5FLML

Structure of transcribing mammalian rna polymerase ii
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
44
structure length
44
Chain Sequence
MIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
total genus 1
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03604 DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.30 Mainly Beta Single Sheet Rubrerythrin, domain 2 RNA polymerase ii, chain L 5flmL00
3GTKL 3I4NL 5C44L 3GTML 3CQZL 3GTOL 2R92L 1I6HL 5FLML 3K7AL 2JA5L 3FKIL 4Y7NL 3S17L 2E2IL 4A3FL 2R93L 4AYBP 4C3IL 3I4ML 3S16L 1TWCL 5M3ML 2NVXL 5M5YL 3H3VM 3HOXL 1SFOL 2WAQP 2VUML 3PO2L 2Y0SP 4BY1L 5C4JL 3S2DL 4QIWP 5IP7L 3S2HL 3RZDL 1R9TL 3HOZL 1I50L 4A3IL 3GTGL 4C2M1 5IP9L 1TWGL 3HOVL 4A3LL 4Y52L 4BY7L 3HOUL 2E2HL 3M4OL 3PO3L 3M3YL 3GTQL 2NVQL 2NVTL 4A3ML 1Y1VL 2NVYL 3S1QL 2E2JL 4BBSL 4A3BL 4X6AL 5M5XL 5C3EL 5C4XL 3HOYL 5FJ8L 3GTLL 3GTPL 2WB1P 4A3JL 3S1NL 3H0GL 5M3FL 4A3DL 2JA6L 1TWAL 4C3HL 3S14L 4A3GL 4A3EL 4A93L 3RZOL 2PMZP 1TWFL 5M5WL 2JA8L 5IYBL 2R7ZL 5IYDL 4A3CL 1I3QL 3HKZP 4C3JL 4BXXL 5IYCL 3S1RL 3S1ML 2B63L 4BBRL 2YU9L 1K83L 1WCML 3GTJL 1TWHL 3HOWL 2JA7L 4A3KL 3S15L 1Y1WL
chains in the Genus database with same CATH superfamily
2AUSB 1S24A 3PIP1 3I4NL 4U671 2VL6A 3GTML 3CQZL 1PZXA 4AI2A 4AI1A 3QVDA 3QQCE 2ZIXA 1RYTA 3KYYA 4TVMA 4AHZA 2DSXA 2R93L 1BQ8A 5M3ML 5MLC3 5M5YL 3HOXL 4TPUA 1SFOL 4K9FA 3WWNB 1IU6A 1OWBA 5C4JL 1F4LA 1Z92B 1BRFA 2M6OA 1RYQA 1R9TL 1I50L 3MPSA 4C2M1 1VZIA 1TWGL 8RXNA 4BY7L 3HJYB 3HOUL 1CAAA 2A6HD 2PVXA 3GTQL 1PFVA 2NVTL 2QL0A 4A3ML 1Y1VL 2NVYL 3S1QL 1DX8A 2C6AA 4X6AL 5M5XL 2L0ZA 1BFYA 2XJUA 2RDVA 5AI2A 1RDVA 1RWDA 2A68D 1PFUA 3S1NL 1BQ9A 4XXBB 7RXNA 2JA6L 2V0EA 1QCVA 2GMGA 2PMZP 3LWOB 5IYBL 3LWVB 2A69D 1IW7D 3NFPI 1CADA 1IRNA 2JI3A 5MFZA 3S1ML 1ZRPA 4JAEA 3HOWL 2HVYC 4A3KL 1FHHA 1IU5A 3S15L 3K7AL 4AHWA 4ZN1B 2R92L 3MQKB 3J7Z1 2JI2A 2XJTA 4AR6A 4A3FL 2E2IL 4B8CD 3MSUA 4AR5A 4C3IL 1E8JA 2PPTA 2O5JD 5GAEc 2WAQP 2Y0SP 3PL5A 2XJSA 4BY1L 2XJVA 4JAGA 3S2HL 3LPEB 5H1Sc 2BE5D 5MFPA 3HOZL 1FHMA 1LTLA 1T9PA 5IP9L 1PFYA 3RYGA 2Z3QB 4Y52L 2E2HL 3PO3L 3M3YL 2NVQL 3P8BA 4BBSL 2V0FA 4ZN3B 5C3EL 3KYXA 1QQTA 1R0JA 2B5ID 3PKJA 1VCXA 3LWQB 4A3DL 3H0GL 3HAXC 1RB9A 3S14L 4XGHA 4A3EL 3RZOL 3KYWA 5M5WL 2JA8L 4LHNA 2AQCA 4A3CL 2K2DA 3H9CA 2KKDA 5MGNA 2B63L 5MF6A 1C09A 3K35A 2V3BB 1TWHL 1NXEA 1T9OA 1T9QA 3GTOL 3FDJA 2MS3A 1I6HL 3PWFA 3IU3I 3KYUA 3FKIL 2JA5L 2H12A 4AHYA 5DM61 1DVBA 4YWMA 3S16L 4AHXA 3H97A 1R0GA 4WFN1 3H3VM 3PIO1 5RXNA 4GS7D 1LKOA 3VPBE 5AN9H 2VUML 3PO2L 1PFWA 4G6BA 1P7PA 3S2DL 4QIWP 5IP7L 1JYBA 3RZDL 2M4YA 4A3IL 3GTGL 2A6ED 2NYDA 3HOVL 4A3LL 2APOB 1ODHA 5AI3A 2CKCA 1R0IA 4UY81 1B13A 1YK5A 2AYJA 1NXGA 1LKMA 2Z3RB 3LNLA 3JR7A 4A3BL 3H99A 5C4XL 3HOYL 4JADA 5FJ8L 2CR8A 3GTLL 3GTPL 2WB1P 4RXNA 4A3JL 2RFKB 1TWAL 5GADc 2PYAA 1SMWA 2XJRA 1SMMA 4AR3A 5K2ME 4AI0A 3PKIA 2PVEA 4C3JL 4BXXL 4AI3A 2HR5A 3ZG6A 2ERSA 1R0HA 5JVH1 6RXNA 4E6YA 1K83L 1WCML 4POFA 1SMUA 2JA7L 3RZTA 3RZ6A 1Y1WL 3B08B 3GTKL 1WJVA 5C44L 3PZAA 2EY4E 5FLML 1S30A 2PSMC 3WWLA 5EINC 4Y7NL 3S17L 1VZGA 1LKPA 1B2OA 4AYBP 3I4ML 5DM71 1TWCL 2NVXL 1VZHA 4ME3A 3HJWB 4AR4A 2XJQA 2LCQA 1IROA 3LWPB 1RDGA 5GAHc 3A44A 3M4OL 1B2JA 2M6PA 3LWRB 3KYVA 2E2JL 1BE7A 3H9BA 2J9UB 5GAGc 2CKAA 5M3FL 1YUZA 3SS2A 4C3HL 4A3GL 4A93L 2C6BA 1TWFL 2KN9A 3P2AA 1OWCA 1B71A 1QYBA 1H7VA 1S2ZA 2R7ZL 5IYDL 2ERJA 1I3QL 3HKZP 5IY0A 1R0FA 1YK4A 3J7Y1 2M4VA 1NNQA 4JAFA 2JI1A 5IYCL 3S1RL 4YWLA 5JVG1 2XJPA 4V196 5EIOC 4BBRL 1YUXA 2YU9L 3GTJL 4POGA 3B0AB 1YV1A 4LHLA
chains in the Genus database with same CATH topology
3GTKL 3I4NL 5C44L 3GTML 3CQZL 3GTOL 2R92L 1I6HL 5FLML 3K7AL 2JA5L 3FKIL 4Y7NL 3S17L 2E2IL 4A3FL 2R93L 4AYBP 4C3IL 3I4ML 3S16L 1TWCL 5M3ML 2NVXL 5M5YL 3H3VM 3HOXL 1SFOL 2WAQP 2VUML 3PO2L 2Y0SP 4BY1L 5C4JL 3S2DL 4QIWP 5IP7L 3S2HL 3RZDL 1R9TL 3HOZL 1I50L 4A3IL 3GTGL 4C2M1 5IP9L 1TWGL 3HOVL 4A3LL 4Y52L 4BY7L 3HOUL 2E2HL 3M4OL 3PO3L 3M3YL 3GTQL 2NVQL 2NVTL 4A3ML 1Y1VL 2NVYL 3S1QL 2E2JL 4BBSL 4A3BL 4X6AL 5M5XL 5C3EL 5C4XL 3HOYL 5FJ8L 3GTLL 3GTPL 2WB1P 4A3JL 3S1NL 3H0GL 5M3FL 4A3DL 2JA6L 1TWAL 4C3HL 3S14L 4A3GL 4A3EL 4A93L 3RZOL 2PMZP 1TWFL 5M5WL 2JA8L 5IYBL 2R7ZL 5IYDL 4A3CL 1I3QL 3HKZP 4C3JL 4BXXL 5IYCL 3S1RL 3S1ML 2B63L 4BBRL 2YU9L 1K83L 1WCML 3GTJL 1TWHL 3HOWL 2JA7L 4A3KL 3S15L 1Y1WL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK L;  3I4N L;  5C44 L;  3GTM L;  3CQZ L;  3GTO L;  2R92 L;  1I6H L;  5FLM L;  3K7A L;  2JA5 L;  3FKI L;  4Y7N L;  3S17 L;  2E2I L;  4A3F L;  2R93 L;  4AYB P;  4C3I L;  3I4M L;  3S16 L;  1TWC L;  5M3M L;  2NVX L;  5M5Y L;  3H3V M;  3HOX L;  1SFO L;  2WAQ P;  2VUM L;  3PO2 L;  2Y0S P;  4BY1 L;  5C4J L;  3S2D L;  4QIW P;  5IP7 L;  3S2H L;  3RZD L;  1R9T L;  3HOZ L;  1I50 L;  4A3I L;  3GTG L;  4C2M 1;  5IP9 L;  1TWG L;  3HOV L;  4A3L L;  4Y52 L;  4BY7 L;  3HOU L;  2E2H L;  3M4O L;  3PO3 L;  3M3Y L;  3GTQ L;  2NVQ L;  2NVT L;  4A3M L;  1Y1V L;  2NVY L;  3S1Q L;  2E2J L;  4BBS L;  4A3B L;  4X6A L;  5M5X L;  5C3E L;  5C4X L;  3HOY L;  5FJ8 L;  3GTL L;  3GTP L;  2WB1 P;  4A3J L;  3S1N L;  3H0G L;  5M3F L;  4A3D L;  2JA6 L;  1TWA L;  4C3H L;  3S14 L;  4A3G L;  4A3E L;  4A93 L;  3RZO L;  2PMZ P;  1TWF L;  5M5W L;  2JA8 L;  5IYB L;  2R7Z L;  5IYD L;  4A3C L;  1I3Q L;  3HKZ P;  4C3J L;  4BXX L;  5IYC L;  3S1R L;  3S1M L;  2B63 L;  4BBR L;  2YU9 L;  1K83 L;  1WCM L;  3GTJ L;  1TWH L;  3HOW L;  2JA7 L;  4A3K L;  3S15 L;  1Y1W L; 
#chains in the Genus database with same CATH topology
 2AUS B;  1S24 A;  3PIP 1;  3I4N L;  4U67 1;  2VL6 A;  3GTM L;  3CQZ L;  1PZX A;  4AI2 A;  4AI1 A;  3QVD A;  3QQC E;  2ZIX A;  1RYT A;  3KYY A;  4TVM A;  4AHZ A;  2DSX A;  2R93 L;  1BQ8 A;  5M3M L;  5MLC 3;  5M5Y L;  3HOX L;  4TPU A;  1SFO L;  4K9F A;  3WWN B;  1IU6 A;  1OWB A;  5C4J L;  1F4L A;  1Z92 B;  1BRF A;  2M6O A;  1RYQ A;  1R9T L;  1I50 L;  3MPS A;  4C2M 1;  1VZI A;  1TWG L;  8RXN A;  4BY7 L;  3HJY B;  3HOU L;  1CAA A;  2A6H D;  2PVX A;  3GTQ L;  1PFV A;  2NVT L;  2QL0 A;  4A3M L;  1Y1V L;  2NVY L;  3S1Q L;  1DX8 A;  2C6A A;  4X6A L;  5M5X L;  2L0Z A;  1BFY A;  2XJU A;  2RDV A;  5AI2 A;  1RDV A;  1RWD A;  2A68 D;  1PFU A;  3S1N L;  1BQ9 A;  4XXB B;  7RXN A;  2JA6 L;  2V0E A;  1QCV A;  2GMG A;  2PMZ P;  3LWO B;  5IYB L;  3LWV B;  2A69 D;  1IW7 D;  3NFP I;  1CAD A;  1IRN A;  2JI3 A;  5MFZ A;  3S1M L;  1ZRP A;  4JAE A;  3HOW L;  2HVY C;  4A3K L;  1FHH A;  1IU5 A;  3S15 L;  3K7A L;  4AHW A;  4ZN1 B;  2R92 L;  3MQK B;  3J7Z 1;  2JI2 A;  2XJT A;  4AR6 A;  4A3F L;  2E2I L;  4B8C D;  3MSU A;  4AR5 A;  4C3I L;  1E8J A;  2PPT A;  2O5J D;  5GAE c;  2WAQ P;  2Y0S P;  3PL5 A;  2XJS A;  4BY1 L;  2XJV A;  4JAG A;  3S2H L;  3LPE B;  5H1S c;  2BE5 D;  5MFP A;  3HOZ L;  1FHM A;  1LTL A;  1T9P A;  5IP9 L;  1PFY A;  3RYG A;  2Z3Q B;  4Y52 L;  2E2H L;  3PO3 L;  3M3Y L;  2NVQ L;  3P8B A;  4BBS L;  2V0F A;  4ZN3 B;  5C3E L;  3KYX A;  1QQT A;  1R0J A;  2B5I D;  3PKJ A;  1VCX A;  3LWQ B;  4A3D L;  3H0G L;  3HAX C;  1RB9 A;  3S14 L;  4XGH A;  4A3E L;  3RZO L;  3KYW A;  5M5W L;  2JA8 L;  4LHN A;  2AQC A;  4A3C L;  2K2D A;  3H9C A;  2KKD A;  5MGN A;  2B63 L;  5MF6 A;  1C09 A;  3K35 A;  2V3B B;  1TWH L;  1NXE A;  1T9O A;  1T9Q A;  3GTO L;  3FDJ A;  2MS3 A;  1I6H L;  3PWF A;  3IU3 I;  3KYU A;  3FKI L;  2JA5 L;  2H12 A;  4AHY A;  5DM6 1;  1DVB A;  4YWM A;  3S16 L;  4AHX A;  3H97 A;  1R0G A;  4WFN 1;  3H3V M;  3PIO 1;  5RXN A;  4GS7 D;  1LKO A;  3VPB E;  5AN9 H;  2VUM L;  3PO2 L;  1PFW A;  4G6B A;  1P7P A;  3S2D L;  4QIW P;  5IP7 L;  1JYB A;  3RZD L;  2M4Y A;  4A3I L;  3GTG L;  2A6E D;  2NYD A;  3HOV L;  4A3L L;  2APO B;  1ODH A;  5AI3 A;  2CKC A;  1R0I A;  4UY8 1;  1B13 A;  1YK5 A;  2AYJ A;  1NXG A;  1LKM A;  2Z3R B;  3LNL A;  3JR7 A;  4A3B L;  3H99 A;  5C4X L;  3HOY L;  4JAD A;  5FJ8 L;  2CR8 A;  3GTL L;  3GTP L;  2WB1 P;  4RXN A;  4A3J L;  2RFK B;  1TWA L;  5GAD c;  2PYA A;  1SMW A;  2XJR A;  1SMM A;  4AR3 A;  5K2M E;  4AI0 A;  3PKI A;  2PVE A;  4C3J L;  4BXX L;  4AI3 A;  2HR5 A;  3ZG6 A;  2ERS A;  1R0H A;  5JVH 1;  6RXN A;  4E6Y A;  1K83 L;  1WCM L;  4POF A;  1SMU A;  2JA7 L;  3RZT A;  3RZ6 A;  1Y1W L;  3B08 B;  3GTK L;  1WJV A;  5C44 L;  3PZA A;  2EY4 E;  5FLM L;  1S30 A;  2PSM C;  3WWL A;  5EIN C;  4Y7N L;  3S17 L;  1VZG A;  1LKP A;  1B2O A;  4AYB P;  3I4M L;  5DM7 1;  1TWC L;  2NVX L;  1VZH A;  4ME3 A;  3HJW B;  4AR4 A;  2XJQ A;  2LCQ A;  1IRO A;  3LWP B;  1RDG A;  5GAH c;  3A44 A;  3M4O L;  1B2J A;  2M6P A;  3LWR B;  3KYV A;  2E2J L;  1BE7 A;  3H9B A;  2J9U B;  5GAG c;  2CKA A;  5M3F L;  1YUZ A;  3SS2 A;  4C3H L;  4A3G L;  4A93 L;  2C6B A;  1TWF L;  2KN9 A;  3P2A A;  1OWC A;  1B71 A;  1QYB A;  1H7V A;  1S2Z A;  2R7Z L;  5IYD L;  2ERJ A;  1I3Q L;  3HKZ P;  5IY0 A;  1R0F A;  1YK4 A;  3J7Y 1;  2M4V A;  1NNQ A;  4JAF A;  2JI1 A;  5IYC L;  3S1R L;  4YWL A;  5JVG 1;  2XJP A;  4V19 6;  5EIO C;  4BBR L;  1YUX A;  2YU9 L;  3GTJ L;  4POG A;  3B0A B;  1YV1 A;  4LHL A; 
#chains in the Genus database with same CATH homology
 3GTK L;  3I4N L;  5C44 L;  3GTM L;  3CQZ L;  3GTO L;  2R92 L;  1I6H L;  5FLM L;  3K7A L;  2JA5 L;  3FKI L;  4Y7N L;  3S17 L;  2E2I L;  4A3F L;  2R93 L;  4AYB P;  4C3I L;  3I4M L;  3S16 L;  1TWC L;  5M3M L;  2NVX L;  5M5Y L;  3H3V M;  3HOX L;  1SFO L;  2WAQ P;  2VUM L;  3PO2 L;  2Y0S P;  4BY1 L;  5C4J L;  3S2D L;  4QIW P;  5IP7 L;  3S2H L;  3RZD L;  1R9T L;  3HOZ L;  1I50 L;  4A3I L;  3GTG L;  4C2M 1;  5IP9 L;  1TWG L;  3HOV L;  4A3L L;  4Y52 L;  4BY7 L;  3HOU L;  2E2H L;  3M4O L;  3PO3 L;  3M3Y L;  3GTQ L;  2NVQ L;  2NVT L;  4A3M L;  1Y1V L;  2NVY L;  3S1Q L;  2E2J L;  4BBS L;  4A3B L;  4X6A L;  5M5X L;  5C3E L;  5C4X L;  3HOY L;  5FJ8 L;  3GTL L;  3GTP L;  2WB1 P;  4A3J L;  3S1N L;  3H0G L;  5M3F L;  4A3D L;  2JA6 L;  1TWA L;  4C3H L;  3S14 L;  4A3G L;  4A3E L;  4A93 L;  3RZO L;  2PMZ P;  1TWF L;  5M5W L;  2JA8 L;  5IYB L;  2R7Z L;  5IYD L;  4A3C L;  1I3Q L;  3HKZ P;  4C3J L;  4BXX L;  5IYC L;  3S1R L;  3S1M L;  2B63 L;  4BBR L;  2YU9 L;  1K83 L;  1WCM L;  3GTJ L;  1TWH L;  3HOW L;  2JA7 L;  4A3K L;  3S15 L;  1Y1W L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...