4AHZA

Flo5a showing a heptanuclear gadolinium cluster on its surface after 60 min of soaking
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahzA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahzA01
4AF9A 4COWA 4AHWA 4AI2A 2XJSA 4AI1A 5A3MA 4GQ7A 4COZA 2XJRA 4AFCA 4COVA 4COUA 2XJUA 4AFBA 5A3LA 4CP1A 4AHYA 4AI0A 4AFAA 4AHXA 4COYA 4CP2A 4CP0A 4LHKA 2XJTA 4A3XA 4LHNA 2XJQA 4ASLA 4D3WA 4LHLA 4AHZA 4AI3A 2XJVA 2XJPA
chains in the Genus database with same CATH superfamily
1DX8A 1H1IA 4WM7C 4QWNA 4ZXEA 5K7PA 4JCKA 5LRRA 1JYBA 1O3SA 2K9ZA 3WDXA 3KCXA 4P00B 2QQUA 2VZQA 1ODMA 1AXYA 4QT6A 5JLVA 3T30A 1W8OA 2Y6JA 4HKLA 4LKFA 3TYJA 3WNNA 3T09A 3ZSEA 1XNKA 2Y26A 2M6PA 1FPN3 3B0AB 1PIV1 3OD0A 5HCFA 5T50A 5C44L 1RUE1 4XFAA 4NN0A 4XIKA 1W0PA 2DCKA 3N3HA 4YPJA 4QQ2A 2GN3A 2YXSA 5GADc 5IVCA 5JVH1 4RQPB 4XTMA 5FYVA 3EHKA 1SZBA 2J1VA 1VBC2 5CG9A 3AYAA 3PO3L 1WGPA 3HT1A 2W87A 1UKRA 5DAQA 5IYDL 1OQEA 5HXVA 1PFWA 4AI2A 4XAAA 2XJSA 1VAKA 4JKMA 3LGRA 5DUVA 3NNJA 1W8FA 3AZXA 3LNLA 4RQPC 4R4XA 4QPIB 2YGLA 3CEWA 1S4CA 4JKLA 1Y9GA 5FZ4A 3BALA 3JCIA 4WM7A 2Z2SB 2F17A 2PQQA 2VG9A 1RVF3 4LUKA 1PO12 4BIFA 1HDKA 1NY72 2FDKA 4QQPA 1JH5A 4YWLA 2FDJA 4NO4A 3LEGA 5EJ3A 3ZYGA 2D43A 1JN2P 3HMYA 3KF5A 4GWJA 4WM8C 4AEDB 5IFPA 1G8WA 4BIOA 1UMZA 4YNIA 4UFHA 2D6PA 4UWDA 4EROA 5C8CB 4LNVA 4QXKA 4N53B 3AMQA 3RGBA 3WQ7A 4QX2A 2D3SA 2Y0IA 1QH6A 4XILA 1ZRDA 1YXWA 2JDAA 5TSWA 1LOEA 5LBBA 4AEDC 2BNMA 4C2M1 1VMHA 2E32A 2JDKA 1R64A 2H0VA 4OZXA 4CCKA 3I3EA 5A6QA 2K0GA 1WW4A 3HQRA 4TSVA 3T0AA 2BYVE 4IV1B 5C8CC 3H9AA 5C5UA 5FTTC 1WJVA 3I8TA 3ZN5A 1K83L 4N53C 2XB6C 1RUF3 1I1EA 1NA1B 1REFA 2AEYA 1KDMA 2ZHLA 2W52A 2HWD2 5AFEA 3M7AA 1BVVA 1BQ8A 2GAUA 3PU8A 2EF6A 5JSRA 2R7EB 4BQ3A 5FPUA 3THTA 2RS11 2GALA 3A21A 5LBEA 1J58A 2ES3A 4BQYA 3OGSA 4IV1C 1AJKA 3UETA 2J1TA 3CQZL 3SC7X 4FTEA 4LT5A 5I93A 3JUUA 1E5SA 1NA1C 1LULA 4KNCA 5E1RA 1D4M1 3WHUA 1YK5A 1L7QA 4QPIA 3O1UA 3KVAA 3ZN4A 7RXNA 4C0BA 3QBQA 4IEUA 4LITA 1JU4A 3RZLA 4LBQD 1JYIA 1LHNA 1RUI3 3LIHA 5M5YL 1QQP2 4K40A 1W05A 5E8AA 1S0BA 3VV1A 3LAGA 4MLOA 4DRVA 3LSEA 3DCQA 2PQSA 2XJVA 2ZMLA 4YW3A 5FMDA 1AR81 3AFKA 5DMYA 1CZVA 1VZIA 1BVP1 2ID4A 2X5IA 3K46A 3HOUL 1WLWA 3H3LA 3WNMA 4CA9A 4ZZ5A 4R9DA 1T6BX 3HVDA 1H7VA 5C8CA 1RJ7A 1OLMA 3GHMA 3MFAA 3NL1A 1ZZ6A 2OIIA 1ULCA 4N53A 5FZGA 4AR3A 1JZ6A 1HV0A 3U11A 3MW4A 3GTQL 3A22A 5FJHA 5LW9A 3B01A 4TLFA 3P5BA 2ERSA 5D8AC 5F32A 4YSFA 1CD3G 5JMOA 4PDWA 3E6CC 3EXUA 2VGDA 3P3PA 5JVVA 4J6GA 4D3WA 3I4IA 4UT5A 1OA4A 2C5DA 2CDPA 4JQTA 1UMIA 1GP4A 5FYCA 3UJOA 4CDWB 4FPEA 2B7YA 2GU9A 3ZFEB 5K4LA 2AH2A 2E2IL 2PAKA 2WZR1 1BK0A 3U10A 2D6LX 1IRNA 2W1QA 2BV4A 2VOXA 3OCPA 1OURA 2H6BA 2QQWA 1AR72 1F9KA 1I50L 3JZVA 4COVA 3WLUA 5JI9A 5JXIA 4XF9A 3O12A 3A44A 2JG9A 4CDWC 2DUQA 2GNTA 1ZM1A 4DEQA 3ZFEC 2EA7A 2V72A 3JQXA 4DB5A 5JOXA 4BLJA 2RR13 1HB3A 3I4NL 2HWE3 2ZS6B 3KB5A 3RDIA 1GP5A 3U0ZA 4NHYA 2BFUL 2VR4A 4Q1PA 1BBT3 4HFSA 1GYKA 3KYYA 3SH4A 3ABZA 5C3PA 2DU0A 3MEPA 2ARXA 2GH8A 2R1BA 3JBG3 4JAEA 1LEMA 2EAAA 2QKDA 2R0HA 3WX5A 5FQ0A 4ES9A 2FCTA 1CWPA 2KN9A 3BU0A 4YWMA 5GAHc 5C4JL 4URAA 5LRSA 4UBGA 3L9JT 2XXZA 4OHWA 5GALA 4BB3A 3S1QL 2ET7A 2WFF1 3P1IA 3B3QE 4EWEA 5CAZA 2NVXL 1A8DA 2BGPA 4L0PA 2A6XA 1IQDC 4Y26A 1ND3B 3H7JA 3CKHA 4P5YA 1XYPA 4LOSA 5GJ6A 1U5IA 3V0AA 4FPJA 3UV9A 4Q1RA 3V0BB 2JG8C 2Z42A 5DDJ2 1FV3A 1K5JA 4P9GA 4XUQA 1FHHA 3ZPYA 3S0MA 1UYPA 1VB2A 4OLLA 3JB8A 3R0RA 4P9YA 1WLCA 1ND3C 2YBSA 4MVTA 2XPJA 4CDWA 2HWC3 2ZBJA 3FUOA 5G04L 3K3OA 1F15A 1H1MA 5GLTA 4NR1A 3EYPA 4ZKTB 1W9TA 5LA1A 3LSDA 1GSLA 5FZEA 3NNMA 2BNOA 3KWVA 1SDDB 1LKOA 1ZZCA 2B39A 3K51A 1W6PB 2Y6KA 4MH0E 2C9KA 2FZ1A 3H8OA 1UOFA 3HOWL 4QQLA 3S7IA 1DCSA 1OLME 4PIYA 2GDFA 4QMAA 5JIAA 3U37A 1PFUA 1UOBA 4UBHA 4XF0A 5IVBA 1YFXA 3BPSA 3BYWA 1W8HA 1TG7A 5EYYA 2PHFA 2WQZC 1XNTA 1BMV2 2P17A 5A6YA 4M4PA 4LLOA 3R05A 4LO4B 1V00A 2XJPA 3IT8A 2OQ6A 4RSUA 4BDVB 1FI2A 5FYMA 4YM3A 2XLFA 2BTVC 2ERFA 4QXCA 4XPVA 2BUKA 1VBE2 1QF3A 5BUVA 1UZYA 3WWLA 1DZRA 1VPHA 4QX5A 4NMIA 2BW8A 3OB8A 3QACA 3LPEB 3LCPA 1WLDA 1WCKA 4YW5A 1ND3A 2WABA 5H9SA 5FCCA 2AENA 2QE3A 2WNUB 2NMNA 1RUNA 1ST8A 4DUVA 5JR2A 4ATFA 2J9UB 3V0BA 5I91A 4Y33A 1S0FA 4NRMA 3WCRA 5JOZA 5KR7A 1YQ2A 1X50A 3VBFB 1WMDA 1CIWA 2DFCA 2HBUA 2WNVC 4OUEA 3P8BA 2JICA 5T54A 1AR91 1PGL2 3N7LA 4H55A 2NPIA 4Z8BA 3DKQA 1JHJA 5FZ6A 4R52A 1AL23 4X8NA 4N7IA 5FZ7A 4Q4X1 4AWDA 5HXMA 4LEJA 4EE2A 1X8MA 3DUIA 3PDQA 2AQCA 1W6PA 2IXCA 3R4SA 3VBFC 4V1PA 3ZG6A 1CESA 4JTNA 3AC0A 3VZNA 4A3GL 3ES1A 3MV11 1N3OA 5FZBA 3L2HA 3WP4A 1WUVA 1PFYA 2BOIA 2ZJCA 2BQPA 2ZTNA 3POIA 3WNPA 3ZMNA 2NYDA 5CG8A 4ZONA 4H7MA 2Y33A 1MS4A 3DKWA 2HR5A 1UY4A 3I4ML 1C57A 2V4VA 2DCJA 4DY3A 4FFFA 3HOZL 5GLZA 3GDBA 2VVFA 3S30A 3J7NA 4UOJA 2EICA 2RS31 1RUI2 2A75A 4A93L 3UKTA 3U14A 1UZWA 2IFWA 4X6AL 5GZEA 3HD8B 5KHIA 2YZ4A 3BODA 3KCYA 1RUD1 4CU6A 1YO8A 3GF6A 5A3LA 2PAEA 2GC2A 4FO9A 1LRHA 5C8WA 4AVAA 3AKPA 1OVSA 1YUDA 5IW0A 4A3ML 5T5LA 4FI9A 4XZPA 5CADA 5FY8A 3NFPI 3SLIA 4CXYA 5E16A 3OD4A 3ZFGB 4BA6A 1M4WA 5JOWA 2WNUA 2RS13 1O8SA 2VE1A 5CFCC 1R083 1EY2A 2XQRA 4LBQB 4K1YA 3HIFA 2VW1A 1XE7A 1KFXL 2Z5WA 3ZYJB 3LEKA 3T08A 3VBFA 3WUCA 4WZFA 4AQ6A 1CX1A 5BNOB 3PIO1 2A73B 4INDA 1OD3A 5C5TA 1R1A1 4NOTA 2WRAA 2R16A 3HOBA 8RXNA 3ZFGC 4AYBP 4G4FA 4LBNA 4CEYB 1GMMA 2V73A 1UWWA 3PJQA 2VMCA 3INAA 2C6BA 1UMHA 1OH4A 2YBPA 4HOOA 3LA7A 1B71A 2AYJA 2XJTA 1KQRA 3PZAA 1TME3 2TUNA 2JXAA 2Z69A 2ZGSA 5A3WA 2A6HD 2R93L 4JAGA 1IPSA 3A7QA 5A7WA 4QHZA 4NUBA 1RUH1 2PLV1 1IU6A 4IEVA 1NZCA 3NNLA 2LM3A 4CEYC 1W9SA 2ZEYA 1P8JA 4P08A 3ZSKA 1D0HA 3N7JA 3I3MA 3RZOL 1AVBA 4QXHA 2HWE2 3HT2A 4P9LA 1RHI2 1TWGL 4XDOA 5JXGA 1NE6A 2MS3A 2VCMA 4QB1A 3B08B 3H3UA 1OLRA 1QEXA 2PHDA 3JBG2 3WUDA 4CCJA 1OLQA 3NO8A 4AFAA 5EINC 4A7KA 4BQWA 4A3EL 1AYM2 3LDKA 3NKTA 3WW4A 3H9CA 2I2SA 1I3HA 2DCYA 4Y7NL 1V6IA 5HCBA 4C90A 1GKBA 2PHTA 2M6OA 4JKKA 2RMU3 3R6SA 1NQJA 3PVEA 5LZ6A 2MEV1 1FMD1 1NZIA 4NHMA 4NHXA 5BXXA 1Z78A 3IDCB 3ITQA 2PYAA 3N9LA 2JA7L 1H1AA 1OOPC 3ZFGA 3S7EA 3ZYHA 5HCAA 3GTPL 1QNYA 2A3XA 1W9FA 1NNQA 3T3YA 3WOGA 4OHYA 1VE0A 4LBQA 3MO4A 4HETA 5A1FA 4RGKA 5HV4A 2R32A 2GP5A 5A3TA 1UF2C 4GB33 1LGNA 4XJAA 1EP0A 1W6NA 3ZN6B 4KU8A 5LA9A 3OUJA 2FCVA 5FYYA 2WZEA 5BNOA 5KWRA 1OBNA 4Q4W2 4AHYA 4NIHA 2MPFA 2K2SA 1VBB1 1ZBE1 2D6KA 2J1SA 5BPXA 2ZA9A 3B9IA 5JSPA 4S2GA 3KS7A 3CU7A 1YFUA 3WP6A 1W8WA 1EV11 1SMWA 2R041 2VPVA 3J7HA 4FOWA 2QJVA 3WV6A 5A1AA 3K77A 3WD5A 2Y6LA 1FOD2 4GAZA 2P34A 2JDHA 3KV9A 3QH6A 4NPLA 3LFIA 1S1AA 5L9RA 4BZ4A 4N9HA 1IG0A 4Q0PA 1BLZA 3ZSLA 3G6JB 1G9BA 2PHLA 2R071 3VKMA 3GZTB 4N43A 1IGOA 2WUHA 5FKCA 3ZXJA 1W3VA 4XJZA 5FZOB 1LOCA 1CQ9A 3H9BA 3OY8B 4WFN1 2W1SA 1YUXA 5CZKA 3CDZB 5CKMA 1PIV2 4EN6B 5F39A 3ZR6A 2YBKA 1KEXA 5DPNA 5FLIA 3WXPA 3GTLL 4FOQA 5EJ1B 3OYWB 2RJ2A 4UAPA 4LTAA 1XNAA 1GQHA 2YMZA 4TYSA 1UXXX 3PVOA 4NIIA 3WHTA 5FZ0A 1F4LA 2VMDA 2A6YA 3B93A 4FTSA 3CJIB 3FLPA 4DY5A 4E2GA 3LPFA 2VAUA 1CADA 2JI3A 1J1LA 3A4UA 4I0BA 2C9AA 2OVUA 2QQMA 2W08A 5JMCA 1JZ4A 3NJZA 3TNPB 1B35B 5MF6A 3DL3A 4CCMA 1WBLA 4Z1VA 2ZIXA 1VBD1 3QQCE 5FUPA 4RGGA 5DZEA 1O3RA 1VBC3 1DG6A 1PFVA 1U12A 2VBPA 4QXBA 1GLHA 2VNOA 1W28A 2OQ7A 3CJIC 1UYZA 1LKPA 4UI9L 4UFJA 1NXMA 4V196 1VRBA 1J3QA 1NLSA 2O0OA 1HRV1 1ACCA 1LR5A 1UU6A 1Q8VA 1B35C 2RS51 3FKIL 2BGOA 2GMMA 3K2OA 3WR0A 1PNFA 4AVBA 1RMU1 3RMXA 2ZPXA 4E4SA 1H6YA 4LO6B 3J8F1 4TZDA 1NCRC 3WF3A 2Q8OA 1QJX1 3HBKA 4CPBD 4ME3A 2ZAAA 4R4ZA 4JGZB 1DZTA 5F5IA 3IIIA 4Y1ZA 1X7NA 5FZ1A 3VBHB 4A3CL 2VZSA 3OBTA 4E6YA 3I2DA 3POYA 1PO13 1WA4A 3DV8A 2NQYA 3MPPG 2VL6A 2VC9A 2Q5TA 4PCRA 5FDBA 1UPSA 3VZOA 3WDUA 1FATA 1UL9A 1OSGA 1RXFA 2ZGKA 1NAEA 1L3JA 1W90A 2Q1MA 4Q0QA 1VZHA 2RDRA 1JYXA 2Y64A 1DQ4A 3OY8A 1T9OA 1ENXA 1GWKA 2WWSA 3E1F1 4OHXA 4JGZC 5FPXA 2OKXA 3IB3A 5LBCA 3VBHC 3SCGA 1PZ7A 3VBSB 5FYZA 1IKQA 2GNDA 2CKAA 1BYHA 3OYWA 4Q2FA 2WNEA 4Q4X3 4QPWA 4AK3A 1AX2A 4YW7A 3BIEA 5CA6A 4DNYA 1QIQA 2BWCA 1UIKA 1R0HA 3VBUA 3CJIA 4YLZA 1TNRA 2VUML 2XH6A 4BPZA 2E6VA 1MS1A 1YNAA 2RS12 3VBSC 5AFBA 2VQTA 2VQUA 1T2XA 4BYYA 1B35A 1DGRA 3GJBA 1ENRA 4O61A 4U2AA 1V0AA 1BRFA 5C3SA 1K12A 1D4M2 1Q8PA 1WMEA 2ARAA 2BDRA 5FK8A 3AKRA 1RIRA 2E53A 4IE4A 4XFBA 2M4YA 1TE1B 4P02B 1W3XA 3K3NA 4FPCA 1LGCA 4FPOB 2D3PA 2W1UA 3RYKA 1XYOA 2ZXQA 5L9VA 1NX9A 4HG6B 2A6VA 2QNKA 5RXNA 3C7OA 3HJWB 3SMHA 1WD4A 5KHJA 4AVTA 5CYYA 5EIYB 3FHQA 1T9QA 1AR82 3I59B 3WNKA 4BK5A 3TAYA 5AVAA 1Q5OA 4JGZA 3RVHA 3VBRB 1QQP3 4QAWA 1CAWB 3LPGA 1IS6A 3CMGA 3F2ZA 2WAOA 3ZDVA 3HAXC 3NNGA 4ARXA 4PJYA 1FNYA 4AI8A 4JDMA 4FPFA 2F6BA 4L99A 5EQUA 2KA3A 5D2AA 3O14A 4FOVA 2XG3A 1LESA 3VBRC 1R1A3 1ZZ9A 3VBSA 5FZFA 4AQSA 2AYHA 5A32A 5DZFA 2J1UA 2ZACA 2PMWB 1SQ4A 3M3CA 5FZ3A 2WZR2 3GNEA 3OBAA 4NRPA 4M3CB 1O8PA 5H9QA 1B2JA 2GMPA 4CDXB 4EN7B 1AL0G 3IAQA 3N9OA 3UK9A 3MLJA 5FPZA 5LY1A 1CPNA 4B8CD 2DURA 4XHBA 3NQHA 1A6CA 1H8VA 1W9YA 2V4AA 3K7AL 2W2IA 4IE0A 4ISRA 3LA3A 1GZWB 4O9EA 3ZYFA 1G9CA 3M8LA 1SCRA 2YY1A 5FO7B 1OQDA 5L19A 2Y60A 4IGOA 4FPGA 4NAOA 3VLBB 4CDXC 4F8AA 2RM21 2GC0A 4KBZA 3RSJA 2EIGA 2GN7A 4MGSA 1QHDA 5A3PA 3UYJA 2BERA 4X6RB 3T4HB 2JDNA 1ZZ8A 2VQAA 2VZVA 1HV1A 2J22A 2QQKA 4WBBA 3TN91 4CUAA 3E97A 4D6RA 4META 3GBGA 1UNBA 3IBMA 2DSXA 2UURA 2MEV3 2P37A 2WFF2 3VBRA 3N9MA 3O1VA 1CAWA 2D98A 2ZEXA 2PHRA 2AR6A 2EIEA 5FZ9A 1D2SA 2QFEA 3AK0A 3NAPB 4XQ4A 1GWLA 4CCDA 1A34A 1VMJA 2YC0A 1UOJA 3LOIA 4QU2A 2D40A 1R0GA 3GYDA 5T3NA 1RTVA 1OI6A 1T6GC 2OT7A 3UGGA 3GZEA 2B9VA 3HQUA 4XIOA 3ACFA 4CCLA 4K1ZA 2W68A 4CDUA 3BI3A 4S2DA 1IKPA 1H2KA 2UWAA 4IW3A 3FBMA 1KD7A 3HQXA 4P5HA 2Q8EA 4XF4A 4GJZA 3HWJA 2VNRA 3LDRA 4N8MA 1LHUA 2XKPA 3NAPC 3WDWA 5BV6A 3RZDL 5DDJ3 1VBB3 2BEOA 1ZBE3 4CCOA 1K3IA 4M3CA 3BB6A 4NWWA 3ZXFA 4C3HL 4CDXA 4TPUA 1HQNA 5FV3A 4XFIA 1V70A 2VOKA 1SDWA 2FZ2A 2ZGUA 3PIJA 3OSDA 4LHNA 1GOGA 1PZ9A 2E31A 4AFMA 3JB4C 2QUOA 1GZWA 1XYNA 4YZ2A 4H14A 5FP7A 3ES4A 4AQ2A 2G19A 2EAKA 4KWJA 5IK8A 1AF9A 4AI3A 1POV1 2R061 1DVBA 1V9U1 1ZA4A 3GZAA 4A3ZA 1MS3A 4EQVA 2E7QA 4Y4YA 4B7KA 1JOPA 3FZ3A 4KI5M 4RHV1 1NXGA 2M4VA 1L7RA 3ILFA 1EAH1 2VO5A 4RR3B 4HKWA 4EZHA 5C3EL 2VZPA 2WQ4A 2XHKA 4IEPA 2VMFA 4AQTA 5C6CA 3FBYA 3IDBB 1QOTA 4FQZA 1X82A 3N7MA 4UXAA 4JADA 1W8UA 1W2OA 4CP9B 3M3QA 3SISA 5A3UA 1S55A 5FY4A 2OYZA 2CGNA 3NAPA 4P9WA 4CU8A 4DFSA 1Z0HA 5H9RA 3HOXL 4FFHA 4Y1VA 1VBE3 2ZMKA 1FHMA 5CVRA 4XJWA 1VIWB 1ZRPA 3AXEA 4Q4Y1 5GM0A 3KSCA 2HLEA 2X5IB 5JIUA 4QPIC 1VBD3 2B4KA 1A8MA 3W5NA 2WBKA 2EVXA 4IETA 4TVMA 4CDQC 5D1IA 5IY0A 4MXWB 3OF1A 4LXLA 1HXS1 1A78A 5F5AA 3KYWA 1LU2A 4TTGA 4QX0A 3MBWA 2NVTL 5CKQA 5IAVA 4YGBA 4RFT0 1DQ0A 3MUZ1 4MSVA 4Q4X2 3TRSB 2W47A 2X5IC 4WVMB 1JMUB 4PDWB 3ENRA 1YUZA 3PNAA 2EXHA 5I0RA 4IEYA 4HL0A 1LAJA 1VZGA 5J37A 3AKTA 2IXIA 2HBTA 2JI2A 1LEDA 4KGQA 4XTPA 4JC1A 2EIDA 2JIGA 2W1WA 4UFLA 4GS7D 1GQGA 2I74A 1C28A 4FCAA 4PDWC 5DAWA 5FYUA 4M0NA 2X05A 1C8NA 3ZYPA 2VECA 1QU0A 2ILMA 2RS32 2ZOEB 1SEFA 3A0KA 1ND2A 3WZ1A 2JG9B 2JKXA 1NLQA 4RR3A 4A3LL 3B02A 3NV4A 4ZU5A 4BMBA 5J1XA 1RUD2 1CONA 3SEEA 1ULOA 4CXXA 3S15L 3MUY1 3SH3A 3R4DB 4HK8A 1O59A 4OCTA 4UYBA 1GFF2 4CUBA 1JODA 4MV2A 3B5LB 1B09A 3NV2A 4LMFA 4MXVA 2BVBA 2WNOA 4PLOA 3VHRA 3PUIA 4CP9A 1YWKA 1Z7S1 2VUJA 4XUOA 2G4IA 1N1YA 2X09A 3CNAA 3P6BA 5FQ0B 5K9YA 3OJBA 1WMXA 3LWPB 2E2JL 2JG9C 3PLQA 4GMP1 4Q4V1 4JDNA 3WNLA 4IL7A 3ON7A 1PZXA 4XETA 1HN0A 3H50A 4AEJA 4BQ4A 3PL5A 3DYMA 4YVWB 2NYYA 4AR4A 1K5MB 1Z92B 1FT9A 1OA2A 2QQNA 1YRZA 2W92A 3KGLA 3PUQA 4P14A 4CUCA 2V5YA 5FOBB 2P1BA 1R0JA 4AFCA 4D7TA 2TEPA 3ZM8A 3OPWA 1R1A2 1JU3A 3LQCA 4MXWA 4XJUA 3ROUA 3OEAA 3ZKUA 4AHXA 1SMMA 2IVIB 1UZVA 4CPBA 5GZFA 5I0DA 1DYOA 5FBZA 3V0AB 1J59A 3AL5A 5DM71 3DGTA 4FFIA 1PX4A 1XU1A 4WVMA 1CAVB 4YVWC 4ARYA 4AR5A 3CQOA 3MF6A 4J1XA 4KMQA 2ADDA 2E9QA 4XXAA 1RUH2 2PLV2 4HSJA 2XWBB 5FY5A 5GZDA 4K8FA 1X33A 3VKOA 2C26A 3AYEA 4DXRA 4E4ZA 5F5CA 1BKZA 5J09A 5IP9L 4OI1A 3I97A 5C4XL 2NLRA 1ODHA 5FP9A 2B45X 2A3YA 1JW6A 2WZPP 5T5OA 3I2HA 1UW8A 4FAHA 2PSMC 3UKVA 2AEZA 3AVSA 2W94A 3H1YA 3NNFA 5FREA 1IROA 3K4ZA 2BFUS 1NG0A 4YW2A 1H8TB 3KMHA 2Q0AA 1EYBA 1R091 2PN5A 3POFA 3Q8EA 3POJA 4A6OA 1QDOA 1SLAA 2VJXA 3LZZA 1NXD1 2NN8A 4UW4A 1RHI3 3RPQA 2MEV2 1FMD2 3FN9A 3ILNA 3ZXGA 4DEVA 3D5OA 4L97A 2QQPA 3APBA 2AC1A 4XURA 2YU9L 5B4XA 1WLTA 3GXUA 2VCBA 1BK1A 3OPZA 5FIXA 1AYM3 3VB9A 3HJYB 3WVJA 5LEJA 3GHNA 3S2HL 2XVGA 1J1TA 3G7DA 4XBQA 1RWDA 2WINB 4YVWA 4PBOA 3RFRA 1K5MA 2NZ9A 4COUA 3OGJA 2BPA2 2V5DA 5GLWA 3O1RA 2VNVA 4RL7A 1XSQA 3WF0A 1DGLA 3WT3A 5FYTA 5K2ME 2RV9A 2E2HL 1K45A 1TMF1 4JTOA 5IYYA 4W8JA 1JYVA 1Y43B 1O4TA 2YC4A 3J26N 4F83A 4QM8A 4UFIA 4XFHA 1SLIA 1NKGA 1C8M1 1VBB2 5FYBA 1ZBE2 3KF3A 3MW2A 3N9NA 1LU1A 1I6XA 1CAVA 4ONUA 3EJKA 4YW1A 4AZZA 1W6MA 3SEPA 3OPTA 3ZIXA 1R0FA 4QKBA 1RYTA 2R042 4Q4W3 4ZPIA 3H8RA 3HR9A 3TBDA 3K35A 1NXEA 4EWDA 3H0OA 1AZDA 5C71A 2HWB1 4QPYA 3CHXA 2JDMA 3RS6A 1NCQB 4NHLA 4TWTA 3TEWA 2R072 5I0SA 5EWSA 1V6LA 1CVNA 4AI0A 3HNBM 4COYA 4F3JA 3AJZA 4BISA 1FOD3 5LK7B 3ST7A 4NROA 3O1MA 4BY7L 1H8TA 4XJ8A 3Q8AA 5ACA1 2P4EA 5KXDA 5T5PA 3FHAA 4QDSA 5GZGA 4NE9A 3ATGA 1NCQC 5T52A 5IK5A 2HYKA 4IGQA 4QQHA 4A42A 5CB7A 1O7FA 3O7OA 4HBNA 3S5QA 3WF4A 1QWRA 4P9IA 1MPXA 2JDZA 3AVRA 3BTYA 1CPMA 3E5UA 4OHVA 1LODA 2WSUA 1UY1A 3FC0A 2BVVA 5FPVA 4MGYE 1JXNA 4PLNA 3T2OA 4IUGA 2FDFA 1DQ6A 2WN2A 1PIV3 4FP2A 1RUE3 2VCCA 5MGNA 1YQ8A 1YYNA 1V6NA 1C3HA 1R9TL 2Q4SA 2VY0A 4FT8A 4D69A 4AXOA 1JI6A 1CX4A 4LBOA 4L9BA 3MPBA 2CY6A 3TOJA 3ZFFB 1U0AA 1VBD2 4WV8A 1GOHA 2IUWA 2BRTA 4KQ7A 3KGZA 3U4XA 1OD5A 3SNMA 4EN0A 5FPAA 4HK9A 1KS4A 4PI2A 2WSVA 1KDKA 2JA6L 2J1RA 2OZ6A 5DAXA 5EV7A 3U75A 2HKXA 4JDOA 3OBRA 1HRV2 2P2KA 4KBBA 3T2PA 1S0EA 1NLRA 5E6HA 2QZ2A 5FLJA 2RS52 4FOYA 2NP0A 3LA2A 3GTKL 4GALA 4YYOA 1LJ7A 1RMU2 4GJYA 4GWIA 4YGDA 1GUIA 3J8F2 4Z82A 4OMDA 3T2TA 1COV1 1QJX2 2DFBA 4QU1A 5FZMA 2WNUC 2QBXA 4QHBA 2V0EA 1N1SA 3GTML 1PVC1 1UU5A 1NCQA 5K0UB 2ZGTA 2ATFA 2H6CA 3OGGA 3CIHA 4SBVA 2ZKLA 4CP2A 1SBDA 1W99A 5EZWA 5FZHA 5A7WB 5IHRA 5IWFA 1GQPA 3WP3A 4OVEA 2DTWA 3VZMA 2OA2A 4NIAA 1RYQA 3BKZA 2ETEA 4GIQA 5F8PA 3AP7A 4CUGA 5M5WL 1HXS3 1OFNA 1BCXA 5FXXA 4CCNA 3LKJA 4DXZA 3ACGA 4OI4A 4AE2A 4CCEA 1EUTA 1ASJ1 4I0AA 1OH3A 2LW8A 3T2QA 1CAUB 5KHHA 3I2JA 1QOOA 1RUC1 3LOBA 4ISQA 4MGZE 2FQPA 1BHGA 5J96B 1QJU1 3TNQA 2A1XA 1RB9A 2D44A 4HN0A 1QCVA 3M3IA 4AL9A 1F8VA 2NM1A 3N36A 3ZFFA 3PO2L 2QDNA 3AZZA 2VL4A 3N9QA 4XUTA 3RNSA 3RZKA 1CAXB 1N3QA 2YU1A 1KJRA 4RGAA 1VRH1 4AHZA 2BJSA 3AMMA 2X53S 3WCSA 5JSOA 1FNZA 1PM4A 3CLPA 2XQXA 3PJYA 3UKNA 4A3FL 4HMZA 1SFNA 2VH9A 3T1LA 5DZGA 2Y6GA 1AYN1 4FXKB 4XE9A 1W6NB 2WWUA 1D4M3 1QYBA 2TNFA 1AR61 1LHWA 1HKDA 2WR9A 2IXKA 4AG4A 2XOMA 2YHJA 2CTVA 2P6HA 3JQWA 1DQ1A 1Z7S3 2B42B 5K0UA 3C7FA 4LBMA 4LQRA 3GTGL 1QMJA 2P3YA 4ZY9A 2CKCA 1C1LA 1S2ZA 2J1AA 3VUOA 5B4NA 3ALQA 2PAMA 4RS5A 1AR83 2BNNA 5BNOC 1Y7BA 2XLGA 2PHUA 4KL1A 4OULA 2WS91 4OQ9A 3RWKX 3U1XA 1S2EA 4ASLA 2OXBA 3DXTA 3JU9A 3MIDA 2WJSA 3CL1A 1H2LA 1BZWA 5SV8A 4DUWA 5FJ8L 5M3ML 1Q8OA 1GNHA 1OHFA 1US3A 4QPGB 1XJAA 4EWAA 3KM5A 5JZGA 4N43B 1UIJA 1VAVA 1UY2A 2ZKNA 3VHOA 1LTEA 4XCBA 3WG4A 3ZOIA 1WWYA 1CAUA 3BTXA 2WQ8A 3TB0A 1MZEA 5EPAA 1OKOA 1D0GA 2B8MA 1MZ5A 1F31A 3AFGA 3C7EA 4NPRA 1QXRA 2TBVA 1GANA 4QPGC 1ZVFA 5FXWA 1FV2A 1DIWA 1IG3A 2WZR3 2YUEA 3MIHA 4N43C 3PVNA 5C7GA 5F3IA 2JE8A 1CAXA 5FXVA 4UF0B 1ONAA 1BEV1 2SLIA 3J7LA 2RM22 2XBO1 4YFZA 3VBOB 5LASA 3VZJA 4AI9A 4CDQA 4BM8A 4ZU7A 2XGXA 4Y3OA 1C4RA 4IE6A 5A7QA 3E5XA 2KXLA 3ZO0B 1ULEA 4A3KL 2OPKA 4GZ9A 3OTFA 5EP9A 4PF5A 3TN92 1XBFA 5DUUA 4NIDA 2WDBA 2Y0OA 4Y4RA 1JUHA 4ZXKA 3WW2A 1JTZX 2ZX0A 3BIWE 3NV3A 3VBOC 1TWAL 1SLCA 3OGRA 1GOFA 3WW3A 4BXSV 5IVEA 3I49A 3AJYA 1RITA 3BVCA 3PKJA 2VZTA 5DG2A 4MGIE 4YM0A 4DRRA 5KXBA 4R9BA 3WG1A 2CU5A 4XGHA 2GC1A 2WFF3 1GNYA 4LOTA 1VMFA 2DVAA 2D6NA 3I2OA 5ABJB 3C3VA 5C3OA 5J48A 1V6OA 5HV0A 1QJY1 4ATEA 3KZ4C 1L7LA 1IZ3A 4QPGA 1KGYA 4Y20B 3MDPA 3H0GL 1VLNA 4N9IA 1WCSA 2GNBA 4XQDA 3MFCA 4HVOA 4KH9A 1DBNA 2E7TA 2CYFA 4A3IL 4LUMA 4C3IL 2X29A 3AYDA 4KWUA 2XUEA 4GXLA 1JHNA 1LOGA 4CXWA 2VM9A 3QVDA 3OOXA 1URXA 4A6SA 2KKDA 4B8EA 4ES8A 5ABJC 1G9AA 4QD2A 4NPMA 1RUE2 1W03A 1TZOA 2VMEA 2XVLA 3WDTA 1FPN1 3ZXDA 4EN8B 1Q3EA 1WMFA 4DZGA 1YFWA 3J7Z1 3P3NA 3RI9A 3WG3A 2JJ6A 3RZGA 1LHVA 3NMBA 2P6CA 1YIPA 5A7OA 5C9AB 4UF0A 5FO8B 3LE0A 2R062 4ORFA 3HJRA 1V9U2 4QB2A 4Y1YA 5FZKA 3VBUB 3VBOA 3VPBE 3NJYA 3OUHA 1LTLA 1W39A 5FKBA 3S1ML 4XF3A 4RHV2 5EFUA 4QM9A 3AP5A 3USUB 4UFMA 1EAH2 2XKOA 3C2UA 4EYUA 5LCWL 4YARA 3M4OL 3Q9OA 1ULGA 4B4QA 1DGRN 5HBAA 4HVQA 3U4SA 5C9AC 4BQ5A 5ISLA 1QKQA 3VBUC 4FXGB 4QKFA 4EN9B 2DWRA 2ZGPA 4GWMA 4AW7A 2GP3A 4K8RB 3FLRA 3HBZA 3O0VA 5MFPA 4A4AA 3ZVXA 1QH7A 1LKMA 4S2HA 1RVF1 3KHCA 2UWBA 4XDQA 4KG0A 3RG0A 1TVGA 2AACA 3SITA 5LA0A 1ZYBA 2W0XA 4Q4Y2 2HEVF 2EXJA 3QD6A 1J3RA 4GA9A 1OQ1A 2YGMA 4A3JL 2VMIA 5FJKA 3IWZA 5ABJA 5CFDB 3FMGA 2LUWA 1G9DA 5L9BA 3KQRA 4Y20A 1R1ZA 1ZA7A 1HXS2 1LNSA 4YG6A 1Y1WL 3P2AA 1DHKB 2CAUA 4I3PA 1UY3A 3C8XA 3AKQA 3J4UH 4FBFA 1KITA 4IE7A 4YG0A 3PHMA 2CDOA 1NT0A 3GBFA 4Q26A 3SS2A 5IYBL 4BY1L 1F5FA 2GZWA 3PU3A 5FBJA 5L73A 5FZDA 5CFDC 1IPKA 5J36A 1AR93 1GZCA 5GAGc 2A6ZA 2ZMNA 5D21A 5A32B 2P5BA 2VZ3A 3POGA 5I0TA 5IVJA 1IU5A 5JDBA 4UFKA 2WLPA 1VJ2A 1N1TA 3HOVL 3ACIA 4A7YA 1CZSA 4I02A 1RUF1 1O91A 4CZSA 5C9AA 3W5MA 2W95A 4WVWA 5FZAA 2Z3QB 2VNGA 2PPTA 2XDVA 3AP9A 3VN4A 1VB4A 1AJOA 1OC1A 4LO5B 1Y1VL 2WO3A 3IZOA 2VUCA 2CR8A 3J7Y1 1C09A 3USUA 2BBAA 4LE3A 4MGQA 4CU9A 4ZZ8A 2XR4A 2ZHMA 1Q43A 4Y52L 2P3KA 3VZKA 5M3FL 4DXSA 1CZTA 4C1XA 4HN1A 4W6WA 2MNGA 3CO2A 3FL7A 5A33B 1DFQA 4AVSA 3O1TA 1ASJ3 2JDUA 2VCAA 1W6OB 2K46A 2ZGRA 4D94A 2RS33 4L92A 4Q0VA 1RUC3 4ITCA 2BGCA 1Z7S2 2D97A 4BU2A 3BTAA 1RUD3 3K4DA 1W0NA 2XL9A 3W59A 4Q4V2 1TWCL 2HH9A 3MW3A 4KGGA 4M01A 4PQQA 2AZ5A 4RA0A 1D7PM 1F2NA 4U36A 3OGVA 5EYXA 2IVJA 5JPNB 1X9PA 2BOJA 4BQ1A 5CFDA 2VBDA 4CRQA 3TEZA 3DYOA 4HXCA 1WCQA 5F2WA 2GH2A 4OQ8A 2LRPA 4QX8A 5LB6A 2AUYA 2IXJA 4OFGA 5KXCA 2R30A 5F2SA 3W58A 4YZ3A 5CBLA 1DYPA 4GWNA 1RC6A 2VMHA 4Q0SA 1GR3A 1OUSA 1UYYA 2ZGQA 4HANA 3OEBA 3AP6A 4YG3A 1YEWA 3U78A 2I45A 2DU1A 2E51A 5SV5A 4CDUB 1SCSA 3PTYA 4D0QA 1AR63 4AGGA 1B2OA 1DZQA 2PYTA 3WDVA 3E6BA 2IXLA 1S2BA 3VGIA 1W06A 1XPWA 3HEIA 1US2A 5I0UA 3UGHA 1C5IA 1I9RA 4LJHA 4RD7A 4AGRA 3PL0A 2ZGLA 4MHRA 4O7XA 2PMZP 1PGW1 5FUIA 3ME2A 2VMGA 2FMDA 1C5HA 1UO9A 3PUAA 5FXZA 4C1WA 4JRAA 3ZKYA 4CDUC 4Z2WA 3AMHA 5JXHA 1UZZA 1ZRFA 1LOBA 5M5XL 2RJKA 2WS93 1RUH3 2PLV3 4D7SA 1DGWX 3NRUA 4YM2A 3K75B 4X8PA 5ANQA 3N7KA 4E9KA 4UY81 1RJ8A 1QGLA 2EALA 1R092 4XBNA 3GALA 3UGFA 4BBRL 2VQ0A 4PIXA 4OI2A 3FLTA 5A33A 4YM1A 1EPWA 2RR11 1MZFA 2GMEA 1SLLA 1W6OA 1CIYA 4XCAA 1NE4A 4JGYA 1OPOA 4MYEA 2C6SA 2CWSA 5DXDA 4AR2A 2DVDA 1BBT1 1MZ6A 1S0JA 5I8TA 1H9PA 3KV4A 3POBA 4XYXA 2RDQA 4LIVA 2A69D 1SBFA 4R9CA 3BN6A 3LEMA 1KXGA 1IW7D 4PI0A 3KVBA 4FPHA 4L8QA 2HWF1 4H3WA 1D4VB 1FMD3 4NHKA 1Q8SA 3MIFA 1OKQA 2DBIA 4B3NA 1AHSA 1BEV3 2WIIB 5BNQA 4DUXA 4BK4A 4Z07A 3RZ6A 1TMF2 3AL6A 4D6QA 5JCTA 3IN9A 2VXRA 4I30A 4CTEA 3ZXAC 4PQ9A 3MSUA 2UU8A 2GNMA 1SACA 2BU9A 2ZABA 1C8M2 2HYXA 2B9UA 1GBGA 3D82A 3DYPA 3IM0A 4AEKA 4X6QB 5IAXA 1GZTA 2YV8A 2A68D 2GMGA 1Q56A 1UKGA 3IPVB 2VU9A 5E89A 4AHWA 3SXWA 3JD71 2WB1P 6RXNA 3DXUA 1ULDA 1OT5A 1V6KA 2WC2A 4LKSA 4E8CA 4XOGA 2VVDA 3F95A 1XU2A 2HWB2 1BJQA 2HWC1 4ZS2A 2ZGOA 2UY9A 4BQ2A 2VOTA 1Y9MA 4K20A 2XHNA 4E4DX 3USSA 1EV13 2R043 4O9GA 3WF2A 2ZEZA 4MADA 2VTXJ 4J25A 4BWOA 2PTMA 5T5JA 3FFQA 1XC6A 4AOCA 5IFTA 1DGWA 2ARBA 5ACA2 4C3JL 5FY7A 4XBLA 4QGMA 2P3IA 2R073 5FK7A 4Y1XA 4FPYA 2EIBA 4NAMA 1POQA 5FPBA 4JVAA 3OUIA 3BUCA 1VBA1 2A3WA 3MGUA 1PMIA 4AI1A 2HJIA 4QX7A 1GICA 1ND2B 2BBVA 3GCWA 2W9XA 4CEWA 5C33A 1HB1A 1CJDA 3POWA 5H1Sc 1XE8A 1G7YA 2E33A 3KT1A 4A45A 1YI9A 4A2UA 5LEKA 1S2KA 2BP6A 3PMSA 4OUMA 4ZHNA 1J83A 1HX6A 1LKNA 1W2TA 3AKSA 2A5ZA 2JIJA 1M06G 5BNNA 1ND2C 4RR3C 4E27A 5A3NA 2CGOA 1UU4A 5MLC3 1XE0A 3N35A 3RJ2X 5FP3A 1ZRIA 2IWGB 1WCUA 4E4HA 4Z92B 3IPVA 1JZ7A 2R7ZL 3NJVA 3I54A 3WQ1A 2LCQA 4FP3A 1DQ5A 4XFCA 4XZUG 4FSJA 3IU3I 1AR92 3LEIA 4YVSA 4SLIA 1COV2 3GTOL 4POGA 1IPJA 3RZTA 4WM8B 5IK4A 3N4MA 5MFZA 1JYNA 1UZ0A 2CWMA 1HRV3 1H0BA 1PVC2 5C3RA 1AL21 4CP0A 4FTBA 2RDSA 2ZHKA 3I3DA 4NVPA 4PIZA 3ORJA 3WG2A 1SPPA 3S16L 2RS53 2W91A 4QIWP 4Q27A 3O1OA 1GWMA 1W0OA 1RMU3 2Q30A 4YFWA 2C24A 3J8F3 2YFZA 1RDGA 4BLIA 5GLUA 1QJX3 2JENA 2ZGMA 2ARCA 2CV6A 4DOUA 1UXZA 2V3BB 1QXPA 5IJRA 3FDJA 5FOJB 2W39A 2ZX1A 4LORA 5F3CA 2ORZA 3KV5A 3H99A 5AN9H 1SFPA 5LBFA 4LLFA 2UY8A 1I3QL 1ASJ2 1E5HA 2PHWA 2XJRA 3L2YA 4W6XA 1PNGA 1RUC2 1MS9A 4LO7A 4UW6A 2HEYF 2ZHNA 1QJU2 2B5HA 4Y1UA 2JA5L 1REDA 3S57A 3S5AA 2ZGNA 2WA3A 1AX1A 3C7HA 4M3CE 2EXKA 1LECA 1O4YA 3MV01 4IV3B 3ZDSA 4C0HA 1HRI1 4CSWA 1YCIA 2J1EA 5EIOC 4PLMA 3VDDB 2QTWB 4GKXA 2GC3A 3D8CA 4RQPA 3T0DA 1ALYA 2JDYA 1MEC1 2V0FA 1RUJ1 2VUAA 1VRH2 2Q8DA 4XXPA 2APOB 3ZMOA 5GLVA 3MPSA 1R081 4IERA 3HKZP 1AYN2 4IV3C 1JOJA 1PMJX 5JWPA 2XJUA 4AVCA 2P3JA 1E57A 3VDDC 5IT6A 3LB9A 4B4PA 1QXJA 1AR62 1VALA 3LDBA 2JD9A 4WM8A 1S0CA 2WO7A 3WINE 5M0TA 4HT1T 3DPRB 5FLML 4CE8A 5JAXA 3U07A 3EQEA 1BQ9A 4XMIA 3S1RL 1U5ZA 4S2FA 2VUDA 3A0NA 4M4RA 1BQPA 1K5MC 1W6MB 2VOVA 1PMHX 2NVQL 4K21A 4GKYA 4OMCA 1TME1 4K9SA 2ET1A 4KG8A 1HB2A 4W6YA 1G9FA 2WS92 2Y6HA 3D0SA 2CHHA 3ECQA 4W65A 1FX5A 5D8AB 3H1MA 2JWPA 1H30A 4AEDA 2KM2A 3O1SA 3H3VM 2FDGA 3DPRC 5A6ZA 1NYWA 1YJKA 4RXNA 5A3MA 3ZXLA 5KXEA 1W6QB 4DO0A 1GV9A 2PA7A 5A70A 1U5XA 3Q8FA 4YWAA 3PWFA 4Q0UA 2MHFA 1UX7A 3ZLIA 2FD8A 5FYHA 5JXJA 2RDVA 3I7DA 1XOYA 2G9ZA 2O8OA 2YPJA 3H3ZA 4I01A 2VZOA 3THPA 4AAPA 2BZDA 2C0ZA 1S30A 3MZHA 2Y6FA 4H7LA 1GP6A 2XWJB 4IV1A 4J1WA 4IV3A 1XXNA 2ZX4A 3DECA 1H2MA 2WT2A 2AREA 3V65A 1NA1A 4LULA 5DABA 2RMU1 3VDDA 2OX0A 1W8TA 1HQWA 4ASMB 3W9AA 3KHBA 1Q8QA 1BEV2 1PO21 2DUPA 1H8TC 2XBO2 2DV9A 3MF9A 3WW1A 4DINB 3M2MA 2C1FA 1P7PA 2W46A 1CJPA 1PGSA 1NUKA 2PELA 4COZA 4D6SA 5KHKA 5FY0A 2IFRA 3M3EA 4QGNA 4W4ZA 2B5ID 3LWRB 4Z2AA 1W8NA 1GNZA 3FWEA 4GB31 5FZLA 5BY5A 4O65A 3S14L 3ZR5A 4HVRA 4IDZA 1UYXA 4WVZA 4OI0A 1N3PA 2RM23 5FY9A 3IMMA 1CAAA 2XONA 3FUQA 4JAAA 3LWOB 5IK7A 3AMPA 4JHTA 3T0BA 1IS5A 1SMUA 1APNA 2RHPA 3DPRA 4QHOA 5DUWA 4MHUA 3O0WA 2Q1ZB 5HPOA 3AM2A 4XABA 4OHZA 1POV0 3WQBA 1DQ2A 1OA3A 1YHFA 1RUG1 3MICA 2OPWA 2QQVA 4LK7A 3TN93 4BJ0A 3M3OA 5C70A 1UQXA 1TQ5A 2IC1A 2WAQP 2CGPA 1OF3A 1HJGA 2VW2A 5FWEA 2Z79A 3W21A 1EV12 5IYCL 1ZRRA 4K9FA 2HWF3 5AI2A 3KYUA 1W2NA 2JG8B 3AX4A 2DVFA 4P9XA 5D8AA 2ZX3A 3UL2A 4GH4B 3D4KA 3HN1A 5A7SA 4PHZA 4QQOA 2R92L 5FUNA 2JI1A 1QJY2 2YU2A 4LPLA 1JYWA 2IZWA 1W6QA 4IEZA 5AC91 3HN3A 4YW4A 3RZZA 3JR7A 3CJXA 3VKNA 2JECA 3LFMA 3VD3A 4ET7A 1ZBA1 2DTYA 4B1LA 1PZ8A 4E2SA 1HQLA 2E63A 2VOWA 2WYFA 4GH4C 4B29A 1RB8G 3JD73 3ZYBA 2RVAA 4YZ4A 3AXDA 4QKDA 5CKNA 2WT0A 1FPN2 2KD7A 4EV0A 4H2AA 1YC61 2DVBA 5FLHA 3WNOA 4HZFA 2QQJA 2RJLA 3ZFEA 2AGSA 4N7UA 5A1LA 1ZX5A 5AI3A 1UCXA 2YDEA 3GBWA 3H1WA 4BXFA 1SG3A 3JXSA 3B7MA 3RZHA 3FX3A 3IAPA 4YZ1A 1ZRCA 1K42A 3GCXA 5A3OA 1SMVA 3B94A 1POV3 2R063 1V9U3 2VBBA 2C6AA 1VBC1 2CL2A 2JKBA 1SFYA 2UWCA 1VBA3 5JR7B 5FZ8A 4RHV3 4A7ZA 5A7PA 1N1VA 4KWKA 1MR5A 4IE5A 3S2DL 1EAH3 1PX3A 1YLLA 3B00A 4JV4A 1B13A 2RE9A 3PTRB 3WSOA 1RVF2 3FE5A 3ZFFC 1NOVA 3GJAA 3Q8CA 2JG8A 2DYCA 1H9WA 5LY2A 4XF1A 4A44A 1AX0A 4F7ZA 3NW4A 2FDIA 1OF4A 1OVPA 4GH4A 3RYPA 2R1DA 1HW5A 1FXZA 4IEWA 2WT1A 2WNVB 3RZJA 2DUOA 3GTJL 4G3YC 3BTZA 1CN1A 3WF1A 1H4HA 4B4RA 1QJEA 2JE7A 1PO11 4LHKA 5FYIA 5GZCA 1NY71 4RS5B 2VW0A 4Q4Y3 2DBNA 4NWVA 1JS9A 2UYAA 4XC9A 2GSYA 1H2NA 4ZS3A 2WO2A 1W2AX 4GMP0 5LK5A 1VCXA 2D93A 2OZJA 2QZ3A 5K0UC 4BMEA 1XQNA 4NJ4A 4COWA 3O5SA 1RGSA 2W3JA 3T4VA 2E26A 3VKLA 2L0ZA 3VHPA 5J7MA 4BH9A 5JZGB 1X9TA 4RS5C 1UY0A 2D6MA 1IS3A 1BXHA 3WWNB 1RUF2 2QQOA 4FPLA 4TXWA 3CZJA 4YGCA 5AVPA 3RI8A 4DMIA 5FY1A 1HJFA 3HPNA 2L9LA 1FAYA 5F7UA 1YK4A 3NVCA 2O14A 2XVKA 5JZGC 1MVEA 1G86A 3SKVA 4DIQA 2R0FA 3MLKA 2B46X 3NKGA 5FRAA 4DXTA 2HWD1 4C8DA 1S0GA 2ORXA 3K4AA 1WA6X 4CDQB 2D5HA 1H4GA 3VZLA 1TWFL 3AP4A 1QJFA 3D0JA 4FPKA 2ZZJA 3THDA 3VKFC 1NQDA 3SCHA 5CFCB 3H8XA 1O3TA 3HNYM 3MYXA 2Q8CA 1VAMA 2RG4A 3SKJE 2DF7A 4NIGA 3QH7A 1HRI3 3KV6A 2PVEA 2PHXA 3VDCA 4G6BA 3HOYL 1MACA 1S0IA 2WNVA 4KU7A 4B1MA 2N7GA 4XW3A 5ANNA 5A7NA 5CISA 1KRIA 2CSGA 1MEC3 1QQP1 2JB8A 1RUJ3 2WN3A 3ELNA 4GMP3 4IEQA 4Q4V3 1DLCA 3EMRA 4M00A 1OWBA 4Y5Z0 5LATA 3BGAA 3ZPOA 4B7EA 1GU3A 2OUJA 3POEA 3CZUA 3ZSMA 1RYYA 1KJLA 4JX0A 4RYDA 3HAGA 1XNBA 2ZZQA 1MS8A 4XMAA 1O5UA 2VZRA 4PBPA 4BQXA 2J42A 2RFKB 5JVG1 1UPIA 1Y4WA 4WVVA 4FQ4A 3VDBA 2QQLA 1GZ9A 2YYOA 3VHNA 3MQKB 3O0XA 4LA2A 4FAGA 3URFA 2I07B 1XRUA 3ETQA 3KT4A 2PXJA 2WAAA 4HONA 3TWIA 2VD7A 3OBZA 3X29B 1PGW2 2YROA 1S0DA 2WFPA 2K2DA 1JZ5A 4NRQA 1HB4A 3I2GA 1OXCA 5APAA 2DCTA 2Y34A 4ZN3B 1H6XA 1ENQA 2ZCWA 1J84A 2A6WA 1Y3TA 4Y5TA 4BCUA 4I3GA 1X36A 1OMIA 4LHLA 5T55A 3IMNA 5FP8A 3IDAA 5FZCA 2XUMA 1I5ZA 2EXIA 3OG2A 3THCA 5C4WB 1RDVA 2WL1A 4L11A 3KT7A 4OZOA 4ZN1B 1DYKA 3MI8A 2RR12 1AXZA 1AR71 5DUXA 4XEZA 4P9JA 3DF0A 1O6UA 1BBT2 2XL7A 3AZWA 5FAXA 3RYRA 5IVYA 1R0IA 1N47A 1OOPB 4MX3A 4XQWA 3ZXEA 2D6OX 2D5FA 4D8MA 1R093 3R4UA 4MGTA 1W2UA 4A3BL 4E8DA 3PUSA 5CFCA 3KD4A 5BNPB 4D7YA 4YGEA 2O8QA 2JB4A 5C4WC 5KHGA 1F5JA 5FWJA 1UX6A 2HWF2 5DG1A 3AZYA 1TNFA 1YIFA 2YPDA 4OYUA 1VP6A 2V09A 4MZUA 4ZU4A 2PVXA 3ZXKA 2QVSB 1PO23 3V56A 1MS5A 1O3QA 4IEOA 5DM61 2NVYL 1YFYA 2EY4E 4RFRB 3ASIA 3HNMA 2FDHA 4QDQA 3GZUC 2QL0A 1OPMA 5BNPC 2QQIA 1V6JA 1DF0A 3ACLA 1O5LA 4DS0A 2LALA 3CBNA 1V6MA 1LENA 3H7YA 3ILRA 3QOPA 4CVUA 1T9PA 3JD72 1TMF3 3DN7A 2ZX2A 5B2GB 5FPLA 2ERJA 5DQ0A 2J7MA 2KR2A 3EO6A 4CEYA 1F4AA 3BCWA 2HWC2 1C8M3 1VR3A 4XVHA 1BE7A 1RUG3 1WW7A 5DDJ1 1DP0A 2Z3RB 1I6HL 1S24A 2H0BA 3I3QA 2X10A 4LBKA 1PK6B 3AYCA 3LWCA 3J9SA 3M4FA 3RMYA 5K8SA 5JPMB 3WNXA 2R6QA 4XUPA 5DAVA 1JUIA 2HWB3 5H9PA 1MQTB 4R9AA 2JE9A 5L36A 4N90A 1IQAA 1RXGA 5C4WA 5AC93 5CNAA 2B63L 1XSRA 3BOWA 4XAEA 2LTNA 2DVGA 2Y8KA 5FMBA 5C3QA 1ZBA3 1AXKA 1PK6C 3QCWA 1CR7A 2WZ8A 1YQ6A 1VBA2 3AMNA 4GQ7A 4K3UA 4CU7A 3E5QA 3VD7A 1OOPA 2E7AA 5FYSA 4YZ5A 4AVVA 5ACA3 2F4LA 1MQTC 5HCHA 2X8KA 4EZ4A 5A80A 1UD1A 4EJRA 3RZMA 3PKIA 3TEXA 5BNPA 4ASKA 1CGPA 1X8EA 3SHRA 1W8ZA 4I0WB 4AAXA 5F37A 1YV1A 1Y9QA 1BMV1 4MO3M 1LHOA 3KLSA 3I3BA 3PVBB 1DU3D 1WW5A 2FBEA 3D3AA 4LK6A 4LR4A 4IQPA 4V2VA 5FFOC 3I2KA 4DQAA 4LBJA 1LCLA 5G05L 4LKDA 1SFOL 1STMA 3POSA 3SCFA 4K6BA 2WYSA 2BE5D 1IHMA 4K7JA 4U671 2JA8L 2ADEA 1VBE1 4HPKB 4PT6A 1WCML 3KYXA 3ZSJA 5GAEc 3ZX7A 3EB7A 2YFUA 4JHZA 4W50A 4HLTA 3T1MA 1EUUA 2VZ1A 1QJZA 3MIBA 1LOFC 3WEZA 1E8JA 3ZN6A 3IDEA 1LB2A 2G1MA 2CNAA 2VXJA 4AFBA 1RUOA 1I5PA 3H97A 1NCRB 4QKNA 3V64A 2OW4A 5IVVA 4CYDA 1XNDA 1UAIA 3LIGA 4HKOA 3VDAA 3E6DA 2F4PA 4L2NA 4MGKE 1SHWB 4A3XA 1AL22 3LWVB 2A6ED 4IXLA 4Y24A 3ZYRA 4A3DL 4LKEA 4XUNA 5FO9B 3CF6E 4G9SB 5IVFA 3B9CA 1J3PA 1PK6A 3KCCA 3LF7A 1ZNPA 1ZZBA 4I09A 2D3RA 4LHSA 1RINA 2AUSB 1COV3 1QY4A 2WLQA 1YI7A 3WDYA 3ZIWA 1JZ3A 1PGL1 1MQTA 5KC6A 1PVC3 4Q8LA 3RWNA 3VD4A 2UYBA 4BXXL 2VVEA 3FJSA 2JDPA 1FYUA 3UESA 1SLBA 2WKKA 5LA2A 3M1HA 2WA4A 4BHPA 4JAFA 3IIAA 3PIP1 3BOPA 2XLAA 3C7GA 2Z4FA 3H8UA 4MUVA 4QB6A 5F3EA 1F35A 2D7FA 5J98B 3ACHA 1HIXA 1LGBA 5FZOA 1IOAA 5FR3A 3MHZA 2LROA 3I2IA 1YQCA 4AFDA 1F4HA 1ULFA 4MOAA 3ZYIB 2VTXA 1WBFA 5IATA 3PIGA 4Y5SA 4FFGA 5E88A 1HRI2 1LOFA 4LA3A 4V2WA 5F3GA 3AZVA 3NJXA 4JGYB 4DPNA 2A7AA 1MS0A 4C91A 5F5QA 3S1NL 1PHMA 1RUI1 1MVQA 1MEC2 1QJU3 3PUHA 4Y22B 1RUJ2 2SBAA 1HLCA 3WY6A 2H12A 1EPZA 5A6XA 3A23A 1RL3A 2PFWA 4HPKA 5L7OB 1R082 5I8SA 5CEHA 2ZEWA 4UW3A 2W5FA 2JD4A 5JUVA 2G9FA 2Y38A 4XHXA 1OUXA 1UOGA 4JGYC 5J3UA 1REEA 2HWD3 3IKWA 4M0HA 3RQ0A 1DDLA 1YJLA 3QLQA 4Q29A 2FCUA 3GM8A 1NCRA 2CAVA 5FMCA 4IGPA 3SH5A 1VRH3 2ZAHA 2VZUA 3MIGA 1QQTA 5EJZB 3KYVA 2YG0A 1KFUL 3PURA 1PVXA 2QCSB 1TWHL 2DDUA 4AR6A 1AYN3 3I2FA 3Q8BA 4QX3A 5L7OC 5GKAC 4LBLA 3DEMA 4IESA 3NV1A 4POFA 3BPZA 4KWLA 4LE4A 5BYNA 2A70A 5HI0A 4AGVA 1TME2 2C4XA 3S6PA 1E5IA 1QNWA 1XNCA 3RJRA 4AYUA 1ZZ7A 5IP7L 3MIEA 2NMOA 1QDCA 3W20A 3K48A 4RN5A 1WW6A 2DCZA 1W04A 4LO8A 5EXOA 3VBHA 5DN2A 4XXBB 1WZXA 3VL9A 2FHRA 5JI7A 5JOYA 3N9PA 5DAPA 2Y0SP 2OUHA 4FVVA 1ZREA 3RRDA 1IS4A 4QGLA 4HSLA 4JQRA 3MLLA 5FP4A 2JEMA 2R49A 2O5JD 1JYTA 1OWCA 1W9WA 3FFZA 4XFGA 4YRDA 4BE3A 3D6EA 5IUQA 1JZ2A 1G6NA 2ENRA 3NWKA 1HN1A 4GULA 3RYGA 3H42B 3VD9A 1JBCA 1ULPA 5FZIA 4PF1A 1DLLA 1QOSA 2HWE1 4QDRA 1UN1A 4YW6A 1RHI1 2RMU2 3VD5A 1JZ8A 1XB9A 1ENSA 1SLTA 3KQ4B 4XJ9A 5KBFA 1E5RA 1PO22 3ETPA 4Y22A 5F6KA 3JBG1 4A41A 4CEWB 3UJQA 3PMEA 1U5YA 5LWBA 3VL8A 5L7OA 1AYM1 5CU1A 2WO1A 3B69A 3FHIB 3WQ0A 2IXHA 4JZRA 2HVYC 2Q1FA 4UW5A 4GD4A 1PM7A 3SQOA 2BWAA 1SBEA 3BU7A 1OFSA 3NSTA 4GB32 2QDRA 4LIUA 1YQ5A 2O1QA 4BBSL 2OS2A 2A71A 2XBO3 3LWQB 1AR73 4Q5OA 3WP5A 5BNNB 1ODNA 4URTA 1O4ZA 4E2QA 1TEIA 4CEWC 2HEWF 5FMOS 4Q8KA 4QX1A 4IEXA 5I8YA 5EHDA 1WKYA 1RUG2 1JYCA 3UT0A 2FMYA 4AF9A 4R8HA 1KS5A 3M3YL 5FMOL 2VULA 4TLGA 2YC2A 3GGLA 4BOWA 3I59A 4YVSB 1WD3A 3EBRA 4Q4W1 5BNNC 3M70A 4I2OA 3J7MA 5KC5A 1A3KA 4CCCA 2VTFA 2XMLA 5CIRA 4CP1A 3TEYA 2RDNA 5F1RA 5F9TA 3AB0A 4WM7B 3LD8A 5AC92 1SPPB 4AEMA 4XACA 3S17L 1JOBA 1C1FA 2LS6A 4M3CF 1LOAA 2XJQA 2JX9A 4JRLA 4OUSA 1ZBA2 4XDPA 3O1PA 1WCDJ 2YB7A 4WZCA 4XFFA 1AUYA 4YVSC 2WWJA 1BFYA 1FOD1 1QJY3 5ERLA 3UNPA 4TN7A 5F6LB 4MG2A 1D2QA 2G9GA
chains in the Genus database with same CATH topology
1DX8A 1H1IA 4WM7C 5K7PA 4JCKA 5LRRA 1JYBA 1O3SA 2K9ZA 3WDXA 3KCXA 5JLVA 1AXYA 4QT6A 4HKLA 3TYJA 1XNKA 2Y26A 2M6PA 1FPN3 3B0AB 1PIV1 3OD0A 5HCFA 5T50A 1RUE1 4XFAA 4NN0A 4XIKA 1W0PA 2DCKA 3N3HA 4QQ2A 2GN3A 2YXSA 5GADc 5JVH1 4RQPB 4XTMA 3EHKA 1VBC2 5CG9A 3AYAA 1WGPA 3HT1A 1UKRA 1OQEA 5HXVA 4AI2A 2XJSA 1VAKA 3LGRA 5DUVA 3AZXA 3LNLA 4RQPC 4R4XA 4QPIB 2YGLA 3CEWA 3BALA 3JCIA 4WM7A 2Z2SB 2PQQA 2VG9A 1RVF3 4LUKA 1PO12 4BIFA 1HDKA 1NY72 4QQPA 1JH5A 4YWLA 4NO4A 5EJ3A 3ZYGA 2D43A 1JN2P 3HMYA 4WM8C 4AEDB 1G8WA 4BIOA 1UMZA 4YNIA 2D6PA 5C8CB 4EROA 4LNVA 4QXKA 4N53B 3AMQA 3WQ7A 2D3SA 2Y0IA 1QH6A 4XILA 1ZRDA 1YXWA 5TSWA 1LOEA 4AEDC 2BNMA 2H0VA 4OZXA 2K0GA 1WW4A 4TSVA 5C8CC 2BYVE 4IV1B 1M06G 3H9AA 5FTTC 1WJVA 3I8TA 3ZN5A 4N53C 2XB6C 1RUF3 1I1EA 1NA1B 1REFA 1KDMA 2ZHLA 2W52A 2HWD2 5AFEA 3M7AA 1BVVA 1BQ8A 2GAUA 2EF6A 5JSRA 3THTA 2RS11 2GALA 1J58A 2ES3A 4IV1C 1AJKA 4FTEA 4LT5A 5I93A 3JUUA 1NA1C 5E1RA 1LULA 4KNCA 1D4M1 3WHUA 1YK5A 4QPIA 3ZN4A 7RXNA 4C0BA 3QBQA 4IEUA 1JYIA 4LBQD 1LHNA 1RUI3 1QQP2 4K40A 5E8AA 1S0BA 3VV1A 3LAGA 4MLOA 4DRVA 3LSEA 2ZMLA 2XJVA 4YW3A 1AR81 3AFKA 1VZIA 1BVP1 2X5IA 1WLWA 4R9DA 1H7VA 5C8CA 1RJ7A 3GHMA 3NL1A 3MFAA 1ZZ6A 2OIIA 1ULCA 4N53A 4AR3A 1HV0A 3U11A 3MW4A 3B01A 4TLFA 2ERSA 5D8AC 4YSFA 1CD3G 4PDWA 3E6CC 3EXUA 2VGDA 3P3PA 5JVVA 4J6GA 4D3WA 3I4IA 1OA4A 2C5DA 3UJOA 4CDWB 4FPEA 2B7YA 2GU9A 3ZFEB 2AH2A 2PAKA 2WZR1 3U10A 2D6LX 1IRNA 2VOXA 3OCPA 2H6BA 1AR72 1F9KA 3JZVA 4COVA 3WLUA 5JI9A 4XF9A 3O12A 3A44A 2JG9A 4CDWC 2DUQA 2GNTA 1ZM1A 3ZFEC 2EA7A 3JQXA 4DB5A 5JOXA 4BLJA 2RR13 2HWE3 2ZS6B 3RDIA 3KB5A 3U0ZA 4Q1PA 2BFUL 1BBT3 4HFSA 1GYKA 3KYYA 3SH4A 2DU0A 3MEPA 2ARXA 2GH8A 2R1BA 3JBG3 4JAEA 1LEMA 2EAAA 2QKDA 2R0HA 3WX5A 5FQ0A 4ES9A 2KN9A 4YWMA 5GAHc 4UBGA 3L9JT 4OHWA 5GALA 2ET7A 2WFF1 3B3QE 4EWEA 5CAZA 1A8DA 2A6XA 4Y26A 1ND3B 3H7JA 1XYPA 5GJ6A 3V0AA 1U5IA 4FPJA 3UV9A 4Q1RA 3V0BB 2JG8C 2Z42A 5DDJ2 1FV3A 4P9GA 1FHHA 3ZPYA 3S0MA 1VB2A 4OLLA 3JB8A 3R0RA 4P9YA 1WLCA 1ND3C 4MVTA 2XPJA 4CDWA 2HWC3 2ZBJA 3FUOA 5GLTA 1H1MA 4NR1A 4ZKTB 3LSDA 1GSLA 2BNOA 1LKOA 1ZZCA 2B39A 3K51A 1W6PB 4MH0E 2FZ1A 4QQLA 3S7IA 4PIYA 2GDFA 4QMAA 5JIAA 4UBHA 4XF0A 1YFXA 5EYYA 2PHFA 2WQZC 1BMV2 2P17A 4LLOA 3R05A 4LO4B 1V00A 2XJPA 3IT8A 4RSUA 1FI2A 4YM3A 2XLFA 2BTVC 2ERFA 4XPVA 2BUKA 1VBE2 1QF3A 5BUVA 1UZYA 3WWLA 1DZRA 4QX5A 2BW8A 3QACA 3LPEB 3LCPA 1WLDA 1WCKA 4YW5A 1ND3A 5H9SA 5FCCA 2AENA 2QE3A 2WNUB 2NMNA 1RUNA 4ATFA 2J9UB 3V0BA 5I91A 1S0FA 3WCRA 5JOZA 1X50A 3VBFB 1WMDA 1CIWA 2DFCA 2WNVC 3P8BA 2JICA 5T54A 1AR91 1PGL2 3N7LA 4H55A 2NPIA 4Z8BA 4R52A 1AL23 4X8NA 4N7IA 4Q4X1 4AWDA 4LEJA 1X8MA 3DUIA 1W6PA 2IXCA 3R4SA 3VBFC 4V1PA 3ZG6A 1CESA 4JTNA 3VZNA 3WP4A 3ES1A 1N3OA 3L2HA 1WUVA 2ZJCA 2ZTNA 2BQPA 3ZMNA 2NYDA 5CG8A 4H7MA 1MS4A 3DKWA 2HR5A 1C57A 2DCJA 4DY3A 5GLZA 2VVFA 3S30A 2RS31 1RUI2 2A75A 3UKTA 2IFWA 5GZEA 3HD8B 5KHIA 2YZ4A 3BODA 3KCYA 1RUD1 1YO8A 3GF6A 5A3LA 2PAEA 2GC2A 4FO9A 1LRHA 5C8WA 4AVAA 3AKPA 1YUDA 5T5LA 4XZPA 5CADA 3NFPI 3SLIA 5E16A 3OD4A 3ZFGB 1M4WA 5JOWA 2WNUA 2RS13 5CFCC 1R083 1EY2A 4LBQB 4K1YA 3HIFA 2VW1A 1XE7A 1KFXL 2Z5WA 3ZYJB 3VBFA 3WUCA 4WZFA 4AQ6A 5BNOB 3PIO1 2A73B 4INDA 1R1A1 4NOTA 2R16A 3ZFGC 8RXNA 4G4FA 4LBNA 4CEYB 2V73A 3PJQA 3INAA 2C6BA 3LA7A 1B71A 2AYJA 2XJTA 1KQRA 3PZAA 1TME3 2TUNA 2JXAA 2Z69A 2ZGSA 2A6HD 4JAGA 1RUH1 2PLV1 1IU6A 4IEVA 1NZCA 4CEYC 2LM3A 3ZSKA 1D0HA 3N7JA 1AVBA 2HWE2 3HT2A 4P9LA 1RHI2 1NE6A 2MS3A 3B08B 3H3UA 1OLRA 2PHDA 3JBG2 3WUDA 1OLQA 3NO8A 4AFAA 5EINC 4A7KA 1AYM2 3NKTA 3WW4A 2I2SA 1I3HA 2DCYA 1V6IA 5HCBA 4C90A 1GKBA 2PHTA 2M6OA 3R6SA 2RMU3 1NQJA 3PVEA 2MEV1 1FMD1 4NHMA 5BXXA 1Z78A 3IDCB 2PYAA 1OOPC 1H1AA 3ZFGA 3S7EA 5HCAA 1QNYA 2A3XA 1NNQA 4OHYA 3WOGA 4LBQA 4HETA 2R32A 1UF2C 4GB33 1LGNA 4XJAA 1EP0A 1W6NA 3ZN6B 4KU8A 5BNOA 5KWRA 4Q4W2 4AHYA 2MPFA 2K2SA 1VBB1 1ZBE1 2D6KA 5BPXA 2ZA9A 3B9IA 5JSPA 4S2GA 3KS7A 3CU7A 1YFUA 3WP6A 1EV11 1SMWA 2R041 2VPVA 4FOWA 3WV6A 2QJVA 3WD5A 1FOD2 2P34A 3QH6A 1S1AA 4BZ4A 4N9HA 4Q0PA 3ZSLA 3G6JB 1G9BA 2PHLA 2R071 3VKMA 3GZTB 4N43A 1IGOA 3ZXJA 4XJZA 1LOCA 1CQ9A 3OY8B 4WFN1 1YUXA 1PIV2 4EN6B 5FLIA 3WXPA 4FOQA 3OYWB 4LTAA 1GQHA 2YMZA 4TYSA 3PVOA 3WHTA 3B93A 2A6YA 4FTSA 3CJIB 3FLPA 4DY5A 4E2GA 1CADA 2JI3A 1J1LA 3A4UA 4I0BA 2C9AA 2OVUA 2W08A 5JMCA 3NJZA 3TNPB 1B35B 5MF6A 3DL3A 4Z1VA 1WBLA 2ZIXA 1VBD1 3QQCE 4RGGA 5DZEA 1O3RA 1VBC3 1DG6A 1U12A 1GLHA 2VNOA 3CJIC 1LKPA 1NXMA 4V196 1J3QA 1NLSA 2O0OA 1HRV1 1LR5A 1UU6A 1Q8VA 1B35C 2RS51 2GMMA 3WR0A 1PNFA 4AVBA 1RMU1 3RMXA 2ZPXA 4E4SA 4LO6B 4TZDA 3J8F1 1NCRC 2Q8OA 1QJX1 4ME3A 2ZAAA 4R4ZA 4JGZB 1DZTA 4Y1ZA 1X7NA 3VBHB 3OBTA 4E6YA 3I2DA 3POYA 1PO13 1WA4A 3DV8A 2NQYA 3MPPG 2VL6A 2Q5TA 4PCRA 5FDBA 1UPSA 3VZOA 3WDUA 1FATA 1UL9A 1OSGA 4Q0QA 2ZGKA 1L3JA 2Q1MA 1VZHA 1DQ4A 3OY8A 1T9OA 1ENXA 4OHXA 2WWSA 5FPXA 4JGZC 3VBHC 3SCGA 1PZ7A 3VBSB 1IKQA 2GNDA 2CKAA 1BYHA 3OYWA 4Q2FA 2WNEA 4Q4X3 4AK3A 1AX2A 5CA6A 4DNYA 2BWCA 1UIKA 1R0HA 3VBUA 3CJIA 4YLZA 1TNRA 2XH6A 4BPZA 2E6VA 1MS1A 1YNAA 2RS12 3VBSC 5AFBA 4BYYA 1B35A 1DGRA 1ENRA 4U2AA 1BRFA 1D4M2 1Q8PA 1WMEA 3AKRA 1RIRA 2E53A 4XFBA 2M4YA 1TE1B 4FPCA 1LGCA 4FPOB 2D3PA 3RYKA 1XYOA 2A6VA 2QNKA 5RXNA 3SMHA 1WD4A 5KHJA 4AVTA 1T9QA 1AR82 3I59B 3TAYA 5AVAA 1Q5OA 4JGZA 3VBRB 1QQP3 1CAWB 1IS6A 4PJYA 1FNYA 4AI8A 4JDMA 4FPFA 2F6BA 4L99A 2KA3A 3O14A 4FOVA 2XG3A 1LESA 3VBRC 1R1A3 1ZZ9A 3VBSA 4AQSA 5A32A 2AYHA 5DZFA 2ZACA 1SQ4A 3M3CA 2WZR2 3GNEA 4M3CB 5H9QA 1B2JA 2GMPA 4CDXB 4EN7B 1AL0G 3UK9A 3MLJA 5FPZA 1CPNA 4B8CD 2DURA 4XHBA 1A6CA 1H8VA 4ISRA 3LA3A 1GZWB 4O9EA 1G9CA 3M8LA 1SCRA 2YY1A 5FO7B 1OQDA 5L19A 4FPGA 3VLBB 4CDXC 4F8AA 2RM21 2GC0A 3RSJA 2EIGA 2GN7A 1QHDA 4X6RB 1ZZ8A 2VQAA 4WBBA 1HV1A 3TN91 3E97A 4META 3GBGA 3IBMA 2DSXA 2UURA 2MEV3 2P37A 2WFF2 3VBRA 1CAWA 2D98A 2PHRA 2AR6A 1D2SA 2QFEA 3AK0A 3NAPB 4XQ4A 2YC0A 3LOIA 4QU2A 2D40A 1R0GA 3GYDA 5T3NA 1RTVA 1OI6A 1T6GC 4XIOA 4CDUA 4K1ZA 2W68A 4S2DA 1IKPA 1H2KA 2UWAA 3FBMA 1KD7A 3HQXA 4P5HA 4XF4A 3HWJA 2VNRA 1LHUA 2XKPA 3NAPC 3WDWA 5BV6A 5DDJ3 1VBB3 2BEOA 1ZBE3 4NWWA 4M3CA 3BB6A 3ZXFA 4CDXA 4TPUA 1HQNA 4XFIA 1V70A 2VOKA 1SDWA 2FZ2A 2ZGUA 4LHNA 1PZ9A 4AFMA 3JB4C 2QUOA 1GZWA 1XYNA 4YZ2A 4H14A 3ES4A 4AQ2A 5IK8A 2EAKA 4KWJA 1AF9A 4AI3A 1POV1 2R061 1DVBA 1V9U1 1ZA4A 3GZAA 1MS3A 2E7QA 4Y4YA 4B7KA 3FZ3A 4RHV1 1NXGA 2M4VA 3ILFA 1EAH1 4RR3B 4HKWA 2WQ4A 2XHKA 4IEPA 4AQTA 5C6CA 3FBYA 3IDBB 1QOTA 4FQZA 1X82A 3N7MA 4UXAA 4JADA 3M3QA 3SISA 1S55A 2OYZA 2CGNA 3NAPA 4P9WA 4DFSA 1Z0HA 5H9RA 4Y1VA 1VBE3 2ZMKA 1FHMA 5CVRA 4XJWA 1VIWB 1ZRPA 3AXEA 4Q4Y1 5GM0A 3KSCA 2X5IB 5JIUA 4QPIC 1VBD3 1A8MA 2EVXA 4IETA 4TVMA 5D1IA 5IY0A 4MXWB 3OF1A 1HXS1 1A78A 3KYWA 1LU2A 4YGBA 4RFT0 1DQ0A 4MSVA 4Q4X2 3TRSB 2X5IC 4WVMB 4PDWB 3ENRA 1YUZA 3PNAA 2EXHA 5I0RA 4IEYA 4HL0A 1VZGA 5J37A 3AKTA 2IXIA 2JI2A 1LEDA 4KGQA 4XTPA 4JC1A 4GS7D 1GQGA 2I74A 1C28A 4FCAA 4PDWC 4M0NA 1C8NA 3ZYPA 2VECA 1QU0A 2ILMA 2RS32 2ZOEB 1SEFA 3A0KA 1ND2A 3WZ1A 2JG9B 4RR3A 4ZU5A 3B02A 3NV4A 4BMBA 1RUD2 1CONA 3SH3A 3R4DB 4HK8A 1GFF2 4MV2A 3B5LB 1B09A 3NV2A 4MXVA 2BVBA 4PLOA 3VHRA 1YWKA 1Z7S1 2VUJA 2G4IA 1N1YA 5K9YA 3CNAA 5FQ0B 3OJBA 2JG9C 3PLQA 4GMP1 4Q4V1 4JDNA 4IL7A 4XETA 3H50A 4AEJA 4YVWB 2NYYA 4AR4A 1K5MB 1Z92B 1FT9A 1OA2A 3KGLA 1YRZA 5FOBB 4P14A 2V5YA 1R0JA 4AFCA 4D7TA 2TEPA 1R1A2 4MXWA 4XJUA 3ROUA 4AHXA 1SMMA 1J59A 3V0AB 5GZFA 5FBZA 5DM71 3DGTA 1XU1A 4WVMA 1CAVB 4YVWC 4AR5A 3MF6A 4J1XA 2E9QA 4XXAA 1RUH2 2PLV2 4HSJA 2XWBB 5GZDA 4K8FA 1X33A 3VKOA 4E4ZA 3AYEA 1BKZA 5J09A 4OI1A 2NLRA 1ODHA 2B45X 2A3YA 1JW6A 2WZPP 5T5OA 1UW8A 4FAHA 2PSMC 3UKVA 5FREA 3H1YA 1IROA 4YW2A 2BFUS 1NG0A 1H8TB 3KMHA 2Q0AA 1EYBA 1R091 2PN5A 1QDOA 1SLAA 3LZZA 1NXD1 2NN8A 4UW4A 1RHI3 3RPQA 2MEV2 1FMD2 3ILNA 3ZXGA 3D5OA 4L97A 2QQPA 3APBA 1WLTA 1BK1A 3OPZA 1AYM3 3WVJA 5LEJA 3GHNA 2XVGA 1J1TA 3G7DA 4XBQA 1RWDA 2WINB 4YVWA 4PBOA 1K5MA 2NZ9A 4COUA 3OGJA 2BPA2 5GLWA 4RL7A 3WT3A 1DGLA 5K2ME 1TMF1 4JTOA 1Y43B 1O4TA 3J26N 4F83A 4QM8A 4XFHA 1SLIA 1VBB2 1C8M1 1ZBE2 3MW2A 4YW1A 4ONUA 1LU1A 1I6XA 1CAVA 3EJKA 1W6MA 3ZIXA 1R0FA 1RYTA 2R042 4Q4W3 3HR9A 3TBDA 3K35A 1NXEA 4EWDA 3H0OA 1AZDA 2HWB1 4QPYA 3RS6A 1NCQB 4NHLA 4TWTA 2R072 5I0SA 5EWSA 1V6LA 1CVNA 4AI0A 4COYA 4F3JA 3AJZA 1FOD3 5LK7B 3ST7A 4XJ8A 1H8TA 5KXDA 5ACA1 5T5PA 5GZGA 3ATGA 1NCQC 5T52A 5IK5A 2HYKA 4QQHA 5CB7A 1O7FA 3O7OA 4HBNA 1QWRA 4P9IA 2JDZA 1CPMA 3E5UA 4OHVA 1LODA 2WSUA 3FC0A 2BVVA 4MGYE 1JXNA 4PLNA 1DQ6A 1PIV3 4FP2A 1RUE3 5MGNA 1YYNA 1V6NA 1C3HA 2Q4SA 2VY0A 4FT8A 4D69A 4AXOA 1CX4A 4LBOA 4L9BA 3MPBA 2CY6A 3TOJA 3ZFFB 1U0AA 1VBD2 4WV8A 4KQ7A 3KGZA 3U4XA 1OD5A 3SNMA 4EN0A 4HK9A 1KS4A 2WSVA 1KDKA 2OZ6A 5EV7A 2HKXA 4JDOA 3OBRA 1HRV2 2P2KA 4KBBA 1S0EA 1NLRA 2QZ2A 5FLJA 2RS52 4FOYA 2NP0A 3LA2A 4GALA 4YYOA 1LJ7A 1RMU2 4YGDA 3J8F2 4Z82A 3T2TA 1COV1 1QJX2 2DFBA 2WNUC 4QHBA 2V0EA 1N1SA 1PVC1 1UU5A 1NCQA 5K0UB 2ZGTA 2ATFA 2H6CA 3OGGA 4SBVA 2ZKLA 4CP2A 1SBDA 5EZWA 3WP3A 4OVEA 2DTWA 3VZMA 2OA2A 1RYQA 2ETEA 4GIQA 3AP7A 1HXS3 1OFNA 1BCXA 3LKJA 4OI4A 4AE2A 1ASJ1 4I0AA 1CAUB 5KHHA 3LOBA 1QOOA 1RUC1 4ISQA 4MGZE 2FQPA 5J96B 1QJU1 3TNQA 1RB9A 2D44A 4HN0A 1QCVA 3M3IA 1F8VA 2NM1A 3N36A 3ZFFA 2QDNA 3RNSA 3AZZA 1CAXB 1N3QA 1KJRA 4RGAA 1VRH1 4AHZA 3AMMA 2X53S 3WCSA 5JSOA 1FNZA 3CLPA 3PJYA 3UKNA 4HMZA 3T1LA 1SFNA 2VH9A 5DZGA 4FXKB 1AYN1 1W6NB 1D4M3 1QYBA 2TNFA 1AR61 1LHWA 1HKDA 2IXKA 4AG4A 2YHJA 2CTVA 3JQWA 1DQ1A 1Z7S3 2B42B 5K0UA 4LBMA 1QMJA 2CKCA 1C1LA 1S2ZA 3VUOA 3ALQA 2PAMA 4RS5A 1AR83 2BNNA 5BNOC 1Y7BA 2XLGA 2PHUA 4KL1A 4OULA 2WS91 4ASLA 3JU9A 3MIDA 2WJSA 3CL1A 1H2LA 1BZWA 5SV8A 1Q8OA 1GNHA 1OHFA 4EWAA 4QPGB 3KM5A 5JZGA 4N43B 1UIJA 1VAVA 2ZKNA 3VHOA 3WG4A 1LTEA 1CAUA 3TB0A 1MZEA 1D0GA 2B8MA 1MZ5A 1F31A 3AFGA 4NPRA 1QXRA 2TBVA 1GANA 4QPGC 1ZVFA 1FV2A 1DIWA 2WZR3 2YUEA 4N43C 3MIHA 3PVNA 1CAXA 1ONAA 1BEV1 2SLIA 2RM22 2XBO1 4YFZA 3VBOB 3VZJA 4CDQA 4ZU7A 4BM8A 2XGXA 1C4RA 3E5XA 2KXLA 3ZO0B 1ULEA 2OPKA 3OTFA 4PF5A 3TN92 5DUUA 2Y0OA 1JUHA 4ZXKA 3WW2A 1JTZX 2ZX0A 3BIWE 3NV3A 3VBOC 1SLCA 3WW3A 3AJYA 1RITA 3PKJA 5DG2A 4MGIE 4YM0A 4DRRA 5KXBA 4R9BA 3WG1A 4XGHA 2GC1A 2WFF3 2DVAA 2D6NA 5ABJB 3C3VA 5J48A 1V6OA 1QJY1 4ATEA 3KZ4C 1IZ3A 4QPGA 4Y20B 3MDPA 1VLNA 4N9IA 4XQDA 1WCSA 2GNBA 3MFCA 4HVOA 4KH9A 1DBNA 2E7TA 2CYFA 4LUMA 2X29A 3AYDA 4GXLA 1JHNA 1LOGA 4ES8A 3QVDA 5ABJC 1URXA 1G9AA 2KKDA 4B8EA 4QD2A 3WDTA 1RUE2 2XVLA 3ZXDA 4EN8B 1FPN1 1Q3EA 1WMFA 4DZGA 1YFWA 3J7Z1 3P3NA 3RI9A 3WG3A 2JJ6A 1LHVA 1YIPA 5C9AB 5FO8B 4ORFA 2R062 4Y1YA 1V9U2 3VBUB 3VBOA 3VPBE 1LTLA 1W39A 4XF3A 4RHV2 5EFUA 4QM9A 3AP5A 3USUB 1EAH2 2XKOA 3C2UA 4YARA 3Q9OA 1ULGA 4B4QA 1DGRN 5HBAA 4HVQA 5C9AC 1QKQA 3VBUC 4FXGB 4EN9B 2DWRA 2ZGPA 4GWMA 4AW7A 3FLRA 3HBZA 3O0VA 5MFPA 3ZVXA 1QH7A 1LKMA 4S2HA 1RVF1 2UWBA 4XDQA 4KG0A 3RG0A 3SITA 1ZYBA 2W0XA 4Q4Y2 2HEVF 2EXJA 3QD6A 1J3RA 4GA9A 1OQ1A 2YGMA 2VMIA 3IWZA 5ABJA 5CFDB 3FMGA 2LUWA 1G9DA 3KQRA 4Y20A 1R1ZA 1HXS2 4YG6A 3P2AA 1DHKB 2CAUA 4I3PA 3J4UH 3AKQA 4FBFA 1KITA 4YG0A 3PHMA 3GBFA 4Q26A 3SS2A 5L73A 1F5FA 2GZWA 5CFDC 1IPKA 5J36A 1AR93 1GZCA 5GAGc 2A6ZA 2ZMNA 5A32B 5I0TA 5JDBA 1IU5A 2WLPA 1VJ2A 1N1TA 4A7YA 4I02A 1RUF1 1O91A 4CZSA 5C9AA 4WVWA 2Z3QB 2VNGA 2PPTA 3AP9A 3VN4A 1VB4A 1AJOA 4LO5B 3USUA 2CR8A 3J7Y1 1C09A 4LE3A 2ZHMA 1Q43A 2P3KA 3VZKA 4C1XA 4HN1A 4W6WA 2MNGA 3CO2A 5A33B 1DFQA 4AVSA 1ASJ3 4D94A 1W6OB 2ZGRA 2RS33 4L92A 4Q0VA 1RUC3 4ITCA 2BGCA 1Z7S2 2D97A 3BTAA 1RUD3 2XL9A 3W59A 4Q4V2 3MW3A 4RA0A 4U36A 4KGGA 4M01A 2AZ5A 1F2NA 5EYXA 5JPNB