2GMGA

Solution nmr structure of protein pf0610 from pyrococcus furiosus, northeast structural genomics consortium target pfg3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
AHHHHHHGSATRREKIIELLLEGDYSPSELARILDMRGKGSKKVILEDLKVISKIAKREGMVLLIKPAQCRKCGFVFKAEINIPSRCPKCKSEWIEEPRFKLERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Pf0610
publication title PF0610, a novel winged helix-turn-helix variant possessing a rubredoxin-like Zn ribbon motif from the hyperthermophilic archaeon, Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Dna binding protein
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2gmgA01
4YWLA 4K9FA 2GMGA 1E8JA 1NNQA 1R0JA 1QYBA 1H7VA 3RZTA 5RXNA 1T9OA 4TPUA 1DX8A 1ZRPA 1IU5A 4AR3A 1S24A 2PVEA 4YWMA 3KYUA 1YUXA 1YK4A 3KYWA 2HR5A 1CAAA 4RXNA 4AR6A 1YK5A 2KN9A 1LKOA 7RXNA 2DSXA 1FHHA 1BFYA 4AR5A 8RXNA 1RYTA 2MS3A 1SMMA 2PVXA 4POFA 2M4YA 1BQ8A 1VCXA 3QVDA 2KKDA 1SMWA 1BQ9A 1BE7A 1SMUA 1R0FA 4ME3A 2RDVA 1IU6A 5AI2A 2LCQA 5AI3A 1RB9A 2QL0A 1CADA 4AR4A 2VL6A 1BRFA 3RZ6A 1YV1A 3RYGA 2PYAA 1R0HA 5IY0A 1RDGA 3A44A 1LTLA 1YUZA 1DVBA 3SS2A 1IROA 1LKPA 1B2JA 1QCVA 3MPSA 3KYYA 2K2DA 1IRNA 1R0GA 4POGA 1T9QA 1R0IA 6RXNA 3PWFA 3PZAA 1B2OA 1T9PA 2V3BB 1RWDA 1B71A 1LKMA 1C09A 1B13A 3KYVA 1JYBA 1S30A 1RDVA 3KYXA 1FHMA 1S2ZA
chains in the Genus database with same CATH superfamily
1NNQA 4AI3A 1QYBA 2R92L 1H7VA 3HOXL 3LWVB 3HOYL 1T9OA 4A3IL 3H0GL 3S2DL 1IU5A 5M3ML 2M6OA 1TWGL 3S15L 4C3IL 1YUXA 2APOB 5M5YL 5MLC3 3PL5A 1I50L 3PKJA 2DSXA 4TVMA 1BFYA 3QQCE 3HJYB 4A3KL 2MS3A 1PFWA 4AHZA 2XJTA 3H99A 1Y1VL 3S1RL 1SMMA 2V0EA 3S16L 3S1QL 1RB9A 3GTOL 3CQZL 1Z92B 2XJSA 1BRFA 3HAXC 5IY0A 1RDGA 3A44A 1PFYA 5IYBL 1DVBA 3P8BA 3MPSA 3KYYA 5JVH1 1IRNA 5FJ8L 1TWAL 3PO3L 3JR7A 3LWOB 6RXNA 2CKAA 4A3ML 3H97A 2V3BB 3ZG6A 1LKMA 1B13A 4A3LL 2E2HL 4X6AL 2Y0SP 4A93L 1FHMA 3GTKL 1S2ZA 2M6PA 4V196 4YWLA 2XJVA 2V0FA 2XJUA 1R0JA 3MQKB 1R9TL 3PKIA 3HOUL 4AI0A 2JA8L 1YK4A 5DM61 1CAAA 4AR6A 2KN9A 3P2AA 2JI3A 2E2IL 2C6AA 3M4OL 1WCML 4AR5A 2R93L 1VZGA 5MFPA 4AHXA 1ODHA 2NYDA 4G6BA 4A3GL 2PVXA 2PMZP 1VCXA 3J7Z1 4ZN3B 3I4NL 4GS7D 5M5XL 4B8CD 3WWNB 1WJVA 1SMUA 4ME3A 2RDVA 1IU6A 4JAFA 2LCQA 3VPBE 2QL0A 5MF6A 2H12A 2J9UB 5EINC 1RYQA 3FKIL 1R0HA 5M5WL 1LTLA 3SS2A 1TWHL 4JADA 3MSUA 4Y7NL 4C3JL 5JVG1 2WB1P 5GADc 1Y1WL 4POGA 1T9QA 3PWFA 1PZXA 1B2OA 3HOVL 1T9PA 4UY81 3KYVA 4BBRL 2EY4E 3RZOL 3KYXA 4BBSL 3B08B 4K9FA 3B0AB 5GAHc 2CKCA 4C2M1 3HOWL 5RXNA 4TPUA 2A6ED 1I6HL 1S24A 4XXBB 1PFUA 4YWMA 3KYUA 4QIWP 1TWCL 3RZDL 3S1ML 2HR5A 4RXNA 5GAEc 2XJQA 4A3BL 5IP9L 7RXNA 1PFVA 3GTLL 4JAGA 2ERSA 1FHHA 8RXNA 2ERJA 2JA6L 3LWQB 5C3EL 2NVQL 3PIO1 1OWBA 1SFOL 2A68D 2NVTL 2C6BA 5K2ME 4POFA 2M4YA 4A3JL 4LHNA 2B63L 4BY1L 4ZN1B 1BE7A 1R0FA 4Y52L 3LWPB 1VZIA 2JA7L 5H1Sc 4AR4A 4C3HL 2L0ZA 3RZ6A 3RYGA 2PYAA 5AN9H 2AQCA 1YUZA 3WWLA 5IYDL 1LKPA 1B2JA 1QCVA 1K83L 5FLML 5GAGc 2E2JL 5MFZA 3M3YL 4AI2A 3IU3I 3H9BA 1R0GA 3S1NL 4JAEA 4BXXL 1IW7D 2NVYL 3GTQL 2JI2A 1F4LA 3K35A 1B71A 1C09A 2WAQP 3LPEB 1JYBA 1RDVA 1VZHA 2JI1A 2O5JD 2AYJA 3GTML 1NXGA 3I4ML 2NVXL 3J7Y1 1TWFL 3FDJA 2GMGA 1E8JA 1OWCA 1QQTA 2VUML 5IP7L 3RZTA 4A3FL 1DX8A 4E6YA 1ZRPA 2PVEA 4AHYA 5MGNA 4WFN1 3H3VM 3H9CA 2AUSB 3KYWA 5C44L 1YK5A 1LKOA 3NFPI 4A3EL 5C4XL 2B5ID 3S14L 3GTGL 1RYTA 2PPTA 2R7ZL 2M4VA 4AI1A 2RFKB 3LWRB 3HJWB 3HOZL 2A6HD 3GTPL 5EIOC 1BQ8A 3QVDA 5IYCL 2KKDA 4A3DL 3LNLA 1SMWA 2JA5L 3S17L 1BQ9A 2Z3QB 3PIP1 5AI2A 5AI3A 2HVYC 4U671 1CADA 1I3QL 3GTJL 2VL6A 1P7PA 4A3CL 1YV1A 3S2HL 5C4JL 2ZIXA 3HKZP 1IROA 5M3FL 2A69D 2XJRA 1NXEA 2K2DA 4AYBP 2PSMC 3PO2L 4LHLA 1R0IA 3PZAA 2CR8A 2BE5D 1RWDA 5DM71 4AHWA 2XJPA 2YU9L 3K7AL 1S30A 2Z3RB 4XGHA 4BY7L 4AR3A
chains in the Genus database with same CATH topology
2M6PA 4V196 4YWLA 2XJVA 2V0FA 2XJUA 3J7Y1 4K9FA 2GMGA 1E8JA 1OWCA 1NNQA 3B0AB 1R0JA 1QYBA 4AI3A 1H7VA 5GAHc 2CKCA 3RZTA 5RXNA 1T9OA 4TPUA 1DX8A 4E6YA 1ZRPA 2A6ED 3PKIA 1IU5A 2M6OA 4AR3A 1S24A 2PVEA 4XXBB 4AHYA 4YWMA 5MGNA 4WFN1 3KYUA 4AI0A 1YUXA 1YK4A 5DM61 3KYWA 2HR5A 1CAAA 4RXNA 5GAEc 2XJQA 4AR6A 1YK5A 5MLC3 2KN9A 1LKOA 3NFPI 3P2AA 7RXNA 3PKJA 2JI3A 2DSXA 4JAGA 4TVMA 2C6AA 2ERSA 1FHHA 2B5ID 1BFYA 4AR5A 2ERJA 3QQCE 8RXNA 1RYTA 1VZGA 2MS3A 2PPTA 3PIO1 4AHZA 2M4VA 2XJTA 4AI1A 1OWBA 2A68D 5MFPA 4AHXA 1ODHA 2NYDA 4G6BA 1SMMA 2A6HD 2C6BA 2PVXA 5K2ME 4POFA 5EIOC 2M4YA 1BQ8A 1VCXA 3J7Z1 3QVDA 4LHNA 4ZN3B 2KKDA 4GS7D 3LNLA 2V0EA 4B8CD 1SMWA 4ZN1B 1BQ9A 1BE7A 1WJVA 2Z3QB 1SMUA 1R0FA 3WWNB 4ME3A 2RDVA 3PIP1 1IU6A 5AI2A 4JAFA 2LCQA 5AI3A 1RB9A 1VZIA 3VPBE 5H1Sc 2QL0A 4U671 5MF6A 1CADA 2H12A 1Z92B 2J9UB 4AR4A 2VL6A 1BRFA 2XJSA 1RYQA 2L0ZA 1YV1A 3RYGA 2PYAA 1R0HA 3RZ6A 5EINC 1RDGA 3A44A 5IY0A 1LTLA 1YUZA 5AN9H 2ZIXA 3WWLA 1DVBA 3SS2A 1IROA 1LKPA 3P8BA 1B2JA 1QCVA 4JADA 3MSUA 3MPSA 2A69D 5GAGc 3KYYA 2XJRA 1NXEA 5JVH1 2K2DA 1IRNA 5MFZA 4AI2A 2PSMC 3IU3I 5JVG1 1R0GA 5GADc 4POGA 1T9QA 4LHLA 1R0IA 6RXNA 3PWFA 2CKAA 3PZAA 2CR8A 4JAEA 1B2OA 1T9PA 4UY81 2BE5D 2V3BB 1IW7D 1RWDA 2JI2A 5DM71 3ZG6A 3K35A 1B71A 1LKMA 1C09A 1B13A 2XJPA 3KYVA 4AHWA 3LPEB 1JYBA 1S30A 1RDVA 1VZHA 2Z3RB 3KYXA 2JI1A 2O5JD 2AYJA 4XGHA 1FHMA 1S2ZA 3B08B 1NXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWL A;  4K9F A;  2GMG A;  1E8J A;  1NNQ A;  1R0J A;  1QYB A;  1H7V A;  3RZT A;  5RXN A;  1T9O A;  4TPU A;  1DX8 A;  1ZRP A;  1IU5 A;  4AR3 A;  1S24 A;  2PVE A;  4YWM A;  3KYU A;  1YUX A;  1YK4 A;  3KYW A;  2HR5 A;  1CAA A;  4RXN A;  4AR6 A;  1YK5 A;  2KN9 A;  1LKO A;  7RXN A;  2DSX A;  1FHH A;  1BFY A;  4AR5 A;  8RXN A;  1RYT A;  2MS3 A;  1SMM A;  2PVX A;  4POF A;  2M4Y A;  1BQ8 A;  1VCX A;  3QVD A;  2KKD A;  1SMW A;  1BQ9 A;  1BE7 A;  1SMU A;  1R0F A;  4ME3 A;  2RDV A;  1IU6 A;  5AI2 A;  2LCQ A;  5AI3 A;  1RB9 A;  2QL0 A;  1CAD A;  4AR4 A;  2VL6 A;  1BRF A;  3RZ6 A;  1YV1 A;  3RYG A;  2PYA A;  1R0H A;  5IY0 A;  1RDG A;  3A44 A;  1LTL A;  1YUZ A;  1DVB A;  3SS2 A;  1IRO A;  1LKP A;  1B2J A;  1QCV A;  3MPS A;  3KYY A;  2K2D A;  1IRN A;  1R0G A;  4POG A;  1T9Q A;  1R0I A;  6RXN A;  3PWF A;  3PZA A;  1B2O A;  1T9P A;  2V3B B;  1RWD A;  1B71 A;  1LKM A;  1C09 A;  1B13 A;  3KYV A;  1JYB A;  1S30 A;  1RDV A;  3KYX A;  1FHM A;  1S2Z A; 
#chains in the Genus database with same CATH topology
 1NNQ A;  4AI3 A;  1QYB A;  2R92 L;  1H7V A;  3HOX L;  3LWV B;  3HOY L;  1T9O A;  4A3I L;  3H0G L;  3S2D L;  1IU5 A;  5M3M L;  2M6O A;  1TWG L;  3S15 L;  4C3I L;  1YUX A;  2APO B;  5M5Y L;  5MLC 3;  3PL5 A;  1I50 L;  3PKJ A;  2DSX A;  4TVM A;  1BFY A;  3QQC E;  3HJY B;  4A3K L;  2MS3 A;  1PFW A;  4AHZ A;  2XJT A;  3H99 A;  1Y1V L;  3S1R L;  1SMM A;  2V0E A;  3S16 L;  3S1Q L;  1RB9 A;  3GTO L;  3CQZ L;  1Z92 B;  2XJS A;  1BRF A;  3HAX C;  5IY0 A;  1RDG A;  3A44 A;  1PFY A;  5IYB L;  1DVB A;  3P8B A;  3MPS A;  3KYY A;  5JVH 1;  1IRN A;  5FJ8 L;  1TWA L;  3PO3 L;  3JR7 A;  3LWO B;  6RXN A;  2CKA A;  4A3M L;  3H97 A;  2V3B B;  3ZG6 A;  1LKM A;  1B13 A;  4A3L L;  2E2H L;  4X6A L;  2Y0S P;  4A93 L;  1FHM A;  3GTK L;  1S2Z A;  2M6P A;  4V19 6;  4YWL A;  2XJV A;  2V0F A;  2XJU A;  1R0J A;  3MQK B;  1R9T L;  3PKI A;  3HOU L;  4AI0 A;  2JA8 L;  1YK4 A;  5DM6 1;  1CAA A;  4AR6 A;  2KN9 A;  3P2A A;  2JI3 A;  2E2I L;  2C6A A;  3M4O L;  1WCM L;  4AR5 A;  2R93 L;  1VZG A;  5MFP A;  4AHX A;  1ODH A;  2NYD A;  4G6B A;  4A3G L;  2PVX A;  2PMZ P;  1VCX A;  3J7Z 1;  4ZN3 B;  3I4N L;  4GS7 D;  5M5X L;  4B8C D;  3WWN B;  1WJV A;  1SMU A;  4ME3 A;  2RDV A;  1IU6 A;  4JAF A;  2LCQ A;  3VPB E;  2QL0 A;  5MF6 A;  2H12 A;  2J9U B;  5EIN C;  1RYQ A;  3FKI L;  1R0H A;  5M5W L;  1LTL A;  3SS2 A;  1TWH L;  4JAD A;  3MSU A;  4Y7N L;  4C3J L;  5JVG 1;  2WB1 P;  5GAD c;  1Y1W L;  4POG A;  1T9Q A;  3PWF A;  1PZX A;  1B2O A;  3HOV L;  1T9P A;  4UY8 1;  3KYV A;  4BBR L;  2EY4 E;  3RZO L;  3KYX A;  4BBS L;  3B08 B;  4K9F A;  3B0A B;  5GAH c;  2CKC A;  4C2M 1;  3HOW L;  5RXN A;  4TPU A;  2A6E D;  1I6H L;  1S24 A;  4XXB B;  1PFU A;  4YWM A;  3KYU A;  4QIW P;  1TWC L;  3RZD L;  3S1M L;  2HR5 A;  4RXN A;  5GAE c;  2XJQ A;  4A3B L;  5IP9 L;  7RXN A;  1PFV A;  3GTL L;  4JAG A;  2ERS A;  1FHH A;  8RXN A;  2ERJ A;  2JA6 L;  3LWQ B;  5C3E L;  2NVQ L;  3PIO 1;  1OWB A;  1SFO L;  2A68 D;  2NVT L;  2C6B A;  5K2M E;  4POF A;  2M4Y A;  4A3J L;  4LHN A;  2B63 L;  4BY1 L;  4ZN1 B;  1BE7 A;  1R0F A;  4Y52 L;  3LWP B;  1VZI A;  2JA7 L;  5H1S c;  4AR4 A;  4C3H L;  2L0Z A;  3RZ6 A;  3RYG A;  2PYA A;  5AN9 H;  2AQC A;  1YUZ A;  3WWL A;  5IYD L;  1LKP A;  1B2J A;  1QCV A;  1K83 L;  5FLM L;  5GAG c;  2E2J L;  5MFZ A;  3M3Y L;  4AI2 A;  3IU3 I;  3H9B A;  1R0G A;  3S1N L;  4JAE A;  4BXX L;  1IW7 D;  2NVY L;  3GTQ L;  2JI2 A;  1F4L A;  3K35 A;  1B71 A;  1C09 A;  2WAQ P;  3LPE B;  1JYB A;  1RDV A;  1VZH A;  2JI1 A;  2O5J D;  2AYJ A;  3GTM L;  1NXG A;  3I4M L;  2NVX L;  3J7Y 1;  1TWF L;  3FDJ A;  2GMG A;  1E8J A;  1OWC A;  1QQT A;  2VUM L;  5IP7 L;  3RZT A;  4A3F L;  1DX8 A;  4E6Y A;  1ZRP A;  2PVE A;  4AHY A;  5MGN A;  4WFN 1;  3H3V M;  3H9C A;  2AUS B;  3KYW A;  5C44 L;  1YK5 A;  1LKO A;  3NFP I;  4A3E L;  5C4X L;  2B5I D;  3S14 L;  3GTG L;  1RYT A;  2PPT A;  2R7Z L;  2M4V A;  4AI1 A;  2RFK B;  3LWR B;  3HJW B;  3HOZ L;  2A6H D;  3GTP L;  5EIO C;  1BQ8 A;  3QVD A;  5IYC L;  2KKD A;  4A3D L;  3LNL A;  1SMW A;  2JA5 L;  3S17 L;  1BQ9 A;  2Z3Q B;  3PIP 1;  5AI2 A;  5AI3 A;  2HVY C;  4U67 1;  1CAD A;  1I3Q L;  3GTJ L;  2VL6 A;  1P7P A;  4A3C L;  1YV1 A;  3S2H L;  5C4J L;  2ZIX A;  3HKZ P;  1IRO A;  5M3F L;  2A69 D;  2XJR A;  1NXE A;  2K2D A;  4AYB P;  2PSM C;  3PO2 L;  4LHL A;  1R0I A;  3PZA A;  2CR8 A;  2BE5 D;  1RWD A;  5DM7 1;  4AHW A;  2XJP A;  2YU9 L;  3K7A L;  1S30 A;  2Z3R B;  4XGH A;  4BY7 L;  4AR3 A; 
#chains in the Genus database with same CATH homology
 2M6P A;  4V19 6;  4YWL A;  2XJV A;  2V0F A;  2XJU A;  3J7Y 1;  4K9F A;  2GMG A;  1E8J A;  1OWC A;  1NNQ A;  3B0A B;  1R0J A;  1QYB A;  4AI3 A;  1H7V A;  5GAH c;  2CKC A;  3RZT A;  5RXN A;  1T9O A;  4TPU A;  1DX8 A;  4E6Y A;  1ZRP A;  2A6E D;  3PKI A;  1IU5 A;  2M6O A;  4AR3 A;  1S24 A;  2PVE A;  4XXB B;  4AHY A;  4YWM A;  5MGN A;  4WFN 1;  3KYU A;  4AI0 A;  1YUX A;  1YK4 A;  5DM6 1;  3KYW A;  2HR5 A;  1CAA A;  4RXN A;  5GAE c;  2XJQ A;  4AR6 A;  1YK5 A;  5MLC 3;  2KN9 A;  1LKO A;  3NFP I;  3P2A A;  7RXN A;  3PKJ A;  2JI3 A;  2DSX A;  4JAG A;  4TVM A;  2C6A A;  2ERS A;  1FHH A;  2B5I D;  1BFY A;  4AR5 A;  2ERJ A;  3QQC E;  8RXN A;  1RYT A;  1VZG A;  2MS3 A;  2PPT A;  3PIO 1;  4AHZ A;  2M4V A;  2XJT A;  4AI1 A;  1OWB A;  2A68 D;  5MFP A;  4AHX A;  1ODH A;  2NYD A;  4G6B A;  1SMM A;  2A6H D;  2C6B A;  2PVX A;  5K2M E;  4POF A;  5EIO C;  2M4Y A;  1BQ8 A;  1VCX A;  3J7Z 1;  3QVD A;  4LHN A;  4ZN3 B;  2KKD A;  4GS7 D;  3LNL A;  2V0E A;  4B8C D;  1SMW A;  4ZN1 B;  1BQ9 A;  1BE7 A;  1WJV A;  2Z3Q B;  1SMU A;  1R0F A;  3WWN B;  4ME3 A;  2RDV A;  3PIP 1;  1IU6 A;  5AI2 A;  4JAF A;  2LCQ A;  5AI3 A;  1RB9 A;  1VZI A;  3VPB E;  5H1S c;  2QL0 A;  4U67 1;  5MF6 A;  1CAD A;  2H12 A;  1Z92 B;  2J9U B;  4AR4 A;  2VL6 A;  1BRF A;  2XJS A;  1RYQ A;  2L0Z A;  1YV1 A;  3RYG A;  2PYA A;  1R0H A;  3RZ6 A;  5EIN C;  1RDG A;  3A44 A;  5IY0 A;  1LTL A;  1YUZ A;  5AN9 H;  2ZIX A;  3WWL A;  1DVB A;  3SS2 A;  1IRO A;  1LKP A;  3P8B A;  1B2J A;  1QCV A;  4JAD A;  3MSU A;  3MPS A;  2A69 D;  5GAG c;  3KYY A;  2XJR A;  1NXE A;  5JVH 1;  2K2D A;  1IRN A;  5MFZ A;  4AI2 A;  2PSM C;  3IU3 I;  5JVG 1;  1R0G A;  5GAD c;  4POG A;  1T9Q A;  4LHL A;  1R0I A;  6RXN A;  3PWF A;  2CKA A;  3PZA A;  2CR8 A;  4JAE A;  1B2O A;  1T9P A;  4UY8 1;  2BE5 D;  2V3B B;  1IW7 D;  1RWD A;  2JI2 A;  5DM7 1;  3ZG6 A;  3K35 A;  1B71 A;  1LKM A;  1C09 A;  1B13 A;  2XJP A;  3KYV A;  4AHW A;  3LPE B;  1JYB A;  1S30 A;  1RDV A;  1VZH A;  2Z3R B;  3KYX A;  2JI1 A;  2O5J D;  2AYJ A;  4XGH A;  1FHM A;  1S2Z A;  3B08 B;  1NXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...