4YWMA

Pyrococcus furiosus mcm n-terminal domain beta-turn triple mutant pentameric ring
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEAAEATPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 67
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ywmA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywmA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywmA01
1VQHA 4AYBG 4UP8A 4GN5A 1YJ9A 1G6PA 1L2FA 4TQUS 4JI8Q 1IBLL 4OONA 2E2JH 1E8JA 3CD6A 5AJ3Q 1R0IA 1NBWA 4DV4L 3RZOH 2GMGA 1PA6A 3S17H 4JI1L 1LKOA 4LF8Q 3PF4A 3OYYA 5JEAG 5M3FG 4A3JH 1QUQB 1V1QA 2CCZA 1P16A 4NB3A 3HOVG 4DAYB 2MNAA 3ICEA 2KENA 2R7DA 3KDFB 2NVQH 4P74A 3GTPH 1QVGA 4HIKA 1DVBA 3EN2A 5IP9H 1IBMQ 4R4TA 4BBSH 1IU5A 5AI2A 2D62A 1YHAA 1IYJB 3MEFA 4PZ8A 3RN2A 4R4OA 5C44G 1L1OB 2N3SA 4HIOA 2AKWB 4A3IH 4JI0Q 1TXYA 1Y14B 1VQIA 4HJ7A 1VCXA 1I3QH 1WOCA 2JA6G 1SLJA 3I7FA 2Z6KA 1S72A 3D31A 1XMQL 1YK4A 3CCMA 2PQAA 2HHHQ 3PO3G 1Z47A 3PCOB 3RLNA 2R93H 3KYYA 2RCNA 3PUWA 1JYBA 2NN6G 2IHFA 4X62L 4A3EH 2DSXA 4JBMA 3HOUH 3TS0A 2F3IA 1I6HH 1KL9A 4UP7A 3JAMc 1HR0W 1QCVA 1XNQQ 4IFDI 1E24A 4B3RQ 1PFSA 1YNXA 2L15A 3KF8B 3M4QA 3J7ZC 4LF8L 2YV5A 4DR2Q 3GTOH 5C4XH 4A3LH 4APVA 1HZBA 1NJIC 4JOIA 1EFWA 2ES2A 4A3BH 1AE3A 2NZOA 3H0GG 5C3EH 1QYBA 2EIFA 4B3MQ 4NXNL 2Q2HA 2I5LX 4JI7L 4JBJA 2GN5A 1E3PA 3KFUA 1YITA 3MPSA 2B29A 4JC0A 4C3JH 4BY7H 3QVDA 2PVXA 1FGUA 1X65A 5IYCH 4DR1Q 1PV4A 5M3MG 3M4PA 3PO2G 4K0KQ 4L5QA 2MS3A 2Q2IA 4AR5A 4AR3A 2UU9Q 3CP0A 3W1BA 3OTOL 4WJ4A 2VQFQ 1LM0A 4A3CG 3F2DA 4HJAA 1N32L 1YVCA 1TWFH 3HOYH 4JYAQ 1KRTA 2PI2A 2VL6A 1G51A 4YWLA 1YIJA 3HOZH 3K8AA 4P72A 2BA0A 2ATWA 3J81i 4EX5A 4BA2I 3H3VH 3PWFA 1T9QA 3U4ZA 3I4MH 1IXRA 5JEAJ 2ZJPA 1CKNA 4JI3Q 2B63G 3S15H 1LTLA 3F2BA 2YU9H 4B3RL 4LF7Q 4TPUA 1CKMA 4LFBQ 1C9OA 4Y7NH 1GO3E 1VQBA 3K80C 4GN3B 3KJPA 2AWNA 2HIXA 2K5VA 2YTXA 4DR2L 4LF9Q 2VUMH 1VQNA 1NNQA 5FJ8G 2JA8H 2RDVA 3BU2A 1OXTA 1EOVA 2WAQG 3IRBA 4BY1G 1XPRA 1K8GA 2RF4A 1VQFA 3EBEA 3M3YH 1W3SA 2DUDA 1VQDA 2RHSB 1S3OA 3I4OA 4DUZL 4PZ7A 4LF6Q 3HKSA 3KF6B 3CCRA 1EQQA 1N33Q 1R0GA 3CCEA 2IX1A 5LMUQ 1JB7A 1X3FA 2R7ZH 2R92G 3ER0A 3F8TA 4P71A 4UP9A 4DR1L 4A93G 3UDGA 5M5YH 4DR7L 4X6AH 4DR3L 2IX0A 2K5HA 3T1YQ 2MQHA 4NXMQ 3CCVA 2BH2A 3KLWA 3CC7A 3GTGH 5C4JH 1K8AC 1O7IA 1CKOA 4A75A 2QEXA 1X54A 2KN9A 2A1AA 1WJJA 3CXCA 1PH2A 4X65L 4IFDG 4JV5Q 5C44H 1GKHA 2OWOA 3HOWG 1K0RA 4A3DG 2FXQA 1BE7A 1CAAA 3ERSX 4JI3L 3TQYA 4JI5L 2E5LL 5LMNW 2JA6H 1UE7A 1EUJA 2R7FA 4YCWA 2YTYA 4B3SQ 1NMGA 3TRZA 4OWXB 2CWAA 3GTLH 3PO3H 3Q8DA 1R0HA 3EIVA 2QGQA 1LKMA 1JMCA 1E7ZA 4A3GH 1ASZA 3UDXA 3M7NA 3J80i 3CCQA 1XNRL 4LF5L 3L0OA 2ZTCA 2XGTA 2CWPA 4HJ8A 2UUAQ 5LMUL 4LFCL 2WB1E 1I5FA 1PH7A 4OO1I 1KRSA 5GROA 1BQ9A 2VQEL 3CW2C 1X9NA 3S1QH 4GKKL 4GNXB 1Q82C 4DR6Q 4PZ6A 2NVYH 3H0GH 4MNOA 3B6YA 3PUXA 3T1HQ 1VQ8A 4NXML 4R1JA 4OX9Q 3AFPA 2LXKA 3GTQH 1UE6A 4C3HH 2ZJRA 1LYLA 2HQLA 4YCVA 4X64Q 4YCUA 3CCLA 2HT1A 3PZAA 4QIWE 1N9WA 4OWWB 1JJGA 3CMAA 1WCMG 1OTCA 2IY5B 4BBRH 3W1GA 2AHOB 1L1OC 2N78A 3AQQA 4DV7Q 1K3RA 3JC63 1VQLA 1Y1WH 1CUKA 4DV2L 2UUBQ 2VZAA 2GVAA 1LKPA 4KHPQ 1SR3A 1SMUA 5J3BA 2OQKA 2ZJQA 2ALYB 4DR5Q 1MJEA 3GTJH 2C35B 5FLXc 1EWIA 4DV6Q 1PH8A 4JBKA 4BXXG 1PYSB 4LF4L 3M85A 1PHJA 4NPSA 4JCVE 4PG3A 4DNIA 3HOXG 4DV0Q 2KCMA 4HJ9A 4JI6L 4DR4Q 2B63H 4DV1Q 2UXDL 4HIMA 1CSQA 2WP8J 4GOPB 1GM5A 1B13A 1YHBA 4A3MG 2KKDA 1XPUA 3PSIA 3L7ZC 5GAGC 3JAMi 2JQOA 1Z9FA 1N36Q 1M90C 3T1HL 4JI8L 1Q46A 2E2HH 5AJ3L 4HJ5A 2I0QA 1B2OA 2Y0SE 1NTGA 3DLLA 3BJUA 1NY4A 4UPAA 4IPDA 1XPOA 8RXNA 1VQ9A 3GD7A 1FHMA 4DV5Q 1TWHH 3U58A 1M1KC 3S16H 3GTMH 4A93H 1VS0A 4KLKA 5M5XH 2IHEA 3NELA 3DM3A 2WFWA 2LCQA 4P75A 4DUYQ 1YZ6A 2KHIA 3UDIA 3E9IA 3WWVA 1HR0Q 2N49A 1IBML 3FP9A 1AE2A 4KHZA 2NVXH 1NMFA 5C4XG 5IP7H 3LGJA 3CC2A 1IBKQ 1HNZQ 4ME3A 2I5MX 1ASYA 2OTJA 3M4OH 1T9HA 1QVFA 3A44A 4DV3Q 4QY7A 4JI0L 4R4IA 2UXBQ 4KHPL 3TEHB 4DV0L 2CQOA 3I4NH 3FKIH 5JJKA 3RN5A 1BVSA 4DV1L 4A3FG 2F4VQ 1KXLA 2HHHL 4JI4Q 3W5OA 5GAHC 1BBUA 1KAWA 2YTVA 1ZRPA 1XNQL 2H5XA 3NEMA 1QVCA 1XTDA 5IYBH 2A19A 1RIPA 5GADC 1YEZA 3BZCA 4O0AA 3L2PA 1WFQA 4QL5A 2RHQB 3FHWA 1YHQA 1HNXQ 1PH9A 1RDVA 1H7VA 1FL0A 1SRUA 2K4KA 2KCTA 4GLVB 1YJNA 3STBC 1QUQA 1VQ6A 2PI2E 4A3KG 4B3ML 5AI3A 5IP9G 1H95A 4BBSG 3KDFA 2UUCQ 1NE3A 4FDBA 4YY3Q 1OXUA 1VQ4A 1GVPA 5HGQA 1XMOQ 2ASBA 1I50H 1TWCH 7RXNA 1A8VA 3MXNB 2EXDA 1RWDA 4A3IG 1IU6A 1IBKL 3F1ZA 2ZM6Q 3ULLA 2JA5G 4AR4A 1FJGQ 1T9OA 3J81j 4LNQA 4K0KL 5M3FH 1L1OA 3GDEA 4YHHQ 1W2BA 1WCMH 1PH3A 5IWAQ 3SGIA 2MFIA 2UU9L 3OW2A 4LFAQ 3RZ6A 3HOVH 2R93G 2VQFL 2B3GA 1C0AA 4LW1A 4A3EG 3HOUG 3KYHC 5E7NA 4JYAL 1BQ8A 1BRFA 3S14H 2OTLA 1B70B 4AIMA 5IYDG 2I5HA 1KC8C 1PH5A 2KBNA 4IFDJ 3UDFA 2Q2TA 1C7YA 3A74A 4J15A 3KYVA 1Q12A 4KI0A 1Q1EA 3K81C 1LUZA 2PQAB 2V3BB 4LF7L 3CCSA 1VQJA 2Q2UA 1WYDA 4QGUA 4A3LG 4LFBL 2D0PA 1TWGH 1YUZA 5RXNA 2K52A 3S24A 2JJQA 3PUVA 4B3TQ 4LF9L 4EQ5A 4K9FA 3KOJA 4A3MH 4JOIC 3PV0A 1J5EQ 3CC4A 1JJCB 1K83H 3RZTA 2JEAI 3K7UC 1UWVA 4UY8C 4GNXC 2VS1A 4JI1Q 4AQYQ 1QZGA 4LF6L 4A3GG 1OXSC 1VQEA 2KHJA 5IYCG 1N8RC 2JE6I 4TVAB 2QL0A 4YWMA 1N33L 3CPWA 1S40A 4DAMA 5LMNQ 4A76A 1PVOA 6RXNA 2LSSA 1K9MC 4LUVA 4OO1G 3I55A 4XIGS 4YHHL 3CCJA 3RR5A 5M5WH 5IE8A 3HOYG 1TWAH 4PMWA 3T1YL 5K36G 4LFAL 4JI2Q 3H3VI 2IT1A 3ZJYC 3HOZG 2WB1G 4LUZA 5HY6A 3JC62 2BH8A 1DGSA 1IROA 3M9BA 4DPGA 3K0XA 3E9HA 4AYBE 4JV5L 4JG2A 3PO2H 1VCIA 1J6QA 2CFMA 1RYTA 3RYGA 5M3MH 4Y52H 2NZHA 1Y1VG 1WI5A 2JA8G 2K75A 2K50A 4GN4B 2XTIA 4A3CH 3KYXA 3UE1A 5IT9c 2PYAA 1VQCA 4X62Q 3I56A 3KYWA 3A0JA 4A3FH 1B71A 1EIYB 4B3SL 4B3TL 3GO5A 4GOPC 1CKNB 1PH4A 1J5EL 4L5SA 1Q86C 4DK6C 1JJ2A 1HZ9A 1B7YB 3F2CA 4MTNA 2R7ZG 1RL2A 3AYHB 4AQYL 3KF6A 2UUAL 1BKBA 3JC66 2V1CC 1A62A 3PUYA 1YI2A 5LMNL 1FHHA 3HKZE 1YUXA 2E8GA 2VW9A 3I2ZA 1PH1A 4JI7Q 4NXNQ 3KJOA 1XJVA 4DR6L 5FJ8H 1SROA 4BY1H 1I94Q 1S24A 1PYBA 1E1TA 3TREA 3U50C 4A3KH 4JI2L 5FLMG 4OX9L 3AFQA 1UE1A 1BFYA 1S2ZA 1E1OA 3HKZG 4RMFA 4X64L 1VQ7A 1U5KA 1Q8KA 2YYZA 4POGA 1SFOH 1P8LA 2JA5H 4IJLA 5C0XI 1KIXA 3OTOQ 3STBD 5DLQE 1SN8A 2AMCB 2Y0SG 1VQMA 1N32Q 4WJ3M 1X3EA 2NN6I 2ZTDA 5C0XG 4DV7L 4IOCA 2ZTEA 1UEBA 3HFZB 3RLFA 1Q81C 2UUBL 3J7A5 1A0IA 2PVEA 1EIFA 4IJHA 4BA1I 4XTCS 1V43A 1G291 4DV6L 1IRNA 1BBWA 4DR5L 3PF5A 5IYDH 4L5RC 3RNUA 2LXJA 2JA7G 1MJCA 3HOWH 2DGYA 4DR4L 4A3DH 2JA9A 3S2DH 2MO0A 5GQOA 3G71A 2VNUD 2GVBA 1A63A 1X56A 2Z0SA 3KYUA 4RG1A 5BR8Q 3RZDH 3CMEA 3CAMA 5EAYA 3A5ZB 1CSPA 2JK8A 5H1SE 1OXXK 3S1NH 2E2IH 2QA4A 1QZHA 4GNXA 2N8NA 4DUZQ 3ULPA 1SMXA 1YBYA 1N36L 1HNWQ 1I94L 2OCEA 1MIUA 5GAEC 1VQ5A 5ELNA 4A3JG 4GS3A 4L5TA 2CKZB 1HH2P 1VQOA 4LWCA 4BBRG 4DV5L 3S2HH 1HZCA 4A4IA 1AH9A 4DR7Q 2JEBI 3BZKA 3G48A 4DR3Q 1R0JA 1Y1WG 3E0EA 2ID0A 4OWTB 1C09A 4GKJQ 3PIOA 1EYGA 2EQSA 4MZ9A 4DUYL 1YJWA 5IY0A 1HR0L 1GD7A 3CCUA 4POFA 1R9TH 1X3GA 1PH6A 1X55A 1E22A 3J81c 1HNZL 2VY3A 3PGZA 1D8LA 4X65Q 1VQKA 1DX8A 3S1RH 4YWKA 1Q1BA 2D0OA 3G4SA 4O2DA 4DV3L 3D0FA 4JI5Q 4X66Q 2AWOA 2E5LQ 1IL2A 2UXBL 4GKJL 3CPFA 2OQ0A 2Z6KC 1Y1VH 2F4VL 2UXCQ 4P73A 4LUOA 1N34Q 5BR8L 3NBHB 4GOPA 4DKAC 3CQZH 4JI4L 3S1MH 1HJPA 2F52A 4R4QA 3PUZA 2K2DA 4IO9A 1U0LA 1K73C 2M4YA 1KD1C 4LF5Q 1XNRQ 3TS2A 1SMMA 1HNWL 1KHIA 2K5NA 5ELOA 3HOXH 4LFCQ 3G6EA 4ALPA 4A3BG 2NVTH 1RDGA 5C3EG 2VQEQ 1HNXL 4GKKQ 5C0XJ 2A8VA 1SMWA 1B8AA 4GLXA 1EQRA 1VQGA 3CF5A 1Q7YC 4AR6A 5JJLA 1IBLQ 3NENA 4DV4Q 2PNHA 3VDYA 4GLAC 1VQAA 5IP7G 4C3IH 2UUCL 2MO1A 4BY7G 4BXXH 3RLOA 4YY3L 4IPGA 5JJIA 1FVIA 5FLMH 1XMOL 2R92H 4DK3C 1OXVA 2HIVA 1IZ6A 1T9PA 1UE5A 2ZM6L 4HIDA 1SE8A 1VQPA 1YK5A 2HR5A 1FJGL 1RB9A 3I4NG 3FKIG 3U4VA 4RXNA 4JBWA 3A5UA 2R6GA 4X66L 2PMZE 1MKHA 5IWAL 3ULJA 4AH6A 1CADA 4IOAA 4DV2Q 3UE0A 4QJFA 2UXCL 3SS2A 4IPHA 1R0FA 4R4CA 1N34L 1D7QA 1V9PA 3I4MG 1KQSA 1B2JA 2WAQE 1L0WA 4H02A 1X6OA 1JT8A 5IYBG 2K14A 4LF4Q 3K7AH 4C2MH 2BA1A 4QQBX 3J80c 4JI6Q 3AEVA 3H15A 1XMQQ 3GTKH 3PIPA 2VUMG 2UXDQ 1S30A 1HZAA 4OXPA 1YV1A 4IPCA 2JA7H 1JE5A
chains in the Genus database with same CATH superfamily
5JAVA 1TIID 4AYBG 1YJ9A 1E8JA 3RZOH 5JVG3 4JI1L 1JE4A 5LHY1 1LTGD 3A7LA 4DNRB 2F0JA 4NB3A 3HOVG 3K35A 2R92L 3KDFB 3S16B 3P75A 1QOHA 3GTMB 3GTPH 5IP9H 1IU5A 2D62A 4ZUJA 2EY5A 1SYEA 3MEFA 4E6IA 1YNJC 5C44G 4HIOA 1TY0A 1OWCA 1GOZA 2AKWB 4A3IH 1Y14B 4HJ7A 4K5XA 2JA6G 1S72A 1TKWB 4X3TA 1W6KA 5EJWA 1Z47A 3FKIB 3I8ZA 3PUWA 2DSXA 1JWUD 2JA7L 3TS0A 3FMCA 3JAMc 3K5OA 1QCVA 1NXGA 1HR0W 1XNQQ 2PMZP 1E24A 4B3RQ 4DAVA 1PFSA 2F3WA 3KF8B 3MFYA 4LF8L 5C4XH 4A3LH 3RZOL 3WOFA 1GUTA 4A3BH 4KY6A 5EPKA 5C3EH 2Q2HA 1EOTA 2GN5A 4CBVA 2WAQB 5I2YA 3QR8A 4KN7C 4FF1A 2EYOA 5DM63 1EIHA 4C3JH 1SYCA 1GHKA 3GTPL 5IYCH 2EOTA 5IP9L 1SNCA 5BN4A 2MS3A 4UY81 3CP0A 1SMYC 3R93A 4A3IL 3F2DA 3IFTA 4TRDA 3NWSA 1N32L 1YVCA 3HOYH 4QIWP 3F2UA 5KRUA 3GQBA 3I4MH 2ZJPA 3KBXA 2B63G 2C6BA 4TPUA 1GO3E 4GN3B 2OT2A 1KNEA 4DR2L 2V0EA 2YTXA 1EY4A 1NNQA 5FJ8G 1TWGB 1EWCA 1ILQA 5M9OA 5C4XL 4A3LL 3VR3A 4A3BL 1W3SA 2DUDA 2RQXA 3WOEA 4DUZL 5C3EL 1F2YA 4LF6Q 3KF6B 1PRTF 2PSMC 3CCRA 1VF7A 2R7ZH 2BOSA 3ER0A 4UP9A 4DR1L 4FXKC 5M5YH 5IYCL 3T1YQ 3NE5B 5FO7B 3SK5A 3CCVA 3GTGH 1LABA 5EGTA 1K8AC 2QEXA 1E0BA 2HDLA 3QB3A 4C1NK 3E5SA 1GKHA 2AUJD 1K0RA 3Q6SA 3ERSX 4JI3L 4JI5L 3I4ML 2AQ2B 3MFGA 5LMNW 3C3LA 4KMUC 2R7FA 1NMGA 4H44C 4OWXB 3PO3H 4TKOB 5CGKA 3EIVA 1LKMA 1RODA 1ASZA 4RHRA 1VZGA 3EROA 1NXEA 4DK0A 4LJZC 1HRJA 5CV8A 2XGTA 4HJ8A 2WB1E 4OO1I 3PL5A 1AEXA 1BQ9A 3LPEB 3MZ5A 2VQEL 1B9MA 4DR6Q 4PZ6A 1EZ8A 1WTWA 1UAPA 4R1JA 4OX9Q 1LYLA 4X64Q 2HT1A 3GTGL 1LO5D 4OWWB 1JJGA 1JWSD 3SK6A 2WACA 1OTCA 1FYCA 1VQLA 3H97A 1RTNA 2VZAA 1H9SB 5J3BA 1JICA 1FR3A 4HSPA 2ZJQA 4DR5Q 5EQ0A 3NBHA 5FLXc 3SEBA 1PFVA 1PYSB 2A6ED 3PO3L 2BDNA 1WD0A 4LF4L 4DNIA 3K0YA 4PG3A 1Q8IA 4DV0Q 4HJ9A 1C0AA 3NQIA 2L4NA 5D65A 1CSQA 2WP8J 4A3DB 1QWYA 1SEBD 2EPBA 5IGDA 4ZKBB 1MSGA 1Z7TA 3L7ZC 2JQOA 2XWBB 2VXWA 1N36Q 4JI8L 1SYBA 4HEDA 2E2HH 5AJ3L 3OWEB 2R92G 1XPOA 1NTGA 3D4RA 4IPDA 4G7OC 1Q90A 2IWHA 2EE1A 1PTOH 4A93H 5M5XH 3PIO3 5MLC3 2EY2A 1EU4A 1FNWA 1PYWD 1Z6HA 3PO2L 2KHIA 3M4YA 2B2WC 5H1Sc 3WWVA 2WB1P 2N49A 1IBML 1AE2A 4V190 5IP7H 1HNZQ 5JJZA 1R9TB 4DV3Q 4R4IA 1KDAA 3S1RB 2K04A 2AYJA 2KQ3A 2F4VQ 3BVMA 4LAAA 2E76C 3W5OA 5GAHC 5CV5A 4QIWB 1DOLA 4ZN3B 2A19A 5GADC 3HJWB 4BY1L 1JCKB 3BZCA 1A15A 3L2PA 2RHQB 1HNXQ 3HOXB 1FL0A 2RDHA 1H9KA 3STBC 1QUQA 1Y8NB 4B3ML 2ZXRA 4DAYA 5IP9G 1H95A 1QG7A 4A93L 5M5XL 1GUGA 1GVPA 2M6OA 3HKZP 1IYUA 4C3IB 4A3IG 1RWDA 2ZM6Q 1H9RA 1T9OA 3LWVB 5M3FH 2K1BA 1W2BA 3J7AF 1PH3A 3SGIA 2MFIA 4M8AA 2A69D 1JOKA 2VQFL 5JVH1 5I4DA 2Y0SB 5IYDG 3I73A 2I5HA 2IPKD 2KBNA 2K6AA 1C7YA 1Q12A 1U4PA 4J1MA 2V3BB 1OWBA 4C2MB 1VQJA 2Q2UA 4A3LG 3GTKB 3S24A 1ZXTA 3P2AA 5AFWA 2A68C 4WFN1 1K83H 1LT3D 3S2HL 3NBIA 5J22A 3J7YW 3I3CA 4C3JG 1UWVA 1Y8PB 2H4OA 2VS1A 3ITPA 2E2JB 1LLRD 3D3RA 5IYCG 2QL0A 4YWMA 4HTHA 3CPWA 1S40A 4V0BA 1F77A 2F0TA 2LSSA 4DXFA 4YHHL 4RWSC 2B2WA 3HOYG 5MF6A 4R9WA 5M3FL 5C3XA 2IT1A 3ZJYC 2NVQB 3K0XA 2O5JC 4BBSB 5IGCA 3X3NA 4AYBE 5M3MH 2CFMA 5COYA 1A3TA 4QB4A 4TVMA 1KLGD 5IT9L 4CGYB 4GN4B 2WV6D 4X62Q 2PYAA 5GAHc 3I56A 4B3SL 3KYWA 1LT4D 2QF7A 4CKBA 4DXGA 1CKNB 2PO4A 4A3EB 1J5EL 4L5SA 3HOUB 1JJ2A 5GADc 2RDFA 3MEHA 5IOCA 1HCZA 3R8BA 2R7ZG 1RL2A 3AYHB 1CZGA 1R4QB 2WINB 1FHHA 2L0CA 2E8GA 1A2UA 5IODA 4ZAIA 4NXNQ 3KJOA 2J7ZA 4CJ0B 2PZWA 1PYBA 3TREA 3U50C 4JI2L 2K7VA 5K5PA 1E1OA 1LT5D 4RMFA 5G3LF 3LNNA 5NUCA 1U5KA 3C46A 2EYFA 4P2CB 2IX3A 4HAEA 5C0XI 2LKVA 2Y0SG 1VQMA 2HCCA 1X3EA 3K7AL 4WJ3M 4IOCA 5M3ML 4DK1A 3HFZB 1Q81C 4XT3B 1A0IA 1STHA 3HOZB 5LL6S 4DV6L 3PF5A 1BBWA 4ULLA 3K58A 2QCPX 3HOWH 4DR4L 3S2DH 2MO0A 3G71A 1U9RA 3KYUA 4RG1A 1STBA 1S5ED 2G9HD 1KABA 1LTID 3Q23A 4AYBP 3PMFA 4ID6A 4OHJA 3S1NH 2JA8B 2MJ8A 1HNWQ 1LTBD 2EJGC 1IKLA 5GAEC 5ELNA 4GS3A 1EEFD 1VQOA 1WTVA 4A4IA 3ZYYX 1ML0D 5CV9A 3E0EA 4OO1H 4OWTB 3X3MA 1C09A 1HFGA 4G6BA 1RCVD 2VB2X 4O42A 1BCPD 1HR0L 1SYGA 5C4JB 1E22A 3WWNB 1DX8A 3DEPA 3HKZB 2E5LQ 2UXBL 4U671 2FJ2A 1Y1VH 5LL6X 4RGOS 1B1ZA 1CK1A 1K3BC 4LUOA 4P73A 3S2DL 3CQZH 1G8ZD 1ICFB 4C56C 3GTLB 2L9HA 2K2DA 3S1NL 1U0LA 2M4YA 2MP1A 4Q5VA 1KD1C 3MXUA 2QDLA 4LF5Q 4A3GB 3G6EA 3LX0A 4ALPA 1RTOA 2NVTH 2ZXPA 1SJHD 3KBGA 3S1QB 4QMGA 1BBXC 3NENA 1EWHA 4DV4Q 2PNHA 3H0GB 4EQOA 5IP7G 2UUCL 3C1EA 5JJIA 4IPGA 1ET9A 5FLMH 3OMGA 4DK3C 2HIVA 1T9PA 1UE5A 1VQPA 1FJGL 2HR5A 1QNKA 4JBWA 2PQEA 2R6GA 5IWAL 1SNMA 5CR3A 4AH6A 5IGGA 4IUNA 4IOAA 1C48A 4DV2Q 4QJFA 2UXCL 4Y7NL 1D2BA 1V9PA 3CHBD 5DNFA 1Y1VL 1DJRD 1YNJD 2WAQE 2C9OA 4KTAA 3J80L 3CQZL 3GTJB 4JI6Q 2UXDQ 4MHEA 2KEEA 1S30A 4OXPA 1IHZA 2E75C 2NWGA 3QO2A 3FEWX 5CMDA 5FOBB 4GN5A 2NVTL 3VR5A 1SDFA 3I91A 1R0IA 3PIP1 5GAEc 1R4PB 3PF4A 3OYYA 2KCNA 5M3FG 3MXNA 3H94A 4A3JH 1V1QA 5FLML 1V1PA 4K14A 3ICEA 4X3UA 2XJRA 1TWHB 2KENA 4JAFA 2BCOA 4P74A 4HIKA 1II3A 4FO2A 3EN2A 1TS4A 5EKLA 4PZ8A 2NVXB 1MGSA 1K8MA 2FHTA 2K5QA 4JI0Q 2CW0C 2KHSA 1SLJA 3NTHA 2R93H 2B5ID 2NN6G 2IHFA 1RHPA 3DWAA 3ND8A 3JAML 1I6HH 1KL9A 4UP7A 1PMRA 1ENFA 3I72A 2M9VA 1CI3M 2NVYL 3OPOA 3J7ZC 3M4QA 1BDOA 2EXZA 2WAQP 3KLSX 3H0GG 5D14A 2EIFA 4NW2A 4JI7L 2I5LX 1E3PA 4A3JL 3MPSA 1BQQT 3AB9A 2B29A 1VZIA 4RFBA 4BY7H 3TSSA 1FGUA 1PV4A 5M3MG 3M4PA 1MSHA 1J8IA 1TWCB 1DONA 3N6RA 2Q2IA 4IALA 4AR3A 3OTOL 1LM0A 1LTAD 2CVRA 3K6OA 3VYRA 4HJAA 1WCMB 1TWFH 1F4LA 1AW7A 1KRTA 3HOVB 5K36H 4AI2A 1B9NA 2VL6A 4P72A 3S14B 2NTTA 3J7AV 3PWFA 2X6GA 2D5DA 2MGSA 4KV6A 4B9WA 3S15H 4B3RL 1LTLA 2YU9H 1I6HL 4LF7Q 4LFBQ 5C4ZA 1C9OA 1XX8A 2F0IA 2QKIC 2VUMH 4LF9Q 3FRPB 1VQNA 3W2DA 3BU2A 1OXTA 1XPRA 3EBEA 3M3YH 2XJUA 1ZYRD 4A3MB 3S16L 1S3OA 3GTML 2C5CA 3HKSA 2F4IA 2Z9HA 1EQQA 2IX1A 4M1UB 1QNUA 1F9PA 1JB7A 1K0SA 3MSUA 4BY7L 4DR3L 4EGVA 3CC7A 2CH4A 5M5WB 2F0HA 1TWAB 3WDNA 4MTKA 3FKIL 2A1AA 1WJJA 1TWFL 2B2TC 1PH2A 4JV5Q 3BS1A 3HOWG 2OWOA 2FXQA 1UE7A 3S15L 1EUJA 2YU9L 5C0XH 1HA6A 1R0HA 4IUVA 2VUML 3EA6A 1I4XA 1HTPA 5AN9H 1T5XD 1E7ZA 5I2XA 3JR7A 3J80i 4CKEA 3CCQA 1XNRL 2ZTCA 3M3YL 1IL8A 5J1ZA 2UUAQ 4NKLA 4LFCL 1YNNC 2F0VA 5JPNC 5A2QL 5GROA 1X9NA 3CW2C 1BCPB 4FF3A 1CM9A 4GNXB 1Q82C 3OHXC 3MXGA 1EQTA 3T1HQ 2IL8A 1GXDC 1UE6A 1STAA 3AU7A 4YCVA 2CKCA 1DD2A 4QIWE 4OIJA 4DGZA 1WCMG 4FXGC 2IY5B 1HUNA 1EU3A 3W1GA 1SFOB 1PXUA 3BVGA 1Y1WH 2UUBQ 1EQVA 1LKPA 2KECA 2OQKA 5FLXL 1MJEA 5DEHA 1PH8A 1PHJA 1PFWA 1Z92B 3RUZA 1PZID 4HIMA 3BDCA 1GM5A 3J7Y1 4A3MG 2AQCA 1XPUA 4BWGB 2IJ0A 3RZDB 1F2ZA 5BN5A 5GAGC 3JAMi 1K28A 1Z9FA 2E2IB 4HJ5A 2Y0SE 2D2CC 2LY7A 4UPAA 1OO9B 4JVZA 4IFDG 3BYTB 8RXNA 4QCLA 1IYVA 1CT1D 2K33A 4FNFA 1TR5A 5EPJA 1PFYA 3KLRA 4KLKA 4RH6A 4ZUIA 3U9SA 2WFWA 4DUYQ 2BDOA 1YZ6A 3E9IA 3FP9A 4KHZA 1BO0A 2B2TA 4O1NA 3LGJA 3VYSA 1Y1WL 3SDZA 4DNTB 3M4OH 1T9HA 2O4XA 3PQIA 4DV0L 3I4NH 1J9OA 3RN5A 2DY8A 4HN7A 1KXLA 2HHHL 1CHQD 1T5EA 1Y8OB 4N9PA 1L0XB 1ICWA 1TS2A 2CH4W 2F0QA 3V05A 1AFPA 2K03A 5C5MA 4ZN1B 3S1MB 2WIIB 4R8IA 2EY6A 3NEMA 4L63B 1RIPA 2EVBA 1I4PA 2SNSA 1PFMA 4OEMB 4DU9A 4GZYC 3IKJA 3H9CA 4KKUA 1RDVA 1H7VA 1NR2A 3B08B 1ODHA 2KJXA 3BYYB 2PI2E 1O80A 1VZHA 5AI3A 3KDFA 4N8FA 4HCSA 1NE3A 1OXUA 1VQ4A 5HGQA 1JOOA 3R2TA 2F1MA 4KKTA 2K5WA 1I50H 7RXNA 4AR4A 1SBBB 2R92B 5JEAH 1AZPA 4K0KL 3GDEA 2JI2A 3GP7A 3M4OL 2UU9L 4OELB 2Y0SP 1NAPA 1HA5A 3VR2A 2JXMB 2B3GA 2R93G 1RDPD 3KYHC 1JOQA 4JYAL 1BQ8A 1BRFA 3I4NL 1B70B 1PTOD 4IFDJ 1KC8C 1IBKL 2O5JD 3UDFA 1V8QA 4UDUC 2Q2TA 1IW7C 3A74A 3KYVA 3K81C 2PQAB 5CC4A 3NFPI 4QGUA 2D0PA 3KF8A 2XJSA 3A55A 3PUVA 3K59A 4B3TQ 2JA7B 4EQ5A 4K9FA 1EYAA 3KOJA 5GAGc 3MTSA 3K57A 4JOIC 3PV0A 4IZ8A 1V1OA 5ELFA 3TN2A 1X3PA 3TBIB 3RZTA 4UY8C 2I46A 5T1IA 4AQYQ 4JI1Q 1OXSC 1N8RC 1N33L 4RGNA 4TVAB 3RZOB 3H3VM 1K9MC 1I50L 3T51B 4XIGS 5IE8A 1B3QA 4PMWA 5K36G 1JORA 4UHVA 1B4OA 2ZT9C 3GTPB 4LUZA 5KYLA 2BH8A 1D5ZC 1DGSA 2R3ZA 3E9HA 1H9MA 3MVVA 4K5WA 4Y52H 4JG2A 3PO2H 1VCIA 4A3IB 2NZHA 1E2WA 4K6DA 3SK8A 2XTIA 4A3FH 5F2DA 3A0JA 2Z3RB 4H0LC 1PH4A 4DK6C 5TSSA 3LWEA 3NWTA 3KF6A 1A62A 2RKSA 3PUYA 1PH1A 2F03A 3HKZE 1YUXA 1SE2A 1KDCA 2VW9A 5C4XB 3GV6A 2ZIXA 4A3BB 3WWLA 3DWPA 1SROA 3S9WA 4BY1H 5C3EB 2B2YC 1I94Q 1S24A 4A3KH 5A35A 1UE1A 3W3AA 2NB0A 2XRQD 4C3JB 4POGA 2PZTA 1PRTD 2JA5H 4IJLA 1STGA 2XJQA 5DLQE 1SN8A 3P1HA 1N32Q 2O2LD 5C0XG 4Y52L 4DV7L 1D5XC 2ZTEA 1UEBA 3RLFA 3HOYB 5C3WA 2NZ1D 1IRNA 4A3FL 1EY6A 4F8MA 2BE5D 3D6WA 1GUWA 3RNUA 2JA7G 2A6HC 1MJCA 3I4MB 3HP3A 2OEOA 2GVBA 2NYZD 2Z0SA 3PKJA 3CMEA 4XQNA 1CSPA 1S5CD 2D9UA 1B2TA 1TQOA 4DUZQ 3ULPA 1YBYA 1DOKA 4XYOA 1PLFA 2F0LA 2X69A 4A3KL 1MBYA 1HH2P 1S5BD 4BBSL 4DV5L 1SSOA 1HZCA 3S2HH 2R7ZB 1AH9A 2SDFA 2LMCB 4WRDA 1Y1WG 3A8JE 2ID0A 5M5YB 1U4LA 4GKJQ 3PIOA 2JA5L 3UI2A 3GTGB 1HXYD 3J81c 1H9SA 3T56B 4ZKCB 2DJFC 1G2TA 4O2DA 3SHLA 4JI5Q 4X66Q 1MI2A 2G9DA 2AWOA 1AN8A 2OQ0A 1B44D 4DKAC 2RFKB 4JI4L 4G57A 3PO3B 3HG9A 4BXXH 1HNWL 1IKMA 5C4XG 1SMMA 2QILA 1KHIA 2XN9C 1EYCA 4JAGA 2FMMA 4A3BG 4YIJA 1X32A 5C3EG 3E0JA 2VQEQ 5C0XJ 2A8VA 4FP5D 4XGHA 2B2YA 1EQRA 3Q22A 3CF5A 3H9BA 4AR6A 5JJLA 1IBLQ 4DF7A 4CDDC 2AQ3B 2B39A 3RLOA 4YY3L 1DM0B 1FVIA 3NTIA 1XMOL 1A3UA 4Q0FA 1GUNA 4I65A 3HOZL 3I4NG 1RB9A 2MUYA 3U4VA 3A5UA 1BNZA 3ULJA 1CADA 1HTLD 2GA4B 1MD2D 1PDQA 3SS2A 1D7QA 3LWQB 4HCEA 3I4MG 2Z3QB 1KQSA 1L0WA 4H02A 1X6OA 4ME5A 4LF4Q 3K7AH 1TU2B 2BA1A 3AEVA 1XMQQ 1PZKD 1BUVT 4Z9CB 2DNEA 2E74C 3OW7A 1XXGA 4BXXL 2QEJC 1CA6A 1JE5A 3NXWA 1BCPF 4UP8A 1L2FA 3QWNA 4TQUS 4JI8Q 5AJ3Q 4DV4L 1NBWA 4X6AL 2KA7A 3S17H 3N52A 2E2HB 5JEAG 2CCZA 1P16A 2MNAA 3FDTA 4FXDA 1PTOB 2B8FA 1EY8A 3FVQA 4A93B 1TS5A 5M5XB 1QVGA 2HDMA 1EL0A 1EFID 3BVZA 4PQXA 1DVBA 1IBMQ 2C6AA 2Q8IB 1YHAA 3RN2A 4R4OA 1L1OB 1I3QH 2F0WA 3MHBA 3I7FA 3D31A 5ELBA 3CCMA 4A3GL 3D4WA 3PO3G 4FYDA 3PCOB 3H3VC 2RCNA 4AI1A 3V2TA 3Q24A 2QDBA 2F3IA 4JW0A 3H6MA 1TVXA 3S1QL 3EFXD 3NQTA 1EYDA 1F9RA 3P7JA 4IUPA 3GTOH 4APVA 2ES2A 1EFWA 3S17L 1LV9A 1AE3A 1WTOA 1QYBA 4B3MQ 4E6YA 1FNUA 5C6AA 4JBJA 1P7PA 2AUSB 1VDZA 5JVH3 1S5DD 5EKKA 1SJED 4DN4M 3BDLA 3OMCA 3HAXC 1DZ1A 3QVDA 1X65A 3PO2G 2A6EC 4L5QA 5DM71 4UAIA 3E3XA 5M3FB 2EJMA 2VQFQ 3FDJA 4K5VA 4DAPA 1I3QL 4CDCC 2PI2A 3PKIA 1U4RA 4YWLA 2A73B 3K8AA 2BA0A 2CHBD 4WFN3 2ATWA 4EX5A 2M4VA 3U4ZA 4EQNA 5JEAJ 1CZWA 1CKNA 1ENAA 1CKMA 4Y7NH 3K80C 1RJTA 2AWNA 2HIXA 5C4HA 1DOMA 1TS3A 2SNMA 4BY1G 3GTOL 1EOVA 3GV3A 1VQDA 2J4XA 4AHZA 4PZ7A 1CTMA 4CDEC 1PRTB 1K83B 5LMUQ 3NPPA 4A93G 3F8TA 3L3OC 4P71A 1B3AA 1LTRD 3UDGA 4I7ZC 4DR7L 3SXHA 2IX0A 4K2KA 4NXMQ 2BH2A 2F0PA 2MPMA 4A75A 1O7ZA 2JYOA 5KNDA 3CXCA 4LHLA 4XQJA 4X65L 5C44H 1BE7A 1CAAA 1SNDA 2ENBA 4LK1C 5G3LD 1BR9A 5M3MB 2JA6H 4CJ2C 2HD3A 4YCWA 4B3SQ 2YTYA 3HZXA 4JAEA 3R3OA 3Q8DA 5EBDA 2F0FA 3UDXA 1PZXA 2L11A 1E2VA 3RMHA 1I5FA 4WORA 1KRSA 2H1EA 4GKKL 2NVYH 4H7BA 2A69C 4MNOA 3PUXA 3LWRB 2EJFC 1O7YA 3AFPA 3GTQH 3A7AB 4C3HH 3HOVL 2HQLA 1D6EC 2K01A 5FKAC 1N9WA 3CMAA 1CHPD 4BBRH 2AHOB 2N78A 4FF4A 3AQQA 5C44L 1K3RA 3K5MA 1CUKA 5BN3A 1SR3A 1SMUA 1U4MA 1QQTA 2JA6L 2ALYB 1O7LA 3A8KE 4DV6Q 4GS7D 4BXXG 2CR8A 3G7LA 1SXTA 3M85A 4KHPQ 4JCVE 4DR4Q 2KCMA 1GUOA 4DV1Q 2B63H 1SMYD 4XXBB 4GOPB 3HOWB 3S2DB 3ND9A 2KKDA 1S4ZA 3M7GA 3MQKB 3HEJA 2ICEC 3T1HL 3S1NB 4H13C 3IU3I 2I0QA 3A54A 1B2OA 4RKLA 3BJUA 1TWAL 5ELDA 3GD7A 1FHMA 2B8GA 3GTQL 4C3HL 1M1KC 3S16H 3GTMH 3G6JB 4U673 2IHEA 3NELA 4KK7A 4P75A 5KNCA 5CV4A 4BBRL 1HR0Q 4CHTB 4B8CD 4RAUC 2G5DA 1HQRD 5JVG1 3CC2A 1IBKQ 2OTJA 2I5MX 4TSSA 1HHVA 5EBCA 3A44A 1EY5A 2HUGA 2UXBQ 3TEHB 2EZVA 3FKIH 1BVSA 1XTCD 3CKIB 3SVMA 2B63L 2HQEA 3SR1A 1Y1VB 4XDXA 1BBUA 3CQZB 1WTQA 2DN8A 1XNQL 2H5XA 4X3KA 1EEID 1QVCA 5IYBH 2A5HA 5FJ8L 1YEZA 2PW7A 1PFUA 2RVLA 4O0AA 2EYMA 5I9OA 4QL5A 3FHWA 1YHQA 1BF4A 1SRUA 1AP0A 3ZG6A 2NVTB 2PYKA 2K4KA 4GLVB 1YJNA 2P5ZX 4K2LA 3H09A 3J81E 2UUCQ 4ZCKA 4FDBA 2ASBA 4HMIA 1A8VA 4HMJA 4FVMA 1ENCA 1FJGQ 5D3IB 5E4XA 5IWAQ 1I4RA 3OW2A 4LFAQ 4OGQC 5JOBA 3VA5A 4IN3A 2OTLA 5DM61 2Z4HA 5KNBA 3VR4A 5DAUA 3PIP3 4KI0A 1Q1EA 1LUZA 4RGMA 3MXPA 2DNCA 1TWGH 1JQYD 5IYBL 2JJQA 1JJCB 2RDGA 2JEAI 1BCPC 4GNXC 1QZGA 4AI3A 4LF6L 1VQEA 2JE6I 4AHWA 5LMNQ 1CQVA 1E2ZA 1PVOA 6RXNA 4LUVA 4OO1G 4N9TA 4A3JB 4KD3A 3T1YL 4PNYA 3TDQA 3H3VI 1UUPA 4ZYSA 5HY6A 1KNAA 3M9BA 4DPGA 5EPLA 4IUQA 2WKCA 1LTTD 1J6QA 1JWMD 3NK9A 3RYGA 5KEEA 1F9SA 1Y1VG 1RF2D 5I9PA 4A3CH 3K5LA 3KYXA 1QJOA 3UE1A 1VQCA 1EIYB 4B3TL 1B71A 4EVOA 1M4VA 2R93B 1TWGL 2XNAC 2A74C 1I6HB 1HZ9A 3MWYW 3F2CA 4MTNA 4AQYL 2A6HD 2F0OA 2K5DA 2Z4IA 1JR0D 4JI7Q 4NP5A 1XJVA 4DR6L 1PTOF 1FD7D 3D4DA 2M00A 3DXJC 5FLMG 4OX9L 3AFQA 1S2ZA 4X64L 1KAAA 3RD4A 3V96A 1Q8KA 4BY7B 3I70A 1HUMA 4RHSA 2XJTA 1KIXA 3OTOQ 3STBD 2V4DA 2AMCB 2NN6I 2ZTDA 1CFMA 1WTPA 3BZDB 3J7A5 5KGUA 1TWFB 5KYIA 1EIFA 4IJHA 4A3CL 4XTCS 1V43A 4BA1I 4DR5L 5IYDH 2EYPA 4L5RC 2LXJA 3IFDA 3P20A 2DGYA 4A3DH 4MN3A 2VNUD 1PZJD 1VMPA 3S15B 2YU9B 1A63A 1X56A 1I6VC 5BR8Q 5EAYA 3A5ZB 2VUMB 1QZHA 3NTKA 4ZLTF 4GNXA 1SMXA 4C3HG 1N36L 3D6CA 1I94L 3M3YB 2L0ZA 2K05A 1MIUA 1VQ5A 2DY7A 4A3JG 5D3DA 2K32A 2CKZB 4RCNA 3FPUB 4BBRG 2RSNA 3DM1A 5KIXA 2PW5A 2FFKB 2F0SA 3BZKA 3G48A 5FO9B 5J39A 4DR3Q 2N88A 2A68D 5IIFA 2F0GA 1EYGA 2EQSA 3QG1A 1YJWA 4KKSA 1GD7A 3J81L 4BS9A 1WTRA 1R9TH 1PH6A 1X55A 4KY7A 2JP1A 3PGZA 1HNZL 1D8LA 1MHWC 3S1RH 1Q1BA 1SYDA 4DV3L 1K8OA 3VA7A 5EINC 1D5MC 1IL2A 3NHHA 3PIO1 5IYDL 3NUCA 3CPFA 2Z6KC 2F4VL 1EZ6A 1N34Q 4A3DL 3I4LA 3NBHB 3L9AX 4R4QA 3PUZA 4FF2A 3HJYB 4IO9A 4PMCA 1XNRQ 3TS2A 5ELOA 3HOXH 4LFCQ 2B2UC 1CA5A 1RDGA 1B53A 1HNXL 4C3JL 2RSOA 3TP8A 2CKAA 1Q7YC 2CQAA 2E2DC 1GHJA 3TZDA 3VDYA 4GLAC 1VQAA 3H91A 4C3IH 4BY7G 4GKJL 1A2TA 3E6ZX 2Z6BA 1SNPA 3HOYL 1ET6A 1OXVA 3HS0C 1IZ6A 4HIDA 2WKDA 3EQLC 2ZM6L 1SE8A 1R9TL 3FKIG 4X66L 3S1RL 1MKHA 1SNQA 4KD4A 3SK4A 3UE0A 1SAPA 5I6WA 1R0FA 1Y1WB 1SYFA 1S5FD 3QJYA 1ZYRC 3FPPA 2ERJA 1JT8A 5IYBG 2K14A 4C2MH 2PCFB 4B08A 3GTKH 3H15A 2VUMG 1HZAA 1A3VA 2WAQG 3HOXL 2R7ZL 1VQHA 1AZQA 1DYQA 4DA2A 1G6PA 3A56A 1IBLL 4OONA 2E2JH 3CD6A 5M5YL 3VYTA 2GMGA 1PA6A 1LKOA 4KJNA 3LNLA 4LF8Q 5EKIA 3T13A 4RA8A 4C3IL 5CV6A 5ISRA 1QUQB 2PNRC 4DAYB 3IL8A 5IT9E 2R7DA 2NVQH 2H12A 4NMZA 5I6YA 4R4TA 4BBSH 5AI2A 1IYJB 2N3SA 1PFNA 4IUTA 1TXYA 1VQIA 3M4OB 1VCXA 1WOCA 2O5IC 2Z6KA 2XRSD 4WJWA 3T4AC 1XMQL 1YK4A 2PQAA 2HHHQ 1FGBD 3I4NB 3GTKL 3RLNA 3KYYA 1JYBA 4X62L 4A3EH 1SE3A 4JBMA 3HOUH 5ELCA 2M6PA 1SNOA 1ESRA 2EYHA 4IFDI 5JPMC 4K6LA 3DEOA 2M2LA 5IGEA 1YNXA 1LT6D 2B2UA 2L15A 2L12A 4C2M1 2E2JL 2YV5A 4DR2Q 2PMZB 1I4QA 1HZBA 1NJIC 4JOIA 2NZOA 1QILA 4NXNL 4NDXA 4ODGA 3Q0AA 3KFUA 3OIPA 4KJOA 1YITA 2NVQL 4JC0A 2V0FA 2PVXA 4DR1Q 1NUCA 2F0DA 2F0UA 1I50B 1NCVA 4K0KQ 5CBAE 4AR5A 5MFPA 2UU9Q 2JSOA 1KTKA 3W1BA 4WJ4A 4A3CG 4JYAQ 1FNVA 3HOZH 2APOB 1G51A 1YIJA 3J81i 4ILWA 4BA2I 5E4WC 3H3VH 1T9QA 1PFBA 4A3EL 1IXRA 3HOUL 4JI3Q 3F2BA 2IW3A 3KJPA 1VQBA 2L55A 4U68A 2MHVA 2K5VA 2E2HL 3URYA 3TP7A 3DMUA 2NUCA 2JA8H 3KK7A 2RDVA 5L37A 2EY1A 1RKNA 1O78A 3IRBA 1K8GA 4N8X1 2RF4A 1VQFA 4CJ1B 2RHSB 3I4OA 3CU7A 4K8JA 2J9UB 1BXTA 1XYIA 2NBFA 1N33Q 1R0GA 3CCEA 3CRKC 5CORA 2HCIA 1X3FA 1VF5C 5IP7L 1JC7A 3MC0B 4X6AH 4PV1C 1Q3LA 3SE0A 2K5HA 2MQHA 3KLWA 5C4JH 3C1FA 1CKOA 1O7IA 5EIOC 1X54A 2KN9A 3A8IE 5K2ME 4X3SA 4S3SA 2NYDA 4A3DG 2HVYC 3TQYA 2JI1A 3KUPA 2E5LL 3PO2B 2AQ1B 3DWQA 3TRZA 2KEDA 1EY0A 2CWAA 3GTLH 4A3FB 2NN6H 2QGQA 1JMCA 4IQZA 2JA8L 4A3GH 4XQQA 3M7NA 2CW0D 4LF5L 3L0OA 2CWPA 3QIAA 5LMUL 1PH7A 3ONAB 3S1QH 1QE6A 1D1IA 3VR6A 1UNSA 3MA2B 3H0GH 3B6YA 2SOBA 4R8NA 1VQ8A 1BOSA 4NXML 2LXKA 4BY1B 2ZJRA 1PTOC 4A3KB 4YCUA 3CCLA 2XJPA 3J80E 3PZAA 5C4JL 2PZUA 4F7XA 3TP5A 1L1OC 3BDOA 2JA5B 4DV7Q 4JPBW 3JC63 4DV2L 2GVAA 4K8IA 4JK1C 4G4KA 1RYQA 3GTJH 2C35B 1C8CA 1EWIA 4JBKA 3BG3A 1WVLA 2F3VA 3LWOB 3GTLL 4NPSA 4XXEA 3HOXG 4JI6L 2UXDL 1K83L 2OF1A 1B13A 1YHBA 3NP8A 1G6ZA 3PSIA 3K5NA 4OIKA 4B9XA 4C3IG 3P8BA 1I4GA 1STYA 2RCFA 1M90C 4EQPA 1Q46A 4KN4C 3H0GL 3DLLA 1VQ9A 1NY4A 2I07B 3OSOA 4DV5Q 1TWHH 3U58A 1VS0A 3S2HB 4V196 3DM3A 4QUFA 2LCQA 5HURA 1WJVA 1B50A 3T53B 3UDIA 3JAME 2NVXH 1QCBD 1NMFA 1M8AA 1VMCA 2XWJB 4ME3A 1ASYA 3MAQA 4KY5A 5CBEE 2WB1B 4JI0L 4QY7A 1GUSA 4KHPL 3GTJL 2CQOA 5ELEA 5JJKA 4XYQA 4DV1L 4A3FG 4C1NI 5CV7A 4JI4Q 3EJIA 3VPBE 5MGNA 4OL7A 1KAWA 2YTVA 2LS01 1ZRPA 1NNXA 1XTDA 2X6LA 1F9QA 1WFQA 1GJXA 2L5TA 4HSVA 1PRTC 1PH9A 3QQCE 2ZXOA 2KCTA 1VQ6A 4ZRZA 4A3KG 1TWHL 2OXPA 4BBSG 2N55A 1NR4A 4YY3Q 4AI0A 1ESFA 1H9JA 2B2VC 1XMOQ 1TWCH 3MXNB 2EXDA 1L0YB 1IU6A 1CQFA 1V1PB 2NVXL 1YNND 2BE5C 3F1ZA 1ZKOA 3ULLA 3J81j 2JA5G 4LNQA 1L1OA 3U9OA 4YHHQ 2J0TD 1QB5D 2F0NA 4AHXA 2EY4E 1WCMH 3C2PA 3HOVH 3EVQA 3RZ6A 4LW1A 4A3EG 4F88A 3HOUG 5E7NA 1HPCA 1W6JA 3HOWL 1KLUD 2L1BA 3S14H 4IURA 2QW7A 3DUZA 4AIMA 2F0MA 1PH5A 1ILPA 2XIWA 2KVMA 4J15A 1EY7A 2Q8RE 3K7AB 4LF7L 3CCSA 4LFBL 1WYDA 1YUZA 5RXNA 2K52A 4ZQ3A 4LF9L 1G91A 4A3MH 4J8QA 3IAYA 2Z8LA 4JADA 1J5EQ 3CC4A 1RD9D 1ONLA 2AUKA 4LHNA 3K7UC 3OOCA 4G7ZC 3QOLA 2KHJA 1QVFA 2F0EA 4IFDH 3S17B 4DAMA 4A76A 1TWCL 2K28A 3I55A 3CCJA 3J7Z1 3RR5A 5IGFA 5M5WH 1TWAH 4LFAL 4JI2Q 3HOZG 2WB1G 4J6HA 1WCML 3JC62 4KHVA 4AHYA 1IROA 3NSWA 3S14L 2FMCA 4DFAA 4HR7B 4JV5L 1RYTA 2PPBC 3TZUA 5A2QE 1I3QB 1WI5A 3LWPB 2K75A 2K50A 2JA8G 5IT9c 3OIQA 1TY2A 3I90A 2R61A 3GO5A 4GOPC 3AMUA 1Q86C 4A3ML 1B7YB 3B0AB 1TT2A 1KDBA 2UUAL 5CYUA 1BKBA 2F0KA 3JC66 2V1CC 5DM73 1YI2A 5LMNL 2PPTA 5E1FA 3GTOB 3I2ZA 1STNA 1D1KA 3OWFA 5FJ8H 3O13A 1WTXA 2LFNA 4I7AA 4G7HC 3KLSA 2B2VA 1E1TA 4RGTA 5FLXE 5M5WL 1I4HA 1BFYA 2Z1CA 3HKZG 1VQ7A 2YYZA 1SFOH 1P8LA 2VB3X 1EY9A 5HGTA 1NSNS 1X3QA 1F2MA 2DJGC 2UUBL 1Y69U 2PVEA 4LMQD 3D8GA 3ERQA 5C5LA 4A3GG 1STEA 1G291 5T1GA 4L6TB 3H99A 2KOLA 3VYUA 3HRZC 2XJVA 2JA9A 5GQOA 4ZK9B 4Y7NB 2KCCA 3RZDH 3CAMA 2EDGA 2EYLA 2JK8A 5H1SE 1OXXK 2E2IH 2QA4A 2N8NA 3CRLC 4QUCA 1IW7D 2XVSA 1LACA 4AYBB 2SEBD 1G2SA 2OCEA 4PMBA 1ZEQX 1F2LA 4L5TA 4LWCA 3TMEA 4L8JA 4DR7Q 2JEBI 4IUUA 1JB3A 1A6XA 4F87A 1R0JA 2TMPA 1SFOL 1DXMA 4DUYL 4MZ9A 5IY0A 3CCUA 4POFA 1C4QA 1X3GA 2EYJA 2VY3A 4X65Q 1VQKA 2R93L 3LWUA 2JN4A 4YWKA 2D0OA 1DCZA 5IGBA 2TSSA 3G4SA 3D0FA 5C44B 2ERSA 1SE4A 2UXCQ 2JA6B 5BR8L 4GOPA 3S1MH 1HJPA 2F52A 4RKBA 3RZDL 4QF4A 5MFZA 1K73C 2E2IL 1LTSD 1WTHA 2K5NA 4XT1B 2RA4A 5E3FA 5FK9C 4ABNA 1UEAB 1HQMC 1WD1A 4GKKQ 1SMWA 1B8AA 4GLXA 1VQGA 4RCOA 3DHQA 2NVYB 4CKCA 2MO1A 3TP6A 2RBMA 2XSCA 3R2IA 2R92H 3GTQB 1XWEA 4C3HB 1HFNA 5FO8B 2JI3A 1YK5A 2Q8TA 4RXNA 2PMZE 3T16A 4BBRB 2NTSA 4MIUA 4IPHA 4R4CA 1N34L 3QOJA 2ICIA 1B2JA 3S1ML 2FINB 4QQBX 3J80c 3PIPA 2KUMA 4CDFC 1YV1A 4IPCA 2JA7H 3HGBA 2B63B 1EIGA
chains in the Genus database with same CATH topology
4AYBG 1YJ9A 1E8JA 3RZOH 4JI1L 4NB3A 3HOVG 3K35A 3KDFB 3GTPH 5IP9H 1IU5A 2D62A 3MEFA 5C44G 4HIOA 1OWCA 2AKWB 4A3IH 1Y14B 4HJ7A 2JA6G 1S72A 1Z47A 3PUWA 2DSXA 3TS0A 3JAMc 1HR0W 1QCVA 1NXGA 1XNQQ 1E24A 4B3RQ 1PFSA 3KF8B 4LF8L 5C4XH 4A3LH 4A3BH 5C3EH 2Q2HA 2GN5A 4C3JH 5IYCH 2MS3A 4UY81 3CP0A 3F2DA 1N32L 1YVCA 3HOYH 3I4MH 2ZJPA 2B63G 2C6BA 4TPUA 1GO3E 4GN3B 4DR2L 2V0EA 2YTXA 1NNQA 5FJ8G 1W3SA 2DUDA 4DUZL 4LF6Q 3KF6B 3CCRA 2PSMC 2R7ZH 3ER0A 4UP9A 4DR1L 5M5YH 3T1YQ 3CCVA 3GTGH 1K8AC 2QEXA 1GKHA 1K0RA 3ERSX 4JI3L 4JI5L 5LMNW 2R7FA 1NMGA 4OWXB 3PO3H 3EIVA 1LKMA 1ASZA 1VZGA 1NXEA 2XGTA 4HJ8A 2WB1E 4OO1I 1BQ9A 3LPEB 2VQEL 4DR6Q 4PZ6A 4R1JA 4OX9Q 1LYLA 4X64Q 2HT1A 4OWWB 1JJGA 1OTCA 1VQLA 2VZAA 5J3BA 2ZJQA 4DR5Q 5FLXc 1PYSB 2A6ED 4LF4L 4DNIA 4PG3A 4HJ9A 4DV0Q 1C0AA 1CSQA 2WP8J 3L7ZC 2JQOA 1N36Q 4JI8L 2E2HH 5AJ3L 2R92G 1XPOA 1NTGA 4IPDA 4A93H 5M5XH 5MLC3 2KHIA 3WWVA 5H1Sc 1IBML 2N49A 1AE2A 5IP7H 1HNZQ 4DV3Q 4R4IA 2AYJA 2F4VQ 3W5OA 5GAHC 4ZN3B 2A19A 5GADC 3BZCA 3L2PA 2RHQB 1HNXQ 1FL0A 3STBC 1QUQA 4B3ML 5IP9G 1H95A 1GVPA 2M6OA 4A3IG 1RWDA 2ZM6Q 1T9OA 5M3FH 1W2BA 1PH3A 3SGIA 2MFIA 2A69D 2VQFL 5JVH1 5IYDG 2I5HA 2KBNA 1C7YA 1Q12A 2V3BB 1OWBA 4A3LG 1VQJA 2Q2UA 3S24A 3P2AA 4WFN1 1K83H 1UWVA 2VS1A 5IYCG 2QL0A 4YWMA 3CPWA 1S40A 2LSSA 4YHHL 3HOYG 5MF6A 2IT1A 3ZJYC 3K0XA 4AYBE 5M3MH 2CFMA 4TVMA 4GN4B 4X62Q 2PYAA 5GAHc 3I56A 4B3SL 3KYWA 4L5SA 1CKNB 1J5EL 1JJ2A 5GADc 2R7ZG 1RL2A 3AYHB 1FHHA 2E8GA 4NXNQ 3KJOA 1PYBA 3TREA 3U50C 4JI2L 1E1OA 4RMFA 1U5KA 5C0XI 2Y0SG 1VQMA 4WJ3M 1X3EA 4IOCA 3HFZB 1Q81C 1A0IA 4DV6L 3PF5A 1BBWA 3HOWH 4DR4L 3S2DH 2MO0A 3G71A 3KYUA 4RG1A 3S1NH 1HNWQ 5GAEC 5ELNA 4GS3A 1VQOA 4A4IA 3E0EA 4OWTB 1C09A 4G6BA 1HR0L 1E22A 3WWNB 1DX8A 2E5LQ 2UXBL 4U671 1Y1VH 4P73A 4LUOA 3CQZH 2K2DA 1U0LA 4LF5Q 2M4YA 1KD1C 3G6EA 4ALPA 2NVTH 3NENA 4DV4Q 2PNHA 5IP7G 2UUCL 5JJIA 4IPGA 5FLMH 4DK3C 2HIVA 1T9PA 1UE5A 1VQPA 1FJGL 2HR5A 4JBWA 2R6GA 5IWAL 4AH6A 4IOAA 4DV2Q 4QJFA 2UXCL 1V9PA 2WAQE 4JI6Q 2UXDQ 1S30A 4OXPA 4GN5A 1R0IA 3PIP1 5GAEc 3PF4A 3OYYA 5M3FG 4A3JH 1V1QA 3ICEA 2XJRA 2KENA 4JAFA 4P74A 4HIKA 3EN2A 4PZ8A 4JI0Q 1SLJA 2R93H 2B5ID 2NN6G 2IHFA 1I6HH 1KL9A 4UP7A 3J7ZC 3M4QA 3H0GG 2EIFA 4JI7L 2I5LX 1E3PA 3MPSA 2B29A 1VZIA 4BY7H 1FGUA 1PV4A 5M3MG 3M4PA 2Q2IA 4AR3A 3OTOL 1LM0A 4HJAA 1TWFH 1KRTA 4AI2A 2VL6A 4P72A 3PWFA 3S15H 4B3RL 1LTLA 2YU9H 4LF7Q 4LFBQ 1C9OA 2VUMH 4LF9Q 1VQNA 3BU2A 1OXTA 1XPRA 3EBEA 3M3YH 2XJUA 1S3OA 3HKSA 1EQQA 2IX1A 1JB7A 3MSUA 4DR3L 3CC7A 2A1AA 1WJJA 1PH2A 4JV5Q 3HOWG 2OWOA 2FXQA 1UE7A 1EUJA 1R0HA 5AN9H 1E7ZA 3J80i 3CCQA 1XNRL 2ZTCA 2UUAQ 4LFCL 5GROA 1X9NA 3CW2C 4GNXB 1Q82C 3T1HQ 1UE6A 4YCVA 2CKCA 4QIWE 1WCMG 2IY5B 3W1GA 1Y1WH 2UUBQ 1LKPA 2OQKA 1MJEA 1PH8A 1PHJA 1Z92B 4HIMA 1GM5A 3J7Y1 4A3MG 1XPUA 5GAGC 3JAMi 1Z9FA 4HJ5A 2Y0SE 4IFDG 4UPAA 8RXNA 4KLKA 2WFWA 4DUYQ 1YZ6A 3E9IA 3FP9A 4KHZA 3LGJA 3M4OH 1T9HA 4DV0L 3I4NH 3RN5A 1KXLA 2HHHL 4ZN1B 3NEMA 1RIPA 1RDVA 1H7VA 3B08B 1ODHA 2PI2E 1VZHA 5AI3A 3KDFA 1NE3A 1OXUA 1VQ4A 5HGQA 1I50H 7RXNA 4AR4A 4K0KL 3GDEA 2JI2A 2UU9L 2R93G 2B3GA 3KYHC 4JYAL 1BQ8A 1BRFA 1B70B 4IFDJ 1KC8C 2O5JD 3UDFA 2Q2TA 3A74A 3KYVA 3K81C 2PQAB 3NFPI 4QGUA 2D0PA 2XJSA 3PUVA 4B3TQ 4EQ5A 4K9FA 3KOJA 5GAGc 4JOIC 3PV0A 3RZTA 4UY8C 4AQYQ 4JI1Q 1OXSC 1N8RC 1N33L 4TVAB 1K9MC 4XIGS 5IE8A 4PMWA 5K36G 4LUZA 2BH8A 1DGSA 3E9HA 4Y52H 4JG2A 3PO2H 1VCIA 2NZHA 2XTIA 4A3FH 3A0JA 2Z3RB 1PH4A 4DK6C 3KF6A 1A62A 3PUYA 1PH1A 3HKZE 1YUXA 2VW9A 2ZIXA 3WWLA 1SROA 4BY1H 1I94Q 1S24A 4A3KH 1UE1A 4POGA 2JA5H 4IJLA 2XJQA 5DLQE 1SN8A 1N32Q 5C0XG 4DV7L 2ZTEA 1UEBA 3RLFA 1IRNA 2BE5D 3RNUA 2JA7G 1MJCA 2GVBA 2Z0SA 3PKJA 3CMEA 1CSPA 4DUZQ 3ULPA 1YBYA 1HH2P 4DV5L 3S2HH 1HZCA 1AH9A 1Y1WG 2ID0A 4GKJQ 3PIOA 3J81c 4O2DA 4JI5Q 4X66Q 2AWOA 2OQ0A 4DKAC 4JI4L 4BXXH 1HNWL 5C4XG 1SMMA 1KHIA 4JAGA 4A3BG 5C3EG 2VQEQ 5C0XJ 2A8VA 4XGHA 1EQRA 3CF5A 4AR6A 5JJLA 1IBLQ 3RLOA 4YY3L 1FVIA 1XMOL 3I4NG 1RB9A 3U4VA 3A5UA 3ULJA 1CADA 3SS2A 1D7QA 3I4MG 2Z3QB 1KQSA 1L0WA 4H02A 1X6OA 4LF4Q 3K7AH 2BA1A 3AEVA 1XMQQ 1JE5A 4UP8A 1L2FA 4TQUS 4JI8Q 5AJ3Q 4DV4L 1NBWA 3S17H 5JEAG 2CCZA 1P16A 2MNAA 1QVGA 1DVBA 1IBMQ 2C6AA 1YHAA 3RN2A 4R4OA 1L1OB 1I3QH 3I7FA 3D31A 3CCMA 3PO3G 3PCOB 2RCNA 4AI1A 2F3IA 3GTOH 4APVA 2ES2A 1EFWA 1AE3A 1QYBA 4B3MQ 4E6YA 4JBJA 3QVDA 1X65A 3PO2G 4L5QA 5DM71 2VQFQ 2PI2A 3PKIA 4YWLA 3K8AA 2BA0A 2ATWA 4EX5A 2M4VA 3U4ZA 5JEAJ 1CKNA 1CKMA 4Y7NH 3K80C 2AWNA 2HIXA 4BY1G 1EOVA 1VQDA 4AHZA 4PZ7A 5LMUQ 4A93G 3F8TA 4P71A 3UDGA 4DR7L 2IX0A 4NXMQ 2BH2A 4A75A 3CXCA 4LHLA 4X65L 5C44H 1BE7A 1CAAA 2JA6H 4YCWA 4B3SQ 2YTYA 4JAEA 3Q8DA 3UDXA 1I5FA 1KRSA 4GKKL 2NVYH 4MNOA 3PUXA 3AFPA 3GTQH 4C3HH 2HQLA 1N9WA 3CMAA 4BBRH 2AHOB 2N78A 3AQQA 1K3RA 1CUKA 1SR3A 1SMUA 2ALYB 4DV6Q 4GS7D 4BXXG 2CR8A 3M85A 4KHPQ 4JCVE 4DR4Q 2KCMA 2B63H 4DV1Q 4XXBB 4GOPB 2KKDA 3T1HL 3IU3I 2I0QA 1B2OA 3BJUA 3GD7A 1FHMA 1M1KC 3S16H 3GTMH 2IHEA 3NELA 4P75A 1HR0Q 4B8CD 5JVG1 3CC2A 1IBKQ 2OTJA 2I5MX 3A44A 2UXBQ 3TEHB 3FKIH 1BVSA 1BBUA 1XNQL 2H5XA 1QVCA 5IYBH 1YEZA 4O0AA 4QL5A 3FHWA 1YHQA 1SRUA 3ZG6A 2K4KA 4GLVB 1YJNA 2UUCQ 4FDBA 2ASBA 1A8VA 1FJGQ 5IWAQ 3OW2A 4LFAQ 2OTLA 5DM61 4KI0A 1Q1EA 1LUZA 1TWGH 2JJQA 1JJCB 2JEAI 4GNXC 1QZGA 4AI3A 4LF6L 1VQEA 2JE6I 4AHWA 5LMNQ 1PVOA 6RXNA 4LUVA 4OO1G 3T1YL 3H3VI 5HY6A 3M9BA 4DPGA 1J6QA 3RYGA 1Y1VG 4A3CH 3KYXA 3UE1A 1VQCA 1EIYB 4B3TL 1B71A 1HZ9A 3F2CA 4MTNA 4AQYL 2A6HD 4JI7Q 1XJVA 4DR6L 5FLMG 4OX9L 3AFQA 1S2ZA 4X64L 1Q8KA 2XJTA 1KIXA 3OTOQ 3STBD 2AMCB 2NN6I 2ZTDA 3J7A5 1EIFA 4IJHA 4BA1I 4XTCS 1V43A 4DR5L 5IYDH 4L5RC 2LXJA 2DGYA 4A3DH 2VNUD 1A63A 1X56A 5BR8Q 5EAYA 3A5ZB 1QZHA 4GNXA 1SMXA 1N36L 1I94L 2L0ZA 1MIUA 1VQ5A 4A3JG 2CKZB 4BBRG 3BZKA 3G48A 4DR3Q 2A68D 1EYGA 2EQSA 1YJWA 1GD7A 1R9TH 1PH6A 1X55A 1HNZL 3PGZA 1D8LA 3S1RH 1Q1BA 4DV3L 5EINC 1IL2A 3PIO1 3CPFA 2Z6KC 2F4VL 1N34Q 3NBHB 4R4QA 3PUZA 4IO9A 1XNRQ 3TS2A 5ELOA 3HOXH 4LFCQ 1RDGA 1HNXL 2CKAA 1Q7YC 3VDYA 4GLAC 1VQAA 4BY7G 4C3IH 4GKJL 1OXVA 1IZ6A 4HIDA 2ZM6L 1SE8A 3FKIG 4X66L 1MKHA 3UE0A 1R0FA 2ERJA 1JT8A 5IYBG 2K14A 4C2MH 3GTKH 3H15A 2VUMG 1HZAA 2WAQG 1VQHA 1G6PA 1IBLL 4OONA 2E2JH 3CD6A 2GMGA 1PA6A 1LKOA 4LF8Q 3LNLA 1QUQB 4DAYB 2R7DA 2NVQH 2H12A 4R4TA 4BBSH 5AI2A 1IYJB 2N3SA 1TXYA 1VQIA 1VCXA 1WOCA 2Z6KA 1XMQL 1YK4A 2PQAA 2HHHQ 3RLNA 3KYYA 1JYBA 4X62L 4A3EH 4JBMA 3HOUH 2M6PA 4IFDI 1YNXA 2L15A 2YV5A 4DR2Q 1HZBA 1NJIC 4JOIA 2NZOA 4NXNL 3KFUA 1YITA 4JC0A 2V0FA 2PVXA 4DR1Q 4K0KQ 4AR5A 5MFPA 2UU9Q 3W1BA 4WJ4A 4A3CG 4JYAQ 3HOZH 1G51A 1YIJA 3J81i 4BA2I 3H3VH 1T9QA 1IXRA 4JI3Q 3F2BA 3KJPA 1VQBA 2K5VA 2JA8H 2RDVA 3IRBA 1K8GA 2RF4A 1VQFA 2RHSB 3I4OA 2J9UB 1N33Q 1R0GA 3CCEA 1X3FA 4X6AH 2K5HA 2MQHA 3KLWA 5C4JH 1CKOA 1O7IA 5EIOC 1X54A 2KN9A 5K2ME 2NYDA 4A3DG 3TQYA 2JI1A 2E5LL 3TRZA 2CWAA 3GTLH 2QGQA 1JMCA 4A3GH 3M7NA 4LF5L 3L0OA 2CWPA 5LMUL 1PH7A 3S1QH 3H0GH 3B6YA 1VQ8A 4NXML 2LXKA 2ZJRA 4YCUA 3CCLA 2XJPA 3PZAA 1L1OC 4DV7Q 3JC63 4DV2L 2GVAA 1RYQA 3GTJH 2C35B 1EWIA 4JBKA 4NPSA 3HOXG 4JI6L 2UXDL 1B13A 1YHBA 3PSIA 3P8BA 1M90C 1Q46A 3DLLA 1VQ9A 1NY4A 4DV5Q 1TWHH 3U58A 1VS0A 4V196 3DM3A 2LCQA 1WJVA 3UDIA 2NVXH 1NMFA 4ME3A 1ASYA 4JI0L 4QY7A 4KHPL 2CQOA 5JJKA 4DV1L 4A3FG 4JI4Q 3VPBE 5MGNA 1KAWA 2YTVA 1ZRPA 1XTDA 1WFQA 1PH9A 3QQCE 2KCTA 1VQ6A 4A3KG 4BBSG 4YY3Q 4AI0A 1XMOQ 1TWCH 3MXNB 2EXDA 1IBKL 1IU6A 3F1ZA 2JA5G 3ULLA 3J81j 4LNQA 1L1OA 4YHHQ 4AHXA 1WCMH 3HOVH 3RZ6A 4LW1A 4A3EG 3HOUG 5E7NA 3S14H 4AIMA 1PH5A 4J15A 4LF7L 3CCSA 4LFBL 1WYDA 1YUZA 5RXNA 2K52A 4LF9L 4A3MH 4JADA 1J5EQ 3CC4A 4LHNA 3K7UC 1QVFA 2KHJA 4DAMA 4A76A 3I55A 3CCJA 3J7Z1 3RR5A 5M5WH 1TWAH 4LFAL 4JI2Q 3HOZG 2WB1G 3JC62 4AHYA 1IROA 4JV5L 1RYTA 1WI5A 2JA8G 2K75A 2K50A 5IT9c 3GO5A 4GOPC 1Q86C 1B7YB 3B0AB 2UUAL 1BKBA 3JC66 2V1CC 1YI2A 5LMNL 2PPTA 3I2ZA 5FJ8H 1E1TA 1BFYA 3HKZG 1VQ7A 2YYZA 1SFOH 1P8LA 2UUBL 2PVEA 4A3GG 1G291 2XJVA 2JA9A 5GQOA 3RZDH 3CAMA 2JK8A 5H1SE 1OXXK 2E2IH 2QA4A 2N8NA 1IW7D 2OCEA 4L5TA 4LWCA 4DR7Q 2JEBI 1R0JA 4DUYL 4MZ9A 5IY0A 3CCUA 4POFA 1X3GA 2VY3A 4X65Q 1VQKA 4YWKA 2D0OA 3G4SA 3D0FA 2ERSA 2UXCQ 5BR8L 4GOPA 3S1MH 1HJPA 2F52A 5MFZA 1K73C 2K5NA 4GKKQ 1SMWA 1B8AA 4GLXA 1VQGA 2MO1A 2R92H 2JI3A 1YK5A 4RXNA 2PMZE 4IPHA 4R4CA 1N34L 1B2JA 4QQBX 3J80c 3PIPA 1YV1A 4IPCA 2JA7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQH A;  4AYB G;  4UP8 A;  4GN5 A;  1YJ9 A;  1G6P A;  1L2F A;  4TQU S;  4JI8 Q;  1IBL L;  4OON A;  2E2J H;  1E8J A;  3CD6 A;  5AJ3 Q;  1R0I A;  1NBW A;  4DV4 L;  3RZO H;  2GMG A;  1PA6 A;  3S17 H;  4JI1 L;  1LKO A;  4LF8 Q;  3PF4 A;  3OYY A;  5JEA G;  5M3F G;  4A3J H;  1QUQ B;  1V1Q A;  2CCZ A;  1P16 A;  4NB3 A;  3HOV G;  4DAY B;  2MNA A;  3ICE A;  2KEN A;  2R7D A;  3KDF B;  2NVQ H;  4P74 A;  3GTP H;  1QVG A;  4HIK A;  1DVB A;  3EN2 A;  5IP9 H;  1IBM Q;  4R4T A;  4BBS H;  1IU5 A;  5AI2 A;  2D62 A;  1YHA A;  1IYJ B;  3MEF A;  4PZ8 A;  3RN2 A;  4R4O A;  5C44 G;  1L1O B;  2N3S A;  4HIO A;  2AKW B;  4A3I H;  4JI0 Q;  1TXY A;  1Y14 B;  1VQI A;  4HJ7 A;  1VCX A;  1I3Q H;  1WOC A;  2JA6 G;  1SLJ A;  3I7F A;  2Z6K A;  1S72 A;  3D31 A;  1XMQ L;  1YK4 A;  3CCM A;  2PQA A;  2HHH Q;  3PO3 G;  1Z47 A;  3PCO B;  3RLN A;  2R93 H;  3KYY A;  2RCN A;  3PUW A;  1JYB A;  2NN6 G;  2IHF A;  4X62 L;  4A3E H;  2DSX A;  4JBM A;  3HOU H;  3TS0 A;  2F3I A;  1I6H H;  1KL9 A;  4UP7 A;  3JAM c;  1HR0 W;  1QCV A;  1XNQ Q;  4IFD I;  1E24 A;  4B3R Q;  1PFS A;  1YNX A;  2L15 A;  3KF8 B;  3M4Q A;  3J7Z C;  4LF8 L;  2YV5 A;  4DR2 Q;  3GTO H;  5C4X H;  4A3L H;  4APV A;  1HZB A;  1NJI C;  4JOI A;  1EFW A;  2ES2 A;  4A3B H;  1AE3 A;  2NZO A;  3H0G G;  5C3E H;  1QYB A;  2EIF A;  4B3M Q;  4NXN L;  2Q2H A;  2I5L X;  4JI7 L;  4JBJ A;  2GN5 A;  1E3P A;  3KFU A;  1YIT A;  3MPS A;  2B29 A;  4JC0 A;  4C3J H;  4BY7 H;  3QVD A;  2PVX A;  1FGU A;  1X65 A;  5IYC H;  4DR1 Q;  1PV4 A;  5M3M G;  3M4P A;  3PO2 G;  4K0K Q;  4L5Q A;  2MS3 A;  2Q2I A;  4AR5 A;  4AR3 A;  2UU9 Q;  3CP0 A;  3W1B A;  3OTO L;  4WJ4 A;  2VQF Q;  1LM0 A;  4A3C G;  3F2D A;  4HJA A;  1N32 L;  1YVC A;  1TWF H;  3HOY H;  4JYA Q;  1KRT A;  2PI2 A;  2VL6 A;  1G51 A;  4YWL A;  1YIJ A;  3HOZ H;  3K8A A;  4P72 A;  2BA0 A;  2ATW A;  3J81 i;  4EX5 A;  4BA2 I;  3H3V H;  3PWF A;  1T9Q A;  3U4Z A;  3I4M H;  1IXR A;  5JEA J;  2ZJP A;  1CKN A;  4JI3 Q;  2B63 G;  3S15 H;  1LTL A;  3F2B A;  2YU9 H;  4B3R L;  4LF7 Q;  4TPU A;  1CKM A;  4LFB Q;  1C9O A;  4Y7N H;  1GO3 E;  1VQB A;  3K80 C;  4GN3 B;  3KJP A;  2AWN A;  2HIX A;  2K5V A;  2YTX A;  4DR2 L;  4LF9 Q;  2VUM H;  1VQN A;  1NNQ A;  5FJ8 G;  2JA8 H;  2RDV A;  3BU2 A;  1OXT A;  1EOV A;  2WAQ G;  3IRB A;  4BY1 G;  1XPR A;  1K8G A;  2RF4 A;  1VQF A;  3EBE A;  3M3Y H;  1W3S A;  2DUD A;  1VQD A;  2RHS B;  1S3O A;  3I4O A;  4DUZ L;  4PZ7 A;  4LF6 Q;  3HKS A;  3KF6 B;  3CCR A;  1EQQ A;  1N33 Q;  1R0G A;  3CCE A;  2IX1 A;  5LMU Q;  1JB7 A;  1X3F A;  2R7Z H;  2R92 G;  3ER0 A;  3F8T A;  4P71 A;  4UP9 A;  4DR1 L;  4A93 G;  3UDG A;  5M5Y H;  4DR7 L;  4X6A H;  4DR3 L;  2IX0 A;  2K5H A;  3T1Y Q;  2MQH A;  4NXM Q;  3CCV A;  2BH2 A;  3KLW A;  3CC7 A;  3GTG H;  5C4J H;  1K8A C;  1O7I A;  1CKO A;  4A75 A;  2QEX A;  1X54 A;  2KN9 A;  2A1A A;  1WJJ A;  3CXC A;  1PH2 A;  4X65 L;  4IFD G;  4JV5 Q;  5C44 H;  1GKH A;  2OWO A;  3HOW G;  1K0R A;  4A3D G;  2FXQ A;  1BE7 A;  1CAA A;  3ERS X;  4JI3 L;  3TQY A;  4JI5 L;  2E5L L;  5LMN W;  2JA6 H;  1UE7 A;  1EUJ A;  2R7F A;  4YCW A;  2YTY A;  4B3S Q;  1NMG A;  3TRZ A;  4OWX B;  2CWA A;  3GTL H;  3PO3 H;  3Q8D A;  1R0H A;  3EIV A;  2QGQ A;  1LKM A;  1JMC A;  1E7Z A;  4A3G H;  1ASZ A;  3UDX A;  3M7N A;  3J80 i;  3CCQ A;  1XNR L;  4LF5 L;  3L0O A;  2ZTC A;  2XGT A;  2CWP A;  4HJ8 A;  2UUA Q;  5LMU L;  4LFC L;  2WB1 E;  1I5F A;  1PH7 A;  4OO1 I;  1KRS A;  5GRO A;  1BQ9 A;  2VQE L;  3CW2 C;  1X9N A;  3S1Q H;  4GKK L;  4GNX B;  1Q82 C;  4DR6 Q;  4PZ6 A;  2NVY H;  3H0G H;  4MNO A;  3B6Y A;  3PUX A;  3T1H Q;  1VQ8 A;  4NXM L;  4R1J A;  4OX9 Q;  3AFP A;  2LXK A;  3GTQ H;  1UE6 A;  4C3H H;  2ZJR A;  1LYL A;  2HQL A;  4YCV A;  4X64 Q;  4YCU A;  3CCL A;  2HT1 A;  3PZA A;  4QIW E;  1N9W A;  4OWW B;  1JJG A;  3CMA A;  1WCM G;  1OTC A;  2IY5 B;  4BBR H;  3W1G A;  2AHO B;  1L1O C;  2N78 A;  3AQQ A;  4DV7 Q;  1K3R A;  3JC6 3;  1VQL A;  1Y1W H;  1CUK A;  4DV2 L;  2UUB Q;  2VZA A;  2GVA A;  1LKP A;  4KHP Q;  1SR3 A;  1SMU A;  5J3B A;  2OQK A;  2ZJQ A;  2ALY B;  4DR5 Q;  1MJE A;  3GTJ H;  2C35 B;  5FLX c;  1EWI A;  4DV6 Q;  1PH8 A;  4JBK A;  4BXX G;  1PYS B;  4LF4 L;  3M85 A;  1PHJ A;  4NPS A;  4JCV E;  4PG3 A;  4DNI A;  3HOX G;  4DV0 Q;  2KCM A;  4HJ9 A;  4JI6 L;  4DR4 Q;  2B63 H;  4DV1 Q;  2UXD L;  4HIM A;  1CSQ A;  2WP8 J;  4GOP B;  1GM5 A;  1B13 A;  1YHB A;  4A3M G;  2KKD A;  1XPU A;  3PSI A;  3L7Z C;  5GAG C;  3JAM i;  2JQO A;  1Z9F A;  1N36 Q;  1M90 C;  3T1H L;  4JI8 L;  1Q46 A;  2E2H H;  5AJ3 L;  4HJ5 A;  2I0Q A;  1B2O A;  2Y0S E;  1NTG A;  3DLL A;  3BJU A;  1NY4 A;  4UPA A;  4IPD A;  1XPO A;  8RXN A;  1VQ9 A;  3GD7 A;  1FHM A;  4DV5 Q;  1TWH H;  3U58 A;  1M1K C;  3S16 H;  3GTM H;  4A93 H;  1VS0 A;  4KLK A;  5M5X H;  2IHE A;  3NEL A;  3DM3 A;  2WFW A;  2LCQ A;  4P75 A;  4DUY Q;  1YZ6 A;  2KHI A;  3UDI A;  3E9I A;  3WWV A;  1HR0 Q;  2N49 A;  1IBM L;  3FP9 A;  1AE2 A;  4KHZ A;  2NVX H;  1NMF A;  5C4X G;  5IP7 H;  3LGJ A;  3CC2 A;  1IBK Q;  1HNZ Q;  4ME3 A;  2I5M X;  1ASY A;  2OTJ A;  3M4O H;  1T9H A;  1QVF A;  3A44 A;  4DV3 Q;  4QY7 A;  4JI0 L;  4R4I A;  2UXB Q;  4KHP L;  3TEH B;  4DV0 L;  2CQO A;  3I4N H;  3FKI H;  5JJK A;  3RN5 A;  1BVS A;  4DV1 L;  4A3F G;  2F4V Q;  1KXL A;  2HHH L;  4JI4 Q;  3W5O A;  5GAH C;  1BBU A;  1KAW A;  2YTV A;  1ZRP A;  1XNQ L;  2H5X A;  3NEM A;  1QVC A;  1XTD A;  5IYB H;  2A19 A;  1RIP A;  5GAD C;  1YEZ A;  3BZC A;  4O0A A;  3L2P A;  1WFQ A;  4QL5 A;  2RHQ B;  3FHW A;  1YHQ A;  1HNX Q;  1PH9 A;  1RDV A;  1H7V A;  1FL0 A;  1SRU A;  2K4K A;  2KCT A;  4GLV B;  1YJN A;  3STB C;  1QUQ A;  1VQ6 A;  2PI2 E;  4A3K G;  4B3M L;  5AI3 A;  5IP9 G;  1H95 A;  4BBS G;  3KDF A;  2UUC Q;  1NE3 A;  4FDB A;  4YY3 Q;  1OXU A;  1VQ4 A;  1GVP A;  5HGQ A;  1XMO Q;  2ASB A;  1I50 H;  1TWC H;  7RXN A;  1A8V A;  3MXN B;  2EXD A;  1RWD A;  4A3I G;  1IU6 A;  1IBK L;  3F1Z A;  2ZM6 Q;  3ULL A;  2JA5 G;  4AR4 A;  1FJG Q;  1T9O A;  3J81 j;  4LNQ A;  4K0K L;  5M3F H;  1L1O A;  3GDE A;  4YHH Q;  1W2B A;  1WCM H;  1PH3 A;  5IWA Q;  3SGI A;  2MFI A;  2UU9 L;  3OW2 A;  4LFA Q;  3RZ6 A;  3HOV H;  2R93 G;  2VQF L;  2B3G A;  1C0A A;  4LW1 A;  4A3E G;  3HOU G;  3KYH C;  5E7N A;  4JYA L;  1BQ8 A;  1BRF A;  3S14 H;  2OTL A;  1B70 B;  4AIM A;  5IYD G;  2I5H A;  1KC8 C;  1PH5 A;  2KBN A;  4IFD J;  3UDF A;  2Q2T A;  1C7Y A;  3A74 A;  4J15 A;  3KYV A;  1Q12 A;  4KI0 A;  1Q1E A;  3K81 C;  1LUZ A;  2PQA B;  2V3B B;  4LF7 L;  3CCS A;  1VQJ A;  2Q2U A;  1WYD A;  4QGU A;  4A3L G;  4LFB L;  2D0P A;  1TWG H;  1YUZ A;  5RXN A;  2K52 A;  3S24 A;  2JJQ A;  3PUV A;  4B3T Q;  4LF9 L;  4EQ5 A;  4K9F A;  3KOJ A;  4A3M H;  4JOI C;  3PV0 A;  1J5E Q;  3CC4 A;  1JJC B;  1K83 H;  3RZT A;  2JEA I;  3K7U C;  1UWV A;  4UY8 C;  4GNX C;  2VS1 A;  4JI1 Q;  4AQY Q;  1QZG A;  4LF6 L;  4A3G G;  1OXS C;  1VQE A;  2KHJ A;  5IYC G;  1N8R C;  2JE6 I;  4TVA B;  2QL0 A;  4YWM A;  1N33 L;  3CPW A;  1S40 A;  4DAM A;  5LMN Q;  4A76 A;  1PVO A;  6RXN A;  2LSS A;  1K9M C;  4LUV A;  4OO1 G;  3I55 A;  4XIG S;  4YHH L;  3CCJ A;  3RR5 A;  5M5W H;  5IE8 A;  3HOY G;  1TWA H;  4PMW A;  3T1Y L;  5K36 G;  4LFA L;  4JI2 Q;  3H3V I;  2IT1 A;  3ZJY C;  3HOZ G;  2WB1 G;  4LUZ A;  5HY6 A;  3JC6 2;  2BH8 A;  1DGS A;  1IRO A;  3M9B A;  4DPG A;  3K0X A;  3E9H A;  4AYB E;  4JV5 L;  4JG2 A;  3PO2 H;  1VCI A;  1J6Q A;  2CFM A;  1RYT A;  3RYG A;  5M3M H;  4Y52 H;  2NZH A;  1Y1V G;  1WI5 A;  2JA8 G;  2K75 A;  2K50 A;  4GN4 B;  2XTI A;  4A3C H;  3KYX A;  3UE1 A;  5IT9 c;  2PYA A;  1VQC A;  4X62 Q;  3I56 A;  3KYW A;  3A0J A;  4A3F H;  1B71 A;  1EIY B;  4B3S L;  4B3T L;  3GO5 A;  4GOP C;  1CKN B;  1PH4 A;  1J5E L;  4L5S A;  1Q86 C;  4DK6 C;  1JJ2 A;  1HZ9 A;  1B7Y B;  3F2C A;  4MTN A;  2R7Z G;  1RL2 A;  3AYH B;  4AQY L;  3KF6 A;  2UUA L;  1BKB A;  3JC6 6;  2V1C C;  1A62 A;  3PUY A;  1YI2 A;  5LMN L;  1FHH A;  3HKZ E;  1YUX A;  2E8G A;  2VW9 A;  3I2Z A;  1PH1 A;  4JI7 Q;  4NXN Q;  3KJO A;  1XJV A;  4DR6 L;  5FJ8 H;  1SRO A;  4BY1 H;  1I94 Q;  1S24 A;  1PYB A;  1E1T A;  3TRE A;  3U50 C;  4A3K H;  4JI2 L;  5FLM G;  4OX9 L;  3AFQ A;  1UE1 A;  1BFY A;  1S2Z A;  1E1O A;  3HKZ G;  4RMF A;  4X64 L;  1VQ7 A;  1U5K A;  1Q8K A;  2YYZ A;  4POG A;  1SFO H;  1P8L A;  2JA5 H;  4IJL A;  5C0X I;  1KIX A;  3OTO Q;  3STB D;  5DLQ E;  1SN8 A;  2AMC B;  2Y0S G;  1VQM A;  1N32 Q;  4WJ3 M;  1X3E A;  2NN6 I;  2ZTD A;  5C0X G;  4DV7 L;  4IOC A;  2ZTE A;  1UEB A;  3HFZ B;  3RLF A;  1Q81 C;  2UUB L;  3J7A 5;  1A0I A;  2PVE A;  1EIF A;  4IJH A;  4BA1 I;  4XTC S;  1V43 A;  1G29 1;  4DV6 L;  1IRN A;  1BBW A;  4DR5 L;  3PF5 A;  5IYD H;  4L5R C;  3RNU A;  2LXJ A;  2JA7 G;  1MJC A;  3HOW H;  2DGY A;  4DR4 L;  4A3D H;  2JA9 A;  3S2D H;  2MO0 A;  5GQO A;  3G71 A;  2VNU D;  2GVB A;  1A63 A;  1X56 A;  2Z0S A;  3KYU A;  4RG1 A;  5BR8 Q;  3RZD H;  3CME A;  3CAM A;  5EAY A;  3A5Z B;  1CSP A;  2JK8 A;  5H1S E;  1OXX K;  3S1N H;  2E2I H;  2QA4 A;  1QZH A;  4GNX A;  2N8N A;  4DUZ Q;  3ULP A;  1SMX A;  1YBY A;  1N36 L;  1HNW Q;  1I94 L;  2OCE A;  1MIU A;  5GAE C;  1VQ5 A;  5ELN A;  4A3J G;  4GS3 A;  4L5T A;  2CKZ B;  1HH2 P;  1VQO A;  4LWC A;  4BBR G;  4DV5 L;  3S2H H;  1HZC A;  4A4I A;  1AH9 A;  4DR7 Q;  2JEB I;  3BZK A;  3G48 A;  4DR3 Q;  1R0J A;  1Y1W G;  3E0E A;  2ID0 A;  4OWT B;  1C09 A;  4GKJ Q;  3PIO A;  1EYG A;  2EQS A;  4MZ9 A;  4DUY L;  1YJW A;  5IY0 A;  1HR0 L;  1GD7 A;  3CCU A;  4POF A;  1R9T H;  1X3G A;  1PH6 A;  1X55 A;  1E22 A;  3J81 c;  1HNZ L;  2VY3 A;  3PGZ A;  1D8L A;  4X65 Q;  1VQK A;  1DX8 A;  3S1R H;  4YWK A;  1Q1B A;  2D0O A;  3G4S A;  4O2D A;  4DV3 L;  3D0F A;  4JI5 Q;  4X66 Q;  2AWO A;  2E5L Q;  1IL2 A;  2UXB L;  4GKJ L;  3CPF A;  2OQ0 A;  2Z6K C;  1Y1V H;  2F4V L;  2UXC Q;  4P73 A;  4LUO A;  1N34 Q;  5BR8 L;  3NBH B;  4GOP A;  4DKA C;  3CQZ H;  4JI4 L;  3S1M H;  1HJP A;  2F52 A;  4R4Q A;  3PUZ A;  2K2D A;  4IO9 A;  1U0L A;  1K73 C;  2M4Y A;  1KD1 C;  4LF5 Q;  1XNR Q;  3TS2 A;  1SMM A;  1HNW L;  1KHI A;  2K5N A;  5ELO A;  3HOX H;  4LFC Q;  3G6E A;  4ALP A;  4A3B G;  2NVT H;  1RDG A;  5C3E G;  2VQE Q;  1HNX L;  4GKK Q;  5C0X J;  2A8V A;  1SMW A;  1B8A A;  4GLX A;  1EQR A;  1VQG A;  3CF5 A;  1Q7Y C;  4AR6 A;  5JJL A;  1IBL Q;  3NEN A;  4DV4 Q;  2PNH A;  3VDY A;  4GLA C;  1VQA A;  5IP7 G;  4C3I H;  2UUC L;  2MO1 A;  4BY7 G;  4BXX H;  3RLO A;  4YY3 L;  4IPG A;  5JJI A;  1FVI A;  5FLM H;  1XMO L;  2R92 H;  4DK3 C;  1OXV A;  2HIV A;  1IZ6 A;  1T9P A;  1UE5 A;  2ZM6 L;  4HID A;  1SE8 A;  1VQP A;  1YK5 A;  2HR5 A;  1FJG L;  1RB9 A;  3I4N G;  3FKI G;  3U4V A;  4RXN A;  4JBW A;  3A5U A;  2R6G A;  4X66 L;  2PMZ E;  1MKH A;  5IWA L;  3ULJ A;  4AH6 A;  1CAD A;  4IOA A;  4DV2 Q;  3UE0 A;  4QJF A;  2UXC L;  3SS2 A;  4IPH A;  1R0F A;  4R4C A;  1N34 L;  1D7Q A;  1V9P A;  3I4M G;  1KQS A;  1B2J A;  2WAQ E;  1L0W A;  4H02 A;  1X6O A;  1JT8 A;  5IYB G;  2K14 A;  4LF4 Q;  3K7A H;  4C2M H;  2BA1 A;  4QQB X;  3J80 c;  4JI6 Q;  3AEV A;  3H15 A;  1XMQ Q;  3GTK H;  3PIP A;  2VUM G;  2UXD Q;  1S30 A;  1HZA A;  4OXP A;  1YV1 A;  4IPC A;  2JA7 H;  1JE5 A; 
#chains in the Genus database with same CATH topology
 5JAV A;  1TII D;  4AYB G;  1YJ9 A;  1E8J A;  3RZO H;  5JVG 3;  4JI1 L;  1JE4 A;  5LHY 1;  1LTG D;  3A7L A;  4DNR B;  2F0J A;  4NB3 A;  3HOV G;  3K35 A;  2R92 L;  3KDF B;  3S16 B;  3P75 A;  1QOH A;  3GTM B;  3GTP H;  5IP9 H;  1IU5 A;  2D62 A;  4ZUJ A;  2EY5 A;  1SYE A;  3MEF A;  4E6I A;  1YNJ C;  5C44 G;  4HIO A;  1TY0 A;  1OWC A;  1GOZ A;  2AKW B;  4A3I H;  1Y14 B;  4HJ7 A;  4K5X A;  2JA6 G;  1S72 A;  1TKW B;  4X3T A;  1W6K A;  5EJW A;  1Z47 A;  3FKI B;  3I8Z A;  3PUW A;  2DSX A;  1JWU D;  2JA7 L;  3TS0 A;  3FMC A;  3JAM c;  3K5O A;  1QCV A;  1NXG A;  1HR0 W;  1XNQ Q;  2PMZ P;  1E24 A;  4B3R Q;  4DAV A;  1PFS A;  2F3W A;  3KF8 B;  3MFY A;  4LF8 L;  5C4X H;  4A3L H;  3RZO L;  3WOF A;  1GUT A;  4A3B H;  4KY6 A;  5EPK A;  5C3E H;  2Q2H A;  1EOT A;  2GN5 A;  4CBV A;  2WAQ B;  5I2Y A;  3QR8 A;  4KN7 C;  4FF1 A;  2EYO A;  5DM6 3;  1EIH A;  4C3J H;  1SYC A;  1GHK A;  3GTP L;  5IYC H;  2EOT A;  5IP9 L;  1SNC A;  5BN4 A;  2MS3 A;  4UY8 1;  3CP0 A;  1SMY C;  3R93 A;  4A3I L;  3F2D A;  3IFT A;  4TRD A;  3NWS A;  1N32 L;  1YVC A;  3HOY H;  4QIW P;  3F2U A;  5KRU A;  3GQB A;  3I4M H;  2ZJP A;  3KBX A;  2B63 G;  2C6B A;  4TPU A;  1GO3 E;  4GN3 B;  2OT2 A;  1KNE A;  4DR2 L;  2V0E A;  2YTX A;  1EY4 A;  1NNQ A;  5FJ8 G;  1TWG B;  1EWC A;  1ILQ A;  5M9O A;  5C4X L;  4A3L L;  3VR3 A;  4A3B L;  1W3S A;  2DUD A;  2RQX A;  3WOE A;  4DUZ L;  5C3E L;  1F2Y A;  4LF6 Q;  3KF6 B;  1PRT F;  2PSM C;  3CCR A;  1VF7 A;  2R7Z H;  2BOS A;  3ER0 A;  4UP9 A;  4DR1 L;  4FXK C;  5M5Y H;  5IYC L;  3T1Y Q;  3NE5 B;  5FO7 B;  3SK5 A;  3CCV A;  3GTG H;  1LAB A;  5EGT A;  1K8A C;  2QEX A;  1E0B A;  2HDL A;  3QB3 A;  4C1N K;  3E5S A;  1GKH A;  2AUJ D;  1K0R A;  3Q6S A;  3ERS X;  4JI3 L;  4JI5 L;  3I4M L;  2AQ2 B;  3MFG A;  5LMN W;  3C3L A;  4KMU C;  2R7F A;  1NMG A;  4H44 C;  4OWX B;  3PO3 H;  4TKO B;  5CGK A;  3EIV A;  1LKM A;  1ROD A;  1ASZ A;  4RHR A;  1VZG A;  3ERO A;  1NXE A;  4DK0 A;  4LJZ C;  1HRJ A;  5CV8 A;  2XGT A;  4HJ8 A;  2WB1 E;  4OO1 I;  3PL5 A;  1AEX A;  1BQ9 A;  3LPE B;  3MZ5 A;  2VQE L;  1B9M A;  4DR6 Q;  4PZ6 A;  1EZ8 A;  1WTW A;  1UAP A;  4R1J A;  4OX9 Q;  1LYL A;  4X64 Q;  2HT1 A;  3GTG L;  1LO5 D;  4OWW B;  1JJG A;  1JWS D;  3SK6 A;  2WAC A;  1OTC A;  1FYC A;  1VQL A;  3H97 A;  1RTN A;  2VZA A;  1H9S B;  5J3B A;  1JIC A;  1FR3 A;  4HSP A;  2ZJQ A;  4DR5 Q;  5EQ0 A;  3NBH A;  5FLX c;  3SEB A;  1PFV A;  1PYS B;  2A6E D;  3PO3 L;  2BDN A;  1WD0 A;  4LF4 L;  4DNI A;  3K0Y A;  4PG3 A;  1Q8I A;  4DV0 Q;  4HJ9 A;  1C0A A;  3NQI A;  2L4N A;  5D65 A;  1CSQ A;  2WP8 J;  4A3D B;  1QWY A;  1SEB D;  2EPB A;  5IGD A;  4ZKB B;  1MSG A;  1Z7T A;  3L7Z C;  2JQO A;  2XWB B;  2VXW A;  1N36 Q;  4JI8 L;  1SYB A;  4HED A;  2E2H H;  5AJ3 L;  3OWE B;  2R92 G;  1XPO A;  1NTG A;  3D4R A;  4IPD A;  4G7O C;  1Q90 A;  2IWH A;  2EE1 A;  1PTO H;  4A93 H;  5M5X H;  3PIO 3;  5MLC 3;  2EY2 A;  1EU4 A;  1FNW A;  1PYW D;  1Z6H A;  3PO2 L;  2KHI A;  3M4Y A;  2B2W C;  5H1S c;  3WWV A;  2WB1 P;  2N49 A;  1IBM L;  1AE2 A;  4V19 0;  5IP7 H;  1HNZ Q;  5JJZ A;  1R9T B;  4DV3 Q;  4R4I A;  1KDA A;  3S1R B;  2K04 A;  2AYJ A;  2KQ3 A;  2F4V Q;  3BVM A;  4LAA A;  2E76 C;  3W5O A;  5GAH C;  5CV5 A;  4QIW B;  1DOL A;  4ZN3 B;  2A19 A;  5GAD C;  3HJW B;  4BY1 L;  1JCK B;  3BZC A;  1A15 A;  3L2P A;  2RHQ B;  1HNX Q;  3HOX B;  1FL0 A;  2RDH A;  1H9K A;  3STB C;  1QUQ A;  1Y8N B;  4B3M L;  2ZXR A;  4DAY A;  5IP9 G;  1H95 A;  1QG7 A;  4A93 L;  5M5X L;  1GUG A;  1GVP A;  2M6O A;  3HKZ P;  1IYU A;  4C3I B;  4A3I G;  1RWD A;  2ZM6 Q;  1H9R A;  1T9O A;  3LWV B;  5M3F H;  2K1B A;  1W2B A;  3J7A F;  1PH3 A;  3SGI A;  2MFI A;  4M8A A;  2A69 D;  1JOK A;  2VQF L;  5JVH 1;  5I4D A;  2Y0S B;  5IYD G;  3I73 A;  2I5H A;  2IPK D;  2KBN A;  2K6A A;  1C7Y A;  1Q12 A;  1U4P A;  4J1M A;  2V3B B;  1OWB A;  4C2M B;  1VQJ A;  2Q2U A;  4A3L G;  3GTK B;  3S24 A;  1ZXT A;  3P2A A;  5AFW A;  2A68 C;  4WFN 1;  1K83 H;  1LT3 D;  3S2H L;  3NBI A;  5J22 A;  3J7Y W;  3I3C A;  4C3J G;  1UWV A;  1Y8P B;  2H4O A;  2VS1 A;  3ITP A;  2E2J B;  1LLR D;  3D3R A;  5IYC G;  2QL0 A;  4YWM A;  4HTH A;  3CPW A;  1S40 A;  4V0B A;  1F77 A;  2F0T A;  2LSS A;  4DXF A;  4YHH L;  4RWS C;  2B2W A;  3HOY G;  5MF6 A;  4R9W A;  5M3F L;  5C3X A;  2IT1 A;  3ZJY C;  2NVQ B;  3K0X A;  2O5J C;  4BBS B;  5IGC A;  3X3N A;  4AYB E;  5M3M H;  2CFM A;  5COY A;  1A3T A;  4QB4 A;  4TVM A;  1KLG D;  5IT9 L;  4CGY B;  4GN4 B;  2WV6 D;  4X62 Q;  2PYA A;  5GAH c;  3I56 A;  4B3S L;  3KYW A;  1LT4 D;  2QF7 A;  4CKB A;  4DXG A;  1CKN B;  2PO4 A;  4A3E B;  1J5E L;  4L5S A;  3HOU B;  1JJ2 A;  5GAD c;  2RDF A;  3MEH A;  5IOC A;  1HCZ A;  3R8B A;  2R7Z G;  1RL2 A;  3AYH B;  1CZG A;  1R4Q B;  2WIN B;  1FHH A;  2L0C A;  2E8G A;  1A2U A;  5IOD A;  4ZAI A;  4NXN Q;  3KJO A;  2J7Z A;  4CJ0 B;  2PZW A;  1PYB A;  3TRE A;  3U50 C;  4JI2 L;  2K7V A;  5K5P A;  1E1O A;  1LT5 D;  4RMF A;  5G3L F;  3LNN A;  5NUC A;  1U5K A;  3C46 A;  2EYF A;  4P2C B;  2IX3 A;  4HAE A;  5C0X I;  2LKV A;  2Y0S G;  1VQM A;  2HCC A;  1X3E A;  3K7A L;  4WJ3 M;  4IOC A;  5M3M L;  4DK1 A;  3HFZ B;  1Q81 C;  4XT3 B;  1A0I A;  1STH A;  3HOZ B;  5LL6 S;  4DV6 L;  3PF5 A;  1BBW A;  4ULL A;  3K58 A;  2QCP X;  3HOW H;  4DR4 L;  3S2D H;  2MO0 A;  3G71 A;  1U9R A;  3KYU A;  4RG1 A;  1STB A;  1S5E D;  2G9H D;  1KAB A;  1LTI D;  3Q23 A;  4AYB P;  3PMF A;  4ID6 A;  4OHJ A;  3S1N H;  2JA8 B;  2MJ8 A;  1HNW Q;  1LTB D;  2EJG C;  1IKL A;  5GAE C;  5ELN A;  4GS3 A;  1EEF D;  1VQO A;  1WTV A;  4A4I A;  3ZYY X;  1ML0 D;  5CV9 A;  3E0E A;  4OO1 H;  4OWT B;  3X3M A;  1C09 A;  1HFG A;  4G6B A;  1RCV D;  2VB2 X;  4O42 A;  1BCP D;  1HR0 L;  1SYG A;  5C4J B;  1E22 A;  3WWN B;  1DX8 A;  3DEP A;  3HKZ B;  2E5L Q;  2UXB L;  4U67 1;  2FJ2 A;  1Y1V H;  5LL6 X;  4RGO S;  1B1Z A;  1CK1 A;  1K3B C;  4LUO A;  4P73 A;  3S2D L;  3CQZ H;  1G8Z D;  1ICF B;  4C56 C;  3GTL B;  2L9H A;  2K2D A;  3S1N L;  1U0L A;  2M4Y A;  2MP1 A;  4Q5V A;  1KD1 C;  3MXU A;  2QDL A;  4LF5 Q;  4A3G B;  3G6E A;  3LX0 A;  4ALP A;  1RTO A;  2NVT H;  2ZXP A;  1SJH D;  3KBG A;  3S1Q B;  4QMG A;  1BBX C;  3NEN A;  1EWH A;  4DV4 Q;  2PNH A;  3H0G B;  4EQO A;  5IP7 G;  2UUC L;  3C1E A;  5JJI A;  4IPG A;  1ET9 A;  5FLM H;  3OMG A;  4DK3 C;  2HIV A;  1T9P A;  1UE5 A;  1VQP A;  1FJG L;  2HR5 A;  1QNK A;  4JBW A;  2PQE A;  2R6G A;  5IWA L;  1SNM A;  5CR3 A;  4AH6 A;  5IGG A;  4IUN A;  4IOA A;  1C48 A;  4DV2 Q;  4QJF A;  2UXC L;  4Y7N L;  1D2B A;  1V9P A;  3CHB D;  5DNF A;  1Y1V L;  1DJR D;  1YNJ D;  2WAQ E;  2C9O A;  4KTA A;  3J80 L;  3CQZ L;  3GTJ B;  4JI6 Q;  2UXD Q;  4MHE A;  2KEE A;  1S30 A;  4OXP A;  1IHZ A;  2E75 C;  2NWG A;  3QO2 A;  3FEW X;  5CMD A;  5FOB B;  4GN5 A;  2NVT L;  3VR5 A;  1SDF A;  3I91 A;  1R0I A;  3PIP 1;  5GAE c;  1R4P B;  3PF4 A;  3OYY A;  2KCN A;  5M3F G;  3MXN A;  3H94 A;  4A3J H;  1V1Q A;  5FLM L;  1V1P A;  4K14 A;  3ICE A;  4X3U A;  2XJR A;  1TWH B;  2KEN A;  4JAF A;  2BCO A;  4P74 A;  4HIK A;  1II3 A;  4FO2 A;  3EN2 A;  1TS4 A;  5EKL A;  4PZ8 A;  2NVX B;  1MGS A;  1K8M A;  2FHT A;  2K5Q A;  4JI0 Q;  2CW0 C;  2KHS A;  1SLJ A;  3NTH A;  2R93 H;  2B5I D;  2NN6 G;  2IHF A;  1RHP A;  3DWA A;  3ND8 A;  3JAM L;  1I6H H;  1KL9 A;  4UP7 A;  1PMR A;  1ENF A;  3I72 A;  2M9V A;  1CI3 M;  2NVY L;  3OPO A;  3J7Z C;  3M4Q A;  1BDO A;  2EXZ A;  2WAQ P;  3KLS X;  3H0G G;  5D14 A;  2EIF A;  4NW2 A;  4JI7 L;  2I5L X;  1E3P A;  4A3J L;  3MPS A;  1BQQ T;  3AB9 A;  2B29 A;  1VZI A;  4RFB A;  4BY7 H;  3TSS A;  1FGU A;  1PV4 A;  5M3M G;  3M4P A;  1MSH A;  1J8I A;  1TWC B;  1DON A;  3N6R A;  2Q2I A;  4IAL A;  4AR3 A;  3OTO L;  1LM0 A;  1LTA D;  2CVR A;  3K6O A;  3VYR A;  4HJA A;  1WCM B;  1TWF H;  1F4L A;  1AW7 A;  1KRT A;  3HOV B;  5K36 H;  4AI2 A;  1B9N A;  2VL6 A;  4P72 A;  3S14 B;  2NTT A;  3J7A V;  3PWF A;  2X6G A;  2D5D A;  2MGS A;  4KV6 A;  4B9W A;  3S15 H;  4B3R L;  1LTL A;  2YU9 H;  1I6H L;  4LF7 Q;  4LFB Q;  5C4Z A;  1C9O A;  1XX8 A;  2F0I A;  2QKI C;  2VUM H;  4LF9 Q;  3FRP B;  1VQN A;  3W2D A;  3BU2 A;  1OXT A;  1XPR A;  3EBE A;  3M3Y H;  2XJU A;  1ZYR D;  4A3M B;  3S16 L;  1S3O A;  3GTM L;  2C5C A;  3HKS A;  2F4I A;  2Z9H A;  1EQQ A;  2IX1 A;  4M1U B;  1QNU A;  1F9P A;  1JB7 A;  1K0S A;  3MSU A;  4BY7 L;  4DR3 L;  4EGV A;  3CC7 A;  2CH4 A;  5M5W B;  2F0H A;  1TWA B;  3WDN A;  4MTK A;  3FKI L;  2A1A A;  1WJJ A;  1TWF L;  2B2T C;  1PH2 A;  4JV5 Q;  3BS1 A;  3HOW G;  2OWO A;  2FXQ A;  1UE7 A;  3S15 L;  1EUJ A;  2YU9 L;  5C0X H;  1HA6 A;  1R0H A;  4IUV A;  2VUM L;  3EA6 A;  1I4X A;  1HTP A;  5AN9 H;  1T5X D;  1E7Z A;  5I2X A;  3JR7 A;  3J80 i;  4CKE A;  3CCQ A;  1XNR L;  2ZTC A;  3M3Y L;  1IL8 A;  5J1Z A;  2UUA Q;  4NKL A;  4LFC L;  1YNN C;  2F0V A;  5JPN C;  5A2Q L;  5GRO A;  1X9N A;  3CW2 C;  1BCP B;  4FF3 A;  1CM9 A;  4GNX B;  1Q82 C;  3OHX C;  3MXG A;  1EQT A;  3T1H Q;  2IL8 A;  1GXD C;  1UE6 A;  1STA A;  3AU7 A;  4YCV A;  2CKC A;  1DD2 A;  4QIW E;  4OIJ A;  4DGZ A;  1WCM G;  4FXG C;  2IY5 B;  1HUN A;  1EU3 A;  3W1G A;  1SFO B;  1PXU A;  3BVG A;  1Y1W H;  2UUB Q;  1EQV A;  1LKP A;  2KEC A;  2OQK A;  5FLX L;  1MJE A;  5DEH A;  1PH8 A;  1PHJ A;  1PFW A;  1Z92 B;  3RUZ A;  1PZI D;  4HIM A;  3BDC A;  1GM5 A;  3J7Y 1;  4A3M G;  2AQC A;  1XPU A;  4BWG B;  2IJ0 A;  3RZD B;  1F2Z A;  5BN5 A;  5GAG C;  3JAM i;  1K28 A;  1Z9F A;  2E2I B;  4HJ5 A;  2Y0S E;  2D2C C;  2LY7 A;  4UPA A;  1OO9 B;  4JVZ A;  4IFD G;  3BYT B;  8RXN A;  4QCL A;  1IYV A;  1CT1 D;  2K33 A;  4FNF A;  1TR5 A;  5EPJ A;  1PFY A;  3KLR A;  4KLK A;  4RH6 A;  4ZUI A;  3U9S A;  2WFW A;  4DUY Q;  2BDO A;  1YZ6 A;  3E9I A;  3FP9 A;  4KHZ A;  1BO0 A;  2B2T A;  4O1N A;  3LGJ A;  3VYS A;  1Y1W L;  3SDZ A;  4DNT B;  3M4O H;  1T9H A;  2O4X A;  3PQI A;  4DV0 L;  3I4N H;  1J9O A;  3RN5 A;  2DY8 A;  4HN7 A;  1KXL A;  2HHH L;  1CHQ D;  1T5E A;  1Y8O B;  4N9P A;  1L0X B;  1ICW A;  1TS2 A;  2CH4 W;  2F0Q A;  3V05 A;  1AFP A;  2K03 A;  5C5M A;  4ZN1 B;  3S1M B;  2WII B;  4R8I A;  2EY6 A;  3NEM A;  4L63 B;  1RIP A;  2EVB A;  1I4P A;  2SNS A;  1PFM A;  4OEM B;  4DU9 A;  4GZY C;  3IKJ A;  3H9C A;  4KKU A;  1RDV A;  1H7V A;  1NR2 A;  3B08 B;  1ODH A;  2KJX A;  3BYY B;  2PI2 E;  1O80 A;  1VZH A;  5AI3 A;  3KDF A;  4N8F A;  4HCS A;  1NE3 A;  1OXU A;  1VQ4 A;  5HGQ A;  1JOO A;  3R2T A;  2F1M A;  4KKT A;  2K5W A;  1I50 H;  7RXN A;  4AR4 A;  1SBB B;  2R92 B;  5JEA H;  1AZP A;  4K0K L;  3GDE A;  2JI2 A;  3GP7 A;  3M4O L;  2UU9 L;  4OEL B;  2Y0S P;  1NAP A;  1HA5 A;  3VR2 A;  2JXM B;  2B3G A;  2R93 G;  1RDP D;  3KYH C;  1JOQ A;  4JYA L;  1BQ8 A;  1BRF A;  3I4N L;  1B70 B;  1PTO D;  4IFD J;  1KC8 C;  1IBK L;  2O5J D;  3UDF A;  1V8Q A;  4UDU C;  2Q2T A;  1IW7 C;  3A74 A;  3KYV A;  3K81 C;  2PQA B;  5CC4 A;  3NFP I;  4QGU A;  2D0P A;  3KF8 A;  2XJS A;  3A55 A;  3PUV A;  3K59 A;  4B3T Q;  2JA7 B;  4EQ5 A;  4K9F A;  1EYA A;  3KOJ A;  5GAG c;  3MTS A;  3K57 A;  4JOI C;  3PV0 A;  4IZ8 A;  1V1O A;  5ELF A;  3TN2 A;  1X3P A;  3TBI B;  3RZT A;  4UY8 C;  2I46 A;  5T1I A;  4AQY Q;  4JI1 Q;  1OXS C;  1N8R C;  1N33 L;  4RGN A;  4TVA B;  3RZO B;  3H3V M;  1K9M C;  1I50 L;  3T51 B;  4XIG S;  5IE8 A;  1B3Q A;  4PMW A;  5K36 G;  1JOR A;  4UHV A;  1B4O A;  2ZT9 C;  3GTP B;  4LUZ A;  5KYL A;  2BH8 A;  1D5Z C;  1DGS A;  2R3Z A;  3E9H A;  1H9M A;  3MVV A;  4K5W A;  4Y52 H;  4JG2 A;  3PO2 H;  1VCI A;  4A3I B;  2NZH A;  1E2W A;  4K6D A;  3SK8 A;  2XTI A;  4A3F H;  5F2D A;  3A0J A;  2Z3R B;  4H0L C;  1PH4 A;  4DK6 C;  5TSS A;  3LWE A;  3NWT A;  3KF6 A;  1A62 A;  2RKS A;  3PUY A;  1PH1 A;  2F03 A;  3HKZ E;  1YUX A;  1SE2 A;  1KDC A;  2VW9 A;  5C4X B;  3GV6 A;  2ZIX A;  4A3B B;  3WWL A;  3DWP A;  1SRO A;  3S9W A;  4BY1 H;  5C3E B;  2B2Y C;  1I94 Q;  1S24 A;  4A3K H;  5A35 A;  1UE1 A;  3W3A A;  2NB0 A;  2XRQ D;  4C3J B;  4POG A;  2PZT A;  1PRT D;  2JA5 H;  4IJL A;  1STG A;  2XJQ A;  5DLQ E;  1SN8 A;  3P1H A;  1N32 Q;  2O2L D;  5C0X G;  4Y52 L;  4DV7 L;  1D5X C;  2ZTE A;  1UEB A;  3RLF A;  3HOY B;  5C3W A;  2NZ1 D;  1IRN A;  4A3F L;  1EY6 A;  4F8M A;  2BE5 D;  3D6W A;  1GUW A;  3RNU A;  2JA7 G;  2A6H C;  1MJC A;  3I4M B;  3HP3 A;  2OEO A;  2GVB A;  2NYZ D;  2Z0S A;  3PKJ A;  3CME A;  4XQN A;  1CSP A;  1S5C D;  2D9U A;  1B2T A;  1TQO A;  4DUZ Q;  3ULP A;  1YBY A;  1DOK A;  4XYO A;  1PLF A;  2F0L A;  2X69 A;  4A3K L;  1MBY A;  1HH2 P;  1S5B D;  4BBS L;  4DV5 L;  1SSO A;  1HZC A;  3S2H H;  2R7Z B;  1AH9 A;  2SDF A;  2LMC B;  4WRD A;  1Y1W G;  3A8J E;  2ID0 A;  5M5Y B;  1U4L A;  4GKJ Q;  3PIO A;  2JA5 L;  3UI2 A;  3GTG B;  1HXY D;  3J81 c;  1H9S A;  3T56 B;  4ZKC B;  2DJF C;  1G2T A;  4O2D A;  3SHL A;  4JI5 Q;  4X66 Q;  1MI2 A;  2G9D A;  2AWO A;  1AN8 A;  2OQ0 A;  1B44 D;  4DKA C;  2RFK B;  4JI4 L;  4G57 A;  3PO3 B;  3HG9 A;  4BXX H;  1HNW L;  1IKM A;  5C4X G;  1SMM A;  2QIL A;  1KHI A;  2XN9 C;  1EYC A;  4JAG A;  2FMM A;  4A3B G;  4YIJ A;  1X32 A;  5C3E G;  3E0J A;  2VQE Q;  5C0X J;  2A8V A;  4FP5 D;  4XGH A;  2B2Y A;  1EQR A;  3Q22 A;  3CF5 A;  3H9B A;  4AR6 A;  5JJL A;  1IBL Q;  4DF7 A;  4CDD C;  2AQ3 B;  2B39 A;  3RLO A;  4YY3 L;  1DM0 B;  1FVI A;  3NTI A;  1XMO L;  1A3U A;  4Q0F A;  1GUN A;  4I65 A;  3HOZ L;  3I4N G;  1RB9 A;  2MUY A;  3U4V A;  3A5U A;  1BNZ A;  3ULJ A;  1CAD A;  1HTL D;  2GA4 B;  1MD2 D;  1PDQ A;  3SS2 A;  1D7Q A;  3LWQ B;  4HCE A;  3I4M G;  2Z3Q B;  1KQS A;  1L0W A;  4H02 A;  1X6O A;  4ME5 A;  4LF4 Q;  3K7A H;  1TU2 B;  2BA1 A;  3AEV A;  1XMQ Q;  1PZK D;  1BUV T;  4Z9C B;  2DNE A;  2E74 C;  3OW7 A;  1XXG A;  4BXX L;  2QEJ C;  1CA6 A;  1JE5 A;  3NXW A;  1BCP F;  4UP8 A;  1L2F A;  3QWN A;  4TQU S;  4JI8 Q;  5AJ3 Q;  4DV4 L;  1NBW A;  4X6A L;  2KA7 A;  3S17 H;  3N52 A;  2E2H B;  5JEA G;  2CCZ A;  1P16 A;  2MNA A;  3FDT A;  4FXD A;  1PTO B;  2B8F A;  1EY8 A;  3FVQ A;  4A93 B;  1TS5 A;  5M5X B;  1QVG A;  2HDM A;  1EL0 A;  1EFI D;  3BVZ A;  4PQX A;  1DVB A;  1IBM Q;  2C6A A;  2Q8I B;  1YHA A;  3RN2 A;  4R4O A;  1L1O B;  1I3Q H;  2F0W A;  3MHB A;  3I7F A;  3D31 A;  5ELB A;  3CCM A;  4A3G L;  3D4W A;  3PO3 G;  4FYD A;  3PCO B;  3H3V C;  2RCN A;  4AI1 A;  3V2T A;  3Q24 A;  2QDB A;  2F3I A;  4JW0 A;  3H6M A;  1TVX A;  3S1Q L;  3EFX D;  3NQT A;  1EYD A;  1F9R A;  3P7J A;  4IUP A;  3GTO H;  4APV A;  2ES2 A;  1EFW A;  3S17 L;  1LV9 A;  1AE3 A;  1WTO A;  1QYB A;  4B3M Q;  4E6Y A;  1FNU A;  5C6A A;  4JBJ A;  1P7P A;  2AUS B;  1VDZ A;  5JVH 3;  1S5D D;  5EKK A;  1SJE D;  4DN4 M;  3BDL A;  3OMC A;  3HAX C;  1DZ1 A;  3QVD A;  1X65 A;  3PO2 G;  2A6E C;  4L5Q A;  5DM7 1;  4UAI A;  3E3X A;  5M3F B;  2EJM A;  2VQF Q;  3FDJ A;  4K5V A;  4DAP A;  1I3Q L;  4CDC C;  2PI2 A;  3PKI A;  1U4R A;  4YWL A;  2A73 B;  3K8A A;  2BA0 A;  2CHB D;  4WFN 3;  2ATW A;  4EX5 A;  2M4V A;  3U4Z A;  4EQN A;  5JEA J;  1CZW A;  1CKN A;  1ENA A;  1CKM A;  4Y7N H;  3K80 C;  1RJT A;  2AWN A;  2HIX A;  5C4H A;  1DOM A;  1TS3 A;  2SNM A;  4BY1 G;  3GTO L;  1EOV A;  3GV3 A;  1VQD A;  2J4X A;  4AHZ A;  4PZ7 A;  1CTM A;  4CDE C;  1PRT B;  1K83 B;  5LMU Q;  3NPP A;  4A93 G;  3F8T A;  3L3O C;  4P71 A;  1B3A A;  1LTR D;  3UDG A;  4I7Z C;  4DR7 L;  3SXH A;  2IX0 A;  4K2K A;  4NXM Q;  2BH2 A;  2F0P A;  2MPM A;  4A75 A;  1O7Z A;  2JYO A;  5KND A;  3CXC A;  4LHL A;  4XQJ A;  4X65 L;  5C44 H;  1BE7 A;  1CAA A;  1SND A;  2ENB A;  4LK1 C;  5G3L D;  1BR9 A;  5M3M B;  2JA6 H;  4CJ2 C;  2HD3 A;  4YCW A;  4B3S Q;  2YTY A;  3HZX A;  4JAE A;  3R3O A;  3Q8D A;  5EBD A;  2F0F A;  3UDX A;  1PZX A;  2L11 A;  1E2V A;  3RMH A;  1I5F A;  4WOR A;  1KRS A;  2H1E A;  4GKK L;  2NVY H;  4H7B A;  2A69 C;  4MNO A;  3PUX A;  3LWR B;  2EJF C;  1O7Y A;  3AFP A;  3GTQ H;  3A7A B;  4C3H H;  3HOV L;  2HQL A;  1D6E C;  2K01 A;  5FKA C;  1N9W A;  3CMA A;  1CHP D;  4BBR H;  2AHO B;  2N78 A;  4FF4 A;  3AQQ A;  5C44 L;  1K3R A;  3K5M A;  1CUK A;  5BN3 A;  1SR3 A;  1SMU A;  1U4M A;  1QQT A;  2JA6 L;  2ALY B;  1O7L A;  3A8K E;  4DV6 Q;  4GS7 D;  4BXX G;  2CR8 A;  3G7L A;  1SXT A;  3M85 A;  4KHP Q;  4JCV E;  4DR4 Q;  2KCM A;  1GUO A;  4DV1 Q;  2B63 H;  1SMY D;  4XXB B;  4GOP B;  3HOW B;  3S2D B;  3ND9 A;  2KKD A;  1S4Z A;  3M7G A;  3MQK B;  3HEJ A;  2ICE C;  3T1H L;  3S1N B;  4H13 C;  3IU3 I;  2I0Q A;  3A54 A;  1B2O A;  4RKL A;  3BJU A;  1TWA L;  5ELD A;  3GD7 A;  1FHM A;  2B8G A;  3GTQ L;  4C3H L;  1M1K C;  3S16 H;  3GTM H;  3G6J B;  4U67 3;  2IHE A;  3NEL A;  4KK7 A;  4P75 A;  5KNC A;  5CV4 A;  4BBR L;  1HR0 Q;  4CHT B;  4B8C D;  4RAU C;  2G5D A;  1HQR D;  5JVG 1;  3CC2 A;  1IBK Q;  2OTJ A;  2I5M X;  4TSS A;  1HHV A;  5EBC A;  3A44 A;  1EY5 A;  2HUG A;  2UXB Q;  3TEH B;  2EZV A;  3FKI H;  1BVS A;  1XTC D;  3CKI B;  3SVM A;  2B63 L;  2HQE A;  3SR1 A;  1Y1V B;  4XDX A;  1BBU A;  3CQZ B;  1WTQ A;  2DN8 A;  1XNQ L;  2H5X A;  4X3K A;  1EEI D;  1QVC A;  5IYB H;  2A5H A;  5FJ8 L;  1YEZ A;  2PW7 A;  1PFU A;  2RVL A;  4O0A A;  2EYM A;  5I9O A;  4QL5 A;  3FHW A;  1YHQ A;  1BF4 A;  1SRU A;  1AP0 A;  3ZG6 A;  2NVT B;  2PYK A;  2K4K A;  4GLV B;  1YJN A;  2P5Z X;  4K2L A;  3H09 A;  3J81 E;  2UUC Q;  4ZCK A;  4FDB A;  2ASB A;  4HMI A;  1A8V A;  4HMJ A;  4FVM A;  1ENC A;  1FJG Q;  5D3I B;  5E4X A;  5IWA Q;  1I4R A;  3OW2 A;  4LFA Q;  4OGQ C;  5JOB A;  3VA5 A;  4IN3 A;  2OTL A;  5DM6 1;  2Z4H A;  5KNB A;  3VR4 A;  5DAU A;  3PIP 3;  4KI0 A;  1Q1E A;  1LUZ A;  4RGM A;  3MXP A;  2DNC A;  1TWG H;  1JQY D;  5IYB L;  2JJQ A;  1JJC B;  2RDG A;  2JEA I;  1BCP C;  4GNX C;  1QZG A;  4AI3 A;  4LF6 L;  1VQE A;  2JE6 I;  4AHW A;  5LMN Q;  1CQV A;  1E2Z A;  1PVO A;  6RXN A;  4LUV A;  4OO1 G;  4N9T A;  4A3J B;  4KD3 A;  3T1Y L;  4PNY A;  3TDQ A;  3H3V I;  1UUP A;  4ZYS A;  5HY6 A;  1KNA A;  3M9B A;  4DPG A;  5EPL A;  4IUQ A;  2WKC A;  1LTT D;  1J6Q A;  1JWM D;  3NK9 A;  3RYG A;  5KEE A;  1F9S A;  1Y1V G;  1RF2 D;  5I9P A;  4A3C H;  3K5L A;  3KYX A;  1QJO A;  3UE1 A;  1VQC A;  1EIY B;  4B3T L;  1B71 A;  4EVO A;  1M4V A;  2R93 B;  1TWG L;  2XNA C;  2A74 C;  1I6H B;  1HZ9 A;  3MWY W;  3F2C A;  4MTN A;  4AQY L;  2A6H D;  2F0O A;  2K5D A;  2Z4I A;  1JR0 D;  4JI7 Q;  4NP5 A;  1XJV A;  4DR6 L;  1PTO F;  1FD7 D;  3D4D A;  2M00 A;  3DXJ C;  5FLM G;  4OX9 L;  3AFQ A;  1S2Z A;  4X64 L;  1KAA A;  3RD4 A;  3V96 A;  1Q8K A;  4BY7 B;  3I70 A;  1HUM A;  4RHS A;  2XJT A;  1KIX A;  3OTO Q;  3STB D;  2V4D A;  2AMC B;  2NN6 I;  2ZTD A;  1CFM A;  1WTP A;  3BZD B;  3J7A 5;  5KGU A;  1TWF B;  5KYI A;  1EIF A;  4IJH A;  4A3C L;  4XTC S;  1V43 A;  4BA1 I;  4DR5 L;  5IYD H;  2EYP A;  4L5R C;  2LXJ A;  3IFD A;  3P20 A;  2DGY A;  4A3D H;  4MN3 A;  2VNU D;  1PZJ D;  1VMP A;  3S15 B;  2YU9 B;  1A63 A;  1X56 A;  1I6V C;  5BR8 Q;  5EAY A;  3A5Z B;  2VUM B;  1QZH A;  3NTK A;  4ZLT F;  4GNX A;  1SMX A;  4C3H G;  1N36 L;  3D6C A;  1I94 L;  3M3Y B;  2L0Z A;  2K05 A;  1MIU A;  1VQ5 A;  2DY7 A;  4A3J G;  5D3D A;  2K32 A;  2CKZ B;  4RCN A;  3FPU B;  4BBR G;  2RSN A;  3DM1 A;  5KIX A;  2PW5 A;  2FFK B;  2F0S A;  3BZK A;  3G48 A;  5FO9 B;  5J39 A;  4DR3 Q;  2N88 A;  2A68 D;  5IIF A;  2F0G A;  1EYG A;  2EQS A;  3QG1 A;  1YJW A;  4KKS A;  1GD7 A;  3J81 L;  4BS9 A;  1WTR A;  1R9T H;  1PH6 A;  1X55 A;  4KY7 A;  2JP1 A;  3PGZ A;  1HNZ L;  1D8L A;  1MHW C;  3S1R H;  1Q1B A;  1SYD A;  4DV3 L;  1K8O A;  3VA7 A;  5EIN C;  1D5M C;  1IL2 A;  3NHH A;  3PIO 1;  5IYD L;  3NUC A;  3CPF A;  2Z6K C;  2F4V L;  1EZ6 A;  1N34 Q;  4A3D L;  3I4L A;  3NBH B;  3L9A X;  4R4Q A;  3PUZ A;  4FF2 A;  3HJY B;  4IO9 A;  4PMC A;  1XNR Q;  3TS2 A;  5ELO A;  3HOX H;  4LFC Q;  2B2U C;  1CA5 A;  1RDG A;  1B53 A;  1HNX L;  4C3J L;  2RSO A;  3TP8 A;  2CKA A;  1Q7Y C;  2CQA A;  2E2D C;  1GHJ A;  3TZD A;  3VDY A;  4GLA C;  1VQA A;  3H91 A;  4C3I H;  4BY7 G;  4GKJ L;  1A2T A;  3E6Z X;  2Z6B A;  1SNP A;  3HOY L;  1ET6 A;  1OXV A;  3HS0 C;  1IZ6 A;  4HID A;  2WKD A;  3EQL C;  2ZM6 L;  1SE8 A;  1R9T L;  3FKI G;  4X66 L;  3S1R L;  1MKH A;  1SNQ A;  4KD4 A;  3SK4 A;  3UE0 A;  1SAP A;  5I6W A;  1R0F A;  1Y1W B;  1SYF A;  1S5F D;  3QJY A;  1ZYR C;  3FPP A;  2ERJ A;  1JT8 A;  5IYB G;  2K14 A;  4C2M H;  2PCF B;  4B08 A;  3GTK H;  3H15 A;  2VUM G;  1HZA A;  1A3V A;  2WAQ G;  3HOX L;  2R7Z L;  1VQH A;  1AZQ A;  1DYQ A;  4DA2 A;  1G6P A;  3A56 A;  1IBL L;  4OON A;  2E2J H;  3CD6 A;  5M5Y L;  3VYT A;  2GMG A;  1PA6 A;  1LKO A;  4KJN A;  3LNL A;  4LF8 Q;  5EKI A;  3T13 A;  4RA8 A;  4C3I L;  5CV6 A;  5ISR A;  1QUQ B;  2PNR C;  4DAY B;  3IL8 A;  5IT9 E;  2R7D A;  2NVQ H;  2H12 A;  4NMZ A;  5I6Y A;  4R4T A;  4BBS H;  5AI2 A;  1IYJ B;  2N3S A;  1PFN A;  4IUT A;  1TXY A;  1VQI A;  3M4O B;  1VCX A;  1WOC A;  2O5I C;  2Z6K A;  2XRS D;  4WJW A;  3T4A C;  1XMQ L;  1YK4 A;  2PQA A;  2HHH Q;  1FGB D;  3I4N B;  3GTK L;  3RLN A;  3KYY A;  1JYB A;  4X62 L;  4A3E H;  1SE3 A;  4JBM A;  3HOU H;  5ELC A;  2M6P A;  1SNO A;  1ESR A;  2EYH A;  4IFD I;  5JPM C;  4K6L A;  3DEO A;  2M2L A;  5IGE A;  1YNX A;  1LT6 D;  2B2U A;  2L15 A;  2L12 A;  4C2M 1;  2E2J L;  2YV5 A;  4DR2 Q;  2PMZ B;  1I4Q A;  1HZB A;  1NJI C;  4JOI A;  2NZO A;  1QIL A;  4NXN L;  4NDX A;  4ODG A;  3Q0A A;  3KFU A;  3OIP A;  4KJO A;  1YIT A;  2NVQ L;  4JC0 A;  2V0F A;  2PVX A;  4DR1 Q;  1NUC A;  2F0D A;  2F0U A;  1I50 B;  1NCV A;  4K0K Q;  5CBA E;  4AR5 A;  5MFP A;  2UU9 Q;  2JSO A;  1KTK A;  3W1B A;  4WJ4 A;  4A3C G;  4JYA Q;  1FNV A;  3HOZ H;  2APO B;  1G51 A;  1YIJ A;  3J81 i;  4ILW A;  4BA2 I;  5E4W C;  3H3V H;  1T9Q A;  1PFB A;  4A3E L;  1IXR A;  3HOU L;  4JI3 Q;  3F2B A;  2IW3 A;  3KJP A;  1VQB A;  2L55 A;  4U68 A;  2MHV A;  2K5V A;  2E2H L;  3URY A;  3TP7 A;  3DMU A;  2NUC A;  2JA8 H;  3KK7 A;  2RDV A;  5L37 A;  2EY1 A;  1RKN A;  1O78 A;  3IRB A;  1K8G A;  4N8X 1;  2RF4 A;  1VQF A;  4CJ1 B;  2RHS B;  3I4O A;  3CU7 A;  4K8J A;  2J9U B;  1BXT A;  1XYI A;  2NBF A;  1N33 Q;  1R0G A;  3CCE A;  3CRK C;  5COR A;  2HCI A;  1X3F A;  1VF5 C;  5IP7 L;  1JC7 A;  3MC0 B;  4X6A H;  4PV1 C;  1Q3L A;  3SE0 A;  2K5H A;  2MQH A;  3KLW A;  5C4J H;  3C1F A;  1CKO A;  1O7I A;  5EIO C;  1X54 A;  2KN9 A;  3A8I E;  5K2M E;  4X3S A;  4S3S A;  2NYD A;  4A3D G;  2HVY C;  3TQY A;  2JI1 A;  3KUP A;  2E5L L;  3PO2 B;  2AQ1 B;  3DWQ A;  3TRZ A;  2KED A;  1EY0 A;  2CWA A;  3GTL H;  4A3F B;  2NN6 H;  2QGQ A;  1JMC A;  4IQZ A;  2JA8 L;  4A3G H;  4XQQ A;  3M7N A;  2CW0 D;  4LF5 L;  3L0O A;  2CWP A;  3QIA A;  5LMU L;  1PH7 A;  3ONA B;  3S1Q H;  1QE6 A;  1D1I A;  3VR6 A;  1UNS A;  3MA2 B;  3H0G H;  3B6Y A;  2SOB A;  4R8N A;  1VQ8 A;  1BOS A;  4NXM L;  2LXK A;  4BY1 B;  2ZJR A;  1PTO C;  4A3K B;  4YCU A;  3CCL A;  2XJP A;  3J80 E;  3PZA A;  5C4J L;  2PZU A;  4F7X A;  3TP5 A;  1L1O C;  3BDO A;  2JA5 B;  4DV7 Q;  4JPB W;  3JC6 3;  4DV2 L;  2GVA A;  4K8I A;  4JK1 C;  4G4K A;  1RYQ A;  3GTJ H;  2C35 B;  1C8C A;  1EWI A;  4JBK A;  3BG3 A;  1WVL A;  2F3V A;  3LWO B;  3GTL L;  4NPS A;  4XXE A;  3HOX G;  4JI6 L;  2UXD L;  1K83 L;  2OF1 A;  1B13 A;  1YHB A;  3NP8 A;  1G6Z A;  3PSI A;  3K5N A;  4OIK A;  4B9X A;  4C3I G;  3P8B A;  1I4G A;  1STY A;  2RCF A;  1M90 C;  4EQP A;  1Q46 A;  4KN4 C;  3H0G L;  3DLL A;  1VQ9 A;  1NY4 A;  2I07 B;  3OSO A;  4DV5 Q;  1TWH H;  3U58 A;  1VS0 A;  3S2H B;  4V19 6;  3DM3 A;  4QUF A;  2LCQ A;  5HUR A;  1WJV A;  1B50 A;  3T53 B;  3UDI A;  3JAM E;  2NVX H;  1QCB D;  1NMF A;  1M8A A;  1VMC A;  2XWJ B;  4ME3 A;  1ASY A;  3MAQ A;  4KY5 A;  5CBE E;  2WB1 B;  4JI0 L;  4QY7 A;  1GUS A;  4KHP L;  3GTJ L;  2CQO A;  5ELE A;  5JJK A;  4XYQ A;  4DV1 L;  4A3F G;  4C1N I;  5CV7 A;  4JI4 Q;  3EJI A;  3VPB E;  5MGN A;  4OL7 A;  1KAW A;  2YTV A;  2LS0 1;  1ZRP A;  1NNX A;  1XTD A;  2X6L A;  1F9Q A;  1WFQ A;  1GJX A;  2L5T A;  4HSV A;  1PRT C;  1PH9 A;  3QQC E;  2ZXO A;  2KCT A;  1VQ6 A;  4ZRZ A;  4A3K G;  1TWH L;  2OXP A;  4BBS G;  2N55 A;  1NR4 A;  4YY3 Q;  4AI0 A;  1ESF A;  1H9J A;  2B2V C;  1XMO Q;  1TWC H;  3MXN B;  2EXD A;  1L0Y B;  1IU6 A;  1CQF A;  1V1P B;  2NVX L;  1YNN D;  2BE5 C;  3F1Z A;  1ZKO A;  3ULL A;  3J81 j;  2JA5 G;  4LNQ A;  1L1O A;  3U9O A;  4YHH Q;  2J0T D;  1QB5 D;  2F0N A;  4AHX A;  2EY4 E;  1WCM H;  3C2P A;  3HOV H;  3EVQ A;  3RZ6 A;  4LW1 A;  4A3E G;  4F88 A;  3HOU G;  5E7N A;  1HPC A;  1W6J A;  3HOW L;  1KLU D;  2L1B A;  3S14 H;  4IUR A;  2QW7 A;  3DUZ A;  4AIM A;  2F0M A;  1PH5 A;  1ILP A;  2XIW A;  2KVM A;  4J15 A;  1EY7 A;  2Q8R E;  3K7A B;  4LF7 L;  3CCS A;  4LFB L;  1WYD A;  1YUZ A;  5RXN A;  2K52 A;  4ZQ3 A;  4LF9 L;  1G91 A;  4A3M H;  4J8Q A;  3IAY A;  2Z8L A;  4JAD A;  1J5E Q;  3CC4 A;  1RD9 D;  1ONL A;  2AUK A;  4LHN A;  3K7U C;  3OOC A;  4G7Z C;  3QOL A;  2KHJ A;  1QVF A;  2F0E A;  4IFD H;  3S17 B;  4DAM A;  4A76 A;  1TWC L;  2K28 A;  3I55 A;  3CCJ A;  3J7Z 1;  3RR5 A;  5IGF A;  5M5W H;  1TWA H;  4LFA L;  4JI2 Q;  3HOZ G;  2WB1 G;  4J6H A;  1WCM L;  3JC6 2;  4KHV A;  4AHY A;  1IRO A;  3NSW A;  3S14 L;  2FMC A;  4DFA A;  4HR7 B;  4JV5 L;  1RYT A;  2PPB C;  3TZU A;  5A2Q E;  1I3Q B;  1WI5 A;  3LWP B;  2K75 A;  2K50 A;  2JA8 G;  5IT9 c;  3OIQ A;  1TY2 A;  3I90 A;  2R61 A;  3GO5 A;  4GOP C;  3AMU A;  1Q86 C;  4A3M L;  1B7Y B;  3B0A B;  1TT2 A;  1KDB A;  2UUA L;  5CYU A;  1BKB A;  2F0K A;  3JC6 6;  2V1C C;  5DM7 3;  1YI2 A;  5LMN L;  2PPT A;  5E1F A;  3GTO B;  3I2Z A;  1STN A;  1D1K A;  3OWF A;  5FJ8 H;  3O13 A;  1WTX A;  2LFN A;  4I7A A;  4G7H C;  3KLS A;  2B2V A;  1E1T A;  4RGT A;  5FLX E;  5M5W L;  1I4H A;  1BFY A;  2Z1C A;  3HKZ G;  1VQ7 A;  2YYZ A;  1SFO H;  1P8L A;  2VB3 X;  1EY9 A;  5HGT A;  1NSN S;  1X3Q A;  1F2M A;  2DJG C;  2UUB L;  1Y69 U;  2PVE A;  4LMQ D;  3D8G A;  3ERQ A;  5C5L A;  4A3G G;  1STE A;  1G29 1;  5T1G A;  4L6T B;  3H99 A;  2KOL A;  3VYU A;  3HRZ C;  2XJV A;  2JA9 A;  5GQO A;  4ZK9 B;  4Y7N B;  2KCC A;  3RZD H;  3CAM A;  2EDG A;  2EYL A;  2JK8 A;  5H1S E;  1OXX K;  2E2I H;  2QA4 A;  2N8N A;  3CRL C;  4QUC A;  1IW7 D;  2XVS A;  1LAC A;  4AYB B;  2SEB D;  1G2S A;  2OCE A;  4PMB A;  1ZEQ X;  1F2L A;  4L5T A;  4LWC A;  3TME A;  4L8J A;  4DR7 Q;  2JEB I;  4IUU A;  1JB3 A;  1A6X A;  4F87 A;  1R0J A;  2TMP A;  1SFO L;  1DXM A;  4DUY L;  4MZ9 A;  5IY0 A;  3CCU A;  4POF A;  1C4Q A;  1X3G A;  2EYJ A;  2VY3 A;  4X65 Q;  1VQK A;  2R93 L;  3LWU A;  2JN4 A;  4YWK A;  2D0O A;  1DCZ A;  5IGB A;  2TSS A;  3G4S A;  3D0F A;  5C44 B;  2ERS A;  1SE4 A;  2UXC Q;  2JA6 B;  5BR8 L;  4GOP A;  3S1M H;  1HJP A;  2F52 A;  4RKB A;  3RZD L;  4QF4 A;  5MFZ A;  1K73 C;  2E2I L;  1LTS D;  1WTH A;  2K5N A;  4XT1 B;  2RA4 A;  5E3F A;  5FK9 C;  4ABN A;  1UEA B;  1HQM C;  1WD1 A;  4GKK Q;  1SMW A;  1B8A A;  4GLX A;  1VQG A;  4RCO A;  3DHQ A;  2NVY B;  4CKC A;  2MO1 A;  3TP6 A;  2RBM A;  2XSC A;  3R2I A;  2R92 H;  3GTQ B;  1XWE A;  4C3H B;  1HFN A;  5FO8 B;  2JI3 A;  1YK5 A;  2Q8T A;  4RXN A;  2PMZ E;  3T16 A;  4BBR B;  2NTS A;  4MIU A;  4IPH A;  4R4C A;  1N34 L;  3QOJ A;  2ICI A;  1B2J A;  3S1M L;  2FIN B;  4QQB X;  3J80 c;  3PIP A;  2KUM A;  4CDF C;  1YV1 A;  4IPC A;  2JA7 H;  3HGB A;  2B63 B;  1EIG A; 
#chains in the Genus database with same CATH homology
 4AYB G;  1YJ9 A;  1E8J A;  3RZO H;  4JI1 L;  4NB3 A;  3HOV G;  3K35 A;  3KDF B;  3GTP H;  5IP9 H;  1IU5 A;  2D62 A;  3MEF A;  5C44 G;  4HIO A;  1OWC A;  2AKW B;  4A3I H;  1Y14 B;  4HJ7 A;  2JA6 G;  1S72 A;  1Z47 A;  3PUW A;  2DSX A;  3TS0 A;  3JAM c;  1HR0 W;  1QCV A;  1NXG A;  1XNQ Q;  1E24 A;  4B3R Q;  1PFS A;  3KF8 B;  4LF8 L;  5C4X H;  4A3L H;  4A3B H;  5C3E H;  2Q2H A;  2GN5 A;  4C3J H;  5IYC H;  2MS3 A;  4UY8 1;  3CP0 A;  3F2D A;  1N32 L;  1YVC A;  3HOY H;  3I4M H;  2ZJP A;  2B63 G;  2C6B A;  4TPU A;  1GO3 E;  4GN3 B;  4DR2 L;  2V0E A;  2YTX A;  1NNQ A;  5FJ8 G;  1W3S A;  2DUD A;  4DUZ L;  4LF6 Q;  3KF6 B;  3CCR A;  2PSM C;  2R7Z H;  3ER0 A;  4UP9 A;  4DR1 L;  5M5Y H;  3T1Y Q;  3CCV A;  3GTG H;  1K8A C;  2QEX A;  1GKH A;  1K0R A;  3ERS X;  4JI3 L;  4JI5 L;  5LMN W;  2R7F A;  1NMG A;  4OWX B;  3PO3 H;  3EIV A;  1LKM A;  1ASZ A;  1VZG A;  1NXE A;  2XGT A;  4HJ8 A;  2WB1 E;  4OO1 I;  1BQ9 A;  3LPE B;  2VQE L;  4DR6 Q;  4PZ6 A;  4R1J A;  4OX9 Q;  1LYL A;  4X64 Q;  2HT1 A;  4OWW B;  1JJG A;  1OTC A;  1VQL A;  2VZA A;  5J3B A;  2ZJQ A;  4DR5 Q;  5FLX c;  1PYS B;  2A6E D;  4LF4 L;  4DNI A;  4PG3 A;  4HJ9 A;  4DV0 Q;  1C0A A;  1CSQ A;  2WP8 J;  3L7Z C;  2JQO A;  1N36 Q;  4JI8 L;  2E2H H;  5AJ3 L;  2R92 G;  1XPO A;  1NTG A;  4IPD A;  4A93 H;  5M5X H;  5MLC 3;  2KHI A;  3WWV A;  5H1S c;  1IBM L;  2N49 A;  1AE2 A;  5IP7 H;  1HNZ Q;  4DV3 Q;  4R4I A;  2AYJ A;  2F4V Q;  3W5O A;  5GAH C;  4ZN3 B;  2A19 A;  5GAD C;  3BZC A;  3L2P A;  2RHQ B;  1HNX Q;  1FL0 A;  3STB C;  1QUQ A;  4B3M L;  5IP9 G;  1H95 A;  1GVP A;  2M6O A;  4A3I G;  1RWD A;  2ZM6 Q;  1T9O A;  5M3F H;  1W2B A;  1PH3 A;  3SGI A;  2MFI A;  2A69 D;  2VQF L;  5JVH 1;  5IYD G;  2I5H A;  2KBN A;  1C7Y A;  1Q12 A;  2V3B B;  1OWB A;  4A3L G;  1VQJ A;  2Q2U A;  3S24 A;  3P2A A;  4WFN 1;  1K83 H;  1UWV A;  2VS1 A;  5IYC G;  2QL0 A;  4YWM A;  3CPW A;  1S40 A;  2LSS A;  4YHH L;  3HOY G;  5MF6 A;  2IT1 A;  3ZJY C;  3K0X A;  4AYB E;  5M3M H;  2CFM A;  4TVM A;  4GN4 B;  4X62 Q;  2PYA A;  5GAH c;  3I56 A;  4B3S L;  3KYW A;  4L5S A;  1CKN B;  1J5E L;  1JJ2 A;  5GAD c;  2R7Z G;  1RL2 A;  3AYH B;  1FHH A;  2E8G A;  4NXN Q;  3KJO A;  1PYB A;  3TRE A;  3U50 C;  4JI2 L;  1E1O A;  4RMF A;  1U5K A;  5C0X I;  2Y0S G;  1VQM A;  4WJ3 M;  1X3E A;  4IOC A;  3HFZ B;  1Q81 C;  1A0I A;  4DV6 L;  3PF5 A;  1BBW A;  3HOW H;  4DR4 L;  3S2D H;  2MO0 A;  3G71 A;  3KYU A;  4RG1 A;  3S1N H;  1HNW Q;  5GAE C;  5ELN A;  4GS3 A;  1VQO A;  4A4I A;  3E0E A;  4OWT B;  1C09 A;  4G6B A;  1HR0 L;  1E22 A;  3WWN B;  1DX8 A;  2E5L Q;  2UXB L;  4U67 1;  1Y1V H;  4P73 A;  4LUO A;  3CQZ H;  2K2D A;  1U0L A;  4LF5 Q;  2M4Y A;  1KD1 C;  3G6E A;  4ALP A;  2NVT H;  3NEN A;  4DV4 Q;  2PNH A;  5IP7 G;  2UUC L;  5JJI A;  4IPG A;  5FLM H;  4DK3 C;  2HIV A;  1T9P A;  1UE5 A;  1VQP A;  1FJG L;  2HR5 A;  4JBW A;  2R6G A;  5IWA L;  4AH6 A;  4IOA A;  4DV2 Q;  4QJF A;  2UXC L;  1V9P A;  2WAQ E;  4JI6 Q;  2UXD Q;  1S30 A;  4OXP A;  4GN5 A;  1R0I A;  3PIP 1;  5GAE c;  3PF4 A;  3OYY A;  5M3F G;  4A3J H;  1V1Q A;  3ICE A;  2XJR A;  2KEN A;  4JAF A;  4P74 A;  4HIK A;  3EN2 A;  4PZ8 A;  4JI0 Q;  1SLJ A;  2R93 H;  2B5I D;  2NN6 G;  2IHF A;  1I6H H;  1KL9 A;  4UP7 A;  3J7Z C;  3M4Q A;  3H0G G;  2EIF A;  4JI7 L;  2I5L X;  1E3P A;  3MPS A;  2B29 A;  1VZI A;  4BY7 H;  1FGU A;  1PV4 A;  5M3M G;  3M4P A;  2Q2I A;  4AR3 A;  3OTO L;  1LM0 A;  4HJA A;  1TWF H;  1KRT A;  4AI2 A;  2VL6 A;  4P72 A;  3PWF A;  3S15 H;  4B3R L;  1LTL A;  2YU9 H;  4LF7 Q;  4LFB Q;  1C9O A;  2VUM H;  4LF9 Q;  1VQN A;  3BU2 A;  1OXT A;  1XPR A;  3EBE A;  3M3Y H;  2XJU A;  1S3O A;  3HKS A;  1EQQ A;  2IX1 A;  1JB7 A;  3MSU A;  4DR3 L;  3CC7 A;  2A1A A;  1WJJ A;  1PH2 A;  4JV5 Q;  3HOW G;  2OWO A;  2FXQ A;  1UE7 A;  1EUJ A;  1R0H A;  5AN9 H;  1E7Z A;  3J80 i;  3CCQ A;  1XNR L;  2ZTC A;  2UUA Q;  4LFC L;  5GRO A;  1X9N A;  3CW2 C;  4GNX B;  1Q82 C;  3T1H Q;  1UE6 A;  4YCV A;  2CKC A;  4QIW E;  1WCM G;  2IY5 B;  3W1G A;  1Y1W H;  2UUB Q;  1LKP A;  2OQK A;  1MJE A;  1PH8 A;  1PHJ A;  1Z92 B;  4HIM A;  1GM5 A;  3J7Y 1;  4A3M G;  1XPU A;  5GAG C;  3JAM i;  1Z9F A;  4HJ5 A;  2Y0S E;  4IFD G;  4UPA A;  8RXN A;  4KLK A;  2WFW A;  4DUY Q;  1YZ6 A;  3E9I A;  3FP9 A;  4KHZ A;  3LGJ A;  3M4O H;  1T9H A;  4DV0 L;  3I4N H;  3RN5 A;  1KXL A;  2HHH L;  4ZN1 B;  3NEM A;  1RIP A;  1RDV A;  1H7V A;  3B08 B;  1ODH A;  2PI2 E;  1VZH A;  5AI3 A;  3KDF A;  1NE3 A;  1OXU A;  1VQ4 A;  5HGQ A;  1I50 H;  7RXN A;  4AR4 A;  4K0K L;  3GDE A;  2JI2 A;  2UU9 L;  2R93 G;  2B3G A;  3KYH C;  4JYA L;  1BQ8 A;  1BRF A;  1B70 B;  4IFD J;  1KC8 C;  2O5J D;  3UDF A;  2Q2T A;  3A74 A;  3KYV A;  3K81 C;  2PQA B;  3NFP I;  4QGU A;  2D0P A;  2XJS A;  3PUV A;  4B3T Q;  4EQ5 A;  4K9F A;  3KOJ A;  5GAG c;  4JOI C;  3PV0 A;  3RZT A;  4UY8 C;  4AQY Q;  4JI1 Q;  1OXS C;  1N8R C;  1N33 L;  4TVA B;  1K9M C;  4XIG S;  5IE8 A;  4PMW A;  5K36 G;  4LUZ A;  2BH8 A;  1DGS A;  3E9H A;  4Y52 H;  4JG2 A;  3PO2 H;  1VCI A;  2NZH A;  2XTI A;  4A3F H;  3A0J A;  2Z3R B;  1PH4 A;  4DK6 C;  3KF6 A;  1A62 A;  3PUY A;  1PH1 A;  3HKZ E;  1YUX A;  2VW9 A;  2ZIX A;  3WWL A;  1SRO A;  4BY1 H;  1I94 Q;  1S24 A;  4A3K H;  1UE1 A;  4POG A;  2JA5 H;  4IJL A;  2XJQ A;  5DLQ E;  1SN8 A;  1N32 Q;  5C0X G;  4DV7 L;  2ZTE A;  1UEB A;  3RLF A;  1IRN A;  2BE5 D;  3RNU A;  2JA7 G;  1MJC A;  2GVB A;  2Z0S A;  3PKJ A;  3CME A;  1CSP A;  4DUZ Q;  3ULP A;  1YBY A;  1HH2 P;  4DV5 L;  3S2H H;  1HZC A;  1AH9 A;  1Y1W G;  2ID0 A;  4GKJ Q;  3PIO A;  3J81 c;  4O2D A;  4JI5 Q;  4X66 Q;  2AWO A;  2OQ0 A;  4DKA C;  4JI4 L;  4BXX H;  1HNW L;  5C4X G;  1SMM A;  1KHI A;  4JAG A;  4A3B G;  5C3E G;  2VQE Q;  5C0X J;  2A8V A;  4XGH A;  1EQR A;  3CF5 A;  4AR6 A;  5JJL A;  1IBL Q;  3RLO A;  4YY3 L;  1FVI A;  1XMO L;  3I4N G;  1RB9 A;  3U4V A;  3A5U A;  3ULJ A;  1CAD A;  3SS2 A;  1D7Q A;  3I4M G;  2Z3Q B;  1KQS A;  1L0W A;  4H02 A;  1X6O A;  4LF4 Q;  3K7A H;  2BA1 A;  3AEV A;  1XMQ Q;  1JE5 A;  4UP8 A;  1L2F A;  4TQU S;  4JI8 Q;  5AJ3 Q;  4DV4 L;  1NBW A;  3S17 H;  5JEA G;  2CCZ A;  1P16 A;  2MNA A;  1QVG A;  1DVB A;  1IBM Q;  2C6A A;  1YHA A;  3RN2 A;  4R4O A;  1L1O B;  1I3Q H;  3I7F A;  3D31 A;  3CCM A;  3PO3 G;  3PCO B;  2RCN A;  4AI1 A;  2F3I A;  3GTO H;  4APV A;  2ES2 A;  1EFW A;  1AE3 A;  1QYB A;  4B3M Q;  4E6Y A;  4JBJ A;  3QVD A;  1X65 A;  3PO2 G;  4L5Q A;  5DM7 1;  2VQF Q;  2PI2 A;  3PKI A;  4YWL A;  3K8A A;  2BA0 A;  2ATW A;  4EX5 A;  2M4V A;  3U4Z A;  5JEA J;  1CKN A;  1CKM A;  4Y7N H;  3K80 C;  2AWN A;  2HIX A;  4BY1 G;  1EOV A;  1VQD A;  4AHZ A;  4PZ7 A;  5LMU Q;  4A93 G;  3F8T A;  4P71 A;  3UDG A;  4DR7 L;  2IX0 A;  4NXM Q;  2BH2 A;  4A75 A;  3CXC A;  4LHL A;  4X65 L;  5C44 H;  1BE7 A;  1CAA A;  2JA6 H;  4YCW A;  4B3S Q;  2YTY A;  4JAE A;  3Q8D A;  3UDX A;  1I5F A;  1KRS A;  4GKK L;  2NVY H;  4MNO A;  3PUX A;  3AFP A;  3GTQ H;  4C3H H;  2HQL A;  1N9W A;  3CMA A;  4BBR H;  2AHO B;  2N78 A;  3AQQ A;  1K3R A;  1CUK A;  1SR3 A;  1SMU A;  2ALY B;  4DV6 Q;  4GS7 D;  4BXX G;  2CR8 A;  3M85 A;  4KHP Q;  4JCV E;  4DR4 Q;  2KCM A;  2B63 H;  4DV1 Q;  4XXB B;  4GOP B;  2KKD A;  3T1H L;  3IU3 I;  2I0Q A;  1B2O A;  3BJU A;  3GD7 A;  1FHM A;  1M1K C;  3S16 H;  3GTM H;  2IHE A;  3NEL A;  4P75 A;  1HR0 Q;  4B8C D;  5JVG 1;  3CC2 A;  1IBK Q;  2OTJ A;  2I5M X;  3A44 A;  2UXB Q;  3TEH B;  3FKI H;  1BVS A;  1BBU A;  1XNQ L;  2H5X A;  1QVC A;  5IYB H;  1YEZ A;  4O0A A;  4QL5 A;  3FHW A;  1YHQ A;  1SRU A;  3ZG6 A;  2K4K A;  4GLV B;  1YJN A;  2UUC Q;  4FDB A;  2ASB A;  1A8V A;  1FJG Q;  5IWA Q;  3OW2 A;  4LFA Q;  2OTL A;  5DM6 1;  4KI0 A;  1Q1E A;  1LUZ A;  1TWG H;  2JJQ A;  1JJC B;  2JEA I;  4GNX C;  1QZG A;  4AI3 A;  4LF6 L;  1VQE A;  2JE6 I;  4AHW A;  5LMN Q;  1PVO A;  6RXN A;  4LUV A;  4OO1 G;  3T1Y L;  3H3V I;  5HY6 A;  3M9B A;  4DPG A;  1J6Q A;  3RYG A;  1Y1V G;  4A3C H;  3KYX A;  3UE1 A;  1VQC A;  1EIY B;  4B3T L;  1B71 A;  1HZ9 A;  3F2C A;  4MTN A;  4AQY L;  2A6H D;  4JI7 Q;  1XJV A;  4DR6 L;  5FLM G;  4OX9 L;  3AFQ A;  1S2Z A;  4X64 L;  1Q8K A;  2XJT A;  1KIX A;  3OTO Q;  3STB D;  2AMC B;  2NN6 I;  2ZTD A;  3J7A 5;  1EIF A;  4IJH A;  4BA1 I;  4XTC S;  1V43 A;  4DR5 L;  5IYD H;  4L5R C;  2LXJ A;  2DGY A;  4A3D H;  2VNU D;  1A63 A;  1X56 A;  5BR8 Q;  5EAY A;  3A5Z B;  1QZH A;  4GNX A;  1SMX A;  1N36 L;  1I94 L;  2L0Z A;  1MIU A;  1VQ5 A;  4A3J G;  2CKZ B;  4BBR G;  3BZK A;  3G48 A;  4DR3 Q;  2A68 D;  1EYG A;  2EQS A;  1YJW A;  1GD7 A;  1R9T H;  1PH6 A;  1X55 A;  1HNZ L;  3PGZ A;  1D8L A;  3S1R H;  1Q1B A;  4DV3 L;  5EIN C;  1IL2 A;  3PIO 1;  3CPF A;  2Z6K C;  2F4V L;  1N34 Q;  3NBH B;  4R4Q A;  3PUZ A;  4IO9 A;  1XNR Q;  3TS2 A;  5ELO A;  3HOX H;  4LFC Q;  1RDG A;  1HNX L;  2CKA A;  1Q7Y C;  3VDY A;  4GLA C;  1VQA A;  4BY7 G;  4C3I H;  4GKJ L;  1OXV A;  1IZ6 A;  4HID A;  2ZM6 L;  1SE8 A;  3FKI G;  4X66 L;  1MKH A;  3UE0 A;  1R0F A;  2ERJ A;  1JT8 A;  5IYB G;  2K14 A;  4C2M H;  3GTK H;  3H15 A;  2VUM G;  1HZA A;  2WAQ G;  1VQH A;  1G6P A;  1IBL L;  4OON A;  2E2J H;  3CD6 A;  2GMG A;  1PA6 A;  1LKO A;  4LF8 Q;  3LNL A;  1QUQ B;  4DAY B;  2R7D A;  2NVQ H;  2H12 A;  4R4T A;  4BBS H;  5AI2 A;  1IYJ B;  2N3S A;  1TXY A;  1VQI A;  1VCX A;  1WOC A;  2Z6K A;  1XMQ L;  1YK4 A;  2PQA A;  2HHH Q;  3RLN A;  3KYY A;  1JYB A;  4X62 L;  4A3E H;  4JBM A;  3HOU H;  2M6P A;  4IFD I;  1YNX A;  2L15 A;  2YV5 A;  4DR2 Q;  1HZB A;  1NJI C;  4JOI A;  2NZO A;  4NXN L;  3KFU A;  1YIT A;  4JC0 A;  2V0F A;  2PVX A;  4DR1 Q;  4K0K Q;  4AR5 A;  5MFP A;  2UU9 Q;  3W1B A;  4WJ4 A;  4A3C G;  4JYA Q;  3HOZ H;  1G51 A;  1YIJ A;  3J81 i;  4BA2 I;  3H3V H;  1T9Q A;  1IXR A;  4JI3 Q;  3F2B A;  3KJP A;  1VQB A;  2K5V A;  2JA8 H;  2RDV A;  3IRB A;  1K8G A;  2RF4 A;  1VQF A;  2RHS B;  3I4O A;  2J9U B;  1N33 Q;  1R0G A;  3CCE A;  1X3F A;  4X6A H;  2K5H A;  2MQH A;  3KLW A;  5C4J H;  1CKO A;  1O7I A;  5EIO C;  1X54 A;  2KN9 A;  5K2M E;  2NYD A;  4A3D G;  3TQY A;  2JI1 A;  2E5L L;  3TRZ A;  2CWA A;  3GTL H;  2QGQ A;  1JMC A;  4A3G H;  3M7N A;  4LF5 L;  3L0O A;  2CWP A;  5LMU L;  1PH7 A;  3S1Q H;  3H0G H;  3B6Y A;  1VQ8 A;  4NXM L;  2LXK A;  2ZJR A;  4YCU A;  3CCL A;  2XJP A;  3PZA A;  1L1O C;  4DV7 Q;  3JC6 3;  4DV2 L;  2GVA A;  1RYQ A;  3GTJ H;  2C35 B;  1EWI A;  4JBK A;  4NPS A;  3HOX G;  4JI6 L;  2UXD L;  1B13 A;  1YHB A;  3PSI A;  3P8B A;  1M90 C;  1Q46 A;  3DLL A;  1VQ9 A;  1NY4 A;  4DV5 Q;  1TWH H;  3U58 A;  1VS0 A;  4V19 6;  3DM3 A;  2LCQ A;  1WJV A;  3UDI A;  2NVX H;  1NMF A;  4ME3 A;  1ASY A;  4JI0 L;  4QY7 A;  4KHP L;  2CQO A;  5JJK A;  4DV1 L;  4A3F G;  4JI4 Q;  3VPB E;  5MGN A;  1KAW A;  2YTV A;  1ZRP A;  1XTD A;  1WFQ A;  1PH9 A;  3QQC E;  2KCT A;  1VQ6 A;  4A3K G;  4BBS G;  4YY3 Q;  4AI0 A;  1XMO Q;  1TWC H;  3MXN B;  2EXD A;  1IBK L;  1IU6 A;  3F1Z A;  2JA5 G;  3ULL A;  3J81 j;  4LNQ A;  1L1O A;  4YHH Q;  4AHX A;  1WCM H;  3HOV H;  3RZ6 A;  4LW1 A;  4A3E G;  3HOU G;  5E7N A;  3S14 H;  4AIM A;  1PH5 A;  4J15 A;  4LF7 L;  3CCS A;  4LFB L;  1WYD A;  1YUZ A;  5RXN A;  2K52 A;  4LF9 L;  4A3M H;  4JAD A;  1J5E Q;  3CC4 A;  4LHN A;  3K7U C;  1QVF A;  2KHJ A;  4DAM A;  4A76 A;  3I55 A;  3CCJ A;  3J7Z 1;  3RR5 A;  5M5W H;  1TWA H;  4LFA L;  4JI2 Q;  3HOZ G;  2WB1 G;  3JC6 2;  4AHY A;  1IRO A;  4JV5 L;  1RYT A;  1WI5 A;  2JA8 G;  2K75 A;  2K50 A;  5IT9 c;  3GO5 A;  4GOP C;  1Q86 C;  1B7Y B;  3B0A B;  2UUA L;  1BKB A;  3JC6 6;  2V1C C;  1YI2 A;  5LMN L;  2PPT A;  3I2Z A;  5FJ8 H;  1E1T A;  1BFY A;  3HKZ G;  1VQ7 A;  2YYZ A;  1SFO H;  1P8L A;  2UUB L;  2PVE A;  4A3G G;  1G29 1;  2XJV A;  2JA9 A;  5GQO A;  3RZD H;  3CAM A;  2JK8 A;  5H1S E;  1OXX K;  2E2I H;  2QA4 A;  2N8N A;  1IW7 D;  2OCE A;  4L5T A;  4LWC A;  4DR7 Q;  2JEB I;  1R0J A;  4DUY L;  4MZ9 A;  5IY0 A;  3CCU A;  4POF A;  1X3G A;  2VY3 A;  4X65 Q;  1VQK A;  4YWK A;  2D0O A;  3G4S A;  3D0F A;  2ERS A;  2UXC Q;  5BR8 L;  4GOP A;  3S1M H;  1HJP A;  2F52 A;  5MFZ A;  1K73 C;  2K5N A;  4GKK Q;  1SMW A;  1B8A A;  4GLX A;  1VQG A;  2MO1 A;  2R92 H;  2JI3 A;  1YK5 A;  4RXN A;  2PMZ E;  4IPH A;  4R4C A;  1N34 L;  1B2J A;  4QQB X;  3J80 c;  3PIP A;  1YV1 A;  4IPC A;  2JA7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...