VQJ A;  2OTJ A;  1J6Q A;  3CPW A;  4LUV A;  2NN6 G;  1ASY A;  3T1Y L;  5C0X J;  1FHM A;  3MSU A;  4WFN 1;  3RN2 A;  4LHN A;  3FHW A;  1HNX Q;  4AH6 A;  1SLJ A;  1CKN A;  4OO1 I;  5IP7 H;  1N33 L;  1I50 H;  3K7A H;  3KJO A;  4MTN A;  2JEA I;  4JI0 Q;  4DR5 Q;  2WB1 E;  1MIU A;  4OON A;  4QL5 A;  4DV4 L;  3FKI H;  2V0F A;  2J9U B;  3I4N G;  4A3E G;  1KRS A;  3S17 H;  4J15 A;  4DKA C;  3ULJ A;  4A3E H;  3TQY A;  1MKH A;  3L7Z C;  3CQZ H;  1VQ8 A;  4XXB B;  2GVB A;  1KD1 C;  1VCX A;  4A3C H;  1R9T H;  3CP0 A;  3KLW A;  5FLM G;  5IWA Q;  3KYU A;  4LFC L;  4GNX A;  3PF5 A;  1Z9F A;  5FLM H;  4ALP A;  1QYB A;  1U5K A;  2B3G A;  4DPG A;  2ATW A;  4JBM A;  1BVS A;  4A4I A;  2A8V A;  4GLX A;  1X55 A;  3ER0 A;  4DAM A;  1VCI A;  5ELN A;  2PQA B;  2JJQ A;  1VQE A;  2RHQ B;  2ALY B;  1QZG A;  1K8A C;  4IOA A;  3OTO L;  5LMN Q;  3HOY G;  1NXE A;  3D31 A;  1YJN A;  1UEB A;  3HOY H;  1YIJ A;  4B3R Q;  2B63 G;  4LF9 L;  2MNA A;  1MJC A;  3F1Z A;  1YHQ A;  3PO2 H;  1IXR A;  3W1B A;  4LUZ A;  3HOX G;  4A75 A;  4JAG A;  1N33 Q;  4A3F G;  3I55 A;  2E2J H;  4LF5 L;  2WFW A;  3T1H L;  2IX1 A;  3W5O A;  4PMW A;  4DV4 Q;  3JC6 3;  2YU9 H;  4U67 1;  4DUZ Q;  4JAE A;  3G4S A;  4POG A;  1WJV A;  4PZ7 A;  1S24 A;  5GAH C;  1I94 Q;  2ZM6 Q;  1JJ2 A;  2XJS A;  1YBY A;  1PH4 A;  4LFB Q;  1OTC A;  1BRF A;  4OXP A;  1PVO A;  2K14 A;  1R0I A;  3PIO 1;  3NFP I;  2OQ0 A;  1Q86 C;  2DSX A;  1K83 H;  1VQI A;  4JG2 A;  2Z6K C;  4XGH A;  2KKD A;  1WI5 A;  3S1Q H;  2UXC L;  4HJA A;  3RNU A;  4DUY L;  4BBR G;  3OTO Q;  1QCV A;  2I5M X;  4BBR H;  1N36 L;  2JI1 A;  1RIP A;  2UU9 L;  1CAA A;  4UP9 A;  4A3G H;  1XMQ L;  2MO0 A;  3GTO H;  1QUQ A;  3M4Q A;  4RXN A;  4BA2 I;  2WB1 G;  4YHH L;  4LF5 Q;  4GOP C;  1FL0 A;  2UXB L;  1TWC H;  1IBL L;  1SRO A;  1YIT A;  5AI2 A;  2M6P A;  4DR4 L;  2VZA A;  3CCL A;  4HJ7 A;  2HHH Q;  1E1O A;  3RLF A;  2UUA L;  1A0I A;  2IHF A;  3PUX A;  2VY3 A;  4C3J H;  3CMA A;  3OW2 A;  3S1M H;  2UXD Q;  3J81 j;  2VUM G;  4GLV B;  2JK8 A;  3CCU A;  2I5H A;  4L5Q A;  3OYY A;  1XNR L;  1X6O A;  2N49 A;  1WOC A;  4JV5 Q;  3UDG A;  4KHP L;  3H0G G;  1BKB A;  1AE3 A;  1X56 A;  3P8B A;  5JEA G;  4TPU A;  3H0G H;  2ZTC A;  4GOP B;  4BXX G;  1LYL A;  2AMC B;  4GS3 A;  3CCM A;  2I0Q A;  4BXX H;  1L1O A;  1N36 Q;  3GD7 A;  3U4Z A;  2RDV A;  2D0O A;  1B8A A;  1GM5 A;  1YJW A;  1R0G A;  1XMQ Q;  5JEA J;  2R93 G;  4MZ9 A;  3TRZ A;  1EFW A;  2NZH A;  2M6O A;  5C0X I;  1VQL A;  3PUW A;  4DV6 L;  4DV1 L;  2UXB Q;  2KHJ A;  1IBL Q;  3B6Y A;  3KF8 B;  3AYH B;  1HR0 Q;  4GKK L;  4B3M Q;  4AI0 A;  4LF4 Q;  1G6P A;  1VQP A;  1YZ6 A;  1A8V A;  4V19 6;  2UUA Q;  3DM3 A;  2VNU D;  2NN6 I;  4A3M H;  2IT1 A;  2F52 A;  3AQQ A;  2ZJQ A;  2UUB L;  2F4V Q;  3P2A A;  4AR4 A;  1X9N A;  1RYT A;  1BQ8 A;  2C6A A;  3EBE A;  4IPC A;  1WCM G;  4C3I H;  2NVQ H;  1XNR Q;  3S14 H;  1N34 Q;  4JOI A;  4LNQ A;  4OX9 L;  4KHP Q;  4H02 A;  1FVI A;  4JI1 Q;  4Y7N H;  3VPB E;  2LCQ A;  1J5E L;  2MO1 A;  2H12 A;  1R0H A;  4JI4 L;  1S40 A;  2KCT A;  2K5V A;  2XJV A;  5LMN W;  1WFQ A;  1PYB A;  5M5X H;  4YCW A;  1DGS A;  3H3V I;  2R92 G;  2V0E A;  1B7Y B;  1RYQ A;  3M9B A;  1S30 A;  2NZO A;  3MXN B;  2CKZ B;  1Q46 A;  4K9F A;  2ES2 A;  4DR7 Q;  2L15 A;  4DV6 Q;  3PF4 A;  1PH9 A;  4BY7 G;  5RXN A;  1AE2 A;  2Q2U A;  2B5I D;  3LPE B;  5FJ8 G;  1Q12 A;  1Y1W G;  3NEN A;  3UDF A;  3F2D A;  4XIG S;  2M4Y A;  3RZD H;  5M3M G;  1XTD A;  3PWF A;  4KI0 A;  5M3M H;  7RXN A;  4X64 Q;  4AQY Q;  3K81 C;  3BJU A;  2GMG A;  2JA6 G;  2K4K A;  5IYC H;  2Q2I A;  3IRB A;  3CC7 A;  4JI3 Q;  2D62 A;  4PZ8 A;  1CKO A;  2EQS A;  4LF7 Q;  8RXN A;  3CC2 A;  2QL0 A;  1HZB A;  1BFY A;  1EWI A;  3CPF A;  1TWG H;  1K0R A;  1VQH A;  1E24 A;  3HOZ G;  1J5E Q;  4HIO A;  3HOZ H;  3GO5 A;  1CSP A;  1EOV A;  4UP8 A;  5GAH c;  1HJP A;  4DV7 L;  1C0A A;  4B3S Q;  2JA8 G;  1YEZ A;  2KEN A;  2V3B B;  1X3F A;  3WWV A;  2JA8 H;  1OXU A;  3ZJY C;  3JAM c;  3AFP A;  1X3E A;  3B08 B;  2A69 D;  2CFM A;  4C3H H;  4DV3 Q;  1VQK A;  1H7V A;  4APV A;  5LMU L;  2ZIX A;  3A5Z B;  1IU6 A;  1A62 A;  2C6B A;  4G6B A;  5EIO C;  4LHL A;  4X66 L;  3CCS A;  1NXG A;  1Q81 C;  1E3P A;  3K80 C;  5IP7 G;  1LKO A;  3U58 A;  3GTP H;  3JC6 6;  4AR5 A;  3CCR A;  2PNH A;  1NE3 A;  4HIK A;  3EN2 A;  4HID A;  1NMF A;  1ZRP A;  1EIF A;  4DV5 Q;  2PVE A;  3CXC A;  2KCM A;  2D0P A;  3FKI G;  2VS1 A;  1Y1V G;  5JJI A;  4JI7 L;  4LUO A;  2PSM C;  1IW7 D;  5MFP A;  1Y1V H;  4GKJ L;  4Y52 H;  4WJ3 M;  2KHI A;  3PUV A;  4A3C G;  4RMF A;  1KRT A;  3CCQ A;  3HOU G;  4DR1 L;  2LXK A;  2LSS A;  1L0W A;  2PI2 A;  3HOU H;  4A3L G;  4A3L H;  1PH2 A;  1RWD A;  3ULP A;  5MLC 3;  2V1C C;  2YV5 A;  2A68 D;  4B3T L;  2QEX A;  1JJC B;  4YWK A;  1IL2 A;  3F8T A;  1PFS A;  1VQM A;  5BR8 Q;  2JA5 H;  4YY3 L;  3PZA A;  1HR0 W;  1K73 C;  1SMU A;  4X66 Q;  3T1Y Q;  1NY4 A;  4DK6 C;  1N32 L;  3J7A 5;  3PO2 G;  1T9H A;  1TWA H;  5C4J H;  3S24 A;  3B0A B;  1HZA A;  3PIO A;  4A93 G;  3WWL A;  2CKA A;  1ASZ A;  1I5F A;  2HIX A;  4A93 H;  4GNX C;  2E2H H;  1RB9 A;  3CF5 A;  2Z6K A;  1DX8 A;  1NBW A;  3W1G A;  3AEV A;  4NXM L;  4JYA L;  1E1T A;  2QGQ A;  4R4Q A;  1T9Q A;  5AI3 A;  3CCV A;  1NTG A;  5JVH 1;  4LFC Q;  1IBK L;  1IBM L;  4DR1 Q;  1VQ4 A;  3JAM i;  1VS0 A;  4A3D G;  2Z3Q B;  1X65 A;  5IP9 H;  4IJL A;  4MNO A;  4A3D H;  4IO9 A;  4NXN L;  2R6G A;  4GOP A;  4X6A H;  4R4O A;  4LF8 L;  1VZG A;  4LFA L;  2E5L L;  1VZH A;  5EIN C;  4BA1 I;  5C44 H;  3BZK A;  3KDF B;  2YTV A;  3M85 A;  2K5N A;  1SFO H;  1VQB A;  1VQA A;  3I2Z A;  4A3G G;  4LF9 Q;  3HFZ B;  1OXV A;  2JQO A;  3NEL A;  5JVG 1;  3SGI A;  1VZI A;  4DV2 L;  1SR3 A;  4P73 A;  1XJV A;  2CQO A;  2MQH A;  1M90 C;  3PO3 G;  5AN9 H;  3T1H Q;  4UY8 C;  2LXJ A;  4OWW B;  3PO3 H;  2JI3 A;  3HKZ E;  3IU3 I;  1YHA A;  2Y0S E;  4JYA Q;  1XPU A;  2BE5 D;  2O5J D;  5IYD H;  1W2B A;  4DK3 C;  2MFI A;  4AI1 A;  4YCV A;  3RLO A;  1IBK Q;  5GAE C;  3RYG A;  1FJG L;  3L0O A;  2HR5 A;  1I6H H;  1LUZ A;  1VQC A;  3M4P A;  4LW1 A;  4NXN Q;  4JI5 L;  5M3F H;  4PG3 A;  4EQ5 A;  4DR3 L;  2VQE L;  1GD7 A;  5HGQ A;  5K2M E;  1PH8 A;  4DV0 L;  1O7I A;  2BH2 A;  4IPD A;  3MPS A;  2UXC Q;  2AYJ A;  4DUY Q;  1UE7 A;  1WJJ A;  1IZ6 A;  2JE6 I;  4ZN1 B;  5IY0 A;  1PH6 A;  2NVY H;  4A76 A;  4HIM A;  1IU5 A;  1KL9 A;  2UU9 Q;  3CD6 A;  5GAG C;  3I4O A;  4DV2 Q;  4YHH Q;  1EQQ A;  2A1A A;  4O2D A;  3CW2 C;  4JAD A;  2Q2H A;  4DR4 Q;  3SS2 A;  4AHY A;  4POF A;  3J80 c;  4A3M G;  4LF6 L;  1YJ9 A;  1V1Q A;  1EQR A;  2HT1 A;  1RL2 A;  1UWV A;  3PGZ A;  2VW9 A;  1B2J A;  1OWB A;  1EYG A;  2M4V A;  3ULL A;  2BA0 A;  1B70 B;  4X62 L;  3UDX A;  3HOW G;  2K50 A;  1RDV A;  1L1O C;  3QQC E;  3HOW H;  2RF4 A;  3FP9 A;  2B29 A;  4BY1 H;  2R7Z G;  2PI2 E;  2R7Z H;  4JI5 Q;  4DR3 Q;  2H5X A;  4DR2 L;  4DV0 Q;  1GO3 E;  1KHI A;  1S3O A;  4JC0 A;  5IE8 A;  4HJ8 A;  1P16 A;  1YK4 A;  2NVT H;  3RZO H;  4R1J A;  1XMO L;  2AHO B;  3ZG6 A;  1LKP A;  4NB3 A;  1T9P A;  3LNL A;  1IRO A;  1FGU A;  3TS2 A;  4X65 L;  2N3S A;  3KYX A;  2CKC A;  4P72 A;  1SN8 A;  2BA1 A;  4JBK A;  4A3I H;  4A3K G;  4JI6 L;  5K36 G;  2RHS B;  1YV1 A;  2UUC L;  4A3K H;  1HZC A;  4DV1 Q;  3J7Z C;  3HKZ G;  1N8R C;  4DAY B;  1CAD A;  4GKK Q;  3RZ6 A;  2Y0S G;  4OWT B;  2EIF A;  2A6E D;  3KOJ A;  3RLN A;  3KF6 B;  4KLK A;  5IT9 c;  5DLQ E;  5GAD C;  1XNQ L;  1I3Q H;  2EXD A;  3CAM A;  1B2O A;  4AYB E;  3M7N A;  4GS7 D;  2HIV A;  1G51 A;  2R7F A;  3KYV A;  2UUB Q;  1S2Z A;  5IYC G;  1JJG A;  3AFQ A;  2N8N A;  1T9O A;  2JA9 A;  1MJE A;  1LTL A;  5C3E H;  1BBW A;  3H15 A;  3DLL A;  4WJ4 A;  4P75 A;  1E22 A;  2WP8 J;  2IX0 A;  1KQS A;  2OQK A;  1PA6 A;  4OX9 Q;  1HNX L;  5J3B A;  4DNI A;  3GTG H;  4YCU A;  2Z0S A;  1YHB A;  3A5U A;  4JI0 L;  5H1S E;  4GN5 A;  4DR5 L;  1BBU A;  4JI4 Q;  4E6Y A;  3I56 A;  4L5R C;  5MF6 A;  1Q8K A;  2JEB I;  4P74 A;  3GDE A;  1SMM A;  4KHZ A;  4IJH A;  5DM7 1;  4QIW E;  5IYB G;  1Q7Y C;  1B71 A;  2ERS A;  4JCV E;  2PQA A;  5IYB H;  2L0Z A;  4QQB X;  2DGY A;  1OXT A;  5IWA L;  2ID0 A;  4YWL A;  3K8A A;  4OWX B;  3J81 c;  2FXQ A;  1CSQ A;  3J80 i;  2ASB A;  2C35 B;  3BU2 A;  1XNQ Q;  3UE0 A;  4DR6 L;  4IFD G;  4AIM A;  2JA7 H;  2WAQ E;  1QVC A;  2CCZ A;  2NVX H;  1UE5 A;  2N78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...