4YWMA

Pyrococcus furiosus mcm n-terminal domain beta-turn triple mutant pentameric ring
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
255
structure length
255
Chain Sequence
b'SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEAAEATPIFRKILEVNHIEPVSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 67
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ywmA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywmA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywmA01
2RCNA 2L15A 4DAMA 2IHEA 2JE6I 4JBJA 4P75A 3G71A 2CFMA 2CQOA 2Q2HA 2CWPA 3NELA 1VQKA 1HNWQ 4DV3L 3GTLH 3HFZB 4GNXC 1VQJA 5C0XI 4OONA 5JEAG 5C44G 2UXDQ 3J81c 3I55A 1XJVA 1IBKQ 1YK4A 2R6GA 2VZAA 3CF5A 3UDFA 1BKBA 2NVTH 3UDGA 4POGA 1YHAA 7RXNA 2MQHA 3KYWA 3JAMi 4A3GH 2ID0A 5C3EH 3H0GG 2B3GA 3AFPA 1N34Q 1M90C 1MJEA 1HR0W 1B70B 3M85A 2N78A 3CPWA 3I7FA 4Y52H 2Q2TA 1E1OA 2LXKA 5C3EG 3FKIH 1K83H 4UPAA 2R7ZG 3A0JA 4DV5L 1ASYA 2EQSA 2OQKA 1U0LA 1XMQL 2ZTEA 5E7NA 3S14H 4LF8L 3MEFA 3TS2A 1TWGH 3K8AA 4LUZA 3W5OA 2GVBA 4B3TL 2YYZA 1JJGA 1YUXA 3GTGH 1BBWA 2E5LQ 2HHHQ 3E0EA 3J7A5 3J7ZC 2AWNA 1KQSA 3I4MH 2H5XA 1KRSA 4DV1L 2CCZA 4BBRG 3PSIA 1YJ9A 3ULLA 2OTLA 2A8VA 4AR5A 3EBEA 2ZJPA 5M3MG 3HOWH 3GD7A 2JA9A 2R93H 3GTQH 3D0FA 2MO0A 2LSSA 3Q8DA 3GTKH 4JYAQ 1VQLA 3PO2G 1WI5A 4KLKA 2R93G 4JV5L 1IYJB 4QJFA 2UU9Q 4LW1A 3KYHC 1SN8A 3U58A 3HOVG 4R4OA 2JA7H 5GAEC 2R92H 4J15A 1LKMA 1X3EA 2RHSB 3EN2A 4IPDA 2ATWA 1SMMA 1EQRA 1Q1EA 4DPGA 2VUMH 4MNOA 4AR6A 4C2MH 4GKJQ 2UXCQ 4DV7L 3CCJA 3ULPA 4P71A 2LCQA 1IXRA 2MO1A 2Z6KA 4R4CA 1E1TA 4PMWA 1HZ9A 1HNZL 3ICEA 1XMOQ 3KF6B 1JJCB 1YEZA 2IHFA 2N3SA 3CCMA 4DV6Q 3S1NH 5M5YH 1JJ2A 4JBKA 5AJ3Q 3L0OA 2YTXA 4A3JG 1N34L 3RZOH 1FGUA 4HIOA 4OO1G 1A63A 4A3IG 3S16H 1E8JA 1I5FA 3WWVA 1N32Q 2E8GA 4RG1A 1CSPA 3LGJA 3OTOQ 4HJ9A 1B2JA 4H02A 3CP0A 3VDYA 2B63H 1CAAA 2F3IA 1KIXA 1R9TH 4LFAL 5IE8A 1UEBA 1VQEA 3PF4A 3M3YH 4BY7H 3HKZE 4BXXG 3F8TA 3PUVA 4X62Q 1XPUA 1K3RA 4XTCS 3T1HL 3K7UC 1Q7YC 4A76A 1YBYA 1ZRPA 1FJGL 1T9HA 4EQ5A 2D62A 4A3LH 3U4VA 3NEMA 3TEHB 4YHHQ 1PA6A 2F4VL 4AQYL 2K50A 4DAYB 4JI3L 1LYLA 1OXXK 1SLJA 1VQNA 1CKNA 3J81i 3ERSX 2I5MX 1X54A 4DV3Q 5K36G 3PWFA 2HIVA 2ZM6L 1K8AC 1J5EL 4WJ3M 4DR3L 1YHQA 5ELOA 4DR5L 4MTNA 1VCIA 1I94L 1P8LA 1IBML 1KAWA 4R4IA 2OCEA 4LFCL 4YCVA 1HR0L 1H7VA 5C0XG 4JG2A 4BA1I 3S1MH 2EIFA 1PH2A 4B3ML 4AR3A 2DSXA 1VQCA 1Y14B 2PMZE 4DV5Q 3M4OH 3RNUA 1XMQQ 2GMGA 2NZOA 2LXJA 3PUWA 4LF8Q 4DK3C 4A4IA 2AKWB 2N8NA 4B3TQ 1BRFA 3TRZA 3S24A 4GLXA 1RWDA 4BBSH 3PCOB 4MZ9A 2WB1E 3CMAA 1X65A 4O0AA 1I50H 3FHWA 4C3HH 3HOZH 2VL6A 4YWMA 1GD7A 2BA0A 4A3BG 4LUVA 4BBSG 1YITA 5HGQA 4NXNL 4DK6C 4A3MH 2E2IH 1X6OA 2WAQG 1OXSC 2VS1A 2A1AA 1YIJA 2YTVA 1QUQB 2JA8G 1G6PA 2HR5A 1X55A 1WCMH 3E9IA 3W1BA 1XNQL 4JV5Q 3CCLA 1YV1A 1TWFH 4TQUS 1VQIA 1UE6A 4R4TA 2VQEL 1WCMG 4BY1G 2JK8A 4AYBE 1PH7A 4YHHL 4Y7NH 4A93H 1Q82C 4OX9L 3E9HA 3S1RH 2BA1A 1NNQA 4K0KL 2VY3A 3BZKA 5C44H 2I0QA 1E24A 5FJ8G 4YWKA 2ZJQA 3GTOH 4A3CG 4B3RL 4DUZL 1R0IA 5IYDG 4RXNA 4DV7Q 4DR6L 1C0AA 4JI0L 4QGUA 1HNZQ 4IOAA 2K14A 3M9BA 1N33L 1BQ9A 1FHHA 2V3BB 3G4SA 2RF4A 3CW2C 3H0GH 3OYYA 2VQFL 3CXCA 3RN5A 1CKOA 4KI0A 3UE0A 3FP9A 1X9NA 4DR2L 3RZTA 2F52A 1MJCA 4YY3L 4HJ8A 5RXNA 2WP8J 1RB9A 4R1JA 2R7ZH 4DV4L 5IY0A 2JA6H 1PVOA 1TWAH 3RR5A 4LFAQ 4HIKA 4AR4A 2K75A 3F2BA 2JA6G 6RXNA 4GLVB 3W1GA 3F2CA 2R7DA 3NBHB 4LF4L 3T1HQ 3AEVA 1BQ8A 2GN5A 3KYYA 5M3FH 3HOXG 5J3BA 1FJGQ 1HZBA 4BBRH 1IU6A 1VQ7A 2F4VQ 5M5WH 5M3FG 2YTYA 5M3MH 4AQYQ 4A3FG 3PIPA 1VQ6A 3CD6A 5C0XJ 1NE3A 2I5HA 4YWLA 1CKMA 1SRUA 1PYSB 1QUQA 2AMCB 2NVYH 4UP9A 5LMNL 2Z6KC 3IRBA 4AIMA 3PF5A 4JI3Q 3PO2H 3QVDA 3PUXA 4BA2I 2K2DA 3PIOA 3KF8B 1SE8A 2ZM6Q 1Q86C 1J5EQ 2KHJA 3RZDH 3H15A 3H3VH 4DR3Q 4DR1L 4A3DG 3U50C 1RYTA 1CKNB 2N49A 3HOVH 4IFDG 2OQ0A 2OTJA 1JYBA 4DR5Q 2K5HA 1QCVA 1I94Q 1HNXL 5JJIA 4DR7L 1OXVA 4X64L 1IBMQ 1R0HA 4LFCQ 4HIDA 1HR0Q 3KLWA 1SMWA 1J6QA 2UXBL 1FHMA 1G291 4X66L 4A3KH 3K81C 4WJ4A 1EWIA 5HY6A 4B3MQ 1Y1WG 1YUZA 1S24A 4NXML 4A3KG 1IU5A 5C4XG 4JI7Q 8RXNA 4IOCA 2Q2IA 4A75A 1XNRL 4A3CH 1RIPA 4A3JH 4A3IH 1O7IA 2NN6I 3CCQA 2XTIA 2ZTCA 4XIGS 1KHIA 1JB7A 4JI5L 2NVXH 4JOIA 1OTCA 1S72A 2MFIA 1C7YA 1KC8C 4NXNQ 1QZHA 4BXXH 3DLLA 1YHBA 1I6HH 2JEBI 2NZHA 3HKSA 1AH9A 1N9WA 2RDVA 3TQYA 3A74A 5BR8L 1LKOA 3A5ZB 4ALPA 3CCRA 5JEAJ 4A3EG 1U5KA 1XPRA 1XNQQ 2JA5H 5FLMG 3T1YL 2NVQH 1DX8A 5IWAL 1HJPA 3KOJA 4LWCA 2VQEQ 1C09A 1LUZA 4HJ7A 2JA5G 1S40A 4EX5A 3CCVA 3KJOA 4OX9Q 4QL5A 5LMNW 5AI2A 3L2PA 2OWOA 4LFBL 4IPCA 1NMGA 4K0KQ 2KBNA 1K8GA 1LM0A 2D0OA 5GAHC 1SFOH 1XPOA 2KN9A 4B3RQ 1GKHA 4DUZQ 1VQ8A 4LF7L 4DNIA 3M7NA 4DR6Q 4JI0Q 1N33Q 1TXYA 1NY4A 1PFSA 2D0PA 1OXUA 1VQHA 1NBWA 4PZ6A 1XTDA 2VQFQ 2K5VA 1C9OA 4GOPA 1VQ9A 4IJLA 4DR2Q 3G48A 2KKDA 1B7YB 5JJKA 2WFWA 1IRNA 4YY3Q 3KDFB 3A5UA 4JI8L 4DV4Q 1PHJA 1TWCH 1CADA 4GKKL 3BU2A 1E22A 1FL0A 4JI7L 4LF4Q 2JQOA 1VS0A 1RDVA 4IFDJ 4C3IH 4LF5Q 2ZTDA 4A3BH 4ME3A 1VQ4A 5IYCH 3KYVA 4OWXB 1UE5A 1PH9A 1VQFA 1X3FA 3J80c 1SMUA 1MIUA 3GTMH 1LKPA 5IYCG 1B71A 4IPHA 5LMNQ 2JA8H 4X6AH 4LF9L 3PV0A 3UDXA 3AQQA 3B6YA 3CC4A 4OWWB 3I56A 3STBC 4JBWA 1PV4A 3CCSA 4BY1H 4IJHA 4DR1Q 2KENA 1VCXA 1WYDA 5LMUL 1HNXQ 1GVPA 1EQQA 4OO1I 3MXNB 4DR7Q 4X64Q 3S15H 5FJ8H 2FXQA 4AH6A 5GADC 2UUAQ 4LNQA 3KFUA 1V1QA 1P16A 5IYDH 2UXBQ 4X66Q 2K4KA 3ULJA 4LF6L 2IT1A 1Z47A 1BE7A 1T9OA 2WAQE 1NTGA 2UUBL 3S1QH 1B13A 4LUOA 3STBD 5IP7H 1W2BA 1EFWA 2PYAA 2E2HH 4DV0L 1QVCA 4L5QA 1XNRQ 2V1CC 3GTJH 1Y1VH 1NMFA 4DR4L 1TWHH 5IP7G 1UE1A 2RHQB 3KDFA 1EIFA 4HJAA 2E2JH 1UE7A 2ALYB 1Y1VG 2PQAB 5FLXc 1YI2A 4JI5Q 1QVFA 4X65L 3CC2A 2PVEA 1KD1C 2I5LX 4GN3B 4JI4L 4B3SL 2CKZB 1I3QH 4QIWE 1EYGA 2EXDA 2NN6G 1WFQA 1L0WA 3AFQA 4YCUA 4JC0A 3G6EA 4DUYL 4JI1L 3K0XA 5BR8Q 3HOXH 3KJPA 3S2DH 3A44A 2PVXA 1HH2P 1LTLA 1N36L 2A19A 3T1YQ 4LF5L 3RZ6A 5IWAQ 4A3FH 2KHIA 1AE3A 1E3PA 1SR3A 1VQOA 3RLFA 2PNHA 3J81j 1A0IA 4LFBQ 4A3DH 3S2HH 1BFYA 3CCEA 1VQPA 1L1OA 4NPSA 4JI6Q 2VNUD 1S30A 1V9PA 2HIXA 2Q2UA 1YZ6A 4LF7Q 1IBLL 1A62A 4DKAC 4A3GG 4KHPL 4OWTB 3MPSA 2HT1A 2C35B 4PZ8A 4UP7A 2MS3A 3I2ZA 3RLOA 4DV2Q 1R0GA 4JOIC 4HIMA 3CAMA 1YK5A 3FKIG 4KHZA 4JI2L 2UUAL 5GROA 4GNXA 5M5XH 1GM5A 2B29A 4JI8Q 3PUZA 4GN4B 4GOPB 1Y1WH 5C4XH 2GVAA 3BZCA 4GKKQ 1UWVA 1R0FA 3DM3A 4TVAB 1EIYB 1PH4A 1IL2A 1KL9A 3I4MG 1OXTA 1SROA 5DLQE 4UP8A 2PQAA 3HOUH 1JE5A 1RDGA 3AYHB 4NXMQ 2PI2E 1PYBA 3J80i 3RLNA 3HOWG 3HOUG 2QL0A 2JEAI 1Q1BA 3K7AH 1JT8A 3RN2A 1B2OA 1VQDA 5H1SE 4PZ7A 1BVSA 1CSQA 2HQLA 4A3EH 4LF9Q 5IYBH 1D8LA 2BH8A 3GTPH 5FLMH 2AWOA 1AE2A 3RYGA 3I4OA 2IY5B 1L2FA 1KXLA 2JA7G 5IYBG 4HJ5A 1GO3E 3M4PA 1T9PA 4GOPC 2R92G 3HOYH 1HNWL 1K9MC 1WJJA 3HKZG 4O2DA 1YJNA 4GN5A 5LMUQ 1NJIC 1Q8KA 2UXDL 1KRTA 2VUMG 3HOYG 1IROA 3EIVA 2KCTA 1IBKL 1IZ6A 2K52A 4P73A 1WOCA 3L7ZC 1R0JA 4LF6Q 3OW2A 4JI6L 4L5RC 1H95A 4R4QA 2DGYA 4NB3A 3JAMc 4P74A 2R7FA 4APVA 4IPGA 2UUBQ 3ZJYC 2ZJRA 2QA4A 3CCUA 4DV0Q 3TS0A 4QQBX 2K5NA 4DR4Q 4DV2L 4YCWA 3PZAA 3F2DA 4OXPA 3CC7A 1VQ5A 3BJUA 2UUCQ 2B63G 3D31A 1ASZA 1VQBA 4BY7G 3CQZH 3M4QA 4X65Q 5JJLA 1YVCA 2E5LL 2HHHL 1CUKA 4B3SQ 4JI4Q 1B8AA 1X56A 1Q46A 4A3LG 5EAYA 4IFDI 4DUYQ 3SS2A 4JI1Q 5GAGC 4JBMA 5IT9c 1HZAA 2MNAA 2Z0SA 4P72A 1PH5A 3H3VI 3GO5A 3JC66 3PO3G 1S2ZA 3UE1A 1N36Q 4JYAL 4FDBA 2PI2A 1QZGA 4GLAC 2UU9L 1EOVA 4IO9A 4PG3A 1QVGA 2ASBA 2IX1A 4C3JH 1V43A 1PH1A 2JJQA 3F1ZA 1DVBA 2AHOB 1BBUA 2WB1G 5GQOA 2M4YA 2VW9A 2Y0SG 3KYXA 1PH8A 1K0RA 1IBLQ 1RL2A 4KHPQ 1T9QA 1N8RC 1L1OB 3CPFA 4GKJL 2UXCL 1G51A 4POFA 1DGSA 3ER0A 1A8VA 1QYBA 3KF6A 1FVIA 3I4NH 3JC63 1VQGA 1XMOL 1M1KC 2XGTA 4JI2Q 3I4NG 4AYBG 5ELNA 1W3SA 3KYUA 2CWAA 4DV6L 1VQMA 5AJ3L 2ES2A 2DUDA 1Q12A 2YV5A 4K9FA 1Q81C 4GNXB 1YJWA 4DV1Q 5IP9H 1N32L 3JC62 3OTOL 1YNXA 2Y0SE 3K80C 1X3GA 3PGZA 2BH2A 2KCMA 3NENA 5IP9G 1JMCA 3HOZG 5AI3A 4L5SA 1D7QA 2UUCL 4X62L 4GS3A 3TREA 4A3MG 4UY8C 1HZCA 1VQAA 4JCVE 1SMXA 3CMEA 1L1OC 2YU9H 1MKHA 1S3OA 4QY7A 3U4ZA 4L5TA 2QEXA 4RMFA 3SGIA 3PO3H 1K73C 3GDEA 1EUJA 1PH6A 3S17H 3PUYA 3UDIA 1Z9FA 2QGQA 2IX0A 1PH3A 1E7ZA 4TPUA 5C4JH 4A93G
chains in the Genus database with same CATH superfamily
2RCNA 3K6OA 4DAMA 2IHEA 3S15B 2CFMA 2CQOA 2Q2HA 3EROA 4K14A 3MSUA 3J80L 4GNXC 1VQJA 4XQNA 1DM0B 4XYQA 3LWVB 2R6GA 3CF5A 3R8BA 4POGA 3BZDB 2MQHA 3KYWA 3JAMi 4A3GH 1D2BA 4WORA 3M85A 2E2JB 3CPWA 2C6BA 5CV7A 4C1NK 5KNBA 2Q2TA 4UPAA 3TMEA 2E2IL 2KJXA 2EQSA 1U0LA 2IWHA 1I3QB 4LF8L 3TS2A 2EPBA 5DAUA 2YYZA 2OT2A 2YU9L 1BBWA 1DOLA 3H9CA 3EVQA 3WOFA 1KQSA 1BCPF 5M3FB 1K3BC 2ZJPA 5CGKA 3D0FA 4LHLA 4JYAQ 1PRTF 3PO2G 4KLKA 4JV5L 1IYJB 2K05A 4LW1A 3SHLA 3IAYA 4K5WA 4FF2A 2XN9C 1VMCA 4J15A 1LKMA 5C3EL 2RHSB 3KLSA 3X3NA 1JOQA 4DPGA 1QWYA 3FKIL 4R4CA 2LCQA 1IXRA 2QDLA 4PMWA 1E1TA 4RH6A 1HZ9A 3ICEA 5C4XB 5KGUA 1TWGL 3S1NH 5M5YH 1JJ2A 3BDLA 2I07B 4A3JG 4BBRL 4OO1G 3NTIA 1N32Q 1EZ8A 4RG1A 4HJ9A 3OTOQ 1WD1A 4H02A 2F3VA 3VDYA 3A8JE 4JW0A 1JC7A 2QW7A 5EINC 5IE8A 1UEBA 1KIXA 1VZHA 3F8TA 5EKKA 3GP7A 3T1HL 4MIUA 4A3LH 2D62A 4EQPA 3TEHB 5KIXA 5D65A 1D1KA 2WIIB 5AFWA 1HTPA 3VR3A 2F0EA 2F03A 3E3XA 4QUCA 3NQIA 1STGA 3D4WA 1SLJA 5IGEA 1CKNA 3J81i 2M6OA 2Z3QB 1YHQA 5CC4A 4ODGA 1KDCA 4A3CL 1VCIA 1AW7A 3KLSX 1WD0A 1IBML 4R4IA 4A3IL 2OCEA 4LFCL 4YCVA 3RUZA 3RZOL 4JG2A 3S1MH 1PH2A 5IIFA 1QNUA 1SYFA 3CQZB 4B3ML 4ZYSA 3SVMA 2KA7A 3M4OH 4UHVA 4DK3C 2AKWB 4B3TQ 1E2VA 4MZ9A 3JAML 3H91A 3NTKA 1X65A 4TSSA 4C3HH 4YWMA 1GD7A 1CZGA 1CQFA 4E6YA 1OXSC 2DNCA 2A1AA 5J39A 1QUQB 1GUNA 1SMYC 1XNQL 4TQUS 2JI1A 1UE6A 1WCMG 4BY1G 4Y7NH 4A93H 2ERSA 4ZCKA 1GUOA 1TQOA 1E24A 3GTOH 4YWKA 2KHSA 4DUZL 1R0IA 5CR3A 4RXNA 1SMYD 5IYDG 4DV7Q 4JI0L 4QGUA 1HNZQ 1FHHA 2VQFL 3HZXA 5CV8A 4HCSA 1D5MC 4ABNA 5K2ME 2F52A 5RXNA 5IOCA 2JA6H 3GV3A 1DYQA 2NTSA 2E75C 4R9WA 4DXGA 2K75A 4A3ML 3C46A 4GLVB 4FO2A 3F2CA 4LF4L 3AEVA 3NPPA 1FJGQ 5C4JB 1S5ED 1TWFL 2F4VQ 2YTYA 1ONLA 3TP7A 1SRUA 1TS5A 4FNFA 1HFGA 3PO2H 2KEDA 4JI3Q 4IFDH 1STYA 1SNMA 1SE8A 4R8NA 3TP8A 3JC63 4DR3Q 1RYTA 1CKNB 3BVZA 2OTJA 1JYBA 3GTJL 4DR7L 4CBVA 1W6KA 4K2KA 4U68A 2UXBL 4KKTA 1FHMA 1G291 4A3KH 1EWIA 3J81L 1Y69U 4JI7Q 5EKIA 3HOXL 1RKNA 4A3JH 4OO1H 1O7IA 2HDMA 1KHIA 3D4DA 2SDFA 5M5WL 3QR8A 4K6LA 4NXNQ 5JPNC 1A3UA 1D5ZC 3A74A 4A3EG 4AHYA 3A5ZB 2B2UA 2F0VA 2JA7B 2NVQH 5IWAL 1HJPA 1BBXC 1EQVA 4HJ7A 2VUMB 2SNMA 4OX9Q 3L2PA 3IU3I 4LFBL 4K0KQ 2KBNA 3DXJC 1LM0A 1Y1WL 4V190 1XPOA 1GKHA 4LF7L 1V8QA 4H44C 5CV9A 2P5ZX 1PFWA 2D0PA 1GUTA 2K5VA 1OWBA 1C9OA 4JPBW 4GOPA 2A74C 4DR2Q 3G48A 5EPKA 1B7YB 3M3YB 5JJKA 2F0UA 2M6PA 1ODHA 1MSGA 2G9DA 3I3CA 2K01A 2MGSA 3K5MA 1RF2D 3NWTA 1CADA 1SNOA 1KDAA 1E22A 3GTPL 1LABA 1ICWA 5FLML 1VS0A 4LF5Q 4XDXA 4ZKCB 2JA5L 2PMZB 5IYCH 1QILA 2RSNA 1PH9A 1FD7D 4C3IG 3NK9A 2XSCA 1I4PA 2RBMA 4LF9L 3PV0A 3UDXA 4CDFC 3P2AA 3D6CA 3B6YA 5KNCA 4BS9A 1ICFB 2K33A 1ILQA 1SFOL 2L11A 1RTNA 4GZYC 4BY1H 4WJWA 2X6LA 4TRDA 2DNEA 5JVH3 1IYVA 1HNXQ 3MXNB 1UUPA 4ZN3B 2L12A 5IT9L 4LNQA 5IYDH 4LMQD 3ULJA 3BG3A 3R93A 1Z47A 1T9OA 3ERQA 3C1FA 1W2BA 2SNSA 2PYAA 5IODA 1I50B 4DR4L 1NMFA 3HS0C 1TWHH 4IUPA 3KDFA 1EIFA 4DXFA 4HJAA 2ALYB 2E2IB 5FLXc 2G9HD 1KD1C 3J7Z1 5JVH1 2X69A 1WCMB 4JI4L 2JA8L 4IQZA 1L0WA 3AFQA 4JC0A 3G6EA 3OW7A 5BR8Q 3S2DH 2PVXA 4TVMA 4CDDC 4MTKA 1K8OA 1BR9A 5IGBA 1K8MA 3S15L 5KEEA 3A7LA 1EY6A 5FJ8L 2CW0C 3VR5A 1OWCA 2VNUD 4JI6Q 2HIXA 2XVSA 2ICEC 3I90A 1A62A 4L63B 3VYRA 3I2ZA 2L9HA 1Y1VL 4O1NA 3CAMA 4H13C 1SBBB 2UUAL 2CW0D 4GOPB 1QB5D 2B2UC 3V2TA 4GKKQ 1I3QL 1R0FA 4TVAB 4BBRB 2L4NA 5DLQE 3HOUH 4UP8A 1XXGA 3AYHB 2HQEA 2QL0A 2JEAI 2EY1A 1Q1BA 1Y8NB 3K0YA 4DFAA 4A3EH 1HFNA 4X3SA 1I4RA 4A3GL 2ICIA 4B9WA 1AE2A 1DCZA 1F2ZA 1L2FA 3AU7A 2IY5B 5IYBG 1PZJD 4HJ5A 3M4PA 1T9PA 4GOPC 3BS1A 3BDOA 4IURA 1WJJA 3HKZG 3N6RA 3Q23A 5LMUQ 4B08A 3HOYG 3EIVA 2QF7A 3W3AA 3VPBE 5DM73 1WOCA 1R0JA 4LF6Q 3OW2A 4CKBA 1JE4A 5C4XL 4A3IB 4NB3A 3AB9A 4APVA 2QA4A 3CCUA 4DV0Q 3TS0A 3D8GA 4QQBX 2BDNA 3MTSA 4DV2L 5IGCA 2B63G 3BJUA 2EY2A 1ASZA 4BY7G 3M4QA 4JAFA 2JP1A 2PQEA 1HPCA 3EFXD 1F77A 4G7ZC 4DNTB 2L0CA 3QWNA 3SS2A 2C5CA 1AEXA 3C3LA 2PYKA 4DA2A 3P1HA 1N36Q 4UY81 4JYAL 4FDBA 1VZIA 4QB4A 1EOVA 1QVGA 2SOBA 1EY9A 1LT4D 1V43A 4C3JH 2JJQA 2AHOB 2WB1G 3S1NL 2M4YA 5MFZA 1S5BD 5EPJA 1RL2A 1T9QA 2ZIXA 3BDCA 5CYUA 2FMCA 4IUNA 4N8FA 1FVIA 5ELEA 3J7YW 5T1GA 1X32A 2XGTA 3OIPA 1CHPD 3I4NG 1W3SA 3KYUA 3CQZL 4A3LL 2DUDA 2KQ3A 2YV5A 3FDTA 4DV1Q 1F2LA 1PDQA 3VR6A 1N32L 3OTOL 2Y0SE 3HOZG 2KCMA 5IP9G 4L5SA 1SJHD 2HD3A 2PNRC 1SMXA 4QY7A 4RMFA 3SGIA 1Z9FA 2QGQA 2IX0A 1PTOF 1LO5D 4TPUA 2B8GA 2L15A 4P75A 1VQKA 2GA4B 2CWPA 3GTLH 2QEJC 5C0XI 4IALA 5GAEc 1VDZA 3M7GA 1XJVA 3UDFA 1BKBA 7RXNA 2EJFC 2ID0A 3H0GG 2B3GA 1N34Q 1M90C 1F9QA 1MJEA 4KD4A 1HR0W 2N78A 4C3HL 1E1OA 4CHTB 1K83H 3A0JA 4KMUC 2OQKA 2ZTEA 2J0TD 3MEFA 4LUZA 3W5OA 2GVBA 5DNFA 4B3TL 3HOXB 1JJGA 5DM63 3GTGH 1GUGA 2RSOA 3E0EA 4KTAA 3J7ZC 4RWSC 2BE5C 2A8VA 3QO2A 3ULLA 4AR5A 3TBIB 5KRUA 5M3MG 1DD2A 2R93H 5C4JL 3GTQH 2WINB 1E0BA 2MO0A 2RDGA 3GTOL 2OXPA 1VQLA 1WI5A 2F0DA 4A3DB 1ET6A 1TR5A 2ENBA 4QJFA 3KYHC 4FP5D 4ZRZA 1AP0A 3NE5B 3HOVG 2F0QA 4R4OA 2BE5D 1J9OA 3EN2A 1SMMA 1A3TA 1CT1D 5DM61 4C2MH 1L0YB 3NXWA 5M5XB 4DV7L 3CCJA 1Y1WB 4P71A 2Z6KA 1HNZL 2MO1A 4HCEA 2I0QA 2PZWA 1CA6A 2H4OA 3S14L 4ZK9B 1NR4A 4KN4C 4MHEA 3CCMA 4HIOA 1LTAD 4ID6A 3S16H 1I5FA 2B63H 1PFYA 3CP0A 3NBHA 1R9TH 3K7AB 2BDOA 3PF4A 4BY7H 3PO2L 4KY7A 2KUMA 3HKZE 2EYHA 3GTKL 1EWCA 4X62Q 4XTCS 3K7UC 3GTPB 4A76A 1YBYA 1FJGL 2R61A 1T9HA 1I4XA 1IW7C 2IL8A 2F4VL 3HOYB 2JA5B 1STEA 3KF8A 1KABA 3PQIA 4JAEA 3PIP3 4JI3L 1OXXK 3MVVA 3TZUA 1VQNA 2SEBD 3ERSX 2I5MX 1X54A 5K36G 3PWFA 2K5WA 5KYIA 4WJ3M 4DR3L 4CGYB 3DWAA 4NDXA 5ELOA 5J1ZA 1IW7D 4A3JL 5FO9B 1NUCA 4XT3B 2Z1CA 1NNXA 1FNUA 3LNNA 2IPKD 2XIWA 2BOSA 1EIHA 1Y14B 2RVLA 3M3YL 1XMQQ 2NZOA 3PUWA 2N8NA 4BBSH 4XXBB 2WB1E 4NKLA 4O0AA 3HOZH 5C5LA 1DOMA 4NXNL 4DK6C 2JYOA 4DK0A 2WAQG 3QG1A 1B9NA 1WTOA 3W1BA 4OIKA 1VQIA 3EQLC 4YHHL 2EY6A 1CTMA 1Q82C 4OX9L 3S1RH 3K5NA 5E4XA 2BA1A 3I4NB 4K0KL 5HURA 1EU3A 1Q90A 1FNVA 3DEOA 2K14A 3M9BA 4HSVA 2TMPA 3CW2C 1GHJA 3H0GH 3CXCA 4KI0A 4DR2L 1Y1VB 1WTRA 4R1JA 1RB9A 3OWFA 1AZQA 1I50L 5DEHA 1TWAH 4LFAQ 1I4HA 3WWNB 5I4DA 2JA6G 3PO3B 1EYAA 2R7DA 3A55A 3NBHB 2LKVA 5FLXE 1KAAA 1WCML 4BY1L 5M3FH 2PSMC 3MC0B 5I2YA 1VQ7A 4HAEA 3T13A 5M3MH 2PMZP 4A3FG 3PIPA 1LTID 4YWLA 5I6WA 1PYSB 1QUQA 4JBKA 2Z6KC 4BA2I 5IYDL 2K2DA 1LT3D 3BVMA 3KF8B 3VA7A 3H15A 4A3GB 4IFDG 2M4VA 3U50C 3DWPA 2N49A 3HOVH 3Q0AA 4DR5Q 1Q8IA 3HG9A 1QCVA 1HNXL 1O7YA 5EGTA 1OXVA 2F0NA 1G8ZD 2NYZD 4ZLTF 4KKSA 3PMFA 3KLWA 4B9XA 1SMWA 4DNRB 1J6QA 4FF4A 5HY6A 1L0XB 4A3KG 4QUFA 2A6HC 2NN6I 2PW5A 2JSOA 2XTIA 2HCCA 1TT2A 1U4MA 4KKUA 1C7YA 1I6HH 1YHBA 3FPUB 1QNKA 3DMUA 2NZHA 3HKSA 1BXTA 3R3OA 4RHSA 2FINB 5BR8L 4Z9CB 3CCRA 5JEAJ 1U5KA 2IJ0A 4TKOB 1XPRA 5D3DA 3RZDL 3DM1A 2A6HD 4OHJA 1PYWD 1S40A 4EX5A 5LL6X 2N88A 5K36H 2D0OA 5GAHC 1TU2B 1PZKD 2XJQA 4K8IA 3SEBA 4DNIA 3M7NA 4DR6Q 3S1NB 5M5YB 3D3RA 5F2DA 3NBIA 3G7LA 1NY4A 1PZXA 1PFSA 1VQHA 1NBWA 1SEBD 3QOJA 4IUUA 3SR1A 4AI0A 2WFWA 4YY3Q 2XNAC 1GJXA 1F2YA 3MFGA 3A7AB 1TWCH 4GKKL 5EIOC 4A3EL 1AN8A 1FL0A 1RYQA 5EPLA 2XJRA 2OF1A 3KUPA 2JQOA 4RFBA 2A5HA 3KYVA 4OWXB 4K5VA 2F0GA 1X3FA 1EZ6A 3GTMH 1LKPA 5IYCG 1B71A 1DOKA 3HRZC 2EY4E 1LTRD 3I56A 1IL8A 3STBC 3CCSA 4IJHA 1RD9D 1VCXA 1XX8A 5LMUL 3S1MB 1EQQA 2F0TA 4OO1I 1C48A 3LPEB 5GADC 4AH6A 4DU9A 3M4OB 1R4QB 4LF6L 4G57A 2O4XA 2WAQE 4DN4M 3S1QH 3STBD 5IP7H 4NXMQ 2E2HH 4DV0L 1QVCA 4L5QA 3FDJA 4C3HB 1UE1A 3O13A 4C3IL 4HTHA 1QVFA 1CZWA 3CC2A 1ENCA 1HQRD 4GN3B 1VF5C 3Q22A 1FGBD 2CKZB 4QIWE 1FR3A 4YCUA 1HCZA 3K0XA 3KJPA 4A93B 3GTJB 1N36L 5MF6A 1O78A 3T1YQ 4A3FH 2KHIA 1A15A 1BQQT 3X3MA 1SNQA 1E3PA 1SR3A 3GTOB 3WWLA 1VQOA 3RLFA 2PNHA 3J81j 2DJGC 4M1UB 3S2HH 1BFYA 3CCEA 1L1OA 1M8AA 4K2LA 1S30A 1PXUA 3T56B 3MXNA 4OWTB 2HT1A 1U4RA 3RLOA 2B8FA 3FKIG 1G2SA 2F0PA 4XT1B 3S14B 1HTLD 4X3KA 1EIYB 4RGTA 3I4MG 3A8KE 2B2WA 1LTGD 2V4DA 1RDGA 2PI2E 2RFKB 3HOWG 3HOUG 3OPOA 3PO2B 1PFMA 3GTKB 3RN2A 2A73B 1B2OA 3B0AB 1VQDA 3WDNA 2L55A 3FRPB 4PZ7A 1BVSA 1CSQA 1D8LA 4A3DL 1JB3A 3MHBA 1HQMC 1KXLA 3MXPA 1D6EC 2R92G 1YJNA 4O2DA 1SNDA 3CHBD 4GN5A 1NJIC 1Q8KA 1SE3A 4A3KB 5NUCA 1IROA 2KCTA 1JWMD 2E2DC 1H9SA 3L7ZC 3OMGA 5M5XL 3GTGL 4ILWA 4A3JB 4L5RC 4R4QA 3J7AF 2ZJRA 2EYJA 1SYEA 1B2TA 3GTQL 4I7ZC 4GS7D 5CORA 3D31A 2L0ZA 1YVCA 1TS2A 4I65A 3K7AL 4BWGB 1CUKA 4B3SQ 1B8AA 1F9RA 1SYGA 1Q46A 2NTTA 3U9SA 2NVQB 5EAYA 4DUYQ 1BO0A 4G7OC 5IYBL 3LWEA 4JI1Q 5GAGC 5IT9c 2E74C 2Z0SA 4P72A 1WTPA 3H3VI 3GO5A 4CKEA 3HOYL 1BDOA 3I72A 1RJTA 2R3ZA 3BYYB 1G91A 3F1ZA 1DVBA 2F3WA 5GQOA 4G6BA 4C3JG 5MGNA 4KJOA 2Y0SG 2B2YA 3S16L 1BNZA 2B2TA 1L1OB 1HHVA 4LAAA 1A8VA 2VXWA 4BY7L 2F0HA 4HEDA 1M1KC 4JI2Q 1QE6A 3MAQA 3T51B 3HAXC 1EEFD 2K32A 2OEOA 5ELNA 2CWAA 4KD3A 4AYBG 3JR7A 4K9FA 3K80C 3PL5A 4DAPA 2BH2A 3DUZA 1W6JA 2UUCL 1MI2A 2A6EC 4X62L 2E76C 2EYMA 1LLRD 3PKIA 4A3MG 1HZCA 2YU9H 3CMEA 1L1OC 1S3OA 4BY1B 3C1EA 3S17H 2K04A 3UDIA 3HKZP 2VW9A 1WJVA 4NMZA 3NUCA 2JE6I 1F9SA 4ZQ3A 1Z6HA 2A6ED 2KVMA 3HFZB 3MXUA 4OONA 5C44G 2UXDQ 4K8JA 3I4NL 4DK1A 2NVTH 4ME5A 4QF4A 2EYPA 3N52A 3W2DA 4IN3A 1EIGA 1SYBA 2B2WC 1H9SB 1TWHB 3AFPA 5C3EH 3OIQA 1B70B 3VYSA 3I7FA 3HOZL 5IP9L 3MEHA 1V1OA 3FKIH 2R7ZG 2V0FA 2LFNA 1XMQL 1B53A 5E7NA 2KEEA 4FVMA 1TWGH 3ND8A 3IFTA 1YUXA 3S2DB 2E5LQ 3PO3L 1H9KA 2XJVA 2AWNA 2PPTA 3GQBA 2H5XA 4CJ1B 3I4MH 3MQKB 2PCFB 3PSIA 1YJ9A 2OTLA 1VZGA 5H1Sc 3S1RL 3EBEA 3HOWH 3GD7A 2JA9A 2N55A 2LSSA 3Q8DA 5FLXL 2M9VA 5I9OA 2R93G 2UU9Q 4C1NI 3K5OA 3MXGA 3RZDB 3H0GL 3BVGA 1EY5A 2R92H 1X3EA 5BN4A 2ATWA 4PMBA 2EOTA 1Q1EA 2NZ1D 1U9RA 1C8CA 4GKJQ 2UXCQ 1A6XA 4LJZC 3ULPA 4AI2A 1XMOQ 5K5PA 1QOHA 5D3IB 1BUVT 2N3SA 4NP5A 1RTOA 4DV6Q 3RZOH 5AJ3Q 3L0OA 2YTXA 3HOUB 1QQTA 1MSHA 1A63A 1JICA 1YNNC 3WWVA 4FF1A 1RHPA 1JQYD 2AQ2B 3C2PA 1CAAA 2F3IA 2Q8IB 4LFAL 3H3VC 5EKLA 5I9PA 2DY8A 1PFVA 4BXXG 2XJTA 4A3EB 1K3RA 1H9MA 1Q7YC 3V96A 4OEMB 5C6AA 1WTXA 2O2LD 1CK1A 1M4VA 1MD2D 3NEMA 2B2YC 1PA6A 3BYTB 5G3LD 2B2TC 1YNND 2A69C 4DAYB 1ENFA 2MHVA 3I8ZA 5DM71 3G6JB 1LYLA 5ELCA 2JI3A 4DV3Q 1K8AC 1I6VC 2LS01 2Z4IA 1PFUA 4RKLA 4DR5L 3LX0A 1EWHA 1P8LA 1KAWA 4JAGA 2A69D 5M5YL 5C0XG 3JAME 1RODA 4BA1I 4EQNA 2EIFA 4AR3A 2QDBA 2DSXA 1EYCA 1LTSD 3K59A 4DV5Q 1KLGD 1B50A 4A4IA 1BRFA 3S24A 4K5XA 1RWDA 4GLXA 2DN8A 3FHWA 4C3IB 4A3BG 2VL6A 4BBSG 5HGQA 4A3MH 2Z3RB 1X6OA 2VS1A 2F0SA 4C3JB 2VB2X 2CH4A 1VF7A 1YNJC 2F0IA 2Y0SB 2HR5A 1YIJA 2JA8G 3E9IA 1GUSA 1S5FD 2AUSB 1KNAA 1TWFH 5MLC3 4R4TA 1PH7A 1QCBD 3LWPB 2JK8A 4AYBE 1TY0A 4PQXA 5ISRA 1Q3LA 4WRDA 3E9HA 2VY3A 2RA4A 1G6ZA 5C44H 3S1ML 5FJ8G 2ZJQA 2ZXRA 1YNJD 4DR6L 1C0AA 4CKCA 4IOAA 1BQ9A 3M4OL 1TKWB 3OYYA 5FOBB 4K6DA 3UE0A 3FP9A 2K6AA 5JPMC 4YY3L 1MJCA 4HJ8A 1UEAB 2MJ8A 3VYUA 2R7ZH 1O80A 2EY5A 3VR2A 3GTML 1PVOA 3RR5A 4AR4A 4KN7C 6RXNA 1SYDA 4KY6A 2EYLA 3KK7A 3KYYA 5KNDA 1HZBA 5EBDA 5M5WH 5M3FG 4AQYQ 4Y7NL 4A93L 1CM9A 1NE3A 1VQ6A 3GTLB 2I5HA 2AMCB 2RQXA 1NR2A 2NVYH 4RHRA 4UP9A 3PF5A 3QVDA 3PIOA 5E4WC 2PZUA 2ZT9C 3L9AX 2ZM6Q 1Q86C 1J5EQ 1JOKA 2KHJA 3S1QL 2Z9HA 2OQ0A 1I94Q 2C6AA 1R0HA 1HR0Q 4ZUIA 3K81C 4JADA 1ZKOA 2J4XA 2Z8LA 2JA6L 3URYA 1OO9B 1YUZA 1S24A 2HDLA 2QILA 4NXML 3GTGB 5C4XG 4IOCA 2K7VA 4XIGS 1NSNS 4A3FL 2F0MA 3GTQB 4HMIA 1PTOH 2NVXH 3I70A 1KDBA 4JOIA 2XWBB 2BCOA 1S72A 2MFIA 2EDGA 4BXXH 3DLLA 1R4PB 1AH9A 1LKOA 1EY8A 2JA5H 3T1YL 3R2IA 3QOLA 2PO4A 4LWCA 3HKZB 2VQEQ 1C09A 4C2MB 3KJOA 5LMNW 2F0FA 4MN3A 2NUCA 5E1FA 5C4ZA 1SFOH 4B3RQ 2KN9A 4A3KL 4IUQA 5CMDA 2D5DA 2KCCA 5CV4A 1VQ8A 5FK9C 1N33Q 1QG7A 4DGZA 3S16B 1OXUA 4PZ6A 1XTDA 1O7LA 5C0XH 2B63B 4CDCC 4BY7B 1HRJA 1IRNA 4DV4Q 2B2VA 2FFKB 4RA8A 4Q5VA 3ONAB 4JI7L 4IUTA 3PIP1 4IFDJ 2LMCB 4A3BH 2NVQL 3A56A 2NBFA 1VQFA 2ZXPA 3J80c 1SMUA 3OOCA 1B3QA 2FHTA 5LMNQ 5IT9E 2G5DA 2JA8H 4X6AH 4FXKC 2WB1B 4S3SA 3CC4A 5CBEE 2X6GA 3SXHA 5JJZA 1IKMA 4DR1Q 4I7AA 2PW7A 3LNLA 2J9UB 4X64Q 3S15H 3H99A 1KLUD 5FJ8H 2FXQA 2UUAQ 2EVBA 1EY7A 3F2UA 1P16A 5C5MA 4X66Q 2IT1A 1TVXA 1G6PA 1NTGA 2CHBD 1B13A 4LUOA 1EFWA 4BBSB 1SE4A 3PKJA 4OIJA 1ZXTA 3TSSA 1XNRQ 2V1CC 1Y1VH 3HOZB 4J1MA 3QJYA 5IP7G 2RHQB 3R2TA 2E2JH 2PQAB 3SK5A 4JI5Q 5IYCL 1IYUA 1F9PA 4QCLA 2I5LX 3NQTA 5E3FA 1LTTD 4ULLA 4B3SL 1I3QH 1XTCD 2NN6G 1WFQA 4DUYL 3MZ5A 4JI1L 1S5CD 1HH2P 1LTLA 3S1RB 2A19A 4LF5L 2RDHA 4G4KA 1AE3A 2KECA 2J7ZA 5EBCA 2L1BA 4KY5A 3U9OA 3H0GB 4NPSA 1S5DD 3RMHA 1V1PA 4DKAC 3MPSA 3OWEB 3K57A 2C35B 3SK8A 5CV6A 2MS3A 1KTKA 5TSSA 4DV2Q 1R0GA 4JOIC 5CV5A 1TWHL 2XJPA 1JWUD 4JI2L 1TWAB 1EEID 2KOLA 5A35A 4JI8Q 4GN4B 5C4XH 2CKAA 2H12A 2F0KA 2GVAA 3S17L 1UWVA 3NSWA 1PH4A 1IL2A 1KL9A 2CR8A 1SYCA 5M3MB 3S2DL 2IX3A 2EZVA 1H9JA 5KYLA 3RLNA 2F1MA 4V0BA 2AYJA 1JT8A 1AZPA 5H1SE 2NVTL 2HQLA 4RGNA 3VYTA 3HOVB 1FYCA 2CQAA 2AWOA 3CRLC 3RYGA 5I2XA 2JA7G 1GO3E 2EYOA 1EU4A 1CA5A 2UXDL 2VUMG 1SAPA 1T5XD 2B2VC 1PMRA 3H6MA 1BF4A 4JI6L 1H95A 5ELBA 3I4ML 3NHHA 3JAMc 2UUBQ 4IPGA 2Q8RE 3ZJYC 2TSSA 5T1IA 1JORA 3ITPA 1F2MA 4FXGC 3HOWL 3HOUL 4YCWA 3PZAA 1IKLA 4OXPA 3F2DA 3CC7A 1VQ5A 5BN3A 3WOEA 1I6HB 1VQBA 3NP8A 3CQZH 4X65Q 3TDQA 2E5LL 1B3AA 3FPPA 2VB3X 1X56A 4IFDI 3DHQA 2R92L 2Z6BA 4JBMA 1HZAA 3OSOA 4UDUC 2MNAA 3LWOB 3JC66 4RAUC 3UE1A 2L5TA 2PI2A 2CKCA 1QZGA 4GLAC 2O5IC 2UU9L 2F4IA 3CKIB 4IO9A 2IX1A 1PH1A 3P8BA 5LL6S 1I4GA 1PFNA 1E2ZA 2HVYC 1O7ZA 1PH8A 1AFPA 1IBLQ 4KHPQ 5IGDA 1BCPB 1N8RC 2ERJA 1GOZA 3CPFA 1G51A 4GKJL 2UXCL 4POFA 4M8AA 3ER0A 1V1PB 3I73A 3KF6A 4P2CB 2PZTA 1TWCB 1XMOL 1PRTB 4DV6L 4PMCA 3SK4A 5AJ3L 1Q12A 2H1EA 3ZYYX 2AUJD 2AUKA 3JC62 5C3XA 5BN5A 1X3GA 1D1IA 3NENA 1JMCA 5AI3A 2DY7A 2WAQB 3GTMB 3TREA 4N9PA 2KCNA 1BCPC 2NN6H 3U4ZA 3VR4A 4HR7B 4L5TA 2QEXA 1MHWC 1EY0A 5LHY1 3GDEA 1K73C 4C3JL 1II3A 1PH3A 1E7ZA 2CCZA 1RDPD 4UAIA 5C4JH 1PRTC 3G71A 3HJYB 1D7QA 4JBJA 4Y7NB 2JXMB 1HNWQ 3NELA 4QIWB 2Z4HA 3D4RA 4DV3L 1ZEQX 5JEAG 1MGSA 3J81c 1BCPD 3I55A 1IBKQ 1YK4A 2VZAA 3S1QB 3OHXC 2JI2A 3KBGA 3UDGA 1YHAA 2E2HB 1STBA 2M2LA 2EJMA 1PRTD 1DZ1A 4Y52H 5C3EG 2LXKA 4E6IA 3E5SA 2WKCA 2RDFA 1A3VA 5JVG3 4DV5L 1ASYA 2JA6B 3S14H 2WV6D 5M9OA 4F7XA 3K8AA 4J6HA 1QJOA 3L3OC 1PZID 2C9OA 2HHHQ 3J7A5 1B4OA 3LWQB 1B9MA 4JK1C 4DV1L 1KRSA 4BBRG 4A3FB 2AQCA 3KBXA 3GTKH 3T4AC 1BOSA 5C44L 1Y8OB 1GHKA 3GTLL 3S2HB 4LK1C 2Y0SP 1SN8A 3IKJA 3U58A 3H94A 2F0OA 5C3WA 5JVG1 3KLRA 4RCOA 2JA7H 1KNEA 2CVRA 5GAEC 1NXGA 4IPDA 1EQRA 4AHZA 2IW3A 2R7ZL 2VUMH 4MNOA 4AR6A 4N8X1 4AYBP 1K83L 3FEWX 2F0LA 2F0JA 3CRKC 3HP3A 4FYDA 3KF6B 5IGGA 1JJCB 1YEZA 2IHFA 1A2TA 4A3CG 5IGFA 1EYDA 4C56C 4F87A 1I4QA 1FGUA 1N34L 4A3IG 1STAA 1XYIA 1E8JA 4AHXA 2HUGA 2E8GA 1CSPA 3LGJA 1B2JA 5CBAE 3I4LA 2NVYL 5HGTA 1VQEA 5MFPA 3M3YH 2R93L 3PUVA 1XPUA 1Y8PB 2JN4A 1ZRPA 1ILPA 4EQ5A 1DONA 3U4VA 4YHHQ 5A2QE 4AQYL 2V0EA 2K50A 4L6TB 3DEPA 1WVLA 4HMJA 4CJ2C 2HIVA 2ZM6L 1J5EL 1ET9A 1HA6A 4MTNA 3B08B 1I94L 2QCPX 1EQTA 1JOOA 4DAVA 1HR0L 1H7VA 2NVXL 1G2TA 5G3LF 2B63L 4BXXL 1VQCA 1R9TL 2PMZE 1DJRD 3RNUA 2GMGA 2LXJA 4LF8Q 1NXEA 4LHNA 4G7HC 3TRZA 1RCVD 3PCOB 2FJ2A 3CMAA 1I50H 2BA0A 1HUNA 4LUVA 1YITA 2B5ID 1TIID 4N9TA 3HGBA 4IZ8A 2E2IH 5FO7B 2YTVA 4ZUJA 5JAVA 1X55A 2EXZA 1TS3A 1WCMH 3NTHA 3J80E 4JV5Q 3CCLA 1YV1A 4IUVA 2XWJB 1SJED 2VQEL 4DAYA 4CJ0B 1UAPA 1NNQA 3BZKA 1ZYRC 4B8CD 5JEAH 4B3RL 4U673 3A8IE 1N33L 2V3BB 2Q8TA 4RKBA 3G4SA 2RF4A 5I6YA 3RN5A 1CKOA 1X9NA 4A3BL 4CDEC 4BBSL 3RZTA 1SNCA 2WP8J 3MFYA 2WACA 1ZYRD 2FMMA 4DV4L 5IY0A 1A2UA 2D2CC 5JOBA 3K35A 2YU9B 4X6AL 4HIKA 4RGMA 3F2BA 3W1GA 3LWRB 3S17B 3T1HQ 1BQ8A 2B39A 2GN5A 3LWUA 3HOXG 5J3BA 3IFDA 3QQCE 4U671 4BBRH 1IU6A 1U4PA 3CD6A 5C0XJ 3MA2B 3FVQA 1CKMA 4KK7A 5LMNL 1GUWA 2XJSA 4KHVA 1HA5A 3IRBA 4AIMA 4WFN3 2RCFA 4KV6A 3PUXA 2NVTB 3J7Y1 1CHQD 3P75A 2WB1P 4A3DG 3RZDH 1JR0D 3H3VH 4DR1L 5C3EB 3H9BA 1K28A 2K5HA 1FNWA 5JJIA 3OMCA 4X64L 5GAHc 1IBMQ 4AI3A 1ENAA 2E2JL 3EJIA 3FKIB 4LFCQ 4HIDA 5AN9H 3A54A 1P7PA 4X66L 4WJ4A 2D9UA 1TWGB 4H0LC 4B3MQ 5COYA 1Y1WG 1TWAL 2LY7A 1IU5A 4Q0FA 8RXNA 4A75A 2Q2IA 1SDFA 2K03A 1XNRL 3I4MB 4A3CH 1RIPA 4PV1C 4X3UA 4WFN1 3NFPI 4A3IH 1SSOA 5M3FL 3CCQA 2ZTCA 3HOWB 1JB7A 4JI5L 3NWSA 1OTCA 5M3ML 1CQVA 1HXYD 1HUMA 1KC8C 1QZHA 2WKDA 5L37A 2JEBI 4C2M1 4H7BA 1CI3M 1N9WA 2RDVA 1H9RA 3TQYA 4ALPA 1WTQA 1X3QA 1X3PA 3HEJA 3J7AV 1XNQQ 5FLMG 1IHZA 2K5DA 1DX8A 2R92B 4RCNA 5EQ0A 3HOVL 3KOJA 1LUZA 4KJNA 2JA5G 3ND9A 3SDZA 2MUYA 3CCVA 1K0SA 4QL5A 5AI2A 2OWOA 1EY4A 4XQQA 1SE2A 1NMGA 4IPCA 4XYOA 1K8GA 2EE1A 4NW2A 2K5QA 1GXDC 3P20A 4DUZQ 3P7JA 4JI0Q 2RKSA 3RZOB 3PIO3 1TXYA 5GADc 4QMGA 2VQFQ 1PLFA 2AQ1B 1VQ9A 1STHA 4IJLA 2KKDA 3A5UA 3KDFB 4JI8L 1PHJA 3I91A 1I6HL 4L8JA 3BU2A 5FKAC 3T53B 4LF4Q 1RDVA 4C3IH 2ZTDA 1ESFA 4ME3A 1VQ4A 2AQ3B 3DWQA 1UE5A 3PIO1 1MIUA 3TP6A 4IPHA 1LT6D 3FMCA 3AQQA 4OWWB 2K1BA 2ZXOA 4JBWA 1PV4A 3EA6A 3TZDA 2KENA 1EOTA 1WYDA 2XJUA 3TN2A 1GVPA 3TP5A 2APOB 1E2WA 4DR7Q 1CFMA 3D6WA 4OL7A 4F88A 3AMUA 3KFUA 1V1QA 4AYBB 5J22A 2UXBQ 2K4KA 3SE0A 1BE7A 1TWCL 2UUBL 3IL8A 4F8MA 1DXMA 3GTJH 1B1ZA 2NWGA 2MP1A 1UE7A 2NB0A 1S4ZA 1Y1VG 3Q24A 4A3MB 1YI2A 1ESRA 2F0WA 4X65L 2PVEA 4JVZA 2PPBC 2EYFA 3T16A 1D5XC 1EYGA 1LT5D 1TWFB 2EXDA 3PO3G 4XQJA 2EJGC 3HOXH 2CH4W 3A44A 4EVOA 4FXDA 3RZ6A 1JWSD 5IWAQ 5C44B 1C4QA 1A0IA 4LFBQ 4A3DH 2HCIA 4J8QA 1VQPA 1LTBD 1V9PA 2XRSD 2Q2UA 1YZ6A 4LF7Q 4EQOA 1IBLL 4A3GG 3J81E 1WTHA 4KHPL 1LV9A 1TS4A 2MPMA 5IP7L 4PZ8A 1EL0A 2E2HL 4UP7A 2R7ZB 5ELFA 4HIMA 1YK5A 4KHZA 1K83B 1MBYA 3ZG6A 1UNSA 4EGVA 5GROA 3MWYW 5M5XH 4GNXA 1GM5A 2B29A 3PUZA 1Y1WH 2O5JC 1EFID 4R8IA 3BZCA 3DM3A 3Q6SA 5EJWA 1OXTA 1SROA 5M5WB 2PQAA 1JE5A 3K5LA 1PYBA 3J80i 4ZN1B 2NVYB 2WAQP 1SNPA 2R93B 3H97A 1TY2A 1LACA 3K7AH 2O5JD 2A68C 5GAGc 4LF9Q 4OELB 5IYBH 3GTPH 2BH8A 1ML0D 3S2HL 1J8IA 1WTWA 5FLMH 3I4OA 4HSPA 3H09A 3QB3A 2NYDA 1Z92B 1HNWL 3HOYH 4Y52L 4AI1A 2K28A 1NAPA 1K9MC 3K58A 1WTVA 4QIWP 4ZAIA 1KRTA 2XRQD 1F4LA 1IBKL 3M4YA 2A68D 1IZ6A 1SXTA 2K52A 4P73A 3E6ZX 3UI2A 2DGYA 2I46A 4P74A 2R7FA 4OGQC 4XXEA 1PTOB 2NVXB 2K5NA 4DR4Q 4PNYA 2UUCQ 4AHWA 1T5EA 1R9TB 4YIJA 5JJLA 3GV6A 2HHHL 4JI4Q 4A3LG 4DF7A 2M00A 2JA7L 1PH5A 1S2ZA 4XGHA 2VUML 1B44D 4X3TA 4RGOS 3CU7A 1SFOB 3VA5A 2ASBA 4PG3A 1PTOC 2QKIC 1XWEA 1JCKB 5A2QL 5FO8B 1BBUA 3H3VM 4O42A 2DJFC 3KYXA 1K0RA 3S9WA 5C4HA 1PFBA 1DGSA 3V05A 3E0JA 1QYBA 3I4NH 1VQGA 1PTOD 4ZKBB 5D14A 1VQMA 2ES2A 3HJWB 1VMPA 1Z7TA 1Q81C 4GNXB 1YJWA 5IP9H 5ELDA 4A3BB 1YNXA 1U4LA 3PGZA 3QIAA 4C3HG 3SK6A 4FF3A 2JA8B 4GS3A 4UY8C 3RD4A 1VQAA 4JCVE 1MKHA 3PO3H 1EUJA 1PH6A 1STNA 1NCVA 3PUYA 4HN7A 4V196 4A93G
chains in the Genus database with same CATH topology
2RCNA 4DAMA 2IHEA 2CFMA 2CQOA 2Q2HA 3MSUA 4GNXC 1VQJA 2R6GA 3CF5A 4POGA 2MQHA 3KYWA 3JAMi 4A3GH 3M85A 3CPWA 2C6BA 2Q2TA 4UPAA 2EQSA 1U0LA 4LF8L 3TS2A 2YYZA 1BBWA 1KQSA 2ZJPA 3D0FA 4LHLA 4JYAQ 3PO2G 4KLKA 4JV5L 1IYJB 4LW1A 4J15A 1LKMA 2RHSB 4DPGA 4R4CA 2LCQA 1IXRA 3ICEA 4PMWA 1E1TA 1HZ9A 3S1NH 5M5YH 1JJ2A 4A3JG 4OO1G 1N32Q 4HJ9A 4RG1A 3OTOQ 4H02A 3VDYA 1KIXA 5EINC 5IE8A 1UEBA 1VZHA 3F8TA 3T1HL 4A3LH 2D62A 3TEHB 1SLJA 1CKNA 3J81i 2M6OA 2Z3QB 1YHQA 1VCIA 1IBML 4R4IA 2OCEA 4LFCL 4YCVA 4JG2A 3S1MH 1PH2A 4B3ML 3M4OH 4DK3C 2AKWB 4B3TQ 4MZ9A 1X65A 4C3HH 4YWMA 1GD7A 4E6YA 1OXSC 2A1AA 1QUQB 1XNQL 4TQUS 2JI1A 1UE6A 1WCMG 4BY1G 4Y7NH 4A93H 2ERSA 1E24A 3GTOH 4YWKA 4DUZL 1R0IA 5IYDG 4RXNA 4DV7Q 4JI0L 4QGUA 1HNZQ 1FHHA 2VQFL 5K2ME 2F52A 5RXNA 2JA6H 2K75A 4GLVB 3F2CA 4LF4L 3AEVA 1FJGQ 2F4VQ 2YTYA 1SRUA 3PO2H 4JI3Q 1SE8A 3JC63 4DR3Q 1RYTA 1CKNB 2OTJA 1JYBA 4DR7L 2UXBL 1FHMA 1G291 4A3KH 1EWIA 4JI7Q 4A3JH 1O7IA 1KHIA 4NXNQ 3A74A 4A3EG 4AHYA 3A5ZB 2NVQH 5IWAL 1HJPA 4HJ7A 4OX9Q 3L2PA 3IU3I 4LFBL 4K0KQ 2KBNA 1LM0A 1XPOA 1GKHA 4LF7L 2D0PA 2K5VA 1OWBA 1C9OA 4GOPA 4DR2Q 3G48A 5JJKA 1B7YB 2M6PA 1ODHA 1CADA 1E22A 1VS0A 4LF5Q 5IYCH 1PH9A 4LF9L 3PV0A 3UDXA 3P2AA 3B6YA 4BY1H 1HNXQ 3MXNB 4ZN3B 4LNQA 5IYDH 3ULJA 1Z47A 1T9OA 1W2BA 2PYAA 4DR4L 1NMFA 1TWHH 3KDFA 1EIFA 4HJAA 2ALYB 5FLXc 1KD1C 3J7Z1 5JVH1 4JI4L 1L0WA 3AFQA 4JC0A 3G6EA 5BR8Q 3S2DH 2PVXA 4TVMA 1OWCA 2VNUD 4JI6Q 2HIXA 1A62A 3I2ZA 3CAMA 2UUAL 4GOPB 4GKKQ 1R0FA 4TVAB 5DLQE 3HOUH 4UP8A 3AYHB 2QL0A 2JEAI 1Q1BA 4A3EH 1AE2A 2IY5B 1L2FA 5IYBG 4HJ5A 4GOPC 3M4PA 1T9PA 1WJJA 3HKZG 5LMUQ 3HOYG 3EIVA 3VPBE 1WOCA 1R0JA 4LF6Q 3OW2A 4NB3A 4APVA 2QA4A 3CCUA 4DV0Q 3TS0A 4QQBX 4DV2L 2B63G 3BJUA 1ASZA 4BY7G 3M4QA 4JAFA 3SS2A 1N36Q 4UY81 4JYAL 4FDBA 1VZIA 1EOVA 1QVGA 4C3JH 1V43A 2JJQA 2AHOB 2WB1G 2M4YA 5MFZA 1RL2A 1T9QA 2ZIXA 1FVIA 2XGTA 3I4NG 1W3SA 3KYUA 2DUDA 2YV5A 4DV1Q 1N32L 3OTOL 2Y0SE 3HOZG 2KCMA 5IP9G 4L5SA 1SMXA 4QY7A 4RMFA 3SGIA 1Z9FA 2QGQA 2IX0A 4TPUA 2L15A 4P75A 1VQKA 2CWPA 3GTLH 5C0XI 5GAEc 1XJVA 3UDFA 1BKBA 7RXNA 2ID0A 1N34Q 3H0GG 2B3GA 1MJEA 1M90C 1HR0W 2N78A 1E1OA 1K83H 3A0JA 2OQKA 2ZTEA 3MEFA 4LUZA 3W5OA 2GVBA 4B3TL 1JJGA 3GTGH 3E0EA 3J7ZC 2A8VA 3ULLA 4AR5A 5M3MG 2R93H 3GTQH 2MO0A 1VQLA 1WI5A 4QJFA 3KYHC 3HOVG 4R4OA 2BE5D 3EN2A 1SMMA 5DM61 4C2MH 4DV7L 3CCJA 1HNZL 4P71A 2Z6KA 2MO1A 2I0QA 3CCMA 4HIOA 3S16H 1I5FA 2B63H 3CP0A 1R9TH 3PF4A 4BY7H 3HKZE 4X62Q 4XTCS 3K7UC 4A76A 1YBYA 1FJGL 1T9HA 2F4VL 4JAEA 4JI3L 1OXXK 1VQNA 3ERSX 2I5MX 1X54A 5K36G 3PWFA 4WJ3M 4DR3L 5ELOA 1IW7D 1Y14B 1XMQQ 2NZOA 3PUWA 2N8NA 4BBSH 4XXBB 2WB1E 4O0AA 3HOZH 4NXNL 4DK6C 2WAQG 3W1BA 1VQIA 4YHHL 1Q82C 4OX9L 3S1RH 2BA1A 4K0KL 2K14A 3M9BA 3CW2C 3H0GH 3CXCA 4KI0A 4DR2L 4R1JA 1RB9A 1TWAH 4LFAQ 2JA6G 3WWNB 2R7DA 3NBHB 5M3FH 2PSMC 1VQ7A 5M3MH 4A3FG 3PIPA 4YWLA 1PYSB 4JBKA 1QUQA 2Z6KC 4BA2I 2K2DA 3KF8B 3H15A 4IFDG 2M4VA 3U50C 3HOVH 2N49A 4DR5Q 1HNXL 1QCVA 1OXVA 3KLWA 1SMWA 1J6QA 5HY6A 4A3KG 2NN6I 2XTIA 1C7YA 1I6HH 1YHBA 2NZHA 3HKSA 5BR8L 3CCRA 5JEAJ 1U5KA 1XPRA 2A6HD 1S40A 4EX5A 2D0OA 5GAHC 2XJQA 4DNIA 3M7NA 4DR6Q 1NY4A 1PFSA 1VQHA 1NBWA 4AI0A 2WFWA 4YY3Q 1TWCH 4GKKL 5EIOC 1FL0A 1RYQA 2XJRA 2JQOA 3KYVA 4OWXB 1X3FA 3GTMH 1LKPA 5IYCG 1B71A 3I56A 3STBC 3CCSA 4IJHA 1VCXA 5LMUL 4OO1I 1EQQA 3LPEB 5GADC 4AH6A 4LF6L 2WAQE 3S1QH 3STBD 5IP7H 4NXMQ 2E2HH 4DV0L 1QVCA 4L5QA 1UE1A 1QVFA 3CC2A 4GN3B 2CKZB 4QIWE 4YCUA 3K0XA 3KJPA 1N36L 5MF6A 3T1YQ 4A3FH 2KHIA 1E3PA 1SR3A 3WWLA 1VQOA 3RLFA 2PNHA 3J81j 3S2HH 1BFYA 3CCEA 1L1OA 1S30A 4OWTB 2HT1A 3RLOA 3FKIG 1EIYB 3I4MG 1RDGA 2PI2E 3HOWG 3HOUG 3RN2A 1B2OA 3B0AB 1VQDA 4PZ7A 1BVSA 1CSQA 1D8LA 1KXLA 2R92G 1YJNA 4O2DA 4GN5A 1NJIC 1Q8KA 1IROA 2KCTA 3L7ZC 4L5RC 4R4QA 2ZJRA 4GS7D 3D31A 2L0ZA 1YVCA 1CUKA 4B3SQ 1B8AA 1Q46A 5EAYA 4DUYQ 4JI1Q 5GAGC 5IT9c 2Z0SA 4P72A 3H3VI 3GO5A 3F1ZA 1DVBA 5GQOA 4G6BA 5MGNA 2Y0SG 1L1OB 1A8VA 1M1KC 4JI2Q 4AYBG 5ELNA 2CWAA 4K9FA 3K80C 2BH2A 2UUCL 4X62L 4A3MG 3PKIA 1HZCA 2YU9H 3CMEA 1L1OC 1S3OA 3S17H 3UDIA 2VW9A 1WJVA 2JE6I 2A6ED 3HFZB 4OONA 5C44G 2UXDQ 2NVTH 5C3EH 3AFPA 1B70B 3I7FA 3FKIH 2R7ZG 2V0FA 1XMQL 5E7NA 1TWGH 1YUXA 2E5LQ 2XJVA 2AWNA 2PPTA 3I4MH 2H5XA 3PSIA 1YJ9A 2OTLA 1VZGA 5H1Sc 3EBEA 3HOWH 3GD7A 2JA9A 2LSSA 3Q8DA 2R93G 2UU9Q 2R92H 1X3EA 2ATWA 1Q1EA 2UXCQ 4GKJQ 3ULPA 4AI2A 1XMOQ 2N3SA 4DV6Q 3RZOH 5AJ3Q 3L0OA 2YTXA 1A63A 3WWVA 1CAAA 2F3IA 4LFAL 4BXXG 2XJTA 1K3RA 1Q7YC 3NEMA 1PA6A 4DAYB 5DM71 1LYLA 2JI3A 4DV3Q 1K8AC 4DR5L 1P8LA 1KAWA 4JAGA 2A69D 5C0XG 4BA1I 2EIFA 4AR3A 2DSXA 4DV5Q 4A4IA 1BRFA 3S24A 4GLXA 1RWDA 3FHWA 4A3BG 2VL6A 4BBSG 5HGQA 4A3MH 2Z3RB 1X6OA 2VS1A 1YIJA 2JA8G 2HR5A 3E9IA 1TWFH 5MLC3 4R4TA 1PH7A 4AYBE 2JK8A 3E9HA 2VY3A 5C44H 5FJ8G 2ZJQA 4DR6L 1C0AA 4IOAA 1BQ9A 3OYYA 3UE0A 3FP9A 4YY3L 1MJCA 4HJ8A 2R7ZH 1PVOA 3RR5A 4AR4A 6RXNA 3KYYA 1HZBA 5M5WH 5M3FG 4AQYQ 1VQ6A 1NE3A 2I5HA 2AMCB 2NVYH 4UP9A 3PF5A 3QVDA 3PIOA 2ZM6Q 1Q86C 1J5EQ 2KHJA 2OQ0A 1I94Q 2C6AA 1R0HA 1HR0Q 3K81C 4JADA 1YUZA 1S24A 4NXML 5C4XG 4IOCA 4XIGS 2NVXH 4JOIA 1S72A 2MFIA 4BXXH 3DLLA 1AH9A 1LKOA 2JA5H 3T1YL 4LWCA 2VQEQ 1C09A 3KJOA 5LMNW 1SFOH 4B3RQ 2KN9A 1VQ8A 1N33Q 1OXUA 4PZ6A 1XTDA 1IRNA 4DV4Q 4JI7L 4IFDJ 3PIP1 4A3BH 1VQFA 3J80c 1SMUA 5LMNQ 2JA8H 4X6AH 3CC4A 4DR1Q 3LNLA 2J9UB 4X64Q 3S15H 5FJ8H 2FXQA 2UUAQ 1P16A 4X66Q 2IT1A 1G6PA 1NTGA 1B13A 4LUOA 1EFWA 3PKJA 1XNRQ 2V1CC 1Y1VH 5IP7G 2RHQB 2E2JH 2PQAB 4JI5Q 2I5LX 4B3SL 1I3QH 2NN6G 1WFQA 4DUYL 4JI1L 1HH2P 1LTLA 2A19A 4LF5L 1AE3A 4NPSA 4DKAC 3MPSA 2C35B 4DV2Q 2MS3A 1R0GA 4JOIC 2XJPA 4JI2L 4JI8Q 4GN4B 5C4XH 2CKAA 2H12A 2GVAA 1UWVA 1PH4A 1IL2A 1KL9A 2CR8A 3RLNA 2AYJA 1JT8A 5H1SE 2HQLA 2AWOA 3RYGA 2JA7G 1GO3E 2UXDL 2VUMG 4JI6L 1H95A 2UUBQ 3JAMc 4IPGA 3ZJYC 4YCWA 3PZAA 3F2DA 4OXPA 3CC7A 1VQ5A 1VQBA 3CQZH 4X65Q 2E5LL 1X56A 4IFDI 4JBMA 1HZAA 2MNAA 3JC66 3UE1A 2PI2A 2CKCA 1QZGA 4GLAC 2UU9L 4IO9A 2IX1A 1PH1A 3P8BA 1PH8A 1IBLQ 4KHPQ 1N8RC 2ERJA 3CPFA 4GKJL 1G51A 2UXCL 4POFA 3ER0A 3KF6A 1XMOL 4DV6L 5AJ3L 1Q12A 3JC62 1X3GA 3NENA 1JMCA 5AI3A 3TREA 3U4ZA 4L5TA 2QEXA 1K73C 3GDEA 1PH3A 2CCZA 1E7ZA 5C4JH 3G71A 1D7QA 4JBJA 1HNWQ 3NELA 4DV3L 5JEAG 3J81c 3I55A 1IBKQ 1YK4A 2VZAA 2JI2A 3UDGA 1YHAA 4Y52H 5C3EG 2LXKA 4DV5L 1ASYA 3S14H 3K8AA 2HHHQ 3J7A5 4DV1L 1KRSA 4BBRG 3GTKH 1SN8A 3U58A 5JVG1 2JA7H 5GAEC 1NXGA 4IPDA 1EQRA 4AHZA 2VUMH 4MNOA 4AR6A 3KF6B 1JJCB 1YEZA 2IHFA 4A3CG 1N34L 1FGUA 4A3IG 1E8JA 4AHXA 2E8GA 1CSPA 3LGJA 1B2JA 1VQEA 5MFPA 3M3YH 3PUVA 1XPUA 1ZRPA 4EQ5A 3U4VA 4YHHQ 4AQYL 2V0EA 2K50A 2HIVA 2ZM6L 1J5EL 4MTNA 3B08B 1I94L 1HR0L 1H7VA 1VQCA 2PMZE 3RNUA 2GMGA 2LXJA 4LF8Q 1NXEA 4LHNA 3TRZA 3PCOB 3CMAA 1I50H 2BA0A 4LUVA 1YITA 2B5ID 2E2IH 2YTVA 1X55A 1WCMH 4JV5Q 3CCLA 1YV1A 2VQEL 1NNQA 3BZKA 4B8CD 4B3RL 1N33L 2V3BB 3G4SA 2RF4A 3RN5A 1CKOA 1X9NA 3RZTA 2WP8J 4DV4L 5IY0A 3K35A 4HIKA 3F2BA 3W1GA 3T1HQ 1BQ8A 2GN5A 3HOXG 5J3BA 3QQCE 4U671 4BBRH 1IU6A 3CD6A 5C0XJ 5LMNL 1CKMA 2XJSA 4AIMA 3IRBA 3PUXA 3J7Y1 4A3DG 3RZDH 3H3VH 4DR1L 2K5HA 5JJIA 4X64L 5GAHc 1IBMQ 4AI3A 4LFCQ 4HIDA 5AN9H 4X66L 4WJ4A 4B3MQ 1Y1WG 1IU5A 8RXNA 4A75A 2Q2IA 1XNRL 4A3CH 1RIPA 4WFN1 3NFPI 4A3IH 3CCQA 2ZTCA 1JB7A 4JI5L 1OTCA 1KC8C 1QZHA 2JEBI 1N9WA 2RDVA 3TQYA 4ALPA 1XNQQ 5FLMG 1DX8A 3KOJA 1LUZA 2JA5G 3CCVA 4QL5A 5AI2A 2OWOA 4IPCA 1NMGA 1K8GA 4DUZQ 4JI0Q 1TXYA 5GADc 2VQFQ 1VQ9A 4IJLA 2KKDA 3A5UA 3KDFB 4JI8L 1PHJA 3BU2A 4LF4Q 1RDVA 4C3IH 2ZTDA 4ME3A 1VQ4A 1UE5A 3PIO1 1MIUA 4IPHA 3AQQA 4OWWB 4JBWA 1PV4A 2KENA 1WYDA 2XJUA 1GVPA 4DR7Q 3KFUA 1V1QA 2UXBQ 2K4KA 1BE7A 2UUBL 3GTJH 1UE7A 1Y1VG 1YI2A 4X65L 2PVEA 1EYGA 2EXDA 3PO3G 3HOXH 3A44A 3RZ6A 5IWAQ 1A0IA 4LFBQ 4A3DH 1VQPA 1V9PA 2Q2UA 1YZ6A 4LF7Q 1IBLL 4A3GG 4KHPL 4PZ8A 4UP7A 4HIMA 1YK5A 4KHZA 3ZG6A 5GROA 4GNXA 5M5XH 1GM5A 2B29A 3PUZA 1Y1WH 3BZCA 3DM3A 1OXTA 1SROA 2PQAA 1JE5A 1PYBA 3J80i 4ZN1B 3K7AH 2O5JD 5GAGc 4LF9Q 5IYBH 3GTPH 2BH8A 5FLMH 3I4OA 2NYDA 1Z92B 1HNWL 3HOYH 4AI1A 1K9MC 1KRTA 1IBKL 2A68D 1IZ6A 2K52A 4P73A 2DGYA 4P74A 2R7FA 2K5NA 4DR4Q 2UUCQ 4AHWA 5JJLA 2HHHL 4JI4Q 4A3LG 1PH5A 1S2ZA 4XGHA 2ASBA 4PG3A 1BBUA 3KYXA 1K0RA 1DGSA 1QYBA 3I4NH 1VQGA 1VQMA 2ES2A 1Q81C 4GNXB 1YJWA 5IP9H 1YNXA 3PGZA 4GS3A 4UY8C 1VQAA 4JCVE 1MKHA 3PO3H 1EUJA 1PH6A 3PUYA 4V196 4A93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCN A;  2L15 A;  4DAM A;  2IHE A;  2JE6 I;  4JBJ A;  4P75 A;  3G71 A;  2CFM A;  2CQO A;  2Q2H A;  2CWP A;  3NEL A;  1VQK A;  1HNW Q;  4DV3 L;  3GTL H;  3HFZ B;  4GNX C;  1VQJ A;  5C0X I;  4OON A;  5JEA G;  5C44 G;  2UXD Q;  3J81 c;  3I55 A;  1XJV A;  1IBK Q;  1YK4 A;  2R6G A;  2VZA A;  3CF5 A;  3UDF A;  1BKB A;  2NVT H;  3UDG A;  4POG A;  1YHA A;  7RXN A;  2MQH A;  3KYW A;  3JAM i;  4A3G H;  2ID0 A;  5C3E H;  3H0G G;  2B3G A;  3AFP A;  1N34 Q;  1M90 C;  1MJE A;  1HR0 W;  1B70 B;  3M85 A;  2N78 A;  3CPW A;  3I7F A;  4Y52 H;  2Q2T A;  1E1O A;  2LXK A;  5C3E G;  3FKI H;  1K83 H;  4UPA A;  2R7Z G;  3A0J A;  4DV5 L;  1ASY A;  2EQS A;  2OQK A;  1U0L A;  1XMQ L;  2ZTE A;  5E7N A;  3S14 H;  4LF8 L;  3MEF A;  3TS2 A;  1TWG H;  3K8A A;  4LUZ A;  3W5O A;  2GVB A;  4B3T L;  2YYZ A;  1JJG A;  1YUX A;  3GTG H;  1BBW A;  2E5L Q;  2HHH Q;  3E0E A;  3J7A 5;  3J7Z C;  2AWN A;  1KQS A;  3I4M H;  2H5X A;  1KRS A;  4DV1 L;  2CCZ A;  4BBR G;  3PSI A;  1YJ9 A;  3ULL A;  2OTL A;  2A8V A;  4AR5 A;  3EBE A;  2ZJP A;  5M3M G;  3HOW H;  3GD7 A;  2JA9 A;  2R93 H;  3GTQ H;  3D0F A;  2MO0 A;  2LSS A;  3Q8D A;  3GTK H;  4JYA Q;  1VQL A;  3PO2 G;  1WI5 A;  4KLK A;  2R93 G;  4JV5 L;  1IYJ B;  4QJF A;  2UU9 Q;  4LW1 A;  3KYH C;  1SN8 A;  3U58 A;  3HOV G;  4R4O A;  2JA7 H;  5GAE C;  2R92 H;  4J15 A;  1LKM A;  1X3E A;  2RHS B;  3EN2 A;  4IPD A;  2ATW A;  1SMM A;  1EQR A;  1Q1E A;  4DPG A;  2VUM H;  4MNO A;  4AR6 A;  4C2M H;  4GKJ Q;  2UXC Q;  4DV7 L;  3CCJ A;  3ULP A;  4P71 A;  2LCQ A;  1IXR A;  2MO1 A;  2Z6K A;  4R4C A;  1E1T A;  4PMW A;  1HZ9 A;  1HNZ L;  3ICE A;  1XMO Q;  3KF6 B;  1JJC B;  1YEZ A;  2IHF A;  2N3S A;  3CCM A;  4DV6 Q;  3S1N H;  5M5Y H;  1JJ2 A;  4JBK A;  5AJ3 Q;  3L0O A;  2YTX A;  4A3J G;  1N34 L;  3RZO H;  1FGU A;  4HIO A;  4OO1 G;  1A63 A;  4A3I G;  3S16 H;  1E8J A;  1I5F A;  3WWV A;  1N32 Q;  2E8G A;  4RG1 A;  1CSP A;  3LGJ A;  3OTO Q;  4HJ9 A;  1B2J A;  4H02 A;  3CP0 A;  3VDY A;  2B63 H;  1CAA A;  2F3I A;  1KIX A;  1R9T H;  4LFA L;  5IE8 A;  1UEB A;  1VQE A;  3PF4 A;  3M3Y H;  4BY7 H;  3HKZ E;  4BXX G;  3F8T A;  3PUV A;  4X62 Q;  1XPU A;  1K3R A;  4XTC S;  3T1H L;  3K7U C;  1Q7Y C;  4A76 A;  1YBY A;  1ZRP A;  1FJG L;  1T9H A;  4EQ5 A;  2D62 A;  4A3L H;  3U4V A;  3NEM A;  3TEH B;  4YHH Q;  1PA6 A;  2F4V L;  4AQY L;  2K50 A;  4DAY B;  4JI3 L;  1LYL A;  1OXX K;  1SLJ A;  1VQN A;  1CKN A;  3J81 i;  3ERS X;  2I5M X;  1X54 A;  4DV3 Q;  5K36 G;  3PWF A;  2HIV A;  2ZM6 L;  1K8A C;  1J5E L;  4WJ3 M;  4DR3 L;  1YHQ A;  5ELO A;  4DR5 L;  4MTN A;  1VCI A;  1I94 L;  1P8L A;  1IBM L;  1KAW A;  4R4I A;  2OCE A;  4LFC L;  4YCV A;  1HR0 L;  1H7V A;  5C0X G;  4JG2 A;  4BA1 I;  3S1M H;  2EIF A;  1PH2 A;  4B3M L;  4AR3 A;  2DSX A;  1VQC A;  1Y14 B;  2PMZ E;  4DV5 Q;  3M4O H;  3RNU A;  1XMQ Q;  2GMG A;  2NZO A;  2LXJ A;  3PUW A;  4LF8 Q;  4DK3 C;  4A4I A;  2AKW B;  2N8N A;  4B3T Q;  1BRF A;  3TRZ A;  3S24 A;  4GLX A;  1RWD A;  4BBS H;  3PCO B;  4MZ9 A;  2WB1 E;  3CMA A;  1X65 A;  4O0A A;  1I50 H;  3FHW A;  4C3H H;  3HOZ H;  2VL6 A;  4YWM A;  1GD7 A;  2BA0 A;  4A3B G;  4LUV A;  4BBS G;  1YIT A;  5HGQ A;  4NXN L;  4DK6 C;  4A3M H;  2E2I H;  1X6O A;  2WAQ G;  1OXS C;  2VS1 A;  2A1A A;  1YIJ A;  2YTV A;  1QUQ B;  2JA8 G;  1G6P A;  2HR5 A;  1X55 A;  1WCM H;  3E9I A;  3W1B A;  1XNQ L;  4JV5 Q;  3CCL A;  1YV1 A;  1TWF H;  4TQU S;  1VQI A;  1UE6 A;  4R4T A;  2VQE L;  1WCM G;  4BY1 G;  2JK8 A;  4AYB E;  1PH7 A;  4YHH L;  4Y7N H;  4A93 H;  1Q82 C;  4OX9 L;  3E9H A;  3S1R H;  2BA1 A;  1NNQ A;  4K0K L;  2VY3 A;  3BZK A;  5C44 H;  2I0Q A;  1E24 A;  5FJ8 G;  4YWK A;  2ZJQ A;  3GTO H;  4A3C G;  4B3R L;  4DUZ L;  1R0I A;  5IYD G;  4RXN A;  4DV7 Q;  4DR6 L;  1C0A A;  4JI0 L;  4QGU A;  1HNZ Q;  4IOA A;  2K14 A;  3M9B A;  1N33 L;  1BQ9 A;  1FHH A;  2V3B B;  3G4S A;  2RF4 A;  3CW2 C;  3H0G H;  3OYY A;  2VQF L;  3CXC A;  3RN5 A;  1CKO A;  4KI0 A;  3UE0 A;  3FP9 A;  1X9N A;  4DR2 L;  3RZT A;  2F52 A;  1MJC A;  4YY3 L;  4HJ8 A;  5RXN A;  2WP8 J;  1RB9 A;  4R1J A;  2R7Z H;  4DV4 L;  5IY0 A;  2JA6 H;  1PVO A;  1TWA H;  3RR5 A;  4LFA Q;  4HIK A;  4AR4 A;  2K75 A;  3F2B A;  2JA6 G;  6RXN A;  4GLV B;  3W1G A;  3F2C A;  2R7D A;  3NBH B;  4LF4 L;  3T1H Q;  3AEV A;  1BQ8 A;  2GN5 A;  3KYY A;  5M3F H;  3HOX G;  5J3B A;  1FJG Q;  1HZB A;  4BBR H;  1IU6 A;  1VQ7 A;  2F4V Q;  5M5W H;  5M3F G;  2YTY A;  5M3M H;  4AQY Q;  4A3F G;  3PIP A;  1VQ6 A;  3CD6 A;  5C0X J;  1NE3 A;  2I5H A;  4YWL A;  1CKM A;  1SRU A;  1PYS B;  1QUQ A;  2AMC B;  2NVY H;  4UP9 A;  5LMN L;  2Z6K C;  3IRB A;  4AIM A;  3PF5 A;  4JI3 Q;  3PO2 H;  3QVD A;  3PUX A;  4BA2 I;  2K2D A;  3PIO A;  3KF8 B;  1SE8 A;  2ZM6 Q;  1Q86 C;  1J5E Q;  2KHJ A;  3RZD H;  3H15 A;  3H3V H;  4DR3 Q;  4DR1 L;  4A3D G;  3U50 C;  1RYT A;  1CKN B;  2N49 A;  3HOV H;  4IFD G;  2OQ0 A;  2OTJ A;  1JYB A;  4DR5 Q;  2K5H A;  1QCV A;  1I94 Q;  1HNX L;  5JJI A;  4DR7 L;  1OXV A;  4X64 L;  1IBM Q;  1R0H A;  4LFC Q;  4HID A;  1HR0 Q;  3KLW A;  1SMW A;  1J6Q A;  2UXB L;  1FHM A;  1G29 1;  4X66 L;  4A3K H;  3K81 C;  4WJ4 A;  1EWI A;  5HY6 A;  4B3M Q;  1Y1W G;  1YUZ A;  1S24 A;  4NXM L;  4A3K G;  1IU5 A;  5C4X G;  4JI7 Q;  8RXN A;  4IOC A;  2Q2I A;  4A75 A;  1XNR L;  4A3C H;  1RIP A;  4A3J H;  4A3I H;  1O7I A;  2NN6 I;  3CCQ A;  2XTI A;  2ZTC A;  4XIG S;  1KHI A;  1JB7 A;  4JI5 L;  2NVX H;  4JOI A;  1OTC A;  1S72 A;  2MFI A;  1C7Y A;  1KC8 C;  4NXN Q;  1QZH A;  4BXX H;  3DLL A;  1YHB A;  1I6H H;  2JEB I;  2NZH A;  3HKS A;  1AH9 A;  1N9W A;  2RDV A;  3TQY A;  3A74 A;  5BR8 L;  1LKO A;  3A5Z B;  4ALP A;  3CCR A;  5JEA J;  4A3E G;  1U5K A;  1XPR A;  1XNQ Q;  2JA5 H;  5FLM G;  3T1Y L;  2NVQ H;  1DX8 A;  5IWA L;  1HJP A;  3KOJ A;  4LWC A;  2VQE Q;  1C09 A;  1LUZ A;  4HJ7 A;  2JA5 G;  1S40 A;  4EX5 A;  3CCV A;  3KJO A;  4OX9 Q;  4QL5 A;  5LMN W;  5AI2 A;  3L2P A;  2OWO A;  4LFB L;  4IPC A;  1NMG A;  4K0K Q;  2KBN A;  1K8G A;  1LM0 A;  2D0O A;  5GAH C;  1SFO H;  1XPO A;  2KN9 A;  4B3R Q;  1GKH A;  4DUZ Q;  1VQ8 A;  4LF7 L;  4DNI A;  3M7N A;  4DR6 Q;  4JI0 Q;  1N33 Q;  1TXY A;  1NY4 A;  1PFS A;  2D0P A;  1OXU A;  1VQH A;  1NBW A;  4PZ6 A;  1XTD A;  2VQF Q;  2K5V A;  1C9O A;  4GOP A;  1VQ9 A;  4IJL A;  4DR2 Q;  3G48 A;  2KKD A;  1B7Y B;  5JJK A;  2WFW A;  1IRN A;  4YY3 Q;  3KDF B;  3A5U A;  4JI8 L;  4DV4 Q;  1PHJ A;  1TWC H;  1CAD A;  4GKK L;  3BU2 A;  1E22 A;  1FL0 A;  4JI7 L;  4LF4 Q;  2JQO A;  1VS0 A;  1RDV A;  4IFD J;  4C3I H;  4LF5 Q;  2ZTD A;  4A3B H;  4ME3 A;  1VQ4 A;  5IYC H;  3KYV A;  4OWX B;  1UE5 A;  1PH9 A;  1VQF A;  1X3F A;  3J80 c;  1SMU A;  1MIU A;  3GTM H;  1LKP A;  5IYC G;  1B71 A;  4IPH A;  5LMN Q;  2JA8 H;  4X6A H;  4LF9 L;  3PV0 A;  3UDX A;  3AQQ A;  3B6Y A;  3CC4 A;  4OWW B;  3I56 A;  3STB C;  4JBW A;  1PV4 A;  3CCS A;  4BY1 H;  4IJH A;  4DR1 Q;  2KEN A;  1VCX A;  1WYD A;  5LMU L;  1HNX Q;  1GVP A;  1EQQ A;  4OO1 I;  3MXN B;  4DR7 Q;  4X64 Q;  3S15 H;  5FJ8 H;  2FXQ A;  4AH6 A;  5GAD C;  2UUA Q;  4LNQ A;  3KFU A;  1V1Q A;  1P16 A;  5IYD H;  2UXB Q;  4X66 Q;  2K4K A;  3ULJ A;  4LF6 L;  2IT1 A;  1Z47 A;  1BE7 A;  1T9O A;  2WAQ E;  1NTG A;  2UUB L;  3S1Q H;  1B13 A;  4LUO A;  3STB D;  5IP7 H;  1W2B A;  1EFW A;  2PYA A;  2E2H H;  4DV0 L;  1QVC A;  4L5Q A;  1XNR Q;  2V1C C;  3GTJ H;  1Y1V H;  1NMF A;  4DR4 L;  1TWH H;  5IP7 G;  1UE1 A;  2RHQ B;  3KDF A;  1EIF A;  4HJA A;  2E2J H;  1UE7 A;  2ALY B;  1Y1V G;  2PQA B;  5FLX c;  1YI2 A;  4JI5 Q;  1QVF A;  4X65 L;  3CC2 A;  2PVE A;  1KD1 C;  2I5L X;  4GN3 B;  4JI4 L;  4B3S L;  2CKZ B;  1I3Q H;  4QIW E;  1EYG A;  2EXD A;  2NN6 G;  1WFQ A;  1L0W A;  3AFQ A;  4YCU A;  4JC0 A;  3G6E A;  4DUY L;  4JI1 L;  3K0X A;  5BR8 Q;  3HOX H;  3KJP A;  3S2D H;  3A44 A;  2PVX A;  1HH2 P;  1LTL A;  1N36 L;  2A19 A;  3T1Y Q;  4LF5 L;  3RZ6 A;  5IWA Q;  4A3F H;  2KHI A;  1AE3 A;  1E3P A;  1SR3 A;  1VQO A;  3RLF A;  2PNH A;  3J81 j;  1A0I A;  4LFB Q;  4A3D H;  3S2H H;  1BFY A;  3CCE A;  1VQP A;  1L1O A;  4NPS A;  4JI6 Q;  2VNU D;  1S30 A;  1V9P A;  2HIX A;  2Q2U A;  1YZ6 A;  4LF7 Q;  1IBL L;  1A62 A;  4DKA C;  4A3G G;  4KHP L;  4OWT B;  3MPS A;  2HT1 A;  2C35 B;  4PZ8 A;  4UP7 A;  2MS3 A;  3I2Z A;  3RLO A;  4DV2 Q;  1R0G A;  4JOI C;  4HIM A;  3CAM A;  1YK5 A;  3FKI G;  4KHZ A;  4JI2 L;  2UUA L;  5GRO A;  4GNX A;  5M5X H;  1GM5 A;  2B29 A;  4JI8 Q;  3PUZ A;  4GN4 B;  4GOP B;  1Y1W H;  5C4X H;  2GVA A;  3BZC A;  4GKK Q;  1UWV A;  1R0F A;  3DM3 A;  4TVA B;  1EIY B;  1PH4 A;  1IL2 A;  1KL9 A;  3I4M G;  1OXT A;  1SRO A;  5DLQ E;  4UP8 A;  2PQA A;  3HOU H;  1JE5 A;  1RDG A;  3AYH B;  4NXM Q;  2PI2 E;  1PYB A;  3J80 i;  3RLN A;  3HOW G;  3HOU G;  2QL0 A;  2JEA I;  1Q1B A;  3K7A H;  1JT8 A;  3RN2 A;  1B2O A;  1VQD A;  5H1S E;  4PZ7 A;  1BVS A;  1CSQ A;  2HQL A;  4A3E H;  4LF9 Q;  5IYB H;  1D8L A;  2BH8 A;  3GTP H;  5FLM H;  2AWO A;  1AE2 A;  3RYG A;  3I4O A;  2IY5 B;  1L2F A;  1KXL A;  2JA7 G;  5IYB G;  4HJ5 A;  1GO3 E;  3M4P A;  1T9P A;  4GOP C;  2R92 G;  3HOY H;  1HNW L;  1K9M C;  1WJJ A;  3HKZ G;  4O2D A;  1YJN A;  4GN5 A;  5LMU Q;  1NJI C;  1Q8K A;  2UXD L;  1KRT A;  2VUM G;  3HOY G;  1IRO A;  3EIV A;  2KCT A;  1IBK L;  1IZ6 A;  2K52 A;  4P73 A;  1WOC A;  3L7Z C;  1R0J A;  4LF6 Q;  3OW2 A;  4JI6 L;  4L5R C;  1H95 A;  4R4Q A;  2DGY A;  4NB3 A;  3JAM c;  4P74 A;  2R7F A;  4APV A;  4IPG A;  2UUB Q;  3ZJY C;  2ZJR A;  2QA4 A;  3CCU A;  4DV0 Q;  3TS0 A;  4QQB X;  2K5N A;  4DR4 Q;  4DV2 L;  4YCW A;  3PZA A;  3F2D A;  4OXP A;  3CC7 A;  1VQ5 A;  3BJU A;  2UUC Q;  2B63 G;  3D31 A;  1ASZ A;  1VQB A;  4BY7 G;  3CQZ H;  3M4Q A;  4X65 Q;  5JJL A;  1YVC A;  2E5L L;  2HHH L;  1CUK A;  4B3S Q;  4JI4 Q;  1B8A A;  1X56 A;  1Q46 A;  4A3L G;  5EAY A;  4IFD I;  4DUY Q;  3SS2 A;  4JI1 Q;  5GAG C;  4JBM A;  5IT9 c;  1HZA A;  2MNA A;  2Z0S A;  4P72 A;  1PH5 A;  3H3V I;  3GO5 A;  3JC6 6;  3PO3 G;  1S2Z A;  3UE1 A;  1N36 Q;  4JYA L;  4FDB A;  2PI2 A;  1QZG A;  4GLA C;  2UU9 L;  1EOV A;  4IO9 A;  4PG3 A;  1QVG A;  2ASB A;  2IX1 A;  4C3J H;  1V43 A;  1PH1 A;  2JJQ A;  3F1Z A;  1DVB A;  2AHO B;  1BBU A;  2WB1 G;  5GQO A;  2M4Y A;  2VW9 A;  2Y0S G;  3KYX A;  1PH8 A;  1K0R A;  1IBL Q;  1RL2 A;  4KHP Q;  1T9Q A;  1N8R C;  1L1O B;  3CPF A;  4GKJ L;  2UXC L;  1G51 A;  4POF A;  1DGS A;  3ER0 A;  1A8V A;  1QYB A;  3KF6 A;  1FVI A;  3I4N H;  3JC6 3;  1VQG A;  1XMO L;  1M1K C;  2XGT A;  4JI2 Q;  3I4N G;  4AYB G;  5ELN A;  1W3S A;  3KYU A;  2CWA A;  4DV6 L;  1VQM A;  5AJ3 L;  2ES2 A;  2DUD A;  1Q12 A;  2YV5 A;  4K9F A;  1Q81 C;  4GNX B;  1YJW A;  4DV1 Q;  5IP9 H;  1N32 L;  3JC6 2;  3OTO L;  1YNX A;  2Y0S E;  3K80 C;  1X3G A;  3PGZ A;  2BH2 A;  2KCM A;  3NEN A;  5IP9 G;  1JMC A;  3HOZ G;  5AI3 A;  4L5S A;  1D7Q A;  2UUC L;  4X62 L;  4GS3 A;  3TRE A;  4A3M G;  4UY8 C;  1HZC A;  1VQA A;  4JCV E;  1SMX A;  3CME A;  1L1O C;  2YU9 H;  1MKH A;  1S3O A;  4QY7 A;  3U4Z A;  4L5T A;  2QEX A;  4RMF A;  3SGI A;  3PO3 H;  1K73 C;  3GDE A;  1EUJ A;  1PH6 A;  3S17 H;  3PUY A;  3UDI A;  1Z9F A;  2QGQ A;  2IX0 A;  1PH3 A;  1E7Z A;  4TPU A;  5C4J H;  4A93 G; 
#chains in the Genus database with same CATH topology
 2RCN A;  3K6O A;  4DAM A;  2IHE A;  3S15 B;  2CFM A;  2CQO A;  2Q2H A;  3ERO A;  4K14 A;  3MSU A;  3J80 L;  4GNX C;  1VQJ A;  4XQN A;  1DM0 B;  4XYQ A;  3LWV B;  2R6G A;  3CF5 A;  3R8B A;  4POG A;  3BZD B;  2MQH A;  3KYW A;  3JAM i;  4A3G H;  1D2B A;  4WOR A;  3M85 A;  2E2J B;  3CPW A;  2C6B A;  5CV7 A;  4C1N K;  5KNB A;  2Q2T A;  4UPA A;  3TME A;  2E2I L;  2KJX A;  2EQS A;  1U0L A;  2IWH A;  1I3Q B;  4LF8 L;  3TS2 A;  2EPB A;  5DAU A;  2YYZ A;  2OT2 A;  2YU9 L;  1BBW A;  1DOL A;  3H9C A;  3EVQ A;  3WOF A;  1KQS A;  1BCP F;  5M3F B;  1K3B C;  2ZJP A;  5CGK A;  3D0F A;  4LHL A;  4JYA Q;  1PRT F;  3PO2 G;  4KLK A;  4JV5 L;  1IYJ B;  2K05 A;  4LW1 A;  3SHL A;  3IAY A;  4K5W A;  4FF2 A;  2XN9 C;  1VMC A;  4J15 A;  1LKM A;  5C3E L;  2RHS B;  3KLS A;  3X3N A;  1JOQ A;  4DPG A;  1QWY A;  3FKI L;  4R4C A;  2LCQ A;  1IXR A;  2QDL A;  4PMW A;  1E1T A;  4RH6 A;  1HZ9 A;  3ICE A;  5C4X B;  5KGU A;  1TWG L;  3S1N H;  5M5Y H;  1JJ2 A;  3BDL A;  2I07 B;  4A3J G;  4BBR L;  4OO1 G;  3NTI A;  1N32 Q;  1EZ8 A;  4RG1 A;  4HJ9 A;  3OTO Q;  1WD1 A;  4H02 A;  2F3V A;  3VDY A;  3A8J E;  4JW0 A;  1JC7 A;  2QW7 A;  5EIN C;  5IE8 A;  1UEB A;  1KIX A;  1VZH A;  3F8T A;  5EKK A;  3GP7 A;  3T1H L;  4MIU A;  4A3L H;  2D62 A;  4EQP A;  3TEH B;  5KIX A;  5D65 A;  1D1K A;  2WII B;  5AFW A;  1HTP A;  3VR3 A;  2F0E A;  2F03 A;  3E3X A;  4QUC A;  3NQI A;  1STG A;  3D4W A;  1SLJ A;  5IGE A;  1CKN A;  3J81 i;  2M6O A;  2Z3Q B;  1YHQ A;  5CC4 A;  4ODG A;  1KDC A;  4A3C L;  1VCI A;  1AW7 A;  3KLS X;  1WD0 A;  1IBM L;  4R4I A;  4A3I L;  2OCE A;  4LFC L;  4YCV A;  3RUZ A;  3RZO L;  4JG2 A;  3S1M H;  1PH2 A;  5IIF A;  1QNU A;  1SYF A;  3CQZ B;  4B3M L;  4ZYS A;  3SVM A;  2KA7 A;  3M4O H;  4UHV A;  4DK3 C;  2AKW B;  4B3T Q;  1E2V A;  4MZ9 A;  3JAM L;  3H91 A;  3NTK A;  1X65 A;  4TSS A;  4C3H H;  4YWM A;  1GD7 A;  1CZG A;  1CQF A;  4E6Y A;  1OXS C;  2DNC A;  2A1A A;  5J39 A;  1QUQ B;  1GUN A;  1SMY C;  1XNQ L;  4TQU S;  2JI1 A;  1UE6 A;  1WCM G;  4BY1 G;  4Y7N H;  4A93 H;  2ERS A;  4ZCK A;  1GUO A;  1TQO A;  1E24 A;  3GTO H;  4YWK A;  2KHS A;  4DUZ L;  1R0I A;  5CR3 A;  4RXN A;  1SMY D;  5IYD G;  4DV7 Q;  4JI0 L;  4QGU A;  1HNZ Q;  1FHH A;  2VQF L;  3HZX A;  5CV8 A;  4HCS A;  1D5M C;  4ABN A;  5K2M E;  2F52 A;  5RXN A;  5IOC A;  2JA6 H;  3GV3 A;  1DYQ A;  2NTS A;  2E75 C;  4R9W A;  4DXG A;  2K75 A;  4A3M L;  3C46 A;  4GLV B;  4FO2 A;  3F2C A;  4LF4 L;  3AEV A;  3NPP A;  1FJG Q;  5C4J B;  1S5E D;  1TWF L;  2F4V Q;  2YTY A;  1ONL A;  3TP7 A;  1SRU A;  1TS5 A;  4FNF A;  1HFG A;  3PO2 H;  2KED A;  4JI3 Q;  4IFD H;  1STY A;  1SNM A;  1SE8 A;  4R8N A;  3TP8 A;  3JC6 3;  4DR3 Q;  1RYT A;  1CKN B;  3BVZ A;  2OTJ A;  1JYB A;  3GTJ L;  4DR7 L;  4CBV A;  1W6K A;  4K2K A;  4U68 A;  2UXB L;  4KKT A;  1FHM A;  1G29 1;  4A3K H;  1EWI A;  3J81 L;  1Y69 U;  4JI7 Q;  5EKI A;  3HOX L;  1RKN A;  4A3J H;  4OO1 H;  1O7I A;  2HDM A;  1KHI A;  3D4D A;  2SDF A;  5M5W L;  3QR8 A;  4K6L A;  4NXN Q;  5JPN C;  1A3U A;  1D5Z C;  3A74 A;  4A3E G;  4AHY A;  3A5Z B;  2B2U A;  2F0V A;  2JA7 B;  2NVQ H;  5IWA L;  1HJP A;  1BBX C;  1EQV A;  4HJ7 A;  2VUM B;  2SNM A;  4OX9 Q;  3L2P A;  3IU3 I;  4LFB L;  4K0K Q;  2KBN A;  3DXJ C;  1LM0 A;  1Y1W L;  4V19 0;  1XPO A;  1GKH A;  4LF7 L;  1V8Q A;  4H44 C;  5CV9 A;  2P5Z X;  1PFW A;  2D0P A;  1GUT A;  2K5V A;  1OWB A;  1C9O A;  4JPB W;  4GOP A;  2A74 C;  4DR2 Q;  3G48 A;  5EPK A;  1B7Y B;  3M3Y B;  5JJK A;  2F0U A;  2M6P A;  1ODH A;  1MSG A;  2G9D A;  3I3C A;  2K01 A;  2MGS A;  3K5M A;  1RF2 D;  3NWT A;  1CAD A;  1SNO A;  1KDA A;  1E22 A;  3GTP L;  1LAB A;  1ICW A;  5FLM L;  1VS0 A;  4LF5 Q;  4XDX A;  4ZKC B;  2JA5 L;  2PMZ B;  5IYC H;  1QIL A;  2RSN A;  1PH9 A;  1FD7 D;  4C3I G;  3NK9 A;  2XSC A;  1I4P A;  2RBM A;  4LF9 L;  3PV0 A;  3UDX A;  4CDF C;  3P2A A;  3D6C A;  3B6Y A;  5KNC A;  4BS9 A;  1ICF B;  2K33 A;  1ILQ A;  1SFO L;  2L11 A;  1RTN A;  4GZY C;  4BY1 H;  4WJW A;  2X6L A;  4TRD A;  2DNE A;  5JVH 3;  1IYV A;  1HNX Q;  3MXN B;  1UUP A;  4ZN3 B;  2L12 A;  5IT9 L;  4LNQ A;  5IYD H;  4LMQ D;  3ULJ A;  3BG3 A;  3R93 A;  1Z47 A;  1T9O A;  3ERQ A;  3C1F A;  1W2B A;  2SNS A;  2PYA A;  5IOD A;  1I50 B;  4DR4 L;  1NMF A;  3HS0 C;  1TWH H;  4IUP A;  3KDF A;  1EIF A;  4DXF A;  4HJA A;  2ALY B;  2E2I B;  5FLX c;  2G9H D;  1KD1 C;  3J7Z 1;  5JVH 1;  2X69 A;  1WCM B;  4JI4 L;  2JA8 L;  4IQZ A;  1L0W A;  3AFQ A;  4JC0 A;  3G6E A;  3OW7 A;  5BR8 Q;  3S2D H;  2PVX A;  4TVM A;  4CDD C;  4MTK A;  1K8O A;  1BR9 A;  5IGB A;  1K8M A;  3S15 L;  5KEE A;  3A7L A;  1EY6 A;  5FJ8 L;  2CW0 C;  3VR5 A;  1OWC A;  2VNU D;  4JI6 Q;  2HIX A;  2XVS A;  2ICE C;  3I90 A;  1A62 A;  4L63 B;  3VYR A;  3I2Z A;  2L9H A;  1Y1V L;  4O1N A;  3CAM A;  4H13 C;  1SBB B;  2UUA L;  2CW0 D;  4GOP B;  1QB5 D;  2B2U C;  3V2T A;  4GKK Q;  1I3Q L;  1R0F A;  4TVA B;  4BBR B;  2L4N A;  5DLQ E;  3HOU H;  4UP8 A;  1XXG A;  3AYH B;  2HQE A;  2QL0 A;  2JEA I;  2EY1 A;  1Q1B A;  1Y8N B;  3K0Y A;  4DFA A;  4A3E H;  1HFN A;  4X3S A;  1I4R A;  4A3G L;  2ICI A;  4B9W A;  1AE2 A;  1DCZ A;  1F2Z A;  1L2F A;  3AU7 A;  2IY5 B;  5IYB G;  1PZJ D;  4HJ5 A;  3M4P A;  1T9P A;  4GOP C;  3BS1 A;  3BDO A;  4IUR A;  1WJJ A;  3HKZ G;  3N6R A;  3Q23 A;  5LMU Q;  4B08 A;  3HOY G;  3EIV A;  2QF7 A;  3W3A A;  3VPB E;  5DM7 3;  1WOC A;  1R0J A;  4LF6 Q;  3OW2 A;  4CKB A;  1JE4 A;  5C4X L;  4A3I B;  4NB3 A;  3AB9 A;  4APV A;  2QA4 A;  3CCU A;  4DV0 Q;  3TS0 A;  3D8G A;  4QQB X;  2BDN A;  3MTS A;  4DV2 L;  5IGC A;  2B63 G;  3BJU A;  2EY2 A;  1ASZ A;  4BY7 G;  3M4Q A;  4JAF A;  2JP1 A;  2PQE A;  1HPC A;  3EFX D;  1F77 A;  4G7Z C;  4DNT B;  2L0C A;  3QWN A;  3SS2 A;  2C5C A;  1AEX A;  3C3L A;  2PYK A;  4DA2 A;  3P1H A;  1N36 Q;  4UY8 1;  4JYA L;  4FDB A;  1VZI A;  4QB4 A;  1EOV A;  1QVG A;  2SOB A;  1EY9 A;  1LT4 D;  1V43 A;  4C3J H;  2JJQ A;  2AHO B;  2WB1 G;  3S1N L;  2M4Y A;  5MFZ A;  1S5B D;  5EPJ A;  1RL2 A;  1T9Q A;  2ZIX A;  3BDC A;  5CYU A;  2FMC A;  4IUN A;  4N8F A;  1FVI A;  5ELE A;  3J7Y W;  5T1G A;  1X32 A;  2XGT A;  3OIP A;  1CHP D;  3I4N G;  1W3S A;  3KYU A;  3CQZ L;  4A3L L;  2DUD A;  2KQ3 A;  2YV5 A;  3FDT A;  4DV1 Q;  1F2L A;  1PDQ A;  3VR6 A;  1N32 L;  3OTO L;  2Y0S E;  3HOZ G;  2KCM A;  5IP9 G;  4L5S A;  1SJH D;  2HD3 A;  2PNR C;  1SMX A;  4QY7 A;  4RMF A;  3SGI A;  1Z9F A;  2QGQ A;  2IX0 A;  1PTO F;  1LO5 D;  4TPU A;  2B8G A;  2L15 A;  4P75 A;  1VQK A;  2GA4 B;  2CWP A;  3GTL H;  2QEJ C;  5C0X I;  4IAL A;  5GAE c;  1VDZ A;  3M7G A;  1XJV A;  3UDF A;  1BKB A;  7RXN A;  2EJF C;  2ID0 A;  3H0G G;  2B3G A;  1N34 Q;  1M90 C;  1F9Q A;  1MJE A;  4KD4 A;  1HR0 W;  2N78 A;  4C3H L;  1E1O A;  4CHT B;  1K83 H;  3A0J A;  4KMU C;  2OQK A;  2ZTE A;  2J0T D;  3MEF A;  4LUZ A;  3W5O A;  2GVB A;  5DNF A;  4B3T L;  3HOX B;  1JJG A;  5DM6 3;  3GTG H;  1GUG A;  2RSO A;  3E0E A;  4KTA A;  3J7Z C;  4RWS C;  2BE5 C;  2A8V A;  3QO2 A;  3ULL A;  4AR5 A;  3TBI B;  5KRU A;  5M3M G;  1DD2 A;  2R93 H;  5C4J L;  3GTQ H;  2WIN B;  1E0B A;  2MO0 A;  2RDG A;  3GTO L;  2OXP A;  1VQL A;  1WI5 A;  2F0D A;  4A3D B;  1ET6 A;  1TR5 A;  2ENB A;  4QJF A;  3KYH C;  4FP5 D;  4ZRZ A;  1AP0 A;  3NE5 B;  3HOV G;  2F0Q A;  4R4O A;  2BE5 D;  1J9O A;  3EN2 A;  1SMM A;  1A3T A;  1CT1 D;  5DM6 1;  4C2M H;  1L0Y B;  3NXW A;  5M5X B;  4DV7 L;  3CCJ A;  1Y1W B;  4P71 A;  2Z6K A;  1HNZ L;  2MO1 A;  4HCE A;  2I0Q A;  2PZW A;  1CA6 A;  2H4O A;  3S14 L;  4ZK9 B;  1NR4 A;  4KN4 C;  4MHE A;  3CCM A;  4HIO A;  1LTA D;  4ID6 A;  3S16 H;  1I5F A;  2B63 H;  1PFY A;  3CP0 A;  3NBH A;  1R9T H;  3K7A B;  2BDO A;  3PF4 A;  4BY7 H;  3PO2 L;  4KY7 A;  2KUM A;  3HKZ E;  2EYH A;  3GTK L;  1EWC A;  4X62 Q;  4XTC S;  3K7U C;  3GTP B;  4A76 A;  1YBY A;  1FJG L;  2R61 A;  1T9H A;  1I4X A;  1IW7 C;  2IL8 A;  2F4V L;  3HOY B;  2JA5 B;  1STE A;  3KF8 A;  1KAB A;  3PQI A;  4JAE A;  3PIP 3;  4JI3 L;  1OXX K;  3MVV A;  3TZU A;  1VQN A;  2SEB D;  3ERS X;  2I5M X;  1X54 A;  5K36 G;  3PWF A;  2K5W A;  5KYI A;  4WJ3 M;  4DR3 L;  4CGY B;  3DWA A;  4NDX A;  5ELO A;  5J1Z A;  1IW7 D;  4A3J L;  5FO9 B;  1NUC A;  4XT3 B;  2Z1C A;  1NNX A;  1FNU A;  3LNN A;  2IPK D;  2XIW A;  2BOS A;  1EIH A;  1Y14 B;  2RVL A;  3M3Y L;  1XMQ Q;  2NZO A;  3PUW A;  2N8N A;  4BBS H;  4XXB B;  2WB1 E;  4NKL A;  4O0A A;  3HOZ H;  5C5L A;  1DOM A;  4NXN L;  4DK6 C;  2JYO A;  4DK0 A;  2WAQ G;  3QG1 A;  1B9N A;  1WTO A;  3W1B A;  4OIK A;  1VQI A;  3EQL C;  4YHH L;  2EY6 A;  1CTM A;  1Q82 C;  4OX9 L;  3S1R H;  3K5N A;  5E4X A;  2BA1 A;  3I4N B;  4K0K L;  5HUR A;  1EU3 A;  1Q90 A;  1FNV A;  3DEO A;  2K14 A;  3M9B A;  4HSV A;  2TMP A;  3CW2 C;  1GHJ A;  3H0G H;  3CXC A;  4KI0 A;  4DR2 L;  1Y1V B;  1WTR A;  4R1J A;  1RB9 A;  3OWF A;  1AZQ A;  1I50 L;  5DEH A;  1TWA H;  4LFA Q;  1I4H A;  3WWN B;  5I4D A;  2JA6 G;  3PO3 B;  1EYA A;  2R7D A;  3A55 A;  3NBH B;  2LKV A;  5FLX E;  1KAA A;  1WCM L;  4BY1 L;  5M3F H;  2PSM C;  3MC0 B;  5I2Y A;  1VQ7 A;  4HAE A;  3T13 A;  5M3M H;  2PMZ P;  4A3F G;  3PIP A;  1LTI D;  4YWL A;  5I6W A;  1PYS B;  1QUQ A;  4JBK A;  2Z6K C;  4BA2 I;  5IYD L;  2K2D A;  1LT3 D;  3BVM A;  3KF8 B;  3VA7 A;  3H15 A;  4A3G B;  4IFD G;  2M4V A;  3U50 C;  3DWP A;  2N49 A;  3HOV H;  3Q0A A;  4DR5 Q;  1Q8I A;  3HG9 A;  1QCV A;  1HNX L;  1O7Y A;  5EGT A;  1OXV A;  2F0N A;  1G8Z D;  2NYZ D;  4ZLT F;  4KKS A;  3PMF A;  3KLW A;  4B9X A;  1SMW A;  4DNR B;  1J6Q A;  4FF4 A;  5HY6 A;  1L0X B;  4A3K G;  4QUF A;  2A6H C;  2NN6 I;  2PW5 A;  2JSO A;  2XTI A;  2HCC A;  1TT2 A;  1U4M A;  4KKU A;  1C7Y A;  1I6H H;  1YHB A;  3FPU B;  1QNK A;  3DMU A;  2NZH A;  3HKS A;  1BXT A;  3R3O A;  4RHS A;  2FIN B;  5BR8 L;  4Z9C B;  3CCR A;  5JEA J;  1U5K A;  2IJ0 A;  4TKO B;  1XPR A;  5D3D A;  3RZD L;  3DM1 A;  2A6H D;  4OHJ A;  1PYW D;  1S40 A;  4EX5 A;  5LL6 X;  2N88 A;  5K36 H;  2D0O A;  5GAH C;  1TU2 B;  1PZK D;  2XJQ A;  4K8I A;  3SEB A;  4DNI A;  3M7N A;  4DR6 Q;  3S1N B;  5M5Y B;  3D3R A;  5F2D A;  3NBI A;  3G7L A;  1NY4 A;  1PZX A;  1PFS A;  1VQH A;  1NBW A;  1SEB D;  3QOJ A;  4IUU A;  3SR1 A;  4AI0 A;  2WFW A;  4YY3 Q;  2XNA C;  1GJX A;  1F2Y A;  3MFG A;  3A7A B;  1TWC H;  4GKK L;  5EIO C;  4A3E L;  1AN8 A;  1FL0 A;  1RYQ A;  5EPL A;  2XJR A;  2OF1 A;  3KUP A;  2JQO A;  4RFB A;  2A5H A;  3KYV A;  4OWX B;  4K5V A;  2F0G A;  1X3F A;  1EZ6 A;  3GTM H;  1LKP A;  5IYC G;  1B71 A;  1DOK A;  3HRZ C;  2EY4 E;  1LTR D;  3I56 A;  1IL8 A;  3STB C;  3CCS A;  4IJH A;  1RD9 D;  1VCX A;  1XX8 A;  5LMU L;  3S1M B;  1EQQ A;  2F0T A;  4OO1 I;  1C48 A;  3LPE B;  5GAD C;  4AH6 A;  4DU9 A;  3M4O B;  1R4Q B;  4LF6 L;  4G57 A;  2O4X A;  2WAQ E;  4DN4 M;  3S1Q H;  3STB D;  5IP7 H;  4NXM Q;  2E2H H;  4DV0 L;  1QVC A;  4L5Q A;  3FDJ A;  4C3H B;  1UE1 A;  3O13 A;  4C3I L;  4HTH A;  1QVF A;  1CZW A;  3CC2 A;  1ENC A;  1HQR D;  4GN3 B;  1VF5 C;  3Q22 A;  1FGB D;  2CKZ B;  4QIW E;  1FR3 A;  4YCU A;  1HCZ A;  3K0X A;  3KJP A;  4A93 B;  3GTJ B;  1N36 L;  5MF6 A;  1O78 A;  3T1Y Q;  4A3F H;  2KHI A;  1A15 A;  1BQQ T;  3X3M A;  1SNQ A;  1E3P A;  1SR3 A;  3GTO B;  3WWL A;  1VQO A;  3RLF A;  2PNH A;  3J81 j;  2DJG C;  4M1U B;  3S2H H;  1BFY A;  3CCE A;  1L1O A;  1M8A A;  4K2L A;  1S30 A;  1PXU A;  3T56 B;  3MXN A;  4OWT B;  2HT1 A;  1U4R A;  3RLO A;  2B8F A;  3FKI G;  1G2S A;  2F0P A;  4XT1 B;  3S14 B;  1HTL D;  4X3K A;  1EIY B;  4RGT A;  3I4M G;  3A8K E;  2B2W A;  1LTG D;  2V4D A;  1RDG A;  2PI2 E;  2RFK B;  3HOW G;  3HOU G;  3OPO A;  3PO2 B;  1PFM A;  3GTK B;  3RN2 A;  2A73 B;  1B2O A;  3B0A B;  1VQD A;  3WDN A;  2L55 A;  3FRP B;  4PZ7 A;  1BVS A;  1CSQ A;  1D8L A;  4A3D L;  1JB3 A;  3MHB A;  1HQM C;  1KXL A;  3MXP A;  1D6E C;  2R92 G;  1YJN A;  4O2D A;  1SND A;  3CHB D;  4GN5 A;  1NJI C;  1Q8K A;  1SE3 A;  4A3K B;  5NUC A;  1IRO A;  2KCT A;  1JWM D;  2E2D C;  1H9S A;  3L7Z C;  3OMG A;  5M5X L;  3GTG L;  4ILW A;  4A3J B;  4L5R C;  4R4Q A;  3J7A F;  2ZJR A;  2EYJ A;  1SYE A;  1B2T A;  3GTQ L;  4I7Z C;  4GS7 D;  5COR A;  3D31 A;  2L0Z A;  1YVC A;  1TS2 A;  4I65 A;  3K7A L;  4BWG B;  1CUK A;  4B3S Q;  1B8A A;  1F9R A;  1SYG A;  1Q46 A;  2NTT A;  3U9S A;  2NVQ B;  5EAY A;  4DUY Q;  1BO0 A;  4G7O C;  5IYB L;  3LWE A;  4JI1 Q;  5GAG C;  5IT9 c;  2E74 C;  2Z0S A;  4P72 A;  1WTP A;  3H3V I;  3GO5 A;  4CKE A;  3HOY L;  1BDO A;  3I72 A;  1RJT A;  2R3Z A;  3BYY B;  1G91 A;  3F1Z A;  1DVB A;  2F3W A;  5GQO A;  4G6B A;  4C3J G;  5MGN A;  4KJO A;  2Y0S G;  2B2Y A;  3S16 L;  1BNZ A;  2B2T A;  1L1O B;  1HHV A;  4LAA A;  1A8V A;  2VXW A;  4BY7 L;  2F0H A;  4HED A;  1M1K C;  4JI2 Q;  1QE6 A;  3MAQ A;  3T51 B;  3HAX C;  1EEF D;  2K32 A;  2OEO A;  5ELN A;  2CWA A;  4KD3 A;  4AYB G;  3JR7 A;  4K9F A;  3K80 C;  3PL5 A;  4DAP A;  2BH2 A;  3DUZ A;  1W6J A;  2UUC L;  1MI2 A;  2A6E C;  4X62 L;  2E76 C;  2EYM A;  1LLR D;  3PKI A;  4A3M G;  1HZC A;  2YU9 H;  3CME A;  1L1O C;  1S3O A;  4BY1 B;  3C1E A;  3S17 H;  2K04 A;  3UDI A;  3HKZ P;  2VW9 A;  1WJV A;  4NMZ A;  3NUC A;  2JE6 I;  1F9S A;  4ZQ3 A;  1Z6H A;  2A6E D;  2KVM A;  3HFZ B;  3MXU A;  4OON A;  5C44 G;  2UXD Q;  4K8J A;  3I4N L;  4DK1 A;  2NVT H;  4ME5 A;  4QF4 A;  2EYP A;  3N52 A;  3W2D A;  4IN3 A;  1EIG A;  1SYB A;  2B2W C;  1H9S B;  1TWH B;  3AFP A;  5C3E H;  3OIQ A;  1B70 B;  3VYS A;  3I7F A;  3HOZ L;  5IP9 L;  3MEH A;  1V1O A;  3FKI H;  2R7Z G;  2V0F A;  2LFN A;  1XMQ L;  1B53 A;  5E7N A;  2KEE A;  4FVM A;  1TWG H;  3ND8 A;  3IFT A;  1YUX A;  3S2D B;  2E5L Q;  3PO3 L;  1H9K A;  2XJV A;  2AWN A;  2PPT A;  3GQB A;  2H5X A;  4CJ1 B;  3I4M H;  3MQK B;  2PCF B;  3PSI A;  1YJ9 A;  2OTL A;  1VZG A;  5H1S c;  3S1R L;  3EBE A;  3HOW H;  3GD7 A;  2JA9 A;  2N55 A;  2LSS A;  3Q8D A;  5FLX L;  2M9V A;  5I9O A;  2R93 G;  2UU9 Q;  4C1N I;  3K5O A;  3MXG A;  3RZD B;  3H0G L;  3BVG A;  1EY5 A;  2R92 H;  1X3E A;  5BN4 A;  2ATW A;  4PMB A;  2EOT A;  1Q1E A;  2NZ1 D;  1U9R A;  1C8C A;  4GKJ Q;  2UXC Q;  1A6X A;  4LJZ C;  3ULP A;  4AI2 A;  1XMO Q;  5K5P A;  1QOH A;  5D3I B;  1BUV T;  2N3S A;  4NP5 A;  1RTO A;  4DV6 Q;  3RZO H;  5AJ3 Q;  3L0O A;  2YTX A;  3HOU B;  1QQT A;  1MSH A;  1A63 A;  1JIC A;  1YNN C;  3WWV A;  4FF1 A;  1RHP A;  1JQY D;  2AQ2 B;  3C2P A;  1CAA A;  2F3I A;  2Q8I B;  4LFA L;  3H3V C;  5EKL A;  5I9P A;  2DY8 A;  1PFV A;  4BXX G;  2XJT A;  4A3E B;  1K3R A;  1H9M A;  1Q7Y C;  3V96 A;  4OEM B;  5C6A A;  1WTX A;  2O2L D;  1CK1 A;  1M4V A;  1MD2 D;  3NEM A;  2B2Y C;  1PA6 A;  3BYT B;  5G3L D;  2B2T C;  1YNN D;  2A69 C;  4DAY B;  1ENF A;  2MHV A;  3I8Z A;  5DM7 1;  3G6J B;  1LYL A;  5ELC A;  2JI3 A;  4DV3 Q;  1K8A C;  1I6V C;  2LS0 1;  2Z4I A;  1PFU A;  4RKL A;  4DR5 L;  3LX0 A;  1EWH A;  1P8L A;  1KAW A;  4JAG A;  2A69 D;  5M5Y L;  5C0X G;  3JAM E;  1ROD A;  4BA1 I;  4EQN A;  2EIF A;  4AR3 A;  2QDB A;  2DSX A;  1EYC A;  1LTS D;  3K59 A;  4DV5 Q;  1KLG D;  1B50 A;  4A4I A;  1BRF A;  3S24 A;  4K5X A;  1RWD A;  4GLX A;  2DN8 A;  3FHW A;  4C3I B;  4A3B G;  2VL6 A;  4BBS G;  5HGQ A;  4A3M H;  2Z3R B;  1X6O A;  2VS1 A;  2F0S A;  4C3J B;  2VB2 X;  2CH4 A;  1VF7 A;  1YNJ C;  2F0I A;  2Y0S B;  2HR5 A;  1YIJ A;  2JA8 G;  3E9I A;  1GUS A;  1S5F D;  2AUS B;  1KNA A;  1TWF H;  5MLC 3;  4R4T A;  1PH7 A;  1QCB D;  3LWP B;  2JK8 A;  4AYB E;  1TY0 A;  4PQX A;  5ISR A;  1Q3L A;  4WRD A;  3E9H A;  2VY3 A;  2RA4 A;  1G6Z A;  5C44 H;  3S1M L;  5FJ8 G;  2ZJQ A;  2ZXR A;  1YNJ D;  4DR6 L;  1C0A A;  4CKC A;  4IOA A;  1BQ9 A;  3M4O L;  1TKW B;  3OYY A;  5FOB B;  4K6D A;  3UE0 A;  3FP9 A;  2K6A A;  5JPM C;  4YY3 L;  1MJC A;  4HJ8 A;  1UEA B;  2MJ8 A;  3VYU A;  2R7Z H;  1O80 A;  2EY5 A;  3VR2 A;  3GTM L;  1PVO A;  3RR5 A;  4AR4 A;  4KN7 C;  6RXN A;  1SYD A;  4KY6 A;  2EYL A;  3KK7 A;  3KYY A;  5KND A;  1HZB A;  5EBD A;  5M5W H;  5M3F G;  4AQY Q;  4Y7N L;  4A93 L;  1CM9 A;  1NE3 A;  1VQ6 A;  3GTL B;  2I5H A;  2AMC B;  2RQX A;  1NR2 A;  2NVY H;  4RHR A;  4UP9 A;  3PF5 A;  3QVD A;  3PIO A;  5E4W C;  2PZU A;  2ZT9 C;  3L9A X;  2ZM6 Q;  1Q86 C;  1J5E Q;  1JOK A;  2KHJ A;  3S1Q L;  2Z9H A;  2OQ0 A;  1I94 Q;  2C6A A;  1R0H A;  1HR0 Q;  4ZUI A;  3K81 C;  4JAD A;  1ZKO A;  2J4X A;  2Z8L A;  2JA6 L;  3URY A;  1OO9 B;  1YUZ A;  1S24 A;  2HDL A;  2QIL A;  4NXM L;  3GTG B;  5C4X G;  4IOC A;  2K7V A;  4XIG S;  1NSN S;  4A3F L;  2F0M A;  3GTQ B;  4HMI A;  1PTO H;  2NVX H;  3I70 A;  1KDB A;  4JOI A;  2XWB B;  2BCO A;  1S72 A;  2MFI A;  2EDG A;  4BXX H;  3DLL A;  1R4P B;  1AH9 A;  1LKO A;  1EY8 A;  2JA5 H;  3T1Y L;  3R2I A;  3QOL A;  2PO4 A;  4LWC A;  3HKZ B;  2VQE Q;  1C09 A;  4C2M B;  3KJO A;  5LMN W;  2F0F A;  4MN3 A;  2NUC A;  5E1F A;  5C4Z A;  1SFO H;  4B3R Q;  2KN9 A;  4A3K L;  4IUQ A;  5CMD A;  2D5D A;  2KCC A;  5CV4 A;  1VQ8 A;  5FK9 C;  1N33 Q;  1QG7 A;  4DGZ A;  3S16 B;  1OXU A;  4PZ6 A;  1XTD A;  1O7L A;  5C0X H;  2B63 B;  4CDC C;  4BY7 B;  1HRJ A;  1IRN A;  4DV4 Q;  2B2V A;  2FFK B;  4RA8 A;  4Q5V A;  3ONA B;  4JI7 L;  4IUT A;  3PIP 1;  4IFD J;  2LMC B;  4A3B H;  2NVQ L;  3A56 A;  2NBF A;  1VQF A;  2ZXP A;  3J80 c;  1SMU A;  3OOC A;  1B3Q A;  2FHT A;  5LMN Q;  5IT9 E;  2G5D A;  2JA8 H;  4X6A H;  4FXK C;  2WB1 B;  4S3S A;  3CC4 A;  5CBE E;  2X6G A;  3SXH A;  5JJZ A;  1IKM A;  4DR1 Q;  4I7A A;  2PW7 A;  3LNL A;  2J9U B;  4X64 Q;  3S15 H;  3H99 A;  1KLU D;  5FJ8 H;  2FXQ A;  2UUA Q;  2EVB A;  1EY7 A;  3F2U A;  1P16 A;  5C5M A;  4X66 Q;  2IT1 A;  1TVX A;  1G6P A;  1NTG A;  2CHB D;  1B13 A;  4LUO A;  1EFW A;  4BBS B;  1SE4 A;  3PKJ A;  4OIJ A;  1ZXT A;  3TSS A;  1XNR Q;  2V1C C;  1Y1V H;  3HOZ B;  4J1M A;  3QJY A;  5IP7 G;  2RHQ B;  3R2T A;  2E2J H;  2PQA B;  3SK5 A;  4JI5 Q;  5IYC L;  1IYU A;  1F9P A;  4QCL A;  2I5L X;  3NQT A;  5E3F A;  1LTT D;  4ULL A;  4B3S L;  1I3Q H;  1XTC D;  2NN6 G;  1WFQ A;  4DUY L;  3MZ5 A;  4JI1 L;  1S5C D;  1HH2 P;  1LTL A;  3S1R B;  2A19 A;  4LF5 L;  2RDH A;  4G4K A;  1AE3 A;  2KEC A;  2J7Z A;  5EBC A;  2L1B A;  4KY5 A;  3U9O A;  3H0G B;  4NPS A;  1S5D D;  3RMH A;  1V1P A;  4DKA C;  3MPS A;  3OWE B;  3K57 A;  2C35 B;  3SK8 A;  5CV6 A;  2MS3 A;  1KTK A;  5TSS A;  4DV2 Q;  1R0G A;  4JOI C;  5CV5 A;  1TWH L;  2XJP A;  1JWU D;  4JI2 L;  1TWA B;  1EEI D;  2KOL A;  5A35 A;  4JI8 Q;  4GN4 B;  5C4X H;  2CKA A;  2H12 A;  2F0K A;  2GVA A;  3S17 L;  1UWV A;  3NSW A;  1PH4 A;  1IL2 A;  1KL9 A;  2CR8 A;  1SYC A;  5M3M B;  3S2D L;  2IX3 A;  2EZV A;  1H9J A;  5KYL A;  3RLN A;  2F1M A;  4V0B A;  2AYJ A;  1JT8 A;  1AZP A;  5H1S E;  2NVT L;  2HQL A;  4RGN A;  3VYT A;  3HOV B;  1FYC A;  2CQA A;  2AWO A;  3CRL C;  3RYG A;  5I2X A;  2JA7 G;  1GO3 E;  2EYO A;  1EU4 A;  1CA5 A;  2UXD L;  2VUM G;  1SAP A;  1T5X D;  2B2V C;  1PMR A;  3H6M A;  1BF4 A;  4JI6 L;  1H95 A;  5ELB A;  3I4M L;  3NHH A;  3JAM c;  2UUB Q;  4IPG A;  2Q8R E;  3ZJY C;  2TSS A;  5T1I A;  1JOR A;  3ITP A;  1F2M A;  4FXG C;  3HOW L;  3HOU L;  4YCW A;  3PZA A;  1IKL A;  4OXP A;  3F2D A;  3CC7 A;  1VQ5 A;  5BN3 A;  3WOE A;  1I6H B;  1VQB A;  3NP8 A;  3CQZ H;  4X65 Q;  3TDQ A;  2E5L L;  1B3A A;  3FPP A;  2VB3 X;  1X56 A;  4IFD I;  3DHQ A;  2R92 L;  2Z6B A;  4JBM A;  1HZA A;  3OSO A;  4UDU C;  2MNA A;  3LWO B;  3JC6 6;  4RAU C;  3UE1 A;  2L5T A;  2PI2 A;  2CKC A;  1QZG A;  4GLA C;  2O5I C;  2UU9 L;  2F4I A;  3CKI B;  4IO9 A;  2IX1 A;  1PH1 A;  3P8B A;  5LL6 S;  1I4G A;  1PFN A;  1E2Z A;  2HVY C;  1O7Z A;  1PH8 A;  1AFP A;  1IBL Q;  4KHP Q;  5IGD A;  1BCP B;  1N8R C;  2ERJ A;  1GOZ A;  3CPF A;  1G51 A;  4GKJ L;  2UXC L;  4POF A;  4M8A A;  3ER0 A;  1V1P B;  3I73 A;  3KF6 A;  4P2C B;  2PZT A;  1TWC B;  1XMO L;  1PRT B;  4DV6 L;  4PMC A;  3SK4 A;  5AJ3 L;  1Q12 A;  2H1E A;  3ZYY X;  2AUJ D;  2AUK A;  3JC6 2;  5C3X A;  5BN5 A;  1X3G A;  1D1I A;  3NEN A;  1JMC A;  5AI3 A;  2DY7 A;  2WAQ B;  3GTM B;  3TRE A;  4N9P A;  2KCN A;  1BCP C;  2NN6 H;  3U4Z A;  3VR4 A;  4HR7 B;  4L5T A;  2QEX A;  1MHW C;  1EY0 A;  5LHY 1;  3GDE A;  1K73 C;  4C3J L;  1II3 A;  1PH3 A;  1E7Z A;  2CCZ A;  1RDP D;  4UAI A;  5C4J H;  1PRT C;  3G71 A;  3HJY B;  1D7Q A;  4JBJ A;  4Y7N B;  2JXM B;  1HNW Q;  3NEL A;  4QIW B;  2Z4H A;  3D4R A;  4DV3 L;  1ZEQ X;  5JEA G;  1MGS A;  3J81 c;  1BCP D;  3I55 A;  1IBK Q;  1YK4 A;  2VZA A;  3S1Q B;  3OHX C;  2JI2 A;  3KBG A;  3UDG A;  1YHA A;  2E2H B;  1STB A;  2M2L A;  2EJM A;  1PRT D;  1DZ1 A;  4Y52 H;  5C3E G;  2LXK A;  4E6I A;  3E5S A;  2WKC A;  2RDF A;  1A3V A;  5JVG 3;  4DV5 L;  1ASY A;  2JA6 B;  3S14 H;  2WV6 D;  5M9O A;  4F7X A;  3K8A A;  4J6H A;  1QJO A;  3L3O C;  1PZI D;  2C9O A;  2HHH Q;  3J7A 5;  1B4O A;  3LWQ B;  1B9M A;  4JK1 C;  4DV1 L;  1KRS A;  4BBR G;  4A3F B;  2AQC A;  3KBX A;  3GTK H;  3T4A C;  1BOS A;  5C44 L;  1Y8O B;  1GHK A;  3GTL L;  3S2H B;  4LK1 C;  2Y0S P;  1SN8 A;  3IKJ A;  3U58 A;  3H94 A;  2F0O A;  5C3W A;  5JVG 1;  3KLR A;  4RCO A;  2JA7 H;  1KNE A;  2CVR A;  5GAE C;  1NXG A;  4IPD A;  1EQR A;  4AHZ A;  2IW3 A;  2R7Z L;  2VUM H;  4MNO A;  4AR6 A;  4N8X 1;  4AYB P;  1K83 L;  3FEW X;  2F0L A;  2F0J A;  3CRK C;  3HP3 A;  4FYD A;  3KF6 B;  5IGG A;  1JJC B;  1YEZ A;  2IHF A;  1A2T A;  4A3C G;  5IGF A;  1EYD A;  4C56 C;  4F87 A;  1I4Q A;  1FGU A;  1N34 L;  4A3I G;  1STA A;  1XYI A;  1E8J A;  4AHX A;  2HUG A;  2E8G A;  1CSP A;  3LGJ A;  1B2J A;  5CBA E;  3I4L A;  2NVY L;  5HGT A;  1VQE A;  5MFP A;  3M3Y H;  2R93 L;  3PUV A;  1XPU A;  1Y8P B;  2JN4 A;  1ZRP A;  1ILP A;  4EQ5 A;  1DON A;  3U4V A;  4YHH Q;  5A2Q E;  4AQY L;  2V0E A;  2K50 A;  4L6T B;  3DEP A;  1WVL A;  4HMJ A;  4CJ2 C;  2HIV A;  2ZM6 L;  1J5E L;  1ET9 A;  1HA6 A;  4MTN A;  3B08 B;  1I94 L;  2QCP X;  1EQT A;  1JOO A;  4DAV A;  1HR0 L;  1H7V A;  2NVX L;  1G2T A;  5G3L F;  2B63 L;  4BXX L;  1VQC A;  1R9T L;  2PMZ E;  1DJR D;  3RNU A;  2GMG A;  2LXJ A;  4LF8 Q;  1NXE A;  4LHN A;  4G7H C;  3TRZ A;  1RCV D;  3PCO B;  2FJ2 A;  3CMA A;  1I50 H;  2BA0 A;  1HUN A;  4LUV A;  1YIT A;  2B5I D;  1TII D;  4N9T A;  3HGB A;  4IZ8 A;  2E2I H;  5FO7 B;  2YTV A;  4ZUJ A;  5JAV A;  1X55 A;  2EXZ A;  1TS3 A;  1WCM H;  3NTH A;  3J80 E;  4JV5 Q;  3CCL A;  1YV1 A;  4IUV A;  2XWJ B;  1SJE D;  2VQE L;  4DAY A;  4CJ0 B;  1UAP A;  1NNQ A;  3BZK A;  1ZYR C;  4B8C D;  5JEA H;  4B3R L;  4U67 3;  3A8I E;  1N33 L;  2V3B B;  2Q8T A;  4RKB A;  3G4S A;  2RF4 A;  5I6Y A;  3RN5 A;  1CKO A;  1X9N A;  4A3B L;  4CDE C;  4BBS L;  3RZT A;  1SNC A;  2WP8 J;  3MFY A;  2WAC A;  1ZYR D;  2FMM A;  4DV4 L;  5IY0 A;  1A2U A;  2D2C C;  5JOB A;  3K35 A;  2YU9 B;  4X6A L;  4HIK A;  4RGM A;  3F2B A;  3W1G A;  3LWR B;  3S17 B;  3T1H Q;  1BQ8 A;  2B39 A;  2GN5 A;  3LWU A;  3HOX G;  5J3B A;  3IFD A;  3QQC E;  4U67 1;  4BBR H;  1IU6 A;  1U4P A;  3CD6 A;  5C0X J;  3MA2 B;  3FVQ A;  1CKM A;  4KK7 A;  5LMN L;  1GUW A;  2XJS A;  4KHV A;  1HA5 A;  3IRB A;  4AIM A;  4WFN 3;  2RCF A;  4KV6 A;  3PUX A;  2NVT B;  3J7Y 1;  1CHQ D;  3P75 A;  2WB1 P;  4A3D G;  3RZD H;  1JR0 D;  3H3V H;  4DR1 L;  5C3E B;  3H9B A;  1K28 A;  2K5H A;  1FNW A;  5JJI A;  3OMC A;  4X64 L;  5GAH c;  1IBM Q;  4AI3 A;  1ENA A;  2E2J L;  3EJI A;  3FKI B;  4LFC Q;  4HID A;  5AN9 H;  3A54 A;  1P7P A;  4X66 L;  4WJ4 A;  2D9U A;  1TWG B;  4H0L C;  4B3M Q;  5COY A;  1Y1W G;  1TWA L;  2LY7 A;  1IU5 A;  4Q0F A;  8RXN A;  4A75 A;  2Q2I A;  1SDF A;  2K03 A;  1XNR L;  3I4M B;  4A3C H;  1RIP A;  4PV1 C;  4X3U A;  4WFN 1;  3NFP I;  4A3I H;  1SSO A;  5M3F L;  3CCQ A;  2ZTC A;  3HOW B;  1JB7 A;  4JI5 L;  3NWS A;  1OTC A;  5M3M L;  1CQV A;  1HXY D;  1HUM A;  1KC8 C;  1QZH A;  2WKD A;  5L37 A;  2JEB I;  4C2M 1;  4H7B A;  1CI3 M;  1N9W A;  2RDV A;  1H9R A;  3TQY A;  4ALP A;  1WTQ A;  1X3Q A;  1X3P A;  3HEJ A;  3J7A V;  1XNQ Q;  5FLM G;  1IHZ A;  2K5D A;  1DX8 A;  2R92 B;  4RCN A;  5EQ0 A;  3HOV L;  3KOJ A;  1LUZ A;  4KJN A;  2JA5 G;  3ND9 A;  3SDZ A;  2MUY A;  3CCV A;  1K0S A;  4QL5 A;  5AI2 A;  2OWO A;  1EY4 A;  4XQQ A;  1SE2 A;  1NMG A;  4IPC A;  4XYO A;  1K8G A;  2EE1 A;  4NW2 A;  2K5Q A;  1GXD C;  3P20 A;  4DUZ Q;  3P7J A;  4JI0 Q;  2RKS A;  3RZO B;  3PIO 3;  1TXY A;  5GAD c;  4QMG A;  2VQF Q;  1PLF A;  2AQ1 B;  1VQ9 A;  1STH A;  4IJL A;  2KKD A;  3A5U A;  3KDF B;  4JI8 L;  1PHJ A;  3I91 A;  1I6H L;  4L8J A;  3BU2 A;  5FKA C;  3T53 B;  4LF4 Q;  1RDV A;  4C3I H;  2ZTD A;  1ESF A;  4ME3 A;  1VQ4 A;  2AQ3 B;  3DWQ A;  1UE5 A;  3PIO 1;  1MIU A;  3TP6 A;  4IPH A;  1LT6 D;  3FMC A;  3AQQ A;  4OWW B;  2K1B A;  2ZXO A;  4JBW A;  1PV4 A;  3EA6 A;  3TZD A;  2KEN A;  1EOT A;  1WYD A;  2XJU A;  3TN2 A;  1GVP A;  3TP5 A;  2APO B;  1E2W A;  4DR7 Q;  1CFM A;  3D6W A;  4OL7 A;  4F88 A;  3AMU A;  3KFU A;  1V1Q A;  4AYB B;  5J22 A;  2UXB Q;  2K4K A;  3SE0 A;  1BE7 A;  1TWC L;  2UUB L;  3IL8 A;  4F8M A;  1DXM A;  3GTJ H;  1B1Z A;  2NWG A;  2MP1 A;  1UE7 A;  2NB0 A;  1S4Z A;  1Y1V G;  3Q24 A;  4A3M B;  1YI2 A;  1ESR A;  2F0W A;  4X65 L;  2PVE A;  4JVZ A;  2PPB C;  2EYF A;  3T16 A;  1D5X C;  1EYG A;  1LT5 D;  1TWF B;  2EXD A;  3PO3 G;  4XQJ A;  2EJG C;  3HOX H;  2CH4 W;  3A44 A;  4EVO A;  4FXD A;  3RZ6 A;  1JWS D;  5IWA Q;  5C44 B;  1C4Q A;  1A0I A;  4LFB Q;  4A3D H;  2HCI A;  4J8Q A;  1VQP A;  1LTB D;  1V9P A;  2XRS D;  2Q2U A;  1YZ6 A;  4LF7 Q;  4EQO A;  1IBL L;  4A3G G;  3J81 E;  1WTH A;  4KHP L;  1LV9 A;  1TS4 A;  2MPM A;  5IP7 L;  4PZ8 A;  1EL0 A;  2E2H L;  4UP7 A;  2R7Z B;  5ELF A;  4HIM A;  1YK5 A;  4KHZ A;  1K83 B;  1MBY A;  3ZG6 A;  1UNS A;  4EGV A;  5GRO A;  3MWY W;  5M5X H;  4GNX A;  1GM5 A;  2B29 A;  3PUZ A;  1Y1W H;  2O5J C;  1EFI D;  4R8I A;  3BZC A;  3DM3 A;  3Q6S A;  5EJW A;  1OXT A;  1SRO A;  5M5W B;  2PQA A;  1JE5 A;  3K5L A;  1PYB A;  3J80 i;  4ZN1 B;  2NVY B;  2WAQ P;  1SNP A;  2R93 B;  3H97 A;  1TY2 A;  1LAC A;  3K7A H;  2O5J D;  2A68 C;  5GAG c;  4LF9 Q;  4OEL B;  5IYB H;  3GTP H;  2BH8 A;  1ML0 D;  3S2H L;  1J8I A;  1WTW A;  5FLM H;  3I4O A;  4HSP A;  3H09 A;  3QB3 A;  2NYD A;  1Z92 B;  1HNW L;  3HOY H;  4Y52 L;  4AI1 A;  2K28 A;  1NAP A;  1K9M C;  3K58 A;  1WTV A;  4QIW P;  4ZAI A;  1KRT A;  2XRQ D;  1F4L A;  1IBK L;  3M4Y A;  2A68 D;  1IZ6 A;  1SXT A;  2K52 A;  4P73 A;  3E6Z X;  3UI2 A;  2DGY A;  2I46 A;  4P74 A;  2R7F A;  4OGQ C;  4XXE A;  1PTO B;  2NVX B;  2K5N A;  4DR4 Q;  4PNY A;  2UUC Q;  4AHW A;  1T5E A;  1R9T B;  4YIJ A;  5JJL A;  3GV6 A;  2HHH L;  4JI4 Q;  4A3L G;  4DF7 A;  2M00 A;  2JA7 L;  1PH5 A;  1S2Z A;  4XGH A;  2VUM L;  1B44 D;  4X3T A;  4RGO S;  3CU7 A;  1SFO B;  3VA5 A;  2ASB A;  4PG3 A;  1PTO C;  2QKI C;  1XWE A;  1JCK B;  5A2Q L;  5FO8 B;  1BBU A;  3H3V M;  4O42 A;  2DJF C;  3KYX A;  1K0R A;  3S9W A;  5C4H A;  1PFB A;  1DGS A;  3V05 A;  3E0J A;  1QYB A;  3I4N H;  1VQG A;  1PTO D;  4ZKB B;  5D14 A;  1VQM A;  2ES2 A;  3HJW B;  1VMP A;  1Z7T A;  1Q81 C;  4GNX B;  1YJW A;  5IP9 H;  5ELD A;  4A3B B;  1YNX A;  1U4L A;  3PGZ A;  3QIA A;  4C3H G;  3SK6 A;  4FF3 A;  2JA8 B;  4GS3 A;  4UY8 C;  3RD4 A;  1VQA A;  4JCV E;  1MKH A;  3PO3 H;  1EUJ A;  1PH6 A;  1STN A;  1NCV A;  3PUY A;  4HN7 A;  4V19 6;  4A93 G; 
#chains in the Genus database with same CATH homology
 2RCN A;  4DAM A;  2IHE A;  2CFM A;  2CQO A;  2Q2H A;  3MSU A;  4GNX C;  1VQJ A;  2R6G A;  3CF5 A;  4POG A;  2MQH A;  3KYW A;  3JAM i;  4A3G H;  3M85 A;  3CPW A;  2C6B A;  2Q2T A;  4UPA A;  2EQS A;  1U0L A;  4LF8 L;  3TS2 A;  2YYZ A;  1BBW A;  1KQS A;  2ZJP A;  3D0F A;  4LHL A;  4JYA Q;  3PO2 G;  4KLK A;  4JV5 L;  1IYJ B;  4LW1 A;  4J15 A;  1LKM A;  2RHS B;  4DPG A;  4R4C A;  2LCQ A;  1IXR A;  3ICE A;  4PMW A;  1E1T A;  1HZ9 A;  3S1N H;  5M5Y H;  1JJ2 A;  4A3J G;  4OO1 G;  1N32 Q;  4HJ9 A;  4RG1 A;  3OTO Q;  4H02 A;  3VDY A;  1KIX A;  5EIN C;  5IE8 A;  1UEB A;  1VZH A;  3F8T A;  3T1H L;  4A3L H;  2D62 A;  3TEH B;  1SLJ A;  1CKN A;  3J81 i;  2M6O A;  2Z3Q B;  1YHQ A;  1VCI A;  1IBM L;  4R4I A;  2OCE A;  4LFC L;  4YCV A;  4JG2 A;  3S1M H;  1PH2 A;  4B3M L;  3M4O H;  4DK3 C;  2AKW B;  4B3T Q;  4MZ9 A;  1X65 A;  4C3H H;  4YWM A;  1GD7 A;  4E6Y A;  1OXS C;  2A1A A;  1QUQ B;  1XNQ L;  4TQU S;  2JI1 A;  1UE6 A;  1WCM G;  4BY1 G;  4Y7N H;  4A93 H;  2ERS A;  1E24 A;  3GTO H;  4YWK A;  4DUZ L;  1R0I A;  5IYD G;  4RXN A;  4DV7 Q;  4JI0 L;  4QGU A;  1HNZ Q;  1FHH A;  2VQF L;  5K2M E;  2F52 A;  5RXN A;  2JA6 H;  2K75 A;  4GLV B;  3F2C A;  4LF4 L;  3AEV A;  1FJG Q;  2F4V Q;  2YTY A;  1SRU A;  3PO2 H;  4JI3 Q;  1SE8 A;  3JC6 3;  4DR3 Q;  1RYT A;  1CKN B;  2OTJ A;  1JYB A;  4DR7 L;  2UXB L;  1FHM A;  1G29 1;  4A3K H;  1EWI A;  4JI7 Q;  4A3J H;  1O7I A;  1KHI A;  4NXN Q;  3A74 A;  4A3E G;  4AHY A;  3A5Z B;  2NVQ H;  5IWA L;  1HJP A;  4HJ7 A;  4OX9 Q;  3L2P A;  3IU3 I;  4LFB L;  4K0K Q;  2KBN A;  1LM0 A;  1XPO A;  1GKH A;  4LF7 L;  2D0P A;  2K5V A;  1OWB A;  1C9O A;  4GOP A;  4DR2 Q;  3G48 A;  5JJK A;  1B7Y B;  2M6P A;  1ODH A;  1CAD A;  1E22 A;  1VS0 A;  4LF5 Q;  5IYC H;  1PH9 A;  4LF9 L;  3PV0 A;  3UDX A;  3P2A A;  3B6Y A;  4BY1 H;  1HNX Q;  3MXN B;  4ZN3 B;  4LNQ A;  5IYD H;  3ULJ A;  1Z47 A;  1T9O A;  1W2B A;  2PYA A;  4DR4 L;  1NMF A;  1TWH H;  3KDF A;  1EIF A;  4HJA A;  2ALY B;  5FLX c;  1KD1 C;  3J7Z 1;  5JVH 1;  4JI4 L;  1L0W A;  3AFQ A;  4JC0 A;  3G6E A;  5BR8 Q;  3S2D H;  2PVX A;  4TVM A;  1OWC A;  2VNU D;  4JI6 Q;  2HIX A;  1A62 A;  3I2Z A;  3CAM A;  2UUA L;  4GOP B;  4GKK Q;  1R0F A;  4TVA B;  5DLQ E;  3HOU H;  4UP8 A;  3AYH B;  2QL0 A;  2JEA I;  1Q1B A;  4A3E H;  1AE2 A;  2IY5 B;  1L2F A;  5IYB G;  4HJ5 A;  4GOP C;  3M4P A;  1T9P A;  1WJJ A;  3HKZ G;  5LMU Q;  3HOY G;  3EIV A;  3VPB E;  1WOC A;  1R0J A;  4LF6 Q;  3OW2 A;  4NB3 A;  4APV A;  2QA4 A;  3CCU A;  4DV0 Q;  3TS0 A;  4QQB X;  4DV2 L;  2B63 G;  3BJU A;  1ASZ A;  4BY7 G;  3M4Q A;  4JAF A;  3SS2 A;  1N36 Q;  4UY8 1;  4JYA L;  4FDB A;  1VZI A;  1EOV A;  1QVG A;  4C3J H;  1V43 A;  2JJQ A;  2AHO B;  2WB1 G;  2M4Y A;  5MFZ A;  1RL2 A;  1T9Q A;  2ZIX A;  1FVI A;  2XGT A;  3I4N G;  1W3S A;  3KYU A;  2DUD A;  2YV5 A;  4DV1 Q;  1N32 L;  3OTO L;  2Y0S E;  3HOZ G;  2KCM A;  5IP9 G;  4L5S A;  1SMX A;  4QY7 A;  4RMF A;  3SGI A;  1Z9F A;  2QGQ A;  2IX0 A;  4TPU A;  2L15 A;  4P75 A;  1VQK A;  2CWP A;  3GTL H;  5C0X I;  5GAE c;  1XJV A;  3UDF A;  1BKB A;  7RXN A;  2ID0 A;  1N34 Q;  3H0G G;  2B3G A;  1MJE A;  1M90 C;  1HR0 W;  2N78 A;  1E1O A;  1K83 H;  3A0J A;  2OQK A;  2ZTE A;  3MEF A;  4LUZ A;  3W5O A;  2GVB A;  4B3T L;  1JJG A;  3GTG H;  3E0E A;  3J7Z C;  2A8V A;  3ULL A;  4AR5 A;  5M3M G;  2R93 H;  3GTQ H;  2MO0 A;  1VQL A;  1WI5 A;  4QJF A;  3KYH C;  3HOV G;  4R4O A;  2BE5 D;  3EN2 A;  1SMM A;  5DM6 1;  4C2M H;  4DV7 L;  3CCJ A;  1HNZ L;  4P71 A;  2Z6K A;  2MO1 A;  2I0Q A;  3CCM A;  4HIO A;  3S16 H;  1I5F A;  2B63 H;  3CP0 A;  1R9T H;  3PF4 A;  4BY7 H;  3HKZ E;  4X62 Q;  4XTC S;  3K7U C;  4A76 A;  1YBY A;  1FJG L;  1T9H A;  2F4V L;  4JAE A;  4JI3 L;  1OXX K;  1VQN A;  3ERS X;  2I5M X;  1X54 A;  5K36 G;  3PWF A;  4WJ3 M;  4DR3 L;  5ELO A;  1IW7 D;  1Y14 B;  1XMQ Q;  2NZO A;  3PUW A;  2N8N A;  4BBS H;  4XXB B;  2WB1 E;  4O0A A;  3HOZ H;  4NXN L;  4DK6 C;  2WAQ G;  3W1B A;  1VQI A;  4YHH L;  1Q82 C;  4OX9 L;  3S1R H;  2BA1 A;  4K0K L;  2K14 A;  3M9B A;  3CW2 C;  3H0G H;  3CXC A;  4KI0 A;  4DR2 L;  4R1J A;  1RB9 A;  1TWA H;  4LFA Q;  2JA6 G;  3WWN B;  2R7D A;  3NBH B;  5M3F H;  2PSM C;  1VQ7 A;  5M3M H;  4A3F G;  3PIP A;  4YWL A;  1PYS B;  4JBK A;  1QUQ A;  2Z6K C;  4BA2 I;  2K2D A;  3KF8 B;  3H15 A;  4IFD G;  2M4V A;  3U50 C;  3HOV H;  2N49 A;  4DR5 Q;  1HNX L;  1QCV A;  1OXV A;  3KLW A;  1SMW A;  1J6Q A;  5HY6 A;  4A3K G;  2NN6 I;  2XTI A;  1C7Y A;  1I6H H;  1YHB A;  2NZH A;  3HKS A;  5BR8 L;  3CCR A;  5JEA J;  1U5K A;  1XPR A;  2A6H D;  1S40 A;  4EX5 A;  2D0O A;  5GAH C;  2XJQ A;  4DNI A;  3M7N A;  4DR6 Q;  1NY4 A;  1PFS A;  1VQH A;  1NBW A;  4AI0 A;  2WFW A;  4YY3 Q;  1TWC H;  4GKK L;  5EIO C;  1FL0 A;  1RYQ A;  2XJR A;  2JQO A;  3KYV A;  4OWX B;  1X3F A;  3GTM H;  1LKP A;  5IYC G;  1B71 A;  3I56 A;  3STB C;  3CCS A;  4IJH A;  1VCX A;  5LMU L;  4OO1 I;  1EQQ A;  3LPE B;  5GAD C;  4AH6 A;  4LF6 L;  2WAQ E;  3S1Q H;  3STB D;  5IP7 H;  4NXM Q;  2E2H H;  4DV0 L;  1QVC A;  4L5Q A;  1UE1 A;  1QVF A;  3CC2 A;  4GN3 B;  2CKZ B;  4QIW E;  4YCU A;  3K0X A;  3KJP A;  1N36 L;  5MF6 A;  3T1Y Q;  4A3F H;  2KHI A;  1E3P A;  1SR3 A;  3WWL A;  1VQO A;  3RLF A;  2PNH A;  3J81 j;  3S2H H;  1BFY A;  3CCE A;  1L1O A;  1S30 A;  4OWT B;  2HT1 A;  3RLO A;  3FKI G;  1EIY B;  3I4M G;  1RDG A;  2PI2 E;  3HOW G;  3HOU G;  3RN2 A;  1B2O A;  3B0A B;  1VQD A;  4PZ7 A;  1BVS A;  1CSQ A;  1D8L A;  1KXL A;  2R92 G;  1YJN A;  4O2D A;  4GN5 A;  1NJI C;  1Q8K A;  1IRO A;  2KCT A;  3L7Z C;  4L5R C;  4R4Q A;  2ZJR A;  4GS7 D;  3D31 A;  2L0Z A;  1YVC A;  1CUK A;  4B3S Q;  1B8A A;  1Q46 A;  5EAY A;  4DUY Q;  4JI1 Q;  5GAG C;  5IT9 c;  2Z0S A;  4P72 A;  3H3V I;  3GO5 A;  3F1Z A;  1DVB A;  5GQO A;  4G6B A;  5MGN A;  2Y0S G;  1L1O B;  1A8V A;  1M1K C;  4JI2 Q;  4AYB G;  5ELN A;  2CWA A;  4K9F A;  3K80 C;  2BH2 A;  2UUC L;  4X62 L;  4A3M G;  3PKI A;  1HZC A;  2YU9 H;  3CME A;  1L1O C;  1S3O A;  3S17 H;  3UDI A;  2VW9 A;  1WJV A;  2JE6 I;  2A6E D;  3HFZ B;  4OON A;  5C44 G;  2UXD Q;  2NVT H;  5C3E H;  3AFP A;  1B70 B;  3I7F A;  3FKI H;  2R7Z G;  2V0F A;  1XMQ L;  5E7N A;  1TWG H;  1YUX A;  2E5L Q;  2XJV A;  2AWN A;  2PPT A;  3I4M H;  2H5X A;  3PSI A;  1YJ9 A;  2OTL A;  1VZG A;  5H1S c;  3EBE A;  3HOW H;  3GD7 A;  2JA9 A;  2LSS A;  3Q8D A;  2R93 G;  2UU9 Q;  2R92 H;  1X3E A;  2ATW A;  1Q1E A;  2UXC Q;  4GKJ Q;  3ULP A;  4AI2 A;  1XMO Q;  2N3S A;  4DV6 Q;  3RZO H;  5AJ3 Q;  3L0O A;  2YTX A;  1A63 A;  3WWV A;  1CAA A;  2F3I A;  4LFA L;  4BXX G;  2XJT A;  1K3R A;  1Q7Y C;  3NEM A;  1PA6 A;  4DAY B;  5DM7 1;  1LYL A;  2JI3 A;  4DV3 Q;  1K8A C;  4DR5 L;  1P8L A;  1KAW A;  4JAG A;  2A69 D;  5C0X G;  4BA1 I;  2EIF A;  4AR3 A;  2DSX A;  4DV5 Q;  4A4I A;  1BRF A;  3S24 A;  4GLX A;  1RWD A;  3FHW A;  4A3B G;  2VL6 A;  4BBS G;  5HGQ A;  4A3M H;  2Z3R B;  1X6O A;  2VS1 A;  1YIJ A;  2JA8 G;  2HR5 A;  3E9I A;  1TWF H;  5MLC 3;  4R4T A;  1PH7 A;  4AYB E;  2JK8 A;  3E9H A;  2VY3 A;  5C44 H;  5FJ8 G;  2ZJQ A;  4DR6 L;  1C0A A;  4IOA A;  1BQ9 A;  3OYY A;  3UE0 A;  3FP9 A;  4YY3 L;  1MJC A;  4HJ8 A;  2R7Z H;  1PVO A;  3RR5 A;  4AR4 A;  6RXN A;  3KYY A;  1HZB A;  5M5W H;  5M3F G;  4AQY Q;  1VQ6 A;  1NE3 A;  2I5H A;  2AMC B;  2NVY H;  4UP9 A;  3PF5 A;  3QVD A;  3PIO A;  2ZM6 Q;  1Q86 C;  1J5E Q;  2KHJ A;  2OQ0 A;  1I94 Q;  2C6A A;  1R0H A;  1HR0 Q;  3K81 C;  4JAD A;  1YUZ A;  1S24 A;  4NXM L;  5C4X G;  4IOC A;  4XIG S;  2NVX H;  4JOI A;  1S72 A;  2MFI A;  4BXX H;  3DLL A;  1AH9 A;  1LKO A;  2JA5 H;  3T1Y L;  4LWC A;  2VQE Q;  1C09 A;  3KJO A;  5LMN W;  1SFO H;  4B3R Q;  2KN9 A;  1VQ8 A;  1N33 Q;  1OXU A;  4PZ6 A;  1XTD A;  1IRN A;  4DV4 Q;  4JI7 L;  4IFD J;  3PIP 1;  4A3B H;  1VQF A;  3J80 c;  1SMU A;  5LMN Q;  2JA8 H;  4X6A H;  3CC4 A;  4DR1 Q;  3LNL A;  2J9U B;  4X64 Q;  3S15 H;  5FJ8 H;  2FXQ A;  2UUA Q;  1P16 A;  4X66 Q;  2IT1 A;  1G6P A;  1NTG A;  1B13 A;  4LUO A;  1EFW A;  3PKJ A;  1XNR Q;  2V1C C;  1Y1V H;  5IP7 G;  2RHQ B;  2E2J H;  2PQA B;  4JI5 Q;  2I5L X;  4B3S L;  1I3Q H;  2NN6 G;  1WFQ A;  4DUY L;  4JI1 L;  1HH2 P;  1LTL A;  2A19 A;  4LF5 L;  1AE3 A;  4NPS A;  4DKA C;  3MPS A;  2C35 B;  4DV2 Q;  2MS3 A;  1R0G A;  4JOI C;  2XJP A;  4JI2 L;  4JI8 Q;  4GN4 B;  5C4X H;  2CKA A;  2H12 A;  2GVA A;  1UWV A;  1PH4 A;  1IL2 A;  1KL9 A;  2CR8 A;  3RLN A;  2AYJ A;  1JT8 A;  5H1S E;  2HQL A;  2AWO A;  3RYG A;  2JA7 G;  1GO3 E;  2UXD L;  2VUM G;  4JI6 L;  1H95 A;  2UUB Q;  3JAM c;  4IPG A;  3ZJY C;  4YCW A;  3PZA A;  3F2D A;  4OXP A;  3CC7 A;  1VQ5 A;  1VQB A;  3CQZ H;  4X65 Q;  2E5L L;  1X56 A;  4IFD I;  4JBM A;  1HZA A;  2MNA A;  3JC6 6;  3UE1 A;  2PI2 A;  2CKC A;  1QZG A;  4GLA C;  2UU9 L;  4IO9 A;  2IX1 A;  1PH1 A;  3P8B A;  1PH8 A;  1IBL Q;  4KHP Q;  1N8R C;  2ERJ A;  3CPF A;  4GKJ L;  1G51 A;  2UXC L;  4POF A;  3ER0 A;  3KF6 A;  1XMO L;  4DV6 L;  5AJ3 L;  1Q12 A;  3JC6 2;  1X3G A;  3NEN A;  1JMC A;  5AI3 A;  3TRE A;  3U4Z A;  4L5T A;  2QEX A;  1K73 C;  3GDE A;  1PH3 A;  2CCZ A;  1E7Z A;  5C4J H;  3G71 A;  1D7Q A;  4JBJ A;  1HNW Q;  3NEL A;  4DV3 L;  5JEA G;  3J81 c;  3I55 A;  1IBK Q;  1YK4 A;  2VZA A;  2JI2 A;  3UDG A;  1YHA A;  4Y52 H;  5C3E G;  2LXK A;  4DV5 L;  1ASY A;  3S14 H;  3K8A A;  2HHH Q;  3J7A 5;  4DV1 L;  1KRS A;  4BBR G;  3GTK H;  1SN8 A;  3U58 A;  5JVG 1;  2JA7 H;  5GAE C;  1NXG A;  4IPD A;  1EQR A;  4AHZ A;  2VUM H;  4MNO A;  4AR6 A;  3KF6 B;  1JJC B;  1YEZ A;  2IHF A;  4A3C G;  1N34 L;  1FGU A;  4A3I G;  1E8J A;  4AHX A;  2E8G A;  1CSP A;  3LGJ A;  1B2J A;  1VQE A;  5MFP A;  3M3Y H;  3PUV A;  1XPU A;  1ZRP A;  4EQ5 A;  3U4V A;  4YHH Q;  4AQY L;  2V0E A;  2K50 A;  2HIV A;  2ZM6 L;  1J5E L;  4MTN A;  3B08 B;  1I94 L;  1HR0 L;  1H7V A;  1VQC A;  2PMZ E;  3RNU A;  2GMG A;  2LXJ A;  4LF8 Q;  1NXE A;  4LHN A;  3TRZ A;  3PCO B;  3CMA A;  1I50 H;  2BA0 A;  4LUV A;  1YIT A;  2B5I D;  2E2I H;  2YTV A;  1X55 A;  1WCM H;  4JV5 Q;  3CCL A;  1YV1 A;  2VQE L;  1NNQ A;  3BZK A;  4B8C D;  4B3R L;  1N33 L;  2V3B B;  3G4S A;  2RF4 A;  3RN5 A;  1CKO A;  1X9N A;  3RZT A;  2WP8 J;  4DV4 L;  5IY0 A;  3K35 A;  4HIK A;  3F2B A;  3W1G A;  3T1H Q;  1BQ8 A;  2GN5 A;  3HOX G;  5J3B A;  3QQC E;  4U67 1;  4BBR H;  1IU6 A;  3CD6 A;  5C0X J;  5LMN L;  1CKM A;  2XJS A;  4AIM A;  3IRB A;  3PUX A;  3J7Y 1;  4A3D G;  3RZD H;  3H3V H;  4DR1 L;  2K5H A;  5JJI A;  4X64 L;  5GAH c;  1IBM Q;  4AI3 A;  4LFC Q;  4HID A;  5AN9 H;  4X66 L;  4WJ4 A;  4B3M Q;  1Y1W G;  1IU5 A;  8RXN A;  4A75 A;  2Q2I A;  1XNR L;  4A3C H;  1RIP A;  4WFN 1;  3NFP I;  4A3I H;  3CCQ A;  2ZTC A;  1JB7 A;  4JI5 L;  1OTC A;  1KC8 C;  1QZH A;  2JEB I;  1N9W A;  2RDV A;  3TQY A;  4ALP A;  1XNQ Q;  5FLM G;  1DX8 A;  3KOJ A;  1LUZ A;  2JA5 G;  3CCV A;  4QL5 A;  5AI2 A;  2OWO A;  4IPC A;  1NMG A;  1K8G A;  4DUZ Q;  4JI0 Q;  1TXY A;  5GAD c;  2VQF Q;  1VQ9 A;  4IJL A;  2KKD A;  3A5U A;  3KDF B;  4JI8 L;  1PHJ A;  3BU2 A;  4LF4 Q;  1RDV A;  4C3I H;  2ZTD A;  4ME3 A;  1VQ4 A;  1UE5 A;  3PIO 1;  1MIU A;  4IPH A;  3AQQ A;  4OWW B;  4JBW A;  1PV4 A;  2KEN A;  1WYD A;  2XJU A;  1GVP A;  4DR7 Q;  3KFU A;  1V1Q A;  2UXB Q;  2K4K A;  1BE7 A;  2UUB L;  3GTJ H;  1UE7 A;  1Y1V G;  1YI2 A;  4X65 L;  2PVE A;  1EYG A;  2EXD A;  3PO3 G;  3HOX H;  3A44 A;  3RZ6 A;  5IWA Q;  1A0I A;  4LFB Q;  4A3D H;  1VQP A;  1V9P A;  2Q2U A;  1YZ6 A;  4LF7 Q;  1IBL L;  4A3G G;  4KHP L;  4PZ8 A;  4UP7 A;  4HIM A;  1YK5 A;  4KHZ A;  3ZG6 A;  5GRO A;  4GNX A;  5M5X H;  1GM5 A;  2B29 A;  3PUZ A;  1Y1W H;  3BZC A;  3DM3 A;  1OXT A;  1SRO A;  2PQA A;  1JE5 A;  1PYB A;  3J80 i;  4ZN1 B;  3K7A H;  2O5J D;  5GAG c;  4LF9 Q;  5IYB H;  3GTP H;  2BH8 A;  5FLM H;  3I4O A;  2NYD A;  1Z92 B;  1HNW L;  3HOY H;  4AI1 A;  1K9M C;  1KRT A;  1IBK L;  2A68 D;  1IZ6 A;  2K52 A;  4P73 A;  2DGY A;  4P74 A;  2R7F A;  2K5N A;  4DR4 Q;  2UUC Q;  4AHW A;  5JJL A;  2HHH L;  4JI4 Q;  4A3L G;  1PH5 A;  1S2Z A;  4XGH A;  2ASB A;  4PG3 A;  1BBU A;  3KYX A;  1K0R A;  1DGS A;  1QYB A;  3I4N H;  1VQG A;  1VQM A;  2ES2 A;  1Q81 C;  4GNX B;  1YJW A;  5IP9 H;  1YNX A;  3PGZ A;  4GS3 A;  4UY8 C;  1VQA A;  4JCV E;  1MKH A;  3PO3 H;  1EUJ A;  1PH6 A;  3PUY A;  4V19 6;  4A93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...