4AHZA

Flo5a showing a heptanuclear gadolinium cluster on its surface after 60 min of soaking
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 57
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahzA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahzA01
5A3LA 4COZA 4COVA 4AHYA 4ASLA 2XJRA 4AFCA 4LHNA 4AI1A 4AI0A 4AFBA 2XJSA 2XJPA 4AHWA 4CP2A 4AI2A 4COWA 4CP1A 4COUA 4D3WA 2XJUA 4LHKA 4A3XA 4AI3A 4AHZA 4AF9A 4LHLA 4AFAA 4AHXA 4COYA 2XJQA 2XJVA 4CP0A 2XJTA 4GQ7A 5A3MA
chains in the Genus database with same CATH superfamily
1H2LA 1JU4A 1UX7A 5A3WA 3UJOA 4Q4Y3 1EPZA 5GZFA 3EXUA 1VBC1 3AMPA 4LNVA 1AYM1 4NPLA 4NIHA 2R073 4BBRL 4H7LA 4HFSA 4AI1A 3OEBA 4PIYA 4OYUA 1IPKA 3ZYPA 5JXHA 3PVOA 4CEYA 3RMYA 4AG4A 4DPNA 5C4XL 4L11A 4W4ZA 4NPRA 2W2IA 3H8RA 4LA2A 5FREA 1HRV3 3B0AB 5FLML 1UXZA 4FPHA 1RYQA 1XOYA 2VW1A 3AM2A 4DRVA 4XQDA 5BV6A 2JE9A 2ZGSA 2XLGA 2D98A 4EJRA 2W47A 3RJ2X 1UY3A 2WSVA 1V6OA 5T5PA 3AVRA 3EYPA 1V6IA 1VBD1 2ID4A 4META 3ZN5A 2P17A 1LHWA 3POFA 1Z0HA 4I01A 4BBSL 4NOTA 4DIQA 1TMF2 4AGVA 2DV9A 1X8MA 2VTXJ 2WO3A 2O8QA 4Y22B 2RR12 3I49A 3CDZB 1MQTA 2HYXA 1CAAA 3P5BA 4UAPA 4AEKA 3T2OA 4CZSA 4RR3A 2ERJA 3M4OL 1O8SA 5F5QA 1ZBE2 1FHHA 1PX3A 1W2AX 2Y6LA 2ZPXA 4LE4A 1EUUA 2WT2A 2WO2A 1AR61 3QACA 5CEHA 3M2MA 2VNOA 2JE7A 4C8DA 4Y20A 1RUNA 2ZHMA 4DEVA 4CCDA 4GZ9A 4B4PA 5FUNA 3ZR6A 1B2OA 1LOGA 3MFCA 5FZEA 1C57A 5D8AC 3I59A 1I50L 3OF1A 3GBWA 2RFKB 2JA8L 4Y1UA 4AWDA 2E7TA 4XHXA 1CAWA 4D7YA 3RRDA 4Q0PA 2DCKA 1QH7A 2GNBA 5FLIA 4ASLA 1OLME 4AFCA 4A3GL 4XMIA 4H14A 1XNTA 2R16A 3N35A 4FOQA 1O3QA 1PM4A 3WNNA 4DNYA 4DEQA 1VCXA 2FDKA 2GC2A 2ARXA 2NMOA 2WS91 1G7YA 2I2SA 3CF6E 2W1SA 4QMAA 2YUEA 4QPGC 5LA0A 4XAEA 1W6OB 4LHKA 3H50A 1IPSA 4A42A 3ZN4A 1UWWA 2D97A 1NCQA 2DUPA 2QBXA 4GD4A 4CP9B 2FMDA 2BUKA 2NMNA 3QCWA 4DQAA 4LO5B 1PVXA 2H6BA 4MX3A 4BHPA 2XWBB 5EPAA 4AEJA 5CBLA 2WA4A 4J6GA 1JHJA 5K7PA 3J8F3 4GULA 2Y0OA 5FMBA 4GWIA 4IE6A 1RUD1 3R6SA 2NYDA 1TMF1 2Y64A 4QPYA 1W28A 1YQCA 4CEYC 5IVBA 1ZRPA 1QY4A 1JOJA 1XXNA 1WMFA 1OLMA 3KVBA 1RL3A 3WWLA 2VTFA 4HPKA 4QHZA 1XU1A 2VC9A 2KXLA 3KM5A 4KL1A 3BIEA 2XJPA 1JS9A 1RVF1 2QE3A 4R4ZA 1IG0A 5F9TA 3ZG6A 2ETEA 5E16A 5IAXA 3ZOIA 5F8PA 1LJ7A 4Y24A 5FZLA 5JWPA 2DBNA 1Y1VL 1V9U2 2Y60A 4ISQA 4QM9A 4YNIA 1CZTA 5EV7A 5LY1A 1UOBA 1HLCA 1Q8PA 4ZU4A 3RZHA 1C28A 1SMWA 4Q8LA 3NAPA 2JG9C 4KI5M 3FBYA 1Q8VA 2JG9B 3QD6A 4QDQA 5FFOC 2G19A 2R0FA 1HW5A 4U36A 3ZXAC 5JSOA 2OA2A 2YYOA 2A6WA 5E89A 5LATA 1XNDA 3KVAA 5FO8B 3VD9A 1LGCA 5GLVA 1ENRA 2BU9A 3ME2A 5A1AA 4HVOA 1MQTC 1OMIA 2Y6FA 2V4VA 4HK9A 4Y4RA 1SCRA 1MQTB 2WZEA 4BY1L 3JCIA 3VV1A 3VZJA 3GTQL 1I3HA 3DPRA 2VBDA 3IMMA 5I0TA 3VHNA 3H0OA 4K3UA 2E9QA 2RE9A 2VAUA 1OVSA 3AMQA 3RFRA 2RHPA 2JA6L 3MV01 4RSUA 4Y20B 2D40A 4AI8A 1N3OA 1XYNA 1SACA 3N7KA 4OHXA 1NT0A 3PO3L 2A3YA 3EHKA 3GJBA 4W8JA 3RJRA 1VALA 2WO7A 3TEXA 3ZIWA 4LUMA 3UV9A 1BYHA 2ET1A 5FZCA 4S2HA 1DQ4A 4OI0A 1IW7D 2YDEA 5BNNC 3AYAA 3Q8BA 4UFKA 4Y1ZA 1ZRIA 1GFF2 5BNNB 2PAMA 1FHMA 1F5JA 3IDAA 1GANA 1WLWA 4PLMA 2C1FA 5L19A 5CKNA 1AL22 1JYIA 4BQ4A 4IDZA 1U5ZA 2CDOA 2DU1A 2YZ4A 3AZXA 4JKMA 4O9EA 2HWD3 4AI2A 1CGPA 1UZWA 4QPWA 3EMRA 3K46A 1F15A 1ZBA1 3GZEA 2B4KA 3IBMA 3S7IA 3AKSA 2HWF3 4U671 4CPBD 2PLV2 2VMHA 1W8FA 1JOBA 1VBC3 4LO7A 1AYM3 1ZZCA 5I91A 1BE7A 3MPBA 1CAXA 1XNCA 2B9UA 2A70A 4ME3A 3WT3A 5LBBA 2R93L 4N8MA 2LUWA 1MS4A 3M70A 4PIZA 2BE5D 2V73A 4JDMA 5SV5A 2M6PA 2RDQA 3T09A 3L2YA 1W8HA 3IAQA 1CIWA 3I8TA 3NO8A 1Y4WA 5IYBL 1YWKA 3HWJA 3RPQA 4QKDA 3PL5A 3ACIA 3LAGA 4BJ0A 3S2HL 2RV9A 5FPBA 1EYBA 3NAPC 2Y38A 5FZ0A 3RDIA 4ZPIA 4IEVA 4PDWB 2XWJB 2Z3RB 1AJKA 3HOUL 2C6SA 2IXLA 4MXVA 4Y33A 4XFAA 1UZYA 1MS8A 5EZWA 4B3NA 2VQTA 1QDCA 1Y1WL 1VBD3 1ZX5A 4IE7A 1G86A 2Y33A 2ZGMA 1CPMA 1H7VA 1WZXA 1HIXA 2FHRA 2OX0A 2R49A 3T3YA 3VKFC 3ZYGA 4FAHA 1N47A 3B02A 3BALA 3DPRC 4YGCA 2J1RA 3DGTA 5I0DA 2W0XA 5JVH1 2HBTA 1COV2 1GNZA 2ZAHA 3DPRB 5L9BA 1W2TA 3WDUA 2V0EA 1BFYA 1WCKA 4CU8A 5F3CA 3LWPB 1OF4A 3GCXA 3ORJA 1BKZA 4OLLA 2P3JA 5M5WL 1W99A 2E7AA 3MV11 1AR63 1H1AA 3BPSA 4R9DA 1CAUB 1VAVA 2RVAA 1UF2C 1YQ2A 3N7MA 2QZ2A 5A6XA 2ZJCA 3MLJA 1VBA2 2D5HA 4GA9A 4IE4A 3PURA 4YGEA 3SCGA 4BLJA 2AUYA 1QJX2 4BQ1A 4JAGA 3HT2A 2UYBA 3TYJA 1VRH2 3NNFA 2TUNA 4COYA 2XJVA 5A1FA 1I5PA 3VDAA 2DCTA 4LBKA 2ZA9A 4Q4W1 4XF0A 4Q0VA 1PFYA 2BBAA 3ACLA 1S30A 1QIQA 2APOB 1AYN1 1OFSA 1AVBA 3LWOB 1A3KA 3KCYA 5FZGA 1H1MA 1NLSA 2HR5A 2B9VA 1LAJA 2WS93 3OPTA 4LXLA 1O3RA 1W6PB 4CCKA 1Q8OA 1YV1A 2QZ3A 2YBSA 1RDVA 3J7NA 1QH6A 4FVVA 1BK0A 2QQKA 1QOTA 3ZXGA 4B29A 3GTJL 5IJRA 2GDFA 1ACCA 2BPA2 1NUKA 3AP6A 3HOVL 1B2JA 1LOBA 1RUD3 3H3UA 3ILRA 1TMF3 1UYZA 3NKGA 3SKVA 1FMD2 5I0UA 1O5LA 3LOIA 3J7MA 4IEUA 1HQLA 2DVDA 5FZOB 1COV1 3ZXDA 4S2GA 2YB7A 5DAQA 1F4AA 1RVF3 5KWRA 2R061 2XB6C 3VB9A 1G9DA 2YFZA 2IZWA 1AZDA 5CZKA 4AVTA 4XDOA 3I2KA 3L2HA 1M06G 4A3IL 3WOGA 1RWDA 1R1ZA 1TVGA 2CGOA 4AGRA 2AQCA 2W95A 2ZTNA 4QXHA 1OVPA 3S14L 3IDCB 3P2AA 1W03A 4XOGA 5C3QA 2WSUA 4LBLA 1KJLA 3S0MA 4LKSA 1A8MA 1NQJA 2OQ7A 5J3UA 3O0VA 1O3SA 3DUIA 4KG8A 2IFWA 2R7EB 4AHZA 4M4PA 1MS9A 4UW6A 4OQ8A 4IE5A 2VMIA 4NHYA 4Q4X1 5FPVA 3UKNA 1DYKA 2PELA 2QQLA 3R4DB 2EXJA 1X82A 4UW5A 1H0BA 4YW3A 4YM1A 5G05L 3LQCA 5FY9A 3THCA 5FMCA 2B8MA 2UURA 4A6SA 1CQ9A 3DXTA 5FZKA 3WG1A 5K8SA 1IZ3A 1DGWX 1OD3A 1UCXA 2WYFA 3IZOA 3LEIA 3VBOA 4DXTA 4CXYA 3N4MA 2Q0AA 1RITA 1WW6A 2XVLA 5BXXA 3B93A 2RJLA 4EQVA 3H8OA 1YFWA 2GC1A 5CB7A 4OUSA 1IS6A 2D93A 1ASJ2 3J7LA 3LPGA 4A3CL 2KR2A 3AP4A 3H1MA 2VZQA 3VZLA 1TEIA 1QJZA 4RHV1 1JHNA 4ET7A 4YARA 1HB2A 1QHDA 4LHSA 1T2XA 1V70A 1URXA 3HVDA 1REEA 2KM2A 5KC6A 4O7XA 1OOPB 1MZFA 1VBE2 2AZ5A 5C3SA 2A6HD 4QIWP 1O5UA 1DQ2A 1WLDA 5FYTA 2VVDA 2AC1A 4XW3A 1OH4A 5LRSA 3VBRB 2G9GA 3WF2A 5EIOC 2DVBA 1UYPA 2H6CA 1SCSA 1N1VA 1ZBA3 2A6VA 2HWE2 3HMYA 3P3NA 1OPMA 4HL0A 4QB2A 2Q8EA 5JOWA 5T3NA 3RWKX 3T30A 3T2TA 4AVAA 4K1ZA 5I8YA 2VY0A 3NJXA 4YG3A 3I2IA 1LHOA 2BZDA 1RJ7A 2A5ZA 4JTOA 4XIKA 1R9TL 1HJFA 1VJ2A 4LULA 4QM8A 1W0OA 5FP9A 3ZVXA 1RB8G 3KQ4B 1DQ1A 4XEZA 5GLUA 1S2EA 3PTYA 4CCLA 1UY0A 2HEYF 3BKZA 2AGSA 3RZZA 3QH7A 1LENA 1G9BA 4D69A 3ENRA 4BXFA 4JDNA 4HVRA 2OXBA 4URTA 3ZXJA 5L9RA 3RYKA 4PT6A 4S2DA 2RJKA 3V56A 3ZSEA 1IRNA 3NRUA 3PU3A 4TXWA 2ZGTA 4OHWA 1ZZBA 4FXGB 3APBA 4AI9A 4MOAA 4GMP0 5CADA 3WNMA 3CJIB 4IE0A 4B8CD 1SPPA 5JZGA 5M5YL 2WFF2 2QDNA 2CTVA 3AYCA 3KGZA 3KV9A 3PJYA 3RS6A 2AEZA 3VBFA 4AQSA 4CA9A 4YSFA 5I8TA 1CVNA 3LIGA 3LB9A 1D2SA 3OBAA 4DUVA 1QEXA 3RQ0A 3SH4A 2NYYA 5GALA 3VD7A 5HCAA 5F3GA 3AYDA 2WR9A 5M3ML 3E6DA 1JZ8A 4EN0A 4Y5SA 3KYWA 3AZYA 3WQBA 3LOBA 1K5MA 3OBRA 3OBTA 3N36A 4LLFA 5C33A 3VBOC 1RUC2 1DLCA 1W3XA 3QVDA 1Q5OA 4GB31 2HWE1 4UW4A 3FHQA 4IETA 4ES8A 5K4LA 5A3TA 3U37A 3UESA 2IC1A 4UFLA 1C1LA 2ATFA 2J7MA 2IXKA 2RMU2 3PKIA 3LDBA 4A3DL 3LA3A 1EUTA 1UZ0A 3RZ6A 4DINB 2H0BA 1MACA 3KWVA 1VB2A 1DP0A 1G9CA 3RZLA 3KSCA 3WINE 5DDJ2 2E53A 2CKAA 2YC0A 1BQ8A 2BVBA 1J58A 1LEMA 4GKYA 4Q4W3 1CIYA 1HRI2 1PIV2 3GZUC 3LZZA 4XUOA 2B39A 1AYN3 2LS6A 2RDSA 2WL1A 5EWSA 4UFMA 3NFPI 2JB8A 3MIDA 1RMU2 1YUXA 4XUTA 4KU8A 4CU9A 3O7OA 5GAEc 2UWCA 1BEV2 3MUZ1 2AUSB 1UXXX 4HT1T 3LF7A 1U0AA 4MGZE 5F1RA 3CMGA 2J1VA 4ITCA 5LEJA 1DYOA 1HX6A 4XABA 2DWRA 2WAOA 2WFF1 5L9VA 5FYBA 1CADA 1FV2A 5G04L 4B7KA 3KMHA 3IWZA 1O4YA 3THPA 5TSWA 1ENSA 3F95A 4NIDA 1OUXA 4WVZA 2ADDA 2W68A 4AEDA 5HI0A 5HXVA 4EROA 1COV3 3FUQA 5CFDA 4IESA 4W65A 4HKOA 2R063 1SBFA 2J1SA 4AI3A 1AX0A 4AAXA 4CDQB 1F5FA 1UOGA 3AKPA 1Y7BA 4DUXA 2QFEA 1IU5A 1C8M1 1WWYA 2XBO1 4EN7B 3HEIA 4W6YA 4GQ7A 4PCRA 3GGLA 3PLQA 4RQPA 2DCYA 4JVAA 5JZGC 5IVYA 1WBFA 1PMIA 2WZR2 5JZGB 3AKTA 1S2KA 4M3CF 3VBFC 5IVEA 3UKTA 3PIGA 1NXGA 2P3KA 4FP3A 4TPUA 2A3XA 5FYIA 3T08A 1NKGA 1YRZA 1B13A 2VJXA 5DDJ1 4EZHA 5BNPA 4Z8BA 3V0AB 1HRI1 3BPZA 1QQP2 4Q4X3 2CWMA 2R041 4XILA 4FPYA 5AFBA 3ETPA 3I3QA 1A6CA 1RMU1 3OPZA 5F3IA 3WF4A 5FZ4A 3VKLA 3IN9A 2VNGA 1SDDB 2XH6A 1KFUL 1LKNA 1VBB2 1VMFA 2Y6HA 2VZVA 2Z42A 2ZGQA 3ZXLA 4EV0A 2GN7A 2JDAA 2M6OA 1WUVA 2QQNA 1L7LA 4YZ2A 4E6YA 4HETA 3WCRA 1TNRA 4X6RB 5T5LA 1GWKA 1DFQA 3ZFGB 5FPAA 1YUZA 4LEJA 1ULOA 5FYZA 3S7EA 5J48A 1CWPA 3KYVA 4BQ3A 3UNPA 1SMUA 1QXJA 3LWCA 1YFYA 3M3YL 4QX2A 4RHV3 5ACA1 3B69A 5IP7L 4R52A 4EWEA 5I93A 2W46A 1PFWA 4KWUA 5GLTA 3A21A 4Y7NL 1BK1A 1QJY2 5FJHA 4EWDA 2EIDA 1W9WA 4Y1VA 4IL7A 1DF0A 2C6AA 1L7QA 2WDBA 4XGHA 1YFUA 1TE1B 1VZIA 4L97A 5FZAA 1JW6A 3PL0A 2IXCA 4PLNA 1CN1A 3ZPOA 3ZFFB 1SMMA 4Y1YA 5LB6A 4MLOA 3ZYHA 5IYYA 3PUAA 3ZX7A 4P00B 3ZSLA 2O14A 2XDVA 3WDYA 2FDIA 2FZ1A 2WN3A 2VZRA 2CNAA 4CDUB 1QQP1 1ONAA 2GP3A 4B8EA 3WW1A 1CX4A 4E4SA 2B5ID 5IK7A 1NCRA 5CFDC 3HJWB 3NWKA 4ZY9A 5GJ6A 4XUNA 4TYSA 2FBEA 3H99A 2N7GA 2YV8A 4W6XA 4XPVA 3KV6A 4JGYA 3LEMA 4QXCA 1DX8A 4XXAA 3TB0A 4C91A 4NAMA 5DAVA 1OA3A 3W5NA 2DF7A 3IB3A 4RQPC 1AR62 3S30A 1UY2A 4RQPB 5C3PA 1RINA 1EAH1 2BQPA 5HBAA 1KRIA 5MF6A 2JD4A 3WP6A 2X10A 1DIWA 4MADA 1OF3A 2R6QA 1ND2B 5AFEA 2EICA 1ZNPA 5BNPC 3AMHA 4UF0A 1C8NA 4N53A 2UU8A 2HWB2 3K51A 4WZCA 1MZ6A 1WD4A 5IFTA 2WT0A 4JCKA 5FZFA 2ZGUA 3NW4A 2Q8DA 3S5AA 1UZZA 2K9ZA 2IFRA 3E5QA 3T1LA 2M4VA 1MEC2 1DGRA 2P34A 4Z07A 5B4XA 2FD8A 2PPTA 5GLZA 2FCTA 2YU1A 2V0FA 4GB33 1YCIA 2HWE3 4IEYA 3O1SA 3PUIA 1SMVA 1RUG1 2NPIA 3KYUA 3WDTA 5MFZA 1YC61 2PXJA 1C3HA 2VMFA 2ZX4A 2YPDA 3B01A 3LEKA 2RS12 2YGLA 4J1WA 1NXEA 2WLQA 1LB2A 2BP6A 2DUQA 4ORFA 4LO6B 4V2WA 1OHFA 5A70A 1W06A 1D0HA 1XNAA 4ZU7A 3M3CA 3WF0A 3B3QE 3ECQA 2OUHA 3IPVB 3KV5A 3ZFEA 5A6QA 1AR92 3M8LA 4IEWA 1DZQA 3NQHA 3VBHA 4JAEA 2ZXQA 5T5OA 1FATA 2BEOA 1JZ4A 1UIKA 3U1XA 1RUJ2 3SC7X 5LW9A 2YY1A 3QOPA 4XUPA 4YFWA 5DUXA 5SV8A 2EALA 2Z3QB 1GQPA 2JIGA 4MO3M 5KC5A 4BYYA 1UMIA 2XOMA 3B5LB 1KJRA 4BY7L 4X6QB 2V72A 1LR5A 4NHXA 3CZJA 2MS3A 1DGWA 2WFF3 1I3QL 3U14A 3M3OA 4CCNA 4KBBA 2LALA 3O1TA 1NCRC 1C09A 4I0AA 1DG6A 1QGLA 4K7JA 4HSJA 2OYZA 1UU6A 5F6KA 4ASKA 1DZTA 4BPZA 2MEV2 4IV1C 5FOBB 4JGYC 5J96B 1ZM1A 2JICA 2Y34A 1MEC1 5DAWA 4IV1B 5IUQA 4RGGA 5IATA 5ABJB 3VDBA 2XVGA 3MF6A 2J1UA 1RUF1 3MW2A 3TRSB 5FP8A 2H0VA 3AMMA 3GTKL 1KXGA 2E63A 1UMZA 2C24A 1C8M3 4IXLA 1PO12 2XBO3 4V2VA 4LO8A 3S5QA 5T54A 4QU2A 1RDGA 1NXD1 2IXJA 2P6HA 4MGQA 1BBT1 3WP4A 5A32A 4GB32 4MGIE 5FY7A 5KR7A 2B5HA 1YIPA 1Z78A 3O1UA 4N53C 1IPJA 4TWTA 2X5IB 4KWKA 5DDJ3 1GUIA 1RUH2 1QMJA 2BDRA 5CU1A 4COZA 1JYWA 1TNFA 1HRI3 3TOJA 1AR91 1DGLA 1NA1A 4BA6A 2R043 5FCCA 2WZ8A 5FK7A 1RMU3 1RUJ1 4YG0A 4YW1A 1PGSA 1NY72 3AX4A 3TEZA 3GCWA 1YNAA 2PYAA 2UY9A 3I3EA 4UT5A 5EYXA 1FNYA 5APAA 5K2ME 2PAKA 4XF9A 2BNOA 4NROA 4HOOA 2VGDA 2WC2A 4XC9A 5C8CA 1YIFA 4U2AA 2PVEA 3OGRA 2JI2A 3WSOA 4N7IA 2BVVA 1WW7A 2OQ6A 2C26A 4UYBA 3GDBA 2DDUA 2ZMNA 3BYWA 2MEV1 4ES9A 5FJKA 3S15L 4BE3A 3ZFEC 4EWAA 5ACA3 1FX5A 2ZKLA 3VBHC 1D4M2 3OY8A 4BXSV 2F6BA 3VBHB 2A6YA 1GZCA 1QJU1 3KV4A 2RS32 4CUAA 1AHSA 1HV0A 5J37A 1QWRA 1X9TA 4XXPA 4K20A 1QNWA 3PO2L 2YPJA 5J98B 1DQ5A 4OI4A 4AE2A 4M00A 3VDDA 2CAVA 2D6NA 1GSLA 2VOTA 3LEGA 3Q9OA 1ZRCA 4HSLA 5DMYA 4I3PA 2K2DA 1CAVB 4QDRA 2BNMA 5KHKA 3J26N 1MS0A 3AL6A 3POGA 3VKOA 5C6CA 1QQP3 4XACA 4CCCA 3B9IA 2E32A 3AB0A 4V1PA 1OLRA 5KHHA 2QJVA 4HZFA 1VMHA 2VNRA 4LK6A 5D8AB 1EP0A 5DAPA 2GSYA 2W87A 3W58A 3B00A 4O65A 1ZYBA 4HANA 1HKDA 4NRPA 2C9KA 5MLC3 1CONA 2Y8KA 1LKPA 4BISA 1S0CA 3H7JA 4X8NA 4HK8A 5A32B 2YBKA 3VBSA 2GMEA 2AH2A 5A7NA 3DYMA 3VBUA 1EAH3 1N1SA 4Q4V2 2A6ZA 4WM7A 5FAXA 4Q26A 5FXWA 1L3JA 3RI8A 4QPGB 3FX3A 2XKOA 4L9BA 4FT8A 4XE9A 4MHRA 3HOZL 5FZBA 1W6NA 2W9XA 1JUHA 3CNAA 2XPJA 1I9RA 4P5YA 2JJ6A 1D7PM 1NA1C 4IEXA 1K45A 1S0DA 2PHLA 3UL2A 4BCUA 1D4M1 4BH9A 3AFGA 3A0NA 1LESA 3IDBB 1X9PA 2IXHA 5L7OA 1YQ8A 2RR11 4ATFA 2JDYA 4CEYB 1ZZ7A 3Q8EA 2FDHA 4HG6B 2R30A 4QGLA 2WLPA 4XDQA 3OBZA 3WUCA 4K9SA 4HMZA 1O4ZA 5C8CC 1ZBE1 2ET7A 4KQ7A 3BGAA 4Y1XA 3SEPA 1RUG3 3RZTA 3P8BA 3K4DA 5H9RA 2B46X 4WVMA 1N3QA 3ZYBA 3R0RA 3WG4A 4UFJA 3VZNA 1R092 1UIJA 1NX9A 1JXNA 4DOUA 5DM61 1US2A 4E2GA 1W90A 5GZDA 3GALA 5A7WA 1APNA 5IYCL 4FO9A 5JDBA 1JBCA 5FR3A 5FK8A 3J7Z1 4L2NA 3HD8B 3AP9A 3ZSMA 2HWC2 2WAQP 2QQOA 4A93L 4M0NA 4UWDA 1RC6A 3CLPA 1UX6A 2XJRA 4M4RA 3GTML 4RR3C 2PHWA 3RYRA 2PHRA 3I3DA 3VDDC 4Q27A 4Q4V1 4RR3B 4DY5A 2VG9A 1D0GA 1W8OA 4FPEA 3VDDB 2VCMA 3ES4A 1AXKA 2ARAA 1DGRN 1LGNA 2SLIA 4OZXA 4JZRA 2XKPA 5M0TA 1IG3A 2OUJA 4JDOA 4G6BA 3B94A 5IVJA 1NE6A 1LOEA 4YVSA 2M4YA 4CE8A 4FSJA 3OJBA 3I59B 4G4FA 5IHRA 2O5JD 1CAWB 3C3VA 1MEC3 4O61A 5FY1A 2DURA 2V5YA 1RUF3 3I2FA 2VZSA 2DCJA 5F39A 2XG3A 1RJ8A 3VBSC 3VBUC 3ATGA 3AC0A 3FLRA 4XBNA 1WW5A 5DUUA 3UKVA 2A71A 4WM7C 3VBUB 1BBT3 3ZDSA 1TWFL 1JOPA 1NCQC 1V9U1 4UBHA 4YM2A 4D8MA 3AP7A 1O6UA 2D3RA 2V09A 2VNVA 2YGMA 5J1XA 1NCQB 3H42B 1IHMA 5DG1A 2IUWA 3X29B 1JZ3A 1FPN2 3GTGL 4H2AA 5LEKA 1XNBA 3JQWA 1DQ6A 4S2FA 3LFMA 4NJ4A 3WDXA 3LCPA 5L7OC 5IWFA 1AR93 5LBCA 4KU7A 1ND3A 3MZHA 1W2NA 1QU0A 4AR5A 3WP5A 1RUJ3 4FPLA 5FP3A 4NHLA 4HPKB 3O1OA 3JZVA 1M4WA 4JC1A 4XF3A 3OTFA 5FYSA 5F2WA 3QQCE 4D6RA 3WV6A 4A7YA 4RGKA 4K21A 5CVRA 3HNYM 2PHXA 1XQNA 1H9WA 1UY1A 1WJVA 3LPEB 2GH8A 2YC4A 1W9FA 2X09A 3J9SA 4M3CA 2P4EA 2J1AA 1OLQA 5DAXA 4BMBA 4BXXL 2LTNA 4C3IL 5IT6A 3S2DL 1SQ4A 2ARBA 1FNZA 4LT5A 2ZX2A 3NAPB 2MEV3 1FI2A 3HQRA 2A68D 1PGL2 1JN2P 3HIFA 3OD4A 1R082 2QKDA 3VHRA 4LTAA 1HQNA 3U0ZA 3RSJA 1RXGA 1SBEA 4KH9A 3NNLA 4RFRB 1QJU3 4LPLA 5F3EA 1AL21 3V65A 4FCAA 3AZWA 2E6VA 3ZLIA 4JKLA 4CVUA 3VHOA 1LNSA 4Y5Z0 5E1RA 3W59A 4N9HA 4RS5A 2VW0A 4HLTA 3WNOA 5JPNB 2EIBA 5F6LB 4YVSC 3POBA 4IEPA 2PLV1 1ZZ6A 2EVXA 4BQYA 1MPXA 1LKOA 2AR6A 2P6CA 1RTVA 4LE3A 4D6SA 4XFGA 1MVEA 2D7FA 4Z2WA 4FTEA 1ENQA 5KBFA 4CCMA 1TWCL 4KGGA 1F4LA 5DPNA 4EN9B 4LITA 3WQ1A 1GWMA 2ZZQA 5M5XL 1G9FA 3BTAA 4LO4B 5FXXA 2DSXA 2XHKA 3AKQA 4C90A 1RUI2 2ZBJA 1JZ7A 4DB5A 4O9GA 4XBQA 3G6JB 1UKRA 3ZMNA 5LA2A 4BQXA 5L73A 3ZKYA 5DUVA 4MVTA 5K0UA 2VZOA 4QB1A 5AVPA 1AR82 2VUCA 2P3IA 4Q1PA 4NHMA 5HCFA 1XNKA 1YQ5A 3M3IA 3UJQA 1BRFA 4A3ML 2CDPA 4E4DX 1I6HL 1PGL1 1F9KA 2VOVA 2VU9A 1R081 1WMXA 4FTSA 1T6BX 3ZN6A 2EIGA 1GQGA 1D4M3 1ND3C 1CZVA 1ALYA 1S1AA 1W6MA 3KCXA 1ND3B 5FP4A 1PZ7A 1CAXB 2JDZA 5A7PA 5JIUA 3NNJA 4UW3A 4A44A 2RR13 2VZ3A 3JR7A 4N43A 4Y5TA 4A3FL 5FY0A 4L8QA 5FZ9A 3JUUA 4TTGA 1MZ5A 2RM22 4XETA 3IIAA 3ZM8A 3I2OA 2O1QA 2ERFA 1ZBE3 2QQWA 4IEOA 3PMEA 4JQTA 1PX4A 4AHYA 1AX1A 1DZRA 3CJXA 5LK7B 4P9JA 5JMOA 1PNGA 3URFA 1N1YA 3K2OA 3NV2A 3I2JA 2ZOEB 4TN7A 1VBA1 4TSVA 5A80A 3R4UA 1VIWB 4YWLA 3ZR5A 4Q29A 3V0BA 1LRHA 1QJX1 3NV4A 4UBGA 2TEPA 2ZAAA 3CQZL 1TWHL 2XUEA 4XFCA 2NVXL 1CPNA 1VRH1 4AW7A 4GJYA 1AJOA 2GNMA 4DXRA 4ZKTB 4MXWA 4IV3A 2CL2A 2BBVA 3JD72 5BNOA 5CA6A 4CDXA 5C9AA 1F2NA 4QAWA 3QLQA 4GMP1 2BFUS 3WUDA 1WCDJ 3MGUA 2UWBA 2VM9A 4Q4V3 4RS5C 3MBWA 3BODA 2L9LA 4XF4A 4XJZA 2P1BA 3T1MA 4BMEA 1FT9A 5FZIA 3IAPA 1MS3A 3RG0A 1GZTA 1LECA 4RGAA 4RD7A 1S0IA 3V64A 5FP7A 4A41A 3C7HA 1SG3A 3MIGA 1EPWA 2VOKA 5A3PA 1WMDA 2UYAA 2ADEA 2QVSB 5HV4A 3O5SA 1FMD1 4DXZA 4DRRA 1E5HA 3B9CA 5FTTC 1ULEA 3BU0A 5F5AA 3UT0A 1UOFA 5IVFA 3GHMA 3HKZP 3MQKB 5I0SA 2Q1ZB 1N3PA 4E27A 5IYDL 4GKXA 4R8HA 1BZWA 5K0UC 2Q5TA 1J3PA 1HN1A 1K12A 1RUE2 5DUWA 4EE2A 5K0UB 1H1IA 1JZ6A 4I02A 4NE9A 1VAMA 1V9U3 1Z7S2 2AREA 4PBOA 1KS4A 1X33A 5FV3A 1YK4A 3ZKUA 4A45A 3WP3A 2I07B 4H7MA 1B35A 2DTYA 3HOXL 1JYCA 4L99A 4W50A 4E2SA 4RFT0 4XF1A 1POQA 3K77A 3PZAA 2D6OX 5AN9H 3OPWA 3FMGA 1YJKA 2RS52 2W91A 3CU7A 3CZUA 3OB8A 5A7QA 3VL8A 4CP1A 1BVP1 2CGPA 4B7EA 1PGW2 1UU5A 2WBKA 1R0FA 2H12A 4N43C 2A7AA 3JD71 4YGBA 1TME2 4YW6A 4OQ9A 2JD9A 2EAAA 4HN1A 3MEPA 1OD5A 2F4LA 2W1WA 3D6EA 3POIA 5L36A 2OPKA 2QDRA 1OC1A 2DCZA 3ON7A 5B2GB 3KHBA 5GAGc 2GC0A 1VPHA 1G6NA 3GBFA 4HKWA 4OMCA 3TAYA 3HQXA 3VD4A 5F2SA 1ENXA 1ODHA 5KXEA 4JAFA 4XTPA 5CFDB 3FL7A 3PUSA 1C5IA 1KDMA 4QKFA 4R9CA 3H8XA 4P9GA 1ASJ1 2LM3A 3H97A 4WVVA 2Q1MA 4YZ3A 3N7LA 2ZEYA 4OHZA 3W21A 3LIHA 1R0JA 1ZRRA 3RZMA 1LGBA 3NV3A 4CUCA 3FWEA 3PVBB 3ETQA 4IV3C 2XQXA 3DYPA 4MXWB 2ORXA 1W04A 5BNOC 2WWJA 4CDXC 1UY4A 4Q8KA 3FC0A 3K75B 4KWLA 5C9AC 1IQDC 2ZGNA 4M0HA 5GKAC 2L0ZA 1AL23 2Y26A 1VBE1 3FHAA 6RXNA 1RUE1 2RJ2A 1NXMA 2VBBA 1OWBA 3T0AA 5HPOA 5AI2A 2RDVA 2VW2A 3PDQA 1DQ0A 1V6KA 2E51A 5C4WA 3VBOB 2WYSA 3POJA 2ZX0A 4LQRA 2QUOA 4NMIA 5FXVA 3ABZA 2EY4E 1GYKA 3K4AA 1O8PA 2EXKA 2PLV3 1UU4A 2RS51 3BVCA 5DQ0A 3M7AA 3PIJA 1R1A2 1HXS2 5CFCA 3BI3A 2Y6KA 1TME1 3IMNA 2VZ1A 2PQQA 4PI0A 3NV1A 3H1YA 2A75A 2WNVA 2CSGA 1OA2A 4LOSA 4DO0A 5JSPA 1LHUA 4KWJA 4FOWA 3OSDA 2YMZA 4RN5A 1W8UA 5FUPA 5JVVA 3O1RA 4QB6A 5GM0A 1WCQA 4WM8A 1LCLA 3OD0A 3RZKA 2Z2SB 4CXWA 4YG6A 4KMQA 1Z92B 3JU9A 1RYYA 2P2KA 2B7YA 2ZMKA 3T2QA 3SHRA 2BWAA 1B35C 2YFUA 4YW5A 3SH5A 3I4IA 1B35B 3WHUA 4J25A 1HV1A 2WJSA 1SLCA 4NRQA 5JXIA 1JYBA 4CYDA 4DUWA 1O91A 5FBJA 1R083 4JHTA 3ACFA 1UW8A 4P9WA 4EN8B 3A7QA 1UO9A 2Z69A 2J22A 4NWVA 4Q4Y2 1OKQA 3K4ZA 4COUA 5LZ6A 3CEWA 1S24A 4LBNA 5JXGA 1H8TA 1W3VA 2WNEA 4LBQA 5C5UA 1JYXA 1RXFA 3QBQA 2QQVA 3D5OA 1YI7A 5H9PA 3TNPB 5FZ3A 1RUC1 1V6MA 2JG8A 3CQOA 5A33A 1OH3A 3M4FA 1OURA 3FJSA 1YLLA 2YBPA 4GH4A 4A4AA 1HJGA 4DY3A 2VUAA 3HBKA 3WWNB 3BTZA 2A69D 1AL0G 2C9AA 1CD3G 1OSGA 1UYXA 2JI1A 1H2NA 2RMU1 1LEDA 3FLPA 4GJZA 4K9FA 4L0PA 4LUKA 1R1A1 1HXS1 1VBA3 2BW8A 2EF6A 1SPPB 2PVXA 5I8SA 3VUOA 4LHNA 4QXBA 1QJX3 2A6ED 3LDRA 3VBFB 3IU3I 1VRH3 2BNNA 3OUIA 4FFIA 2A73B 1JH5A 3OYWA 3Q8FA 4FPKA 3S1NL 1PIV1 2WABA 1K5MC 2WKKA 4IGQA 4XJWA 4AVVA 3ILNA 2JA5L 4BIOA 4AVCA 2XR4A 1WGPA 4GMP3 1K5MB 3B7MA 5DN2A 4JGZA 1W05A 5C4WC 1LKMA 1R0IA 1KGYA 1BEV1 4C0HA 2VO5A 4AHXA 1U12A 4H3WA 2DVGA 5I0RA 2QQJA 3K3OA 4QDSA 3WLUA 4YM0A 5IVCA 1DDLA 4F7ZA 1DLLA 1UPSA 1ULFA 3USSA 4GS7D 5CFCC 2K0GA 2WZPP 3LDKA 5FYMA 3HN1A 2WNVC 4UI9L 2VPVA 1JODA 1S0GA 3AXDA 1FMD3 5FMOS 2WNVB 4MUVA 1Y9GA 3IT8A 2V3BB 2OZ6A 3C8XA 3KCCA 1XSRA 1Y3TA 3MW4A 3WNPA 5F37A 4WM8C 1CJDA 5FYUA 3MPPG 4XURA 4CEWA 3BCWA 2NVQL 5C5TA 3C7FA 3K7AL 1KD7A 2WO1A 1JUIA 4NHKA 1H6YA 1POV0 4MV2A 1VE0A 1X7NA 3POWA 5MFPA 4AAPA 4ZZ8A 3A23A 1IKPA 4A3JL 2JA7L 3AKRA 3NJYA 2Y0SP 3I3MA 4AR4A 3THTA 4AYUA 1B71A 4OHVA 4P02B 1R0HA 1UL9A 2WZR1 2JENA 3JXSA 1QDOA 4ZXEA 3VZKA 3S1RL 3MLLA 2AACA 4GAZA 1DBNA 4C0BA 2EIEA 3NSTA 4AEDC 4YFZA 3WF1A 3JD73 4AEDB 1X8EA 1P7PA 4LBQB 3J8F2 4XUQA 3AZZA 3HBZA 2JG8C 5C44L 3MFAA 2G9ZA 1OA4A 5CYYA 4D6QA 3BB6A 1VBB1 4GH4C 5FLJA 1FYUA 3LGRA 2JB4A 1V6LA 1XC6A 4PI2A 3ZO0B 3ZXEA 4CCEA 3VD3A 1RB9A 5A3UA 3QH6A 1T9OA 2ERSA 2NP0A 1GLHA 1H8VA 3H7YA 2YU2A 4NVPA 3C7GA 1ZA7A 1GNHA 4AYBP 5DG2A 5JOXA 3CL1A 4FTBA 1ASJ3 1C5HA 2RG4A 5A3LA 3NMBA 4FAGA 1NAEA 2D6LX 1QXPA 3AXEA 4AI0A 5BNPB 5FMOL 3KYYA 3POEA 3MIEA 3TNQA 1QJY1 4ZN3B 4FPJA 1QOOA 4B1LA 4NPMA 1VBE3 2OS2A 4JGZC 1RGSA 1HB4A 1RUE3 2QQUA 4QT6A 3WW4A 3IIIA 2CYFA 2D3PA 4Z82A 4BM8A 3O0WA 3H9AA 1EY2A 2WRAA 3MF9A 5H1Sc 3U07A 2RS53 4Q5OA 1BLZA 3PVNA 1ODMA 2LRPA 1XYOA 1C4RA 2GH2A 1AF9A 2RDNA 3P1IA 3PHMA 1J3QA 2JDUA 1TME3 3C7OA 1W8WA 4M01A 5F7UA 3H3LA 3BUCA 2VBPA 5J36A 2GU9A 3AYEA 2BOJA 4RYDA 4CEWC 2EXHA 1VR3A 4JV4A 3DXUA 4CEWB 4NN0A 5BY5A 1GMMA 5JOZA 2DYCA 2XLFA 2VUML 4FQZA 4LBMA 5FO9B 2ZKNA 3NVCA 1I1EA 1YHFA 5FPUA 3AZVA 4YLZA 5GADc 5LBEA 3FKIL 4OMDA 4UY81 3DV8A 5FO7B 1BQPA 5ANNA 2NVYL 4GWNA 4MSVA 4NIAA 2VD7A 4OZOA 2W5FA 2HWD2 3M3EA 1H2MA 2OIIA 2Z79A 1VAKA 1DVBA 4KNCA 4IGPA 2HWB1 3NL1A 2JDPA 3VKMA 3ZIXA 2W1UA 2WNOA 2V5DA 1AR72 3ZYFA 1VBC2 2GMGA 3B08B 5EINC 1NCRB 1KFXL 1SLIA 2ZIXA 3VGIA 4OI2A 3EB7A 2JEMA 5DXDA 3H8UA 1IS5A 1W2OA 4JGYB 4XHBA 3W9AA 1GR3A 3MLKA 1RUC3 1OPOA 1XE0A 2PYTA 1IKQA 3PUHA 2VZPA 4I0BA 1LOAA 4ZS2A 4P9XA 1LU2A 1JU3A 2R1BA 4XDPA 4ARYA 5EXOA 5FDBA 4QX5A 3FN9A 4QHBA 3BTXA 2RMU3 1PFUA 1CR7A 2A3WA 2RS11 1STMA 4MGSA 1ZRFA 1R1A3 2WINB 4BQ2A 4CP0A 3VN4A 1IS4A 4HBNA 3LWVB 5K9YA 3AL5A 3TN92 4F3JA 4UF0B 1S2ZA 1S55A 3KLSA 2DVAA 4N53B 5ANQA 3VZOA 5FZHA 4Y26A 5CG9A 1U5XA 1WKYA 1XSQA 1ULCA 3O1MA 1S0BA 4POGA 1PIV3 2VZTA 1NZIA 3DKWA 3LD8A 4H55A 2I45A 2PA7A 4AR3A 2FQPA 2ZGRA 3FHIB 4Q0UA 1HB3A 1LHNA 2E7QA 4QPIA 3VDCA 1W39A 2OPWA 4E2QA 1BEV3 3PIP1 2ZCWA 1F4HA 5IK5A 1DU3D 4QX3A 4PJYA 4IUGA 3O14A 1UYYA 1PMJX 1W6OA 4CU7A 1D2QA 4DS0A 4AOCA 4ZN1B 1N1TA 4CU6A 1OUSA 3PU8A 1QCVA 3WF3A 1YK5A 4PQ9A 3I2HA 3PIO1 1AR71 3FZ3A 1WA6X 2PSMC 4JADA 3HOYL 3FBMA 3OGSA 5JI7A 5JVG1 4E8CA 4B4RA 3OCPA 2CR8A 4CUBA 2CU5A 4A7ZA 4AEMA 3DN7A 1H9PA 2Z5WA 3DCQA 4XFIA 3ZFEB 1AX2A 3BU7A 2YROA 3T4VA 5EHDA 3SISA 3J7HA 3T4HB 5JOYA 1PO11 1REFA 3A44A 2VMDA 4LJHA 4DXSA 3J4UH 2HVYC 2HJIA 1W9TA 2WS92 2WZR3 1XPWA 4ISRA 3WDWA 1GNYA 2VVFA 1SDWA 3VL9A 4I0WB 5IAVA 3TN91 3HNMA 3FUOA 1RUH1 3P3PA 3JBG2 4XYXA 2Q30A 2NQYA 3AP5A 1ZVFA 2Q8CA 2ZHLA 2JG9A 4EN6B 5C3EL 2PN5A 5T52A 1RUD2 3M3QA 1RHI2 2YC2A 1NY71 4FOYA 2MNGA 4JQRA 2XJSA 1Q43A 1VBB3 2HLEA 2W39A 4CUGA 2ZGPA 4JRLA 3GZTB 1RVF2 3NJVA 2GNTA 5JCTA 2VCBA 1W0NA 1FXZA 1UD1A 1S2BA 2BGCA 1JYVA 5GZCA 4NO4A 2VCAA 2D3SA 2A1XA 4LIUA 1QOSA 4LHLA 4XZUG 3ELNA 1D4VB 4UXAA 2QTWB 1T6GC 4LA3A 4OUEA 2JXAA 4QQ2A 4UOJA 4A6OA 4EYUA 1XE7A 3I7DA 1NLRA 4R4XA 1QJY3 1NA1B 4TLFA 8RXNA 3T2PA 1MS1A 4QPIC 5MGNA 2RS31 5BNNA 1X50A 2KA3A 4QPIB 5T55A 2PMWB 4CRQA 2GAUA 1OFNA 3EBRA 5CKQA 2K46A 3AVSA 4BB3A 5C8WA 2EA7A 1E57A 5C8CB 2ES3A 1JYTA 1TG7A 4HXCA 1SFNA 1ULDA 2VR4A 3JBG1 3I2DA 3DYOA 5EYYA 4ONUA 4XFHA 3RZOL 1W6QA 1UOJA 1R64A 2WAAA 2VUDA 2JWPA 1WCSA 2ZEZA 1RHI1 2GC3A 2J9UB 4QQPA 1GQHA 3OY8B 3OGVA 3S17L 1UNBA 2VVEA 1LTLA 3G7DA 4PHZA 1W9YA 2JDKA 2ZX3A 3WW3A 5CAZA 3D82A 5LA9A 3USUA 1SZBA 1Q8QA 2G4IA 4QQHA 5ERLA 4G3YC 5GLWA 1GKBA 2O0OA 4OVEA 5M3FL 1UMHA 2YG0A 4CCJA 1SBDA 7RXNA 3Q8AA 1LODA 4P14A 1SLAA 2AEYA 2ZEWA 2W92A 1SEFA 1X36A 4XFBA 5AVAA 3BTYA 1YJLA 1MS5A 4HONA 4FFFA 4QU1A 3RYPA 2GZWA 1KITA 1ZBA2 4R9AA 4PDWA 1SFYA 2HWB3 3ACGA 3MUY1 3LSDA 1E5IA 4CTEA 4QX8A 2XJTA 1NE4A 1QNYA 1SLLA 4FI9A 1V6NA 1ZZ9A 4Z92B 5FZDA 1NQDA 1RUOA 2HEWF 2KN9A 4XIOA 2DVFA 1H30A 3HJRA 5D21A 3JB8A 4AZZA 2WQZC 4BK5A 5KXDA 2HBUA 1JYNA 3WNKA 1VRBA 3PUQA 5FOJB 3MICA 3VBSB 5A3NA 4X6AL 5GAHc 1WLCA 2WB1P 1YO8A 3H9CA 1C1FA 2QQIA 2RS13 1R091 1ZA4A 3C2UA 4JKKA 5KXCA 1RYTA 1R0GA 3VPBE 1CAUA 2XVKA 4M3CE 3WY6A 1H2KA 5IP9L 1W6NB 5AC92 3TWIA 4K8RB 1GP4A 4FPGA 5A1LA 5IK4A 3LNLA 1GP5A 1VP6A 3NKTA 2WT1A 5EFUA 5FYHA 4YZ1A 2GP5A 3W20A 4DMIA 3PWFA 4NUBA 3TEYA 1H4HA 2HWC1 2C4XA 2DFCA 2R1DA 5L7OB 5JR2A 1UQXA 3POSA 4YWMA 3BOWA 3SCHA 3HQUA 1J83A 3LA7A 4P9IA 4A3ZA 2VXJA 5LK5A 2C5DA 4QQOA 3RZJA 3GM8A 1W6PA 2VE1A 3GTPL 1DCSA 2G9FA 4LBQD 2CGNA 3E1F1 3HN3A 4WVMB 3WHTA 1GBGA 2BWCA 5C3OA 3H0GL 3A4UA 3BIWE 1W6QB 5LY2A 3ZXKA 1SLBA 4FPCA 1AR73 3OGGA 2IXIA 4FFGA 1W8TA 1GOFA 4LBOA 2D43A 5A7WB 4ZONA 1A78A 3ZMOA 4LIVA 5A7SA 2W1QA 4AQTA 3ZDVA 5J7MA 2BERA 2ZGLA 2XLAA 4LBJA 5D1IA 4ASMB 2VCCA 2Z4FA 4P08A 4Q0QA 5FZOA 3O1PA 2FCVA 4I30A 4INDA 1CX1A 1PO13 4LKFA 3USUB 4Q4W2 4YYOA 5LASA 1AYN2 1IS3A 4QKBA 2NLRA 4BDVB 1BMV2 4LOTA 4A3KL 3FFZA 2XXZA 2RDRA 3S6PA 3I54A 1Q56A 2GMPA 4PDWC 4OI1A 5RXNA 1BXHA 1FPN1 3TN93 2DU0A 3ZYIB 1VMJA 1GU3A 5H9SA 5AC91 4I3GA 1RUH3 5FQ0A 4J1XA 5C71A 4YVSB 1QKQA 2ZABA 3FLTA 4A3XA 3U75A 2FDFA 3THDA 4CP9A 4D7TA 4B1MA 4AF9A 2P37A 5FY5A 5FPXA 4NWWA 1G9AA 3RZDL 4CXXA 3RWNA 2SBAA 4JRAA 2FZ2A 4HN0A 1JTZX 4E8DA 3R05A 3DF0A 1JZ2A 1JZ5A 1LULA 5IY0A 2O8OA 2DTWA 2VOXA 1O7FA 3U11A 5C7GA 1ZZ8A 4OULA 3H3VM 2R062 4SLIA 2WFPA 5FYVA 3U4XA 5E8AA 4A3EL 1Q8SA 3MI8A 2A6XA 3IKWA 4E4ZA 2D5FA 2OVUA 3AJZA 4UFHA 4K6BA 1S0JA 3H3ZA 1FOD2 1J1TA 1P8JA 3A0KA 2JECA 1ODNA 1IU6A 2WQ4A 2WNUA 3PMSA 1OI6A 4LMFA 4N90A 3JQXA 4XVHA 4YW7A 2AYHA 1ULPA 3HNBM 3OGJA 1LOFA 1J1LA 5KHJA 2VL4A 3RMXA 2BJSA 2RS33 1RIRA 1QYBA 4C3HL 2ARCA 4XFFA 1A34A 4Q4X2 5LA1A 1OOPA 2ZGOA 3S1QL 1HDKA 4Z2AA 3N9PA 5FPLA 1MVQA 5BPXA 4BLIA 1BMV1 4LORA 4LLOA 5EP9A 4XQ4A 3UYJA 2ZHKA 3P6BA 2J1EA 3LWQB 3VBRA 4E9KA 5FJ8L 3SITA 2JDMA 4D7SA 3E97A 3S57A 3FE5A 3ZSKA 2HH9A 2OZJA 2Y6GA 4M3CB 2CAUA 3JBG3 1HN0A 3Q8CA 2XUMA 3LWRB 1GZWA 4LKDA 2LW8A 5EJ3A 5JMCA 2QCSB 2CY6A 1HB1A 4DZGA 1RHI3 3I4ML 1K3IA 1LOCA 1GOGA 3ZYRA 3WVJA 2ZHNA 3S1ML 3D4KA 4RHV2 2KKDA 1RUI1 2CHHA 5A3MA 4XJ8A 3WQ7A 3VZMA 4BQWA 3ACHA 2R92L 3RI9A 4JTNA 1SFOL 5IK8A 1AR81 1PZ8A 4MYEA 1PVC2 4RS5B 2VULA 3GYDA 4F83A 3UGGA 4AVBA 3HR9A 5C3RA 3INAA 1FOD1 1GV9A 1B09A 5T5JA 5FQ0B 1EV12 3CJIA 2R7ZL 2VMCA 1YYNA 4BIFA 1YI9A 3DEMA 3RYGA 3WCSA 2MHFA 2PQSA 2FDJA 5LBFA 3K48A 1PZXA 2B63L 1CESA 5JUVA 1W9SA 4AR2A 5CISA 2RM21 5C4JL 2JKBA 4Z1VA 3KGLA 3E6CC 1O4TA 3ILFA 3I97A 5B4NA 4MGTA 1WBLA 4BWOA 4PBPA 3VHPA 1PMHX 1YXWA 3E5XA 4QWNA 5KXBA 3T0DA 4I09A 3CBNA 1TZOA 4COVA 5JSRA 2E31A 1KEXA 1R093 3PJQA 1IOAA 1SHWB 4FOVA 3WXPA 2QQMA 2WNUC 3ALQA 4KBZA 5FMDA 5FUIA 5LRRA 3ZPYA 4GALA 3UGHA 1TWAL 2WNUB 3O1VA 4XTMA 2E26A 1PFVA 4EZ4A 5IVVA 3ZN6B 4QD2A 1LOFC 2V4AA 4JAAA 4C1WA 1L7RA 5F5IA 5DABA 2XJUA 1W6MB 2G1MA 3UK9A 2R32A 2HWC3 3D0SA 1OOPC 4BZ4A 4NIGA 1CZSA 1AUYA 1KDKA 4N43B 1E8JA 2VTXA 2VECA 4QX0A 5FKCA 5FZ8A 1W8ZA 1BVVA 1G8WA 3MIHA 1XB9A 3MHZA 1PVC1 4IEQA 3VBRC 1XE8A 4RL7A 1FAYA 2BFUL 3LA2A 5C70A 3FDJA 2FMYA 2OT7A 2WN2A 4YM3A 5BUVA 2WA3A 1EV11 4TVMA 1E5RA 1QF3A 2JIJA 2WWUA 2VMGA 5DM71 1PK6A 1GZWB 1XU2A 3MDPA 5F32A 3WNLA 4BK4A 1A8DA 1MZEA 2D44A 3W5MA 4TZDA 4A2UA 2PHFA 4CDWA 3V0BB 1PNFA 3NNMA 2UY8A 2ZGKA 3WX5A 3PNAA 4PF1A 4QX1A 1YQ6A 3KF3A 2NZ9A 2BGOA 1LU1A 3ASIA 5JIAA 3ST7A 4IV3B 5BYNA 1QJEA 1E5SA 4LK7A 5BNOB 4CDXB 5C9AB 2Q4SA 2TBVA 3EQEA 4QGMA 5A7OA 4NR1A 1US3A 3S16L 2IVJA 4QGNA 4XXBB 2HYKA 4XMAA 1W2UA 4CDQA 4IERA 5FKBA 1Z7S1 4AK3A 3WEZA 1K42A 4HVQA 1NG0A 3H1WA 3JB4C 5FLHA 3N9OA 3DECA 3CJIC 4FP2A 4QKNA 3HAXC 1FPN3 1QXRA 1REDA 5AC93 4MG2A 1SFPA 3KS7A 3PTRB 1J84A 1BCXA 2IVIB 3M1HA 2XL7A 2UWAA 1PGW1 3K35A 1Y43B 4A7KA 1KS5A 4ZXKA 1BHGA 4P9YA 3RVHA 3U4SA 5GZGA 3V0AA 2CKCA 1QJFA 4RXNA 1K5JA 4SBVA 5HV0A 1V6JA 2J42A 1NYWA 2D6MA 1O3TA 3C7EA 1GP6A 3SNMA 4AQ6A 1F8VA 1PO22 4ZZ5A 1C8M2 3MW3A 2XBO2 3KHCA 2W52A 2YXSA 3UGFA 4BOWA 3MSUA 4WFN1 3WZ1A 4ZHNA 3ZFGA 1GOHA 3SMHA 3SCFA 4XBLA 5T50A 1DHKB 2DBIA 3SKJE 2VZUA 4W6WA 5JR7B 1FV3A 1POV1 5KHGA 3FFQA 2JX9A 1WD3A 4V196 2BGPA 3SS2A 5HCBA 1OWCA 1I5ZA 4C1XA 4QX7A 2OW4A 5FY4A 2R042 2R072 3U78A 4K1YA 1WA4A 5EJ1B 3CKHA 4L92A 3T0BA 1J3RA 3WR0A 3ZSJA 3SLIA 4CPBA 5JXJA 4WV8A 2ENRA 2ILMA 1OKOA 4QHOA 4JX0A 3MIBA 3N9QA 1PK6C 4BU2A 1XYPA 2E33A 3TEWA 1ZRDA 3OUHA 3ZFFA 1PK6B 4QXKA 2E2IL 1HRV2 3HOWL 3I4NL 4FXKB 4LKEA 3WW2A 4CDWC 5JI9A 1IROA 3MPSA 5H9QA 3EO6A 4CDWB 5JAXA 3KB5A 1T9QA 1T9PA 5A6YA 5ISLA 3LKJA 4POFA 4MGYE 4YZ4A 4CDUA 1KQRA 3GBGA 1SLTA 3D8CA 5DZFA 2FDGA 5ACA2 3SXWA 1V0AA 1ULGA 4FFHA 1UAIA 5IW0A 1RUI3 2NM1A 2VXRA 1IQAA 4CDQC 5CG8A 2J1TA 3LPFA 2PTMA 4GIQA 4K40A 2ZX1A 5FZ1A 5EJZB 2WQ8A 3BOPA 4Y4YA 2GNDA 5CIRA 1PO21 5FRAA 1ST8A 1AR83 3PKJA 5C4WB 3F2ZA 4AXOA 4UFIA 2D6KA 4K8FA 4NRMA 4A3LL 1FOD3 2VOWA 2X53S 3AJYA 3K3NA 4GWMA 4C2M1 2OKXA 2MPFA 4XCAA 1UZVA 5FY8A 3SH3A 1OBNA 1ND2A 1Y9MA 2JDHA 4CSWA 3KF5A 4LR4A 1NOVA 1CJPA 2PHTA 5E6HA 3LSEA 4Q4Y1 5CFCB 2I74A 1IGOA 2VH9A 5FPZA 5FXZA 2WUHA 2HKXA 5J09A 3D3AA 5CNAA 4COWA 3ROUA 4NAOA 2R071 2RM23 3ITQA 2XONA 2C6BA 3EJKA 3VKNA 4WM8B 1QQTA 3ES1A 4MH0E 1GICA 2FCUA 4RA0A 1TQ5A 2GALA 4PQQA 1K83L 3POYA 4P9LA 2B45X 2JI3A 1HRV1 1XJAA 2QNKA 3ZFGC 4Q0SA 2AENA 4WZFA 1UN1A 1EAH2 1VB4A 1WCUA 1V00A 2ZACA 4YVWA 3GHNA 4IGOA 3CIHA 3VD5A 1F35A 1UKGA 4AQ2A 1NNQA 3NJZA 4AFBA 4Y52L 1H8TC 3WQ0A 1ZREA 4XQWA 4Q2FA 3ZYJB 2PFWA 2KD7A 3GNEA 3N9NA 1H8TB 1WCML 3IPVA 2Q1FA 1VLNA 1VZGA 2VMEA 5DZEA 5A33B 2BRTA 2JG8B 3DKQA 1I6XA 1DYPA 1PVC3 1UPIA 3GTOL 1WMEA 2BOIA 2XGXA 1PZ9A 1YFXA 4IEZA 4GH4B 4N7UA 4FPOB 3ZFFC 4ATEA 2W3JA 2BTVC 2HEVF 5AI3A 1F31A 1EV13 1RUG2 1AXZA 2XMLA 3GTLL 2LCQA 2PHDA 1LTEA 2XHNA 2BV4A 3HOBA 4XAAA 5DZGA 4CDUC 3TBDA 4Q1RA 4KG0A 4XCBA 1WW4A 4ARXA 4XJUA 3J7Y1 1H6XA 3OYWB 3KD4A 1VZHA 1W8NA 3OUJA 4CP2A 5D2AA 2JDNA 4E4HA 4IV1A 1PHMA 3N3HA 4BQ5A 5ABJA 4HKLA 4FBFA 5FYCA 4D3WA 2E2JL 2CV6A 2VUJA 4QQLA 1GZ9A 1XBFA 4JGZB 2DFBA 5CKMA 4D0QA 3GF6A 5EIYB 1Z7S3 3D0JA 3I2GA 4YW2A 2P3YA 3WDVA 3I3BA 4Y3OA 4YRDA 4KGQA 4AFMA 1Y9QA 5FZMA 4MZUA 3N9LA 1S0FA 1H4GA 2PHUA 2ORZA 2VQ0A 5HXMA 4CCOA 1ND2C 2ZMLA 4A3BL 4AGGA 4F8AA 1OQ1A 4YWAA 5LWBA 3KYXA 3MO4A 2AYJA 3GZAA 3KT1A 3OOXA 3AFKA 1LHVA 2X5IA 2ZEXA 4FPFA 4P5HA 4WM7B 5A6ZA 4AR6A 3HJYB 1OT5A 2E2HL 1PM7A 1YEWA 3HPNA 3E5UA 3J8F1 3U10A 3MYXA 5HCHA 3CHXA 4AHWA 3BN6A 3SQOA 1NZCA 1OXCA 3RNSA 5FIXA 2XQRA 3KT7A 4G9SB 3HT1A 2QL0A 3IM0A 2IWGB 5FWJA 3E6BA 3H9BA 1BJQA 4ZU5A 4AFDA 1RUF2 2VQUA 3GJAA 2PAEA 4YZ5A 2VQAA 5F5CA 2F17A 1JMUB 4OCTA 3KQRA 2TNFA 4IW3A 4OHYA 4B4QA 4YVWC 5FZ6A 2C0ZA 4XJ9A 1BBT2 3NNGA 2X29A 4PLOA 2Y6JA 4YVWB 3WD5A 2QQPA 4GXLA 4WVWA 3KZ4C 5IFPA 3UETA 3N7JA 3WNXA 2BYVE 5JLVA 3IDEA 2Q8OA 4YW4A 1OQEA 3A22A 2HWF2 1XRUA 4URAA 1POV3 5FZ7A 2W94A 3LE0A 2DUOA 5GZEA 2XL9A 4I2OA 1AYM2 1U5IA 2F4PA 2JE8A 5FBZA 2B42B 5FWEA 4OFGA 5LCWL 3DL3A 3RGBA 3GXUA 3OEAA 2Y0IA 3AMNA 4MHUA 4GWJA 4Y22A 4IQPA 1O59A 2PMZP 1S0EA 2NN8A 1MR5A 2ZS6B 3CO2A 4R9BA 5EQUA 4MGKE 5BNQA 2CWSA 4PF5A 3WG3A 1J59A 2EAKA 4WBBA 3MIFA 2YHJA 3AK0A 4X8PA 4ZS3A 4AFAA 3KT4A 2EXIA 1TWGL 1HXS3 1CAVA 2JKXA 2X8KA 3OG2A 2R0HA 4FQ4A 4N9IA 1YUDA 4D94A 1S4CA 4YGDA 5FYYA 2WWSA 4AVSA 4AL9A 1WLTA 4DFSA 4C3JL 2WIIB 3LFIA 3SEEA 1U5YA 5ABJC 3VLBB 5KHIA 5JPMB 2VL6A 2YU9L 1W0PA 1JI6A 1VBD2 3N9MA 3O12A 5D8AA 4PIXA 3WG2A 2K2SA 3HAGA 1NLQA 2GMMA 4JHZA 3O0XA 1QJU2 3RZGA 1PO23 3R4SA 3PVEA 4OUMA 2D6PA 5E88A 2NVTL 1HQWA 1BQ9A 4YPJA 1AXYA 4TLGA 4XJAA 2X05A 5A3OA 2GN3A 2HWD1 1OQDA 2LROA 4QPGA 2ZZJA 4XZPA 2P5BA 4NIIA 2X5IC 2XJQA 3L9JT 3ZXFA 2W08A 1Q3EA 1GWLA 2HWF1
chains in the Genus database with same CATH topology
1H2LA 3UJOA 4Q4Y3 1EPZA 5GZFA 3EXUA 1VBC1 3AMPA 4LNVA 1AYM1 2R073 4H7LA 4HFSA 4AI1A 4PIYA 1IPKA 3ZYPA 3PVOA 4CEYA 3RMYA 4AG4A 4DPNA 4L11A 4NPRA 4LA2A 5FREA 1HRV3 3B0AB 4FPHA 1RYQA 3AM2A 2VW1A 4DRVA 4XQDA 5BV6A 2JE9A 2ZGSA 2XLGA 2D98A 4EJRA 3RJ2X 2WSVA 1V6OA 5T5PA 1V6IA 1VBD1 4META 3ZN5A 2P17A 1LHWA 4I01A 1Z0HA 4NOTA 1TMF2 4AGVA 2DV9A 1X8MA 4Y22B 2O8QA 2RR12 1MQTA 1CAAA 4AEKA 4CZSA 4RR3A 2ERJA 5F5QA 1ZBE2 1FHHA 2ZPXA 4LE4A 2WT2A 1AR61 3QACA 3M2MA 2VNOA 2JE7A 4Y20A 1RUNA 2ZHMA 4B4PA 1B2OA 1LOGA 3MFCA 1C57A 5D8AC 3I59A 3OF1A 4Y1UA 3GBWA 5JOZA 4AWDA 2E7TA 4XHXA 1CAWA 4D7YA 3RRDA 4Q0PA 2DCKA 1QH7A 2GNBA 5FLIA 4ASLA 4AFCA 4XMIA 4H14A 3N35A 2R16A 1O3QA 4FOQA 4DNYA 1VCXA 2GC2A 2ARXA 2NMOA 2WS91 1G7YA 2I2SA 3CF6E 4QMAA 4QPGC 2YUEA 1W6OB 4LHKA 3H50A 3ZN4A 2D97A 1NCQA 2DUPA 2FMDA 2BUKA 2NMNA 3QCWA 4DQAA 4LO5B 1PVXA 2H6BA 4MX3A 4BHPA 2XWBB 4AEJA 5CBLA 2WA4A 4J6GA 5K7PA 3J8F3 4GULA 2Y0OA 1RUD1 3R6SA 2NYDA 1TMF1 4QPYA 4CEYC 1ZRPA 1QY4A 1JOJA 1XXNA 1WMFA 1RL3A 3WWLA 4HPKA 1XU1A 3KM5A 2KXLA 4KL1A 2XJPA 1RVF1 2QE3A 4R4ZA 5F9TA 3ZG6A 2ETEA 5E16A 1LJ7A 4Y24A 5JWPA 4QM9A 1V9U2 4ISQA 4YNIA 5EV7A 1HLCA 1Q8PA 4ZU4A 1C28A 1SMWA 4Q8LA 3NAPA 2JG9C 3FBYA 1Q8VA 2JG9B 3QD6A 5FFOC 3ZXAC 4U36A 2R0FA 1HW5A 5JSOA 2OA2A 2YYOA 2A6WA 5E89A 1XNDA 1LGCA 5GLVA 1ENRA 3ME2A 4HVOA 1MQTC 1OMIA 4HK9A 3VZJA 3VV1A 1SCRA 1MQTB 3JCIA 1I3HA 3DPRA 3VHNA 5I0TA 3H0OA 4K3UA 2E9QA 2RE9A 3AMQA 2RHPA 4RSUA 4Y20B 2D40A 4AI8A 1N3OA 1XYNA 1SACA 3N7KA 4OHXA 2A3YA 3EHKA 3RJRA 1VALA 4LUMA 3UV9A 1BYHA 2ET1A 4S2HA 1DQ4A 4OI0A 1IW7D 2YDEA 5BNNC 3AYAA 4Y1ZA 1GFF2 5BNNB 2PAMA 1FHMA 1F5JA 1GANA 1WLWA 4PLMA 2C1FA 5L19A 1AL22 1JYIA 1U5ZA 2YZ4A 2DU1A 3AZXA 4O9EA 2HWD3 4AI2A 1ZBA1 3IBMA 3S7IA 3AKSA 2HWF3 4U671 2PLV2 2VMHA 1VBC3 4LO7A 1AYM3 1ZZCA 5I91A 1BE7A 3MPBA 1CAXA 1XNCA 2B9UA 2A70A 4ME3A 3WT3A 2LUWA 1MS4A 3M70A 4PIZA 2BE5D 2V73A 4JDMA 5SV5A 2M6PA 3L2YA 1CIWA 3I8TA 3NO8A 1YWKA 3HWJA 3RPQA 3LAGA 1EYBA 3NAPC 2Y38A 3RDIA 4IEVA 4PDWB 2XWJB 2Z3RB 1AJKA 2IXLA 4MXVA 5EZWA 4B3NA 4XFAA 1UZYA 1MS8A 1QDCA 1VBD3 1ZX5A 1G86A 2ZGMA 1CPMA 1H7VA 1HIXA 2FHRA 2R49A 3VKFC 3ZYGA 4FAHA 1N47A 3B02A 3BALA 3DPRC 4YGCA 3DGTA 2W0XA 5JVH1 1COV2 1GNZA 2ZAHA 3DPRB 3WDUA 2V0EA 1BFYA 1WCKA 1BKZA 4OLLA 2P3JA 2E7AA 1AR63 1H1AA 4R9DA 1CAUB 1VAVA 1UF2C 3N7MA 2QZ2A 2ZJCA 3MLJA 1VBA2 2D5HA 4GA9A 4YGEA 4BLJA 3SCGA 2AUYA 1QJX2 4BQ1A 4JAGA 3HT2A 2UYBA 3TYJA 1VRH2 2TUNA 4COYA 2XJVA 2DCTA 4LBKA 2ZA9A 4Q4W1 4XF0A 4Q0VA 3ACLA 1S30A 1AYN1 1OFSA 1AVBA 1A3KA 3KCYA 1H1MA 1NLSA 2HR5A 1O3RA 2WS93 1W6PB 1Q8OA 1YV1A 2QZ3A 1RDVA 1QH6A 4FVVA 1QOTA 3ZXGA 4B29A 2GDFA 2BPA2 3AP6A 1B2JA 1LOBA 1RUD3 3H3UA 3ILRA 1TMF3 3NKGA 1FMD2 5I0UA 1O5LA 3LOIA 4IEUA 1HQLA 2DVDA 1COV1 3ZXDA 4S2GA 1RVF3 5KWRA 2R061 2XB6C 1G9DA 2IZWA 1AZDA 4AVTA 3L2HA 1M06G 3WOGA 1RWDA 1R1ZA 2CGOA 4AGRA 2ZTNA 3IDCB 3P2AA 4XOGA 2WSUA 4LBLA 1KJLA 1A8MA 1NQJA 5J3UA 3O0VA 1O3SA 3DUIA 4KG8A 2IFWA 4AHZA 1MS9A 4UW6A 2VMIA 4Q4X1 3UKNA 1DYKA 2PELA 3R4DB 2EXJA 1X82A 4UW5A 1H0BA 4YW3A 4YM1A 2B8MA 2UURA 5K8SA 1CQ9A 3WG1A 1IZ3A 1DGWX 1UCXA 3VBOA 3N4MA 2Q0AA 1RITA 1WW6A 2XVLA 5BXXA 3B93A 2RJLA 1YFWA 2GC1A 5CB7A 4OUSA 1IS6A 2D93A 1ASJ2 3AP4A 3H1MA 3VZLA 1TEIA 1QJZA 4RHV1 1JHNA 4YARA 1QHDA 1V70A 1URXA 1REEA 2KM2A 5KC6A 1OOPB 1MZFA 1VBE2 2AZ5A 2A6HD 1O5UA 1DQ2A 1WLDA 2VVDA 4XW3A 5LRSA 3VBRB 2G9GA 5EIOC 2DVBA 4GB32 2H6CA 1SCSA 1N1VA 1ZBA3 2A6VA 2HWE2 3HMYA 3P3NA 1OPMA 4HL0A 5JOWA 5T3NA 3T2TA 4AVAA 4K1ZA 5I8YA 2VY0A 4YG3A 1LHOA 1RJ7A 2A5ZA 4JTOA 4XIKA 4LULA 1VJ2A 4QM8A 3ZVXA 1W0OA 1RB8G 1DQ1A 4XEZA 5GLUA 3PTYA 2HEYF 2AGSA 3RZZA 3QH7A 1LENA 1G9BA 4D69A 3ENRA 4JDNA 4HVRA 4URTA 3ZXJA 3RYKA 4S2DA 2RJKA 3V56A 3ZSEA 1IRNA 2ZGTA 4OHWA 1ZZBA 4FXGB 3APBA 4GMP0 5CADA 3CJIB 5JZGA 4B8CD 2WFF2 2QDNA 2CTVA 3AYCA 3KGZA 3RS6A 3PJYA 4AQSA 4YSFA 3VBFA 5I8TA 1CVNA 3LB9A 1D2SA 3RQ0A 3SH4A 2NYYA 5GALA 5HCAA 3AYDA 3E6DA 4EN0A 3KYWA 3AZYA 1K5MA 3OBRA 3OBTA 3N36A 4LLFA 5C33A 3VBOC 1RUC2 4UW4A 3QVDA 1Q5OA 4GB31 2HWE1 4IETA 4ES8A 2IC1A 1C1LA 2ATFA 2IXKA 2RMU2 3PKIA 3LA3A 3RZ6A 4DINB 2H0BA 1MACA 1VB2A 1G9CA 3KSCA 3WINE 5DDJ2 2E53A 2CKAA 2YC0A 1BQ8A 2BVBA 1J58A 1LEMA 4GKYA 4Q4W3 1HRI2 3LZZA 1PIV2 3GZUC 2B39A 1AYN3 2WL1A 5EWSA 3NFPI 3MIDA 1RMU2 1YUXA 4KU8A 3O7OA 5GAEc 2UWCA 1BEV2 4HT1T 4MGZE 1U0AA 5F1RA 4ITCA 5LEJA 1HX6A 2DWRA 2WFF1 1CADA 1FV2A 4B7KA 3KMHA 3IWZA 1O4YA 3THPA 5TSWA 1ENSA 4WVZA 2W68A 4AEDA 5HI0A 5HXVA 4EROA 1COV3 3FUQA 5CFDA 4IESA 4W65A 4HKOA 2R063 1SBFA 4AI3A 1AX0A 4CDQB 1F5FA 3AKPA 1Y7BA 2QFEA 1IU5A 1C8M1 2XBO1 4EN7B 4W6YA 4GQ7A 4PCRA 3PLQA 4RQPA 2DCYA 4JVAA 5JZGC 1WBFA 1PMIA 2WZR2 5JZGB 3AKTA 1S2KA 4M3CF 3VBFC 3UKTA 1NXGA 2P3KA 4FP3A 4TPUA 2A3XA 1YRZA 5DDJ1 1B13A 5BNPA 4Z8BA 3V0AB 1HRI1 3BPZA 1QQP2 4Q4X3 2CWMA 2R041 4XILA 4FPYA 5AFBA 1A6CA 1RMU1 3OPZA 3VKLA 3IN9A 2VNGA 2XH6A 2ZGQA 1KFUL 1LKNA 1VBB2 2Z42A 3ZXLA 4EV0A 2GN7A 2M6OA 1WUVA 4YZ2A 4E6YA 4HETA 3WCRA 1TNRA 4X6RB 5T5LA 1DFQA 3ZFGB 1YUZA 4LEJA 5J48A 3S7EA 3KYVA 1SMUA 1QXJA 3LWCA 1YFYA 4RHV3 5ACA1 3B69A 4R52A 4EWEA 5I93A 5GLTA 1BK1A 1QJY2 4EWDA 4Y1VA 4IL7A 1DF0A 2C6AA 4XGHA 1YFUA 1TE1B 1VZIA 4L97A 1JW6A 2IXCA 4PLNA 1CN1A 3ZFFB 1SMMA 4Y1YA 4MLOA 3ZX7A 3ZSLA 3WDYA 2FZ1A 2CNAA 4CDUB 1QQP1 1ONAA 4E4SA 4B8EA 3WW1A 1CX4A 2B5ID 5IK7A 1NCRA 5CFDC 3NWKA 5GJ6A 4TYSA 2FBEA 2N7GA 2YV8A 4W6XA 4XPVA 5CFDB 4JGYA 4XXAA 1DX8A 3TB0A 4C91A 1OA3A 2DF7A 4RQPC 1AR62 3S30A 4RQPB 1RINA 1EAH1 2BQPA 5HBAA 1KRIA 5MF6A 2JD4A 3WP6A 1DIWA 2R6QA 1ND2B 5AFEA 1ZNPA 5BNPC 3AMHA 1C8NA 4N53A 2UU8A 2HWB2 3K51A 4WZCA 1MZ6A 1WD4A 2WT0A 4JCKA 2ZGUA 3NW4A 1UZZA 2K9ZA 2IFRA 3E5QA 3T1LA 2M4VA 1MEC2 1DGRA 2P34A 4Z07A 2PPTA 5GLZA 2V0FA 4GB33 1YCIA 2HWE3 4IEYA 1SMVA 1RUG1 2NPIA 3KYUA 3WDTA 5MFZA 1C3HA 2ZX4A 3B01A 2RS12 2YGLA 4J1WA 1NXEA 2WLQA 1LB2A 2DUQA 4ORFA 4LO6B 1OHFA 1D0HA 4ZU7A 3M3CA 3B3QE 3ECQA 2OUHA 3IPVB 3ZFEA 1AR92 3M8LA 4IEWA 1DZQA 3VBHA 4JAEA 5T5OA 1FATA 2BEOA 1UIKA 1RUJ2 2YY1A 3QOPA 4YFWA 5DUXA 5SV8A 2EALA 2Z3QB 5KC5A 4BYYA 3B5LB 1KJRA 4X6QB 1LR5A 2MS3A 1DGWA 2WFF3 3M3OA 4KBBA 2LALA 1NCRC 1C09A 4I0AA 1DG6A 1QGLA 4K7JA 4HSJA 2OYZA 1UU6A 5F6KA 4BPZA 1DZTA 5FOBB 2MEV2 4IV1C 5J96B 4JGYC 1ZM1A 2JICA 1MEC1 4IV1B 5IUQA 4RGGA 5ABJB 2XVGA 3MF6A 1RUF1 3MW2A 3TRSB 2H0VA 3AMMA 1KXGA 2E63A 1UMZA 4IXLA 1C8M3 1PO12 2XBO3 4LO8A 5T54A 4QU2A 1RDGA 1NXD1 2IXJA 1BBT1 3WP4A 5A32A 4MGIE 2B5HA 1YIPA 1Z78A 4N53C 1IPJA 4TWTA 2X5IB 4KWKA 5DDJ3 1RUH2 1QMJA 5CU1A 4COZA 1TNFA 1HRI3 3TOJA 1AR91 1DGLA 1NA1A 4BA6A 2R043 5FCCA 1RMU3 1RUJ1 4YG0A 4YW1A 1PGSA 1NY72 3AX4A 1YNAA 2PYAA 2UY9A 5EYXA 1FNYA 5K2ME 2PAKA 4XF9A 2BNOA 2VGDA 2WC2A 5C8CA 1YIFA 4U2AA 2PVEA 2JI2A 4N7IA 2BVVA 1WW7A 2ZMNA 2MEV1 4ES9A 4BE3A 4EWAA 3ZFEC 5ACA3 1FX5A 2ZKLA 3VBHC 1D4M2 3OY8A 2F6BA 3VBHB 2A6YA 1GZCA 1QJU1 2RS32 5J37A 1AHSA 1HV0A 1QWRA 4XXPA 4K20A 1QNWA 2YPJA 5J98B 1DQ5A 4OI4A 4AE2A 4M00A 3VDDA 2CAVA 2D6NA 1GSLA 1ZRCA 3Q9OA 4HSLA 4I3PA 2K2DA 1CAVB 2BNMA 5KHKA 3J26N 1MS0A 3VKOA 5C6CA 1QQP3 3B9IA 3AB0A 4V1PA 5KHHA 1OLRA 2QJVA 4HZFA 2VNRA 5D8AB 1EP0A 2GSYA 3W58A 3B00A 1ZYBA 4HANA 1HKDA 5MLC3 1CONA 1LKPA 1S0CA 3H7JA 4X8NA 4HK8A 5A32B 3VBSA 2GMEA 2AH2A 3VBUA 1EAH3 1N1SA 4Q4V2 2A6ZA 4WM7A 5FAXA 4Q26A 3RI8A 1L3JA 4QPGB 3FX3A 2XKOA 4L9BA 4FT8A 4XE9A 1W6NA 1JUHA 3CNAA 2XPJA 1I9RA 2JJ6A 4IEXA 1NA1C 3UL2A 1S0DA 2PHLA 4BCUA 1D4M1 4BH9A 3AFGA 3A0NA 1LESA 3IDBB 2IXHA 5L7OA 2RR11 4ATFA 4CEYB 1ZZ7A 2R30A 4QGLA 2WLPA 4XDQA 3WUCA 4K9SA 4HMZA 1O4ZA 5C8CC 1ZBE1 2ET7A 4KQ7A 4Y1XA 1RUG3 3RZTA 3P8BA 5H9RA 2B46X 4WVMA 1N3QA 3R0RA 3WG4A 3VZNA 1R092 1UIJA 1JXNA 4DOUA 5DM61 4E2GA 5GZDA 3GALA 1APNA 4FO9A 5JDBA 1JBCA 3J7Z1 4L2NA 3HD8B 3AP9A 3ZSMA 2HWC2 4M0NA 1RC6A 3CLPA 1UX6A 2XJRA 4RR3C 2PHWA 3RYRA 2PHRA 3VDDC 4Q27A 4Q4V1 4RR3B 4DY5A 2VG9A 1D0GA 4FPEA 3VDDB 3ES4A 1AXKA 1DGRN 1LGNA 2SLIA 4OZXA 2XKPA 4JDOA 2OUJA 4G6BA 3B94A 1NE6A 1LOEA 4YVSA 2M4YA 4FSJA 3OJBA 3I59B 4G4FA 2O5JD 1CAWB 3C3VA 1MEC3 2DURA 2V5YA 1RUF3 2DCJA 2XG3A 1RJ8A 3VBSC 3VBUC 3ATGA 5DUUA 3FLRA 4XBNA 1WW5A 3UKVA 2A71A 4WM7C 3VBUB 1BBT3 3ZDSA 1V9U1 1NCQC 4UBHA 4YM2A 3AP7A 2V09A 2D3RA 2YGMA 1NCQB 1IHMA 5DG1A 3X29B 1FPN2 5LEKA 1XNBA 3JQWA 1DQ6A 4S2FA 3WDXA 3LCPA 5L7OC 1AR93 4KU7A 1ND3A 3MZHA 1QU0A 4AR5A 3WP5A 1RUJ3 4FPLA 4NHLA 4HPKB 3JZVA 1M4WA 4JC1A 4XF3A 3OTFA 3QQCE 3WV6A 4A7YA 4K21A 5CVRA 2PHXA 1XQNA 1H9WA 1WJVA 3LPEB 2GH8A 3J9SA 4M3CA 1OLQA 4BMBA 2LTNA 5IT6A 4LT5A 2ARBA 1SQ4A 1FNZA 2ZX2A 3NAPB 2MEV3 1FI2A 2A68D 1PGL2 1JN2P 3HIFA 3OD4A 1R082 2QKDA 3VHRA 4LTAA 1HQNA 3U0ZA 3RSJA 1SBEA 4KH9A 1QJU3 1AL21 3V65A 4FCAA 3AZWA 2E6VA 3VHOA 4Y5Z0 5E1RA 3W59A 4N9HA 4RS5A 2VW0A 4HLTA 5JPNB 5F6LB 4YVSC 4IEPA 2PLV1 1ZZ6A 2EVXA 1LKOA 2AR6A 1RTVA 4LE3A 4XFGA 1MVEA 2D7FA 4Z2WA 4FTEA 1ENQA 5KBFA 4KGGA 4EN9B 3WQ1A 2ZZQA 1G9FA 3BTAA 4LO4B 2DSXA 2XHKA 3AKQA 4C90A 1RUI2 2ZBJA 4DB5A 4O9GA 4XBQA 3G6JB 1UKRA 3ZMNA 5L73A 5DUVA 4MVTA 5K0UA 5AVPA 1AR82 2P3IA 4Q1PA 4NHMA 5HCFA 1XNKA 3M3IA 3UJQA 1BRFA 4E4DX 1PGL1 1F9KA 2VOVA 2VU9A 1R081 4FTSA 3ZN6A 2EIGA 1GQGA 1D4M3 1ND3C 1ALYA 1S1AA 1W6MA 3KCXA 1ND3B 1PZ7A 1CAXB 2JDZA 5JIUA 4UW3A 2RR13 4N43A 4L8QA 3JUUA 1MZ5A 2RM22 4XETA 3IIAA 2O1QA 2ERFA 1ZBE3 4IEOA 3PMEA 3CJXA 4AHYA 1AX1A 1DZRA 5LK7B 4P9JA 1PNGA 3URFA 1N1YA 3NV2A 2ZOEB 4TSVA 1VBA1 3R4UA 1VIWB 4YWLA 3V0BA 4Q29A 1LRHA 1QJX1 3NV4A 4UBGA 2TEPA 2ZAAA 4XFCA 1CPNA 1VRH1 4AW7A 1AJOA 2GNMA 4ZKTB 4MXWA 4IV3A 2CL2A 2BBVA 3JD72 5BNOA 5CA6A 4CDXA 5C9AA 1F2NA 3QLQA 4GMP1 2BFUS 3WUDA 1WCDJ 3MGUA 2UWBA 4Q4V3 4RS5C 4XF4A 4XJZA 3BODA 4BMEA 3T1MA 1FT9A 1MS3A 3RG0A 1LECA 4RGAA 4RD7A 1S0IA 3V64A 3MIGA 1EPWA 2VOKA 1WMDA 2UYAA 2QVSB 3O5SA 1FMD1 4DXZA 4DRRA 3B9CA 5FTTC 1ULEA 3GHMA 5I0SA 2Q1ZB 1N3PA 4E27A 4GKXA 4R8HA 1BZWA 5K0UC 2Q5TA 1J3PA 1RUE2 5DUWA 5K0UB 1H1IA 4I02A 1VAMA 1V9U3 1Z7S2 2AREA 4PBOA 1KS4A 1X33A 1YK4A 3WP3A 2I07B 4H7MA 1B35A 2DTYA 1JYCA 4L99A 4E2SA 4RFT0 4XF1A 3PZAA 2D6OX 5AN9H 3FMGA 1YJKA 2RS52 3CU7A 3VL8A 4CP1A 1BVP1 2CGPA 4B7EA 1PGW2 1UU5A 4YGBA 1R0FA 2H12A 4N43C 2A7AA 3JD71 1TME2 2EAAA 4HN1A 3MEPA 1OD5A 3D6EA 5L36A 2OPKA 2QDRA 2DCZA 5B2GB 5GAGc 2GC0A 3GBFA 1G6NA 4HKWA 3TAYA 3HQXA 1ENXA 1ODHA 5KXEA 4JAFA 4XTPA 1C5IA 1KDMA 4R9CA 4P9GA 1ASJ1 2LM3A 4WVVA 4YZ3A 2Q1MA 4BOWA 3N7LA 4OHZA 1R0JA 1ZRRA 1LGBA 3NV3A 3FWEA 3PVBB 3ETQA 4IV3C 4MXWB 5BNOC 4CDXC 5C9AC 4Q8KA 3FC0A 4KWLA 4M0HA 2ZGNA 5GKAC 2L0ZA 1AL23 2Y26A 1VBE1 6RXNA 1RUE1 1NXMA 1OWBA 5AI2A 2RDVA 2VW2A 1DQ0A 1V6KA 2E51A 5C4WA 3VBOB 2ZX0A 2QUOA 1GYKA 2EXKA 2PLV3 1UU4A 2RS51 3M7AA 1R1A2 1HXS2 5CFCA 3IMNA 1TME1 2PQQA 3NV1A 3H1YA 2A75A 2WNVA 1OA2A 5JSPA 1LHUA 4KWJA 4FOWA 2YMZA 5JVVA 5GM0A 4WM8A 1LCLA 3OD0A 2Z2SB 4YG6A 1Z92B 3JU9A 2P2KA 2B7YA 2ZMKA 3SHRA 2BWAA 1B35C 4YW5A 3SH5A 3I4IA 1B35B 3WHUA 1HV1A 2WJSA 1SLCA 1JYBA 4CYDA 1O91A 1R083 1UW8A 4P9WA 4EN8B 2Z69A 4NWVA 4Q4Y2 1OKQA 4COUA 3CEWA 1S24A 4LBNA 1H8TA 2WNEA 4LBQA 3QBQA 3D5OA 1YI7A 5H9PA 3TNPB 5A33A 1RUC1 1V6MA 2JG8A 3M4FA 3FJSA 1YLLA 4GH4A 4DY3A 2VUAA 3WWNB 2A69D 1AL0G 2C9AA 1CD3G 1OSGA 2RMU1 2JI1A 1H2NA 3FLPA 1LEDA 4K9FA 4LUKA 1R1A1 1HXS1 1VBA3 2BW8A 2EF6A 5I8SA 2PVXA 3VUOA 4LHNA 1QJX3 2A6ED 3VBFB 3IU3I 1VRH3 2BNNA 2A73B 1JH5A 3OYWA 4FPKA 1PIV1 4XJWA 1K5MC 2WKKA 4AVVA 4BIOA 3ILNA 4AVCA 1WGPA 4GMP3 1K5MB 3B7MA 4JGZA 5C4WC 1LKMA 1R0IA 1BEV1 4C0HA 4AHXA 1U12A 4H3WA 2DVGA 5I0RA 3WLUA 4YM0A 1DDLA 4F7ZA 1DLLA 1UPSA 1ULFA 3USSA 4GS7D 5CFCC 2K0GA 2WZPP 3HN1A 2WNVC 2VPVA 1S0GA 3AXDA 1FMD3 5FMOS 2WNVB 4MUVA 3IT8A 2V3BB 2OZ6A 3KCCA