4AHZA

Flo5a showing a heptanuclear gadolinium cluster on its surface after 60 min of soaking
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
total genus 57
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahzA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahzA01
4A3XA 4CP0A 4COYA 4COUA 2XJUA 4AI0A 5A3LA 4D3WA 4COZA 2XJSA 4AFCA 2XJVA 4AHXA 4AI2A 4AFAA 4CP2A 4AHZA 4ASLA 4AHYA 4LHNA 4GQ7A 2XJRA 2XJPA 4LHLA 4AF9A 4AHWA 4COWA 4AI1A 4COVA 4AFBA 4AI3A 5A3MA 2XJTA 4CP1A 2XJQA 4LHKA
chains in the Genus database with same CATH superfamily
1IPJA 3OYWA 3WNNA 3JU9A 2JEMA 4MX3A 4EQVA 1W90A 1PK6C 3POGA 4UFMA 4NIGA 2X5IA 4PBOA 2BGCA 1PGL1 3H1WA 3IU3I 4BMEA 2LALA 4A3DL 5KXBA 4R4ZA 4KL1A 2D5FA 2PFWA 1IS6A 4PJYA 5HI0A 3VDDB 2V4VA 2YC4A 4OHZA 3VHPA 4SLIA 3EYPA 4CU7A 3PIO1 1E57A 2CTVA 1AJOA 1LECA 4LUMA 2JDYA 2XJRA 1BHGA 1ZRIA 5FYHA 3PLQA 4D0QA 2W68A 4QAWA 4Y3OA 4DXTA 4PDWC 2HWD2 4Q1PA 3O1PA 4LNVA 1B2JA 2RDSA 5IW0A 1XBFA 1YRZA 5T54A 3KT7A 5JXIA 4Y1YA 3VD4A 3KHCA 2WAQP 1J84A 3D0SA 3R4SA 5TSWA 5H9QA 3AFGA 4YZ2A 1UCXA 4A3XA 1R093 1RUF1 2IVJA 5AFEA 2OX0A 2WWJA 2C0ZA 4JRAA 3HOWL 4M3CB 2UURA 2DF7A 2E2JL 4XFGA 1X9TA 4OZOA 4URTA 4GMP3 4NO4A 1GANA 1QF3A 3RMXA 1JYXA 5FMDA 4MGQA 4O9EA 3KV6A 4OYUA 2XWBB 3IBMA 1VR3A 4XAAA 4C3IL 5FXWA 1CAUA 1CD3G 5LA9A 4GS7D 3NNLA 4Z92B 2DYCA 2EIDA 2ID4A 2P34A 3DCQA 4JKLA 3LA7A 2HWE2 5ERLA 5BNOC 5ABJB 3ILRA 3TB0A 2RM22 5FY4A 4JAAA 5IFTA 2OIIA 1F5JA 1MZEA 5J96B 1VBE2 5J1XA 2QQJA 1UU5A 3FLTA 3ZSJA 3U4SA 1AL22 4UF0A 2H6BA 4E2QA 2HWC2 1NZCA 5IVEA 3ZSLA 1SLLA 1GNYA 1HQLA 1I3HA 1QQP1 3HQUA 2VZRA 5FCCA 3M3CA 2JG8A 1COV2 5C5TA 4BK4A 2VMEA 4KU8A 4PIYA 1UPIA 2AGSA 1ZRCA 4KMQA 4LLFA 1TWGL 5HPOA 3RZHA 1QDOA 1ZBE2 5FYZA 2M6PA 1H8TC 3SNMA 3ZFGB 1UYPA 4S2GA 5HCBA 4B1MA 2VE1A 1LEDA 1NCQA 1QXPA 2OUHA 3HR9A 1UYXA 4QB6A 4WBBA 5JIAA 1EP0A 5A3OA 1XNCA 4IE4A 4BWOA 2B63L 2RMU3 4RD7A 4NMIA 1OKOA 3NNGA 2JG8C 3VL8A 1HB1A 4D3WA 3FHQA 1LNSA 3MPSA 4V2VA 4BA6A 1W03A 5KWRA 2HWD3 5IP7L 3S7EA 1YJLA 1RUI2 4MV2A 1S4CA 4Y4RA 2WZ8A 3VDDA 5IYCL 1Z7S1 1RXGA 3S2HL 2XVGA 5FP9A 5T5LA 2DVGA 2D3PA 4QPGC 1W8WA 2W92A 3VLBB 2ES3A 1DYOA 3VV1A 1OLRA 4EWAA 2WT1A 4XW3A 4A3KL 3CKHA 3HT1A 3JZVA 3FMGA 4DEVA 3ACLA 2RMU1 3T0AA 2HEWF 4C3HL 1CESA 2A68D 2K9ZA 4UAPA 2A3YA 2AACA 4Q4Y1 1RWDA 2EAAA 2C26A 3OGGA 4Q8LA 3ZFGC 3Q9OA 4JGYB 4Q26A 4S2HA 5CYYA 3N9MA 4WFN1 4LULA 5DUVA 3ZSKA 3MGUA 4BXXL 2A1XA 3VBFB 2Z79A 4HG6B 1RUD1 3VD9A 1G9CA 5EP9A 3LPGA 1B09A 3M3OA 4QGNA 1YFYA 5K7PA 1LOCA 3BIWE 3VZJA 5A3WA 2LS6A 1RYQA 5I0DA 1IW7D 2ETEA 3GHNA 3OF1A 4XFCA 1JZ5A 1MEC2 4GD4A 4ZS2A 5CFCC 3SH3A 3SH4A 1PGW2 1OLME 5E89A 4C0BA 3KSCA 3N7KA 2VL4A 4C1WA 1OF4A 5FZGA 4C90A 4Y33A 1JZ6A 2WA3A 3MIFA 1C28A 2PELA 1DQ4A 1C1LA 1HRI1 1WLTA 1HRV2 2IXKA 3H3LA 3H8UA 3T2PA 5IAVA 5GLWA 2ZX4A 5JOWA 2J1AA 1FOD1 4XFAA 3W58A 1JOBA 1EYBA 3IKWA 2OQ7A 2D97A 2QQMA 3NRUA 3NJXA 1W8UA 5JVG1 2ZKLA 3WZ1A 4DXRA 4WM7B 3MEPA 2FZ1A 3RZMA 2QNKA 4YVSB 4KWUA 5A6ZA 3WDUA 4RHV2 5C6CA 2WIIB 4HK8A 2WQ8A 3FX3A 4JDOA 4YW2A 3VZKA 1GP4A 4QX1A 1BQ9A 2ZGPA 4YGEA 5LATA 3KQRA 1HRI3 5L7OA 4YPJA 1QXJA 1NXMA 3MZHA 3PWFA 4CEWC 1U5YA 2VU9A 2WFF1 1Q8PA 3KV9A 3OD0A 5FLHA 1ODNA 2WLQA 1D4M3 4N8MA 1CPMA 3DECA 3GXUA 4NAMA 1VBB3 5IATA 3R4UA 4FPJA 4OQ8A 4B4RA 3O14A 1I9RA 4HOOA 4XFHA 3VBHC 2PA7A 4XXAA 4IEQA 3JCIA 1VBC3 3ZXAC 3OPZA 1CR7A 1GKBA 3E5UA 5CIRA 1RB8G 1NZIA 3IMNA 3N9LA 2UY9A 3TN91 1FI2A 2R071 4YRDA 4C1XA 3D4KA 4QD2A 3ZSMA 2VVDA 4IL7A 3T0BA 2LCQA 1OURA 3RVHA 1IROA 4UWDA 1TMF1 5FMBA 3RI9A 3RNSA 1VRH3 1W9YA 2ZX0A 1W8ZA 2RS51 2VPVA 1N3OA 2W46A 1RTVA 5HCAA 2W9XA 3RI8A 4CSWA 4JAEA 2H0BA 5ANNA 3RSJA 1C5IA 2JD9A 3S5AA 1PIV3 1F4AA 2DU1A 1E5RA 4Q4X1 5FK8A 2DSXA 4MXWB 4Y20A 2XG3A 3VB9A 4FTEA 4PLNA 1CJDA 4O7XA 3HBZA 4K9SA 3MLKA 1XNDA 3ZPYA 1Q43A 1VPHA 1ST8A 1SDWA 2JE8A 4N7IA 2O8QA 1G9BA 1GZWB 4R9CA 3SMHA 1BBT2 4EYUA 3RRDA 3W9AA 4OUSA 1NE6A 3THDA 2VCAA 3QLQA 4ZU5A 3MUY1 2GAUA 4P02B 2XJTA 4R9BA 3HT2A 2GMPA 2XB6C 4K3UA 4Q29A 1OPMA 2P6HA 4G9SB 4A3GL 1S0CA 5C4XL 2GN7A 4YZ4A 1G86A 3TEZA 3LSEA 4BK5A 4XIOA 4AE2A 1R0FA 1DU3D 1EV11 1OC1A 1ND3C 1YEWA 3FC0A 2C6BA 3J7Y1 1MZ5A 2WUHA 3VBUB 4QPWA 5IAXA 4OHYA 1SLBA 1LB2A 5F3IA 4BU2A 4FOVA 1GUIA 2VQAA 4QXCA 3WG2A 2Y6HA 5BV6A 1OA2A 3W21A 2RR12 4FO9A 5JXHA 4XF3A 5DM71 5DAQA 5BNNC 5FZBA 5L73A 1WCSA 3GZUC 4QX5A 3UGFA 1AUYA 2JDAA 2XGXA 3PIP1 4LHLA 2M4VA 4ISRA 3UKNA 5DAPA 5BNPC 2HBTA 4UW5A 1TE1B 2B8MA 2XR4A 3KD4A 1ZA4A 5GAHc 2W1SA 2RS32 3HOYL 5JMCA 4HPKA 3HAXC 4BY1L 4LBNA 4H7MA 4N9IA 3ZG6A 1LTEA 3IPVB 4Y5TA 5CNAA 5F32A 5FYYA 4BQXA 4OCTA 4HLTA 5FYTA 1W6NA 5CFDB 4N43C 1VP6A 1ZZ6A 3EQEA 1STMA 5KXDA 1OLMA 1O3TA 5HCHA 3RMYA 1R091 1RUF3 2B7YA 1KEXA 4WZFA 1W8OA 2VZOA 5B4XA 5DABA 5DAWA 4MADA 1RUH1 3E5XA 3NL1A 2AEYA 3QCWA 4PHZA 5C3PA 1IHMA 5J09A 3AP9A 4P14A 4Y24A 3O1VA 2CAVA 1YHFA 4BBRL 5EYYA 3CEWA 5DUXA 4MOAA 5FJHA 4RQPA 1LODA 3KCCA 1MQTC 4WVWA 5F2SA 2CAUA 5KHHA 1AXZA 2HYKA 3ALQA 2ET1A 1SMUA 1IS3A 1SLIA 2HBUA 2KA3A 4BQWA 3S14L 1HJFA 1OUSA 4BXSV 3WV6A 1RHI2 2B39A 4YLZA 2DV9A 2P17A 5FP4A 1DCSA 2YU2A 4LE4A 3PJYA 1PIV2 4K21A 3N7JA 3RYGA 3U10A 4IEVA 3M4OL 3MIGA 1VBD2 2JICA 3PMEA 5D21A 3USSA 1YFUA 4I0BA 1DYPA 1SFOL 3N7LA 1RHI3 1XYNA 1GQGA 4E6YA 1W0OA 2BEOA 3UJOA 2ARAA 1LCLA 2CL2A 3G7DA 2A6ED 2P2KA 3H42B 5A32B 3WEZA 4ORFA 4N43B 1BRFA 4X6AL 1NAEA 3MPPG 3WNPA 1IRNA 1F8VA 5L9BA 3VGIA 1UYZA 4DEQA 1V0AA 1DIWA 2BGPA 3PO2L 4ZN1B 1C8M1 2QZ3A 4LE3A 1PVC1 1DZRA 4RS5A 1W6NB 1H1IA 2E53A 1X8MA 4Z07A 3N9OA 4XTPA 2FDHA 2A71A 2ZEXA 2WS91 4Q4V3 4CCEA 3J7LA 4LKEA 3ZXLA 1CAVB 2B5HA 1I50L 1OMIA 3ZFFB 4I0AA 4M4RA 5A80A 3T4HB 5FZAA 2WABA 3ZVXA 3WOGA 3WP6A 3A0NA 4L99A 2PTMA 5CBLA 4PDWA 2ERSA 1VRBA 2HLEA 5IVFA 4WM8C 1HKDA 2ZS6B 2Q8CA 3OBZA 2VZPA 2ZTNA 4Z2WA 5C8CB 1X33A 4K9FA 1QJX3 5CFCA 2BVBA 1L7QA 4QT6A 2JDHA 5JLVA 3BTZA 2VMIA 4YGBA 4ZY9A 4GJZA 2VY0A 4YW6A 1GR3A 3FJSA 2V5DA 4HVQA 1T9QA 5DDJ2 3SKJE 2DUPA 1W28A 3KVBA 3MYXA 4XUPA 1PNFA 3WDYA 1PO11 4YW4A 3MO4A 4LKDA 5HV4A 2XMLA 5JMOA 1NUKA 2APOB 4UW6A 4TLFA 4QXBA 2E6VA 1YUDA 5SV8A 4NIAA 4XETA 4B7EA 2AC1A 4C91A 4U36A 5FXVA 1QJZA 1GZWA 1GLHA 2XL7A 3I2IA 2QQIA 3K3OA 5LA1A 2XWJB 5LA2A 1QMJA 4I02A 4BY7L 4BE3A 5EXOA 4MGTA 4AHXA 3I2JA 1HQNA 1HLCA 1LJ7A 1K45A 5A33A 1F31A 4LTAA 3W59A 1OA4A 1KRIA 4NPMA 1V6LA 2VCCA 4Q0VA 4CVUA 1ALYA 2RS53 5FZ8A 2AREA 1HW5A 2WFPA 1W6PB 3FBMA 4LK6A 5FYUA 2GC2A 3GBWA 3PVNA 4HKWA 4I2OA 3KYVA 4M00A 5FY8A 2YYOA 4YSFA 1IU5A 4ZZ5A 3VBOC 4UY81 3EXUA 4PIXA 1NCQB 3VKMA 3F95A 3NWKA 1WWYA 2PQQA 2R073 1W6QA 4CCJA 5BNPB 2R7EB 2XBO2 2JD4A 3I59B 3LA3A 4AVVA 2WN2A 4HSJA 1TVGA 2A73B 1O91A 3KM5A 2BDRA 4IV1C 4QU2A 3RJRA 4A41A 1WBLA 5F39A 1AX2A 1UYYA 3RJ2X 2IFRA 1JYNA 3LFIA 5EQUA 3ZIWA 3ZYGA 4QKBA 2P5BA 1XNKA 3PUAA 1XPWA 1PO23 2E26A 1EUTA 2WO2A 4CA9A 4P08A 3GZTB 4FOWA 3TN93 2QQUA 3VHOA 2RFKB 2JIJA 1ZRRA 5K0UA 3CDZB 4IETA 3DF0A 4PQQA 5DQ0A 3C7GA 5JXJA 2VD7A 1J1TA 4IV1A 2IXLA 3MF9A 5FZ3A 2G9FA 5T55A 4NR1A 3U75A 4ES8A 3NKTA 1WW6A 1NG0A 1RJ7A 2H0VA 3MFCA 1OHFA 2J7MA 1E5IA 2ERFA 1UIJA 1QOSA 1QEXA 3I2FA 3ZYFA 4BMBA 5JXGA 3U4XA 3EB7A 3C3VA 3FWEA 4OI2A 4KU7A 5GLVA 2JDZA 3PO3L 2WS93 4NHYA 1F5FA 5C4WA 3ES4A 3ZFGA 1XB9A 1IKQA 2V0FA 1NX9A 2NVQL 2EA7A 2Q0AA 2XLGA 5A7OA 3RDIA 3SITA 5EIOC 2J1RA 3ST7A 1LU2A 4A6SA 2HWC3 3AZYA 2VC9A 3N9QA 1KS4A 1I6HL 1BQPA 5M3FL 4KQ7A 4PDWB 5KBFA 4MGYE 4K8RB 3JD73 5FYBA 3AMQA 4GH4B 4QXHA 4XBNA 2ZZJA 1W2UA 1W9FA 2CHHA 1ZZ9A 2RM23 1ACCA 1JHNA 2VQ0A 2WNOA 2Y38A 3OCPA 1G6NA 4LBKA 4RGKA 3SEPA 4BHPA 5KHJA 1GOGA 1RHI1 3A22A 4EROA 5FP3A 1UW8A 3S5QA 4NVPA 4H3WA 4XBLA 1GWMA 4N90A 3O0WA 1R083 1W6QB 3PNAA 2J9UB 3NNFA 2A6WA 4FPYA 4P9XA 2EXHA 4YM3A 3BUCA 3WP4A 1PX4A 1UNBA 3CIHA 1K5MC 1L7LA 1VBA1 3H7YA 3I8TA 3OPWA 4RGAA 4XCAA 1ZBA2 3N36A 1VB2A 1NCRB 3LF7A 1W9TA 3BI3A 4CUBA 2NP0A 2W39A 5FYVA 1FPN3 5FQ0B 1RUD3 1R092 1LKPA 2XUEA 2EF6A 2VOXA 1REFA 3J8F1 1A8MA 2XQXA 3BODA 2YPJA 2XONA 4BQ4A 1URXA 1R1A3 1ULDA 3KCXA 3MF6A 1YWKA 3ZFEC 5BNOA 4XFBA 1DYKA 4O65A 1S2EA 1ONAA 4KWJA 1B35C 1MQTA 3Q8EA 4JGZC 2AQCA 1MACA 3TNPB 1RUI1 2RHPA 3VBSB 2OQ6A 1LAJA 4H55A 4PIZA 3HOZL 5CAZA 4CXYA 3I3QA 3I2GA 4B29A 1OVPA 3ACHA 5F2WA 5LBFA 3PIJA 2LROA 1TME3 5FO9B 2VTXA 5ANQA 1O5UA 1HX6A 4IE7A 1OD3A 4YW1A 2ORXA 5FV3A 3OSDA 3E6CC 4LO8A 3FE5A 1C57A 3ELNA 3WNXA 3H50A 2VMGA 4FPEA 3B9IA 3FUQA 1UZ0A 2QL0A 3ZXFA 2O14A 4UYBA 5FDBA 1U12A 3UESA 5FO7B 1TWHL 2WZR1 5MF6A 5FYCA 1SLTA 4AVSA 3QVDA 4I09A 3T0DA 1O3SA 2PHRA 3WD5A 1AYM1 1YQ2A 4JVAA 4YZ3A 2J42A 3GCXA 1COV3 3D5OA 1AR81 1FOD3 1RL3A 4FXKB 3R4DB 2IC1A 1S0DA 4X8PA 1CZTA 1HIXA 3USUA 2PLV3 2OYZA 1PO21 2XUMA 4LHKA 1XU2A 2FCVA 3W5MA 1UKRA 5IYDL 5FZFA 4GB33 4ZONA 3HNYM 1GQPA 4Z8BA 3WDTA 1W8NA 2ORZA 5HXVA 4FAHA 2D40A 1Q8OA 4HVOA 1V9U3 3SEEA 5JPMB 4AYUA 3LWQB 1XNTA 3ATGA 1NA1B 1MVEA 5KHIA 2FBEA 3P3NA 5F8PA 2C5DA 4AFCA 1FHMA 1RUOA 4AI2A 1GFF2 4ZPIA 3HKZP 5K0UC 5A6XA 1RDVA 1O7FA 5H1Sc 4M3CA 1W39A 1CN1A 1WMFA 1NNQA 3I97A 4FXGB 1AR91 5E8AA 4A2UA 2EICA 2BJSA 4FFFA 4YW3A 4Q4X2 1O8SA 3UETA 3O1TA 2V73A 3ACFA 3O12A 3EHKA 4N7UA 1EY2A 1TNFA 2HWE1 3POIA 3S0MA 2D3SA 2AR6A 1AR62 3VBFC 3ZSEA 3IIIA 4TPUA 1FNZA 4AI0A 5FY7A 3ZO0B 2GNTA 4CE8A 2BNMA 1SLCA 4QB1A 4NHMA 3RYKA 1UWWA 5FO8B 1W6OA 4HK9A 1ZYBA 5FR3A 1NA1C 3ZPOA 3EO6A 2W0XA 3NAPA 2QQWA 2EIEA 2OW4A 2R16A 2QDNA 3ECQA 4A42A 2D6NA 2LTNA 4FP3A 4D94A 5C7GA 3QBQA 5CG9A 2EIBA 5JOXA 2R30A 4D6QA 5C3QA 2B45X 3HPNA 3LZZA 1I3QL 3RG0A 3E1F1 2WLPA 4W8JA 1RUJ3 5IWFA 3VHRA 3GTGL 3H8RA 4J25A 4UW3A 3WW4A 3S2DL 2XBO3 1W9WA 3AKRA 3L9JT 3VDDC 5T5PA 2NYDA 4YM0A 4RQPC 1N1VA 3ZN6B 4CP9B 2VR4A 3CZUA 4JHZA 4CU8A 1WGPA 1AR72 4LHSA 1YQ6A 5CB7A 3M1HA 1R0HA 2R0HA 1DF0A 4XF4A 3B01A 3URFA 3PTYA 2FDIA 2MNGA 5DG2A 4OMDA 2D6KA 5F9TA 4FQ4A 1T6BX 1YV1A 3S1QL 4IV3B 4XHXA 3LAGA 1PFYA 4XPVA 1AR61 4IEOA 5FBJA 2ZHKA 2ZGRA 1PGL2 4AQ2A 4AK3A 1WW4A 3AC0A 2FZ2A 2PAEA 2JDKA 5IK4A 4RR3A 2CYFA 1LGCA 3D0JA 4S2FA 4QIWP 2WR9A 4UFKA 4QGMA 5LK5A 3VPBE 1Y1VL 1QGLA 2ZEYA 1R0GA 4CYDA 1BFYA 1WA4A 2OA2A 2W94A 5BNQA 2NVXL 4XFIA 4AR5A 2GNMA 3OY8A 4UFIA 4UT5A 2R043 1XXNA 1D7PM 2ZGTA 1HXS3 4H7LA 4KWKA 5FYIA 4A45A 1RUE2 1YQ5A 3HWJA 3V64A 4BLIA 1I6XA 4INDA 1RMU2 5MFZA 3C2UA 4LO4B 4AFBA 1POV3 3HN1A 1WZXA 2E51A 4IEXA 1GMMA 4IGPA 5LCWL 1A8DA 3F2ZA 5AVPA 1ZRDA 2BPA2 3VKLA 4Q4Y2 3Q8CA 2A70A 1D2SA 4YZ5A 1NCRC 1DGLA 4BJ0A 5D8AB 2WT2A 1CX4A 1QQTA 5M5YL 4PCRA 4BQ1A 3IWZA 1GZCA 4XYXA 1AVBA 2IVIB 4YGCA 3DYMA 1J3RA 3U11A 3WG1A 5ACA3 4ET7A 4L0PA 4WVZA 4XAEA 3ACGA 2RE9A 5F5IA 3FDJA 4XOGA 2QQKA 1UY2A 1HB3A 1PO22 2VJXA 3CJIB 3MI8A 5L19A 3HEIA 1LTLA 3U14A 1BEV2 1B2OA 3IB3A 4NOTA 4PLOA 3NV3A 1UMIA 3OGJA 2W1UA 5BXXA 3W5NA 2B46X 1J83A 4NRQA 1BVP1 1OSGA 2LUWA 3NW4A 4QKFA 5DUWA 1D4M1 1AJKA 4YW7A 2IZWA 3NNJA 1AR82 4XC9A 4QQPA 5F5CA 3I2DA 3MW3A 4CPBA 3ZKYA 2DURA 2Y60A 3JD71 3U78A 1OQEA 1ZVFA 1N3PA 1VBD3 4GZ9A 4JADA 2ZABA 5D1IA 1QJY2 3WG3A 2W95A 4TSVA 1OBNA 4XJ8A 1OKQA 3WF3A 5JUVA 4R8HA 4QX7A 5FK7A 1DX8A 2WZR2 1AL0G 4PBPA 5C3EL 3LEKA 4Q0QA 2DUQA 3RZZA 3S7IA 2RDNA 2ET7A 1OOPC 5GZEA 2ZGUA 4MUVA 5FZMA 1PO12 3RYRA 3IDEA 1YQCA 3UV9A 3A0KA 1QOOA 4QX2A 3MIDA 4XJWA 1GOHA 5IK5A 4V1PA 2AUSB 1OF3A 3IZOA 4IEPA 4HKLA 1OI6A 1QJX1 2VZUA 5LBBA 3UKTA 4JGYC 2XKPA 2WQ4A 3RZ6A 2WNEA 2QQLA 2I74A 1UZZA 1L3JA 4Q0SA 1IPSA 1ZRPA 2R49A 3LD8A 4FP2A 4ATEA 2FDFA 3M3IA 3HIFA 1DZQA 3K4AA 4FQZA 2VMDA 5FZOA 3WHUA 4L97A 2ERJA 5D2AA 1Q8QA 4AEDB 4XZPA 3O1MA 1H6XA 5I0SA 2EAKA 4Y5SA 1UZVA 5DDJ3 2X09A 5EJZB 3USUB 2Y6GA 2WNUC 4XUQA 1CIWA 2HYXA 3KGZA 4BIFA 5LY1A 1W2AX 2WAAA 5BNOB 2PAMA 4CRQA 2CU5A 1YI9A 3DYPA 3FHIB 3SXWA 3WF1A 3WUDA 1H8TA 1PX3A 1X9PA 3KWVA 2D93A 3ZLIA 4Z1VA 1H0BA 5ABJC 4AI3A 3ZMOA 1UF2C 4AI9A 5G04L 2PMWB 3ZXDA 1OT5A 4ZHNA 2TNFA 4MZUA 1PMIA 1OFNA 4TYSA 4EN8B 1CJPA 1WKYA 2D5HA 2G9ZA 2R93L 2X05A 3ZYPA 3M3YL 2XQRA 5FJKA 5HCFA 2Y0OA 3O0XA 2WQZC 1WW5A 3AMMA 5KHGA 4QMAA 5M5XL 3UGHA 1WMDA 4K40A 1VBC1 3V0AB 5I8SA 2VZVA 4QHBA 1JH5A 2JXAA 3RWNA 4QDQA 4XURA 5ACA1 1LOFA 3NKGA 5K8SA 1ASJ3 1SCSA 5BUVA 2XXZA 1BBT3 1O3RA 2VNRA 3ZYRA 1B13A 2QQVA 2HKXA 2PVXA 4ONUA 1FMD2 2XLFA 4META 3FLPA 1F35A 5AN9H 1PO13 2NZ9A 4XJ9A 2X53S 4DY5A 5BNNB 2JX9A 2RJLA 4AVAA 4POFA 1W2OA 2G4IA 2J1TA 4JAFA 2LM3A 2SLIA 4XFFA 1NYWA 2ZHNA 4K1ZA 3OGRA 4ARXA 3RQ0A 2UWBA 1H9PA 2JG8B 1C3HA 1FX5A 1VALA 1LOFC 3PUHA 1SPPB 1UN1A 4Q0PA 1N47A 3CMGA 5DPNA 1KDMA 4DOUA 2JDMA 4NHLA 5C8CC 2V0EA 4HBNA 4JTNA 1AR83 5HXMA 4KWLA 3NMBA 1OQDA 2QQNA 3BCWA 3ZX7A 5C9AA 3N35A 4WM7A 1O4YA 5FYSA 4L8QA 4XTMA 4NIIA 1UU6A 2WRAA 3PL5A 3WR0A 1L7RA 3JR7A 2NYYA 5A3MA 2AEZA 2J1SA 4XXPA 2CY6A 3QH7A 4XIKA 5C4WC 4AVBA 1I1EA 1QJY1 3NQHA 2RVAA 5C9AB 2C9KA 2K46A 2WSVA 3BN6A 3P1IA 3VD3A 2NQYA 4Q4V1 4GWMA 5DZFA 1V6IA 3O1UA 5FPZA 1H2LA 5J98B 4FPOB 5LA0A 1K42A 5EPAA 2D44A 3DPRC 4XF0A 2W91A 3I3DA 3OBTA 1NCRA 4R9AA 4R9DA 1RJ8A 5DUUA 4BCUA 5IUQA 4GH4C 2DVFA 2TEPA 4A3ML 2G19A 3NJZA 4W6YA 1J58A 2E7AA 2DDUA 3K75B 3O1OA 1KDKA 2YROA 3E97A 5DZEA 5GM0A 5B2GB 5H9RA 1LGBA 3H3UA 2VMCA 1SACA 2BZDA 1RUE3 1S55A 3TAYA 2BWAA 3ZXKA 1HXS2 1TWFL 2WZPP 1FATA 4DMIA 4DIQA 2R042 2RR13 3B69A 5CZKA 1BLZA 4E2SA 3OG2A 1MZ6A 2JA6L 1RUJ1 3WQ7A 2GNDA 1PK6A 3KCYA 4EN6B 3B3QE 4F8AA 1JUIA 2BOJA 1VLNA 2JG9C 3AB0A 1NXGA 4Y1XA 3V0AA 1QIQA 1FHHA 4CDWA 2CV6A 4ARYA 3J7NA 1NKGA 4DXSA 3ZDSA 1W2TA 1CWPA 1LESA 3ZIXA 2WDBA 3E6BA 5K9YA 3J7Z1 1IU6A 1ASJ1 4ZU4A 1RUE1 2R32A 1VMFA 1Q8SA 2GDFA 3RS6A 1PGSA 2I2SA 3JBG1 4JKKA 2VOWA 1N1YA 4IE0A 1ULFA 5FLIA 3JQWA 2VVFA 2WINB 3AM2A 1BYHA 3D82A 1H8TB 4OLLA 4UXAA 4AFMA 1S0JA 2IFWA 2WB1P 1X8EA 3OUIA 4H2AA 5CFDC 5I8YA 2AH2A 3QH6A 3FBYA 3OUJA 4XEZA 5DMYA 4TTGA 1UY3A 2MPFA 1GU3A 4LIUA 2BBAA 2H6CA 2ZCWA 4U2AA 3T1MA 1VAVA 2FMYA 5FBZA 1ZBA1 1ODMA 1YXWA 1QJY3 2HWF3 4BZ4A 4TZDA 1WCUA 2YFZA 2UWAA 2DFBA 1DZTA 1JOJA 3IN9A 1LR5A 1C5HA 3K2OA 2WFF3 4E4SA 4CTEA 5A6QA 2EXIA 4RGGA 2PHDA 1WLCA 1DBNA 2XL9A 3H1MA 4BOWA 4CDQA 5C5UA 2OPKA 3GM8A 4KG0A 1BEV3 5F3GA 1XSQA 3GTML 1ZREA 1RXFA 3AJZA 3VZOA 4H14A 1P7PA 3NJYA 5J7MA 4AI8A 4BQ2A 4QU1A 4RFRB 5JI9A 4IQPA 4UOJA 4COYA 2E9QA 1XJAA 2ZACA 2PVEA 2C24A 2RJKA 2ZGKA 4QX3A 3VZNA 3S16L 2Y26A 1AYN3 4HZFA 4KH9A 1KJLA 4AQSA 2BU9A 1H2MA 2Z42A 6RXNA 1N1TA 1O8PA 2ZGNA 4NAOA 4YWMA 1WD3A 1K5MA 1R0JA 3AZZA 1YFXA 1Y9GA 4AQTA 3QD6A 3H8XA 4FCAA 1UY4A 2Q4SA 1SBEA 3POBA 2UYAA 2YG0A 4JX0A 3P3PA 4LUKA 4XACA 5FXZA 5A70A 5JWPA 4HN0A 4XVHA 2ZXQA 3AXEA 1HRI2 2AYJA 1V6KA 2BFUS 4AEJA 1ZBE3 4AGRA 4LOSA 1JYBA 1WJVA 4X8NA 1SMWA 3ITQA 2BGOA 5GAGc 3OJBA 3QACA 1LHOA 7RXNA 5F3EA 1AXYA 1PGW1 1H2KA 3BPZA 2MEV2 4P9LA 4RHV3 3PU3A 1GYKA 4YG6A 4AAPA 4BXFA 5A33B 3AKTA 1JU4A 3GYDA 5K0UB 1QY4A 4NROA 5C8CA 1NCQC 2RS31 5JDBA 4DXZA 2QVSB 4LBQB 5DM61 2VULA 4CDWB 5C70A 1ND3B 1M06G 3H97A 1W6MB 4CCDA 5BNNA 4KG8A 4RS5C 2YY1A 3LPEB 2CWSA 4WVVA 4GB32 5AC91 1BK1A 1JYVA 1JZ8A 3ILNA 1CAVA 3DUIA 1RUG1 4OZXA 2PXJA 5D8AA 3GBGA 2HWB2 1ULCA 3FFQA 4M0HA 3I59A 3LDRA 2GSYA 1US2A 5E6HA 4XCBA 1ZRFA 2WZEA 2XHNA 4FI9A 2Y0SP 3C8XA 1F15A 1RUC1 1N1SA 2YBSA 3ETQA 2G9GA 2R0FA 1VBA3 3TOJA 4AHWA 1A3KA 1OA3A 2IXCA 3KV5A 4LLOA 4IGOA 4HMZA 5LRRA 3AXDA 5MGNA 2H12A 5JZGC 2DU0A 1NE4A 1DQ1A 2OT7A 1S2BA 5FRAA 4R52A 1NLSA 3KZ4C 5FIXA 1HQWA 4IEZA 4XHBA 2RR11 3BOPA 1EAH3 2O0OA 4CEYA 1BE7A 1RUJ2 2GC1A 3J9SA 2TBVA 5E88A 2W52A 1A78A 1YCIA 2Y64A 3JUUA 5FPAA 3CO2A 2R041 1X50A 4QDSA 4RS5B 1O4ZA 3WNLA 3KB5A 4LKSA 1S30A 3UKVA 5I0RA 3SH5A 5FUNA 3BYWA 2NMOA 2A7AA 1LOGA 3FHAA 2EVXA 3LB9A 5FZOB 4AHYA 1S24A 3LWRB 5LB6A 3S1RL 2GH8A 1UOFA 1YUZA 4AF9A 3PMSA 3WNOA 4COVA 5IHRA 4CDUA 4LQRA 5A32A 1WW7A 1V00A 2VW2A 4AOCA 2WYFA 4NHKA 3B94A 5IK7A 5JOYA 4GKYA 3I4IA 3UYJA 2OVUA 4BB3A 1LULA 1YUXA 2VO5A 1KJRA 3PVOA 1EAH2 3N9NA 1AR63 4J6GA 5C9AC 3H3VM 5A1AA 5M0TA 1LRHA 4EJRA 4LO7A 1FPN2 1AF9A 4K1YA 3M70A 2BVVA 4AL9A 3AK0A 2WNVB 2RG4A 1ZBA3 1J1LA 1HB4A 2IXHA 4YVWB 5J48A 4O9GA 5FPBA 2A6HD 5CKQA 2VBPA 4POGA 1YI7A 3AYCA 1SDDB 4E8DA 2BBVA 2VM9A 4RR3C 1T9PA 3J7MA 1R082 3LGRA 1BKZA 3RZTA 4QX0A 5FP8A 2K2DA 1YO8A 3PIGA 1ZX5A 3POFA 2YZ4A 2W3JA 4XXBB 3KQ4B 4GWJA 3NFPI 1Q8VA 2A3WA 3T30A 1C1FA 1GOFA 1OOPA 4XUNA 3J8F2 1D4VB 2QTWB 1CAXA 5MFPA 1V9U2 3P2AA 1LHUA 3FLRA 3IDBB 5AFBA 5CFDA 1VCXA 3CNAA 4AR6A 2VZQA 2DCKA 4YNIA 1CX1A 4XQWA 4IERA 1QDCA 1APNA 1PMJX 1CVNA 2G1MA 5EINC 1GV9A 4CCCA 1I5ZA 1ND2C 2DTYA 4LPLA 1QOTA 2E31A 5K2ME 1ULOA 3LE0A 4AFAA 4CUCA 3IMMA 1FOD2 2P37A 1HV0A 5FY9A 2VOVA 2HWD1 1S0IA 4MVTA 5BYNA 5A7SA 2MEV1 1QJU3 5CADA 1J3QA 4KNCA 2JG9A 4L92A 1H2NA 2YU1A 3VBUA 3N7MA 4FFIA 1EPWA 1OWBA 3PTRB 4RQPB 5FZ9A 3WDWA 4EN9B 1RVF3 4MGSA 5A3PA 5L9VA 4G4FA 5GZFA 4CDUB 4FPKA 1JZ4A 4M3CF 2W08A 4MHUA 5I0UA 4MH0E 3JQXA 4BYYA 1GBGA 2IUWA 4XQ4A 2VUJA 2ZX1A 3VDBA 4JCKA 2ZGOA 4IV3C 1K83L 2VL6A 1K5MB 1S1AA 4WZCA 5LBCA 3THCA 3ZOIA 2CNAA 4ME3A 1KXGA 3O7OA 2JDPA 3IPVA 4D7TA 1XE0A 1V9U1 5JVH1 5IVYA 3I7DA 4JHTA 2M6OA 2PMZP 2YUEA 2ZHMA 5JSRA 3VBRB 4ITCA 4BQYA 4IEYA 5KHKA 5IY0A 1FAYA 4JRLA 4YVWA 4AEDC 1O3QA 3ZDVA 1QJEA 2RDRA 3MW2A 4HONA 3L2HA 4AAXA 1O4TA 4UFHA 2FCUA 1MVQA 1DHKB 3MDPA 4IV3A 5LRSA 2Y0IA 1RUD2 2E32A 3THTA 4XJUA 1NQDA 1RITA 2VNOA 1TWAL 5LK7B 1Z78A 4UBGA 4EE2A 5J37A 3AVSA 3DXUA 3RGBA 5FZDA 1FNYA 2IXJA 4SBVA 4GMP1 3G6JB 4ZKTB 4CP2A 2DVDA 2RDQA 3CJIA 4XABA 4XMIA 2WYSA 4CP9A 2ADDA 3WT3A 3PVEA 4HETA 4BH9A 3HQRA 1ENQA 1IQDC 5GAEc 1BEV1 1QYBA 5GKAC 3AKSA 1JZ3A 1JYIA 5A7WA 3K4ZA 2E33A 3GDBA 2HWB3 2W1QA 4TN7A 1Z7S2 3ZFFC 3OGSA 4LR4A 3ZYJB 5A6YA 1MS3A 1RYYA 4LT5A 5FPVA 3WF2A 4D7YA 3JD72 2CR8A 2HWF1 5LASA 3VD5A 1RC6A 4CUAA 2ZAHA 4HT1T 3U07A 1TMF3 1W6OB 1RDGA 1O5LA 1CAWA 5FUPA 1XC6A 1AL21 1F9KA 1F4HA 1H9WA 1E5SA 2QJVA 4Q5OA 5FY0A 2PHUA 1S0GA 2MEV3 2VAUA 4Z82A 3T3YA 4LITA 4A7KA 3K35A 1WLWA 5FOBB 1US3A 3SCFA 2XVKA 2KM2A 2ARXA 1OH4A 2NN8A 5FAXA 5IVCA 1CZSA 2JECA 2XJQA 2YDEA 4JQTA 1U5ZA 3JXSA 3PVBB 3ZYHA 4GALA 3B08B 2XLAA 2ZGLA 5FFOC 3DYOA 5IYBL 3GJAA 3VD7A 1PFVA 5EZWA 3LKJA 2ZHLA 1WMXA 3TEXA 1RUNA 4Q4V2 5FY1A 5L7OC 5LW9A 3ACIA 3AMPA 5E16A 2Q1MA 1PVXA 4DINB 1W9SA 4CEWA 4KGQA 4DFSA 1RUG2 4NHXA 2XJSA 1LOBA 2DBIA 1R9TL 4LBJA 3TN92 3DGTA 1P8JA 2UU8A 4GB31 5AC92 3THPA 3CL1A 3LWVB 3GTOL 1OLQA 1JHJA 1QNWA 1C4RA 2CGNA 2B9UA 1BMV2 3HOXL 3MHZA 4AR2A 1VAMA 1UOBA 2WT0A 4V2WA 2JI3A 4DB5A 4DUVA 4Y22B 2WFF2 3Q8BA 5GJ6A 1ND2A 4E8CA 2E63A 1CAUB 3RYPA 1NOVA 3H9BA 3M3EA 1UZWA 1C8NA 3GTLL 2XDVA 1RYTA 2ZEWA 4JC1A 4LBMA 3CJXA 5GZGA 1O59A 5EFUA 2R072 3IAQA 5EWSA 4MGIE 4OI1A 1QU0A 1HN0A 2JWPA 1CONA 3FN9A 4WM8A 3NO8A 3EMRA 2AENA 1GP5A 3J7HA 3SISA 1C8M2 2ZMKA 5IYYA 4JZRA 1SCRA 3VBSC 5EHDA 2F17A 3H8OA 4IUGA 2DCJA 3LQCA 5HV0A 3TYJA 1UOJA 2BRTA 4WVMB 2SBAA 2BE5D 4A3FL 1ZZ7A 3VKNA 1ULEA 2WKKA 2D43A 1QJU1 1YJKA 1WCQA 5FY5A 1HRV1 3HD8B 4CDQB 3AP7A 5FZKA 2K0GA 1FT9A 4BIOA 4XDPA 4G3YC 2Y6KA 3KF3A 5C33A 5IVBA 3BKZA 1DP0A 1QHDA 1UU4A 4I3GA 1NXEA 4P5HA 4RFT0 4YM1A 4LKFA 4XGHA 3AYAA 3ZXEA 3VBSA 3WW1A 4QQOA 1R1A1 2RS33 3WG4A 2XPJA 4CU6A 4NRPA 1EPZA 5LZ6A 1MQTB 4CCMA 4AR4A 3K3NA 3BIEA 1TQ5A 2ZGMA 1GSLA 5GLUA 1N3QA 2BFUL 3GJBA 5I0TA 4A4AA 2PSMC 2VH9A 1RUH2 1IG3A 1RUH3 1VMHA 2X5IB 1AX0A 3OPTA 4MHRA 4XILA 1QJX2 3ZR6A 3C7EA 1YK5A 2EXJA 1REDA 2R062 1V6OA 1WA6X 2YHJA 3A23A 1ENXA 3J4UH 3CHXA 4P9JA 4YW5A 1DQ0A 3BPSA 4IEUA 3VHNA 2ARCA 4YZ1A 5KC5A 1JZ2A 4HFSA 5T3NA 1CQ9A 1LENA 1JODA 4U671 4FTSA 4AR3A 3PJQA 4GMP0 1H4GA 4L2NA 4I0WB 3WHTA 4EN7B 2PHXA 1NY72 4CDXA 5LEKA 4ZZ8A 4YG3A 2C6AA 1VMJA 1OXCA 1PK6B 1Q3EA 2HEVF 4QPYA 5CG8A 1HJGA 3A7QA 4Q27A 1H30A 3POEA 4DQAA 3SLIA 1RGSA 1F2NA 4DO0A 5BY5A 1A34A 2D98A 5A1FA 5LY2A 1UO9A 5DZGA 1BXHA 3KGLA 2GMEA 1ZZCA 4GH4A 2CGOA 2PYTA 5FZIA 5L9RA 4OQ9A 1EUUA 2OKXA 5A3TA 3WWLA 2VGDA 5D8AC 2GC3A 3PKIA 4GA9A 5GZDA 4CP1A 1CIYA 2PLV1 4B4PA 3LSDA 3KF5A 3WDVA 3OD4A 4CDXC 3AFKA 3T2TA 1JMUB 5JSOA 5FUIA 1M4WA 3DV8A 3T08A 4BISA 2WO1A 5G05L 2EXKA 5A3LA 3POWA 1MZFA 4DRVA 1K5JA 3A21A 4Q4W2 3VZLA 3O0VA 1LHVA 2WO3A 3TNQA 2JDNA 1FV2A 3WCRA 5A3NA 1W06A 1G9DA 3MSUA 4PI2A 2ZBJA 4OHXA 4A3ZA 1UL9A 3V0BA 3GZAA 1VZIA 4YVWC 4AYBP 2VCMA 4CEYC 4A93L 3B00A 4TLGA 1KQRA 5EV7A 4IESA 4AQ6A 4XMAA 2YGLA 2DCZA 4OUEA 3MV01 2KKDA 2C4XA 1PZ7A 4D69A 5JI7A 4Y52L 4N43A 3AX4A 5J36A 1UKGA 1W8FA 2X10A 4N53B 3B7MA 3LIHA 3OBAA 4CP0A 1QQP2 1SPPA 3MICA 2I07B 1C09A 4R4XA 3I49A 3D6EA 2ILMA 4M01A 3WQ1A 2KD7A 2Q30A 1CGPA 1DDLA 4GIQA 1VBE1 2R063 1NQJA 4YM2A 1W04A 5A7QA 2Y8KA 3APBA 2BP6A 1X7NA 3VUOA 1RIRA 3PHMA 1H8VA 1Z92B 2D3RA 3WW3A 3VKFC 4RN5A 4RYDA 1MS4A 1OVSA 2IXIA 3JBG3 3M8LA 3POSA 2EY4E 5C44L 4A3CL 3I3MA 4YARA 2IWGB 2XKOA 2OZJA 4JDMA 5T5JA 3SHRA 3IM0A 1MPXA 3KT4A 4IDZA 3C7HA 4NJ4A 4NWVA 4OI0A 1WBFA 3TRSB 5FZHA 1VAKA 2WNUB 5CU1A 5JR2A 2TUNA 3CQOA 1Y9QA 1Z7S3 2KXLA 4K20A 3VDAA 5FPUA 5FMOL 5T5OA 3MIHA 3GTQL 2VW0A 3KMHA 4RHV1 4F3JA 5FLML 1AXKA 1DQ6A 4DZGA 4FFHA 2V72A 3U37A 1G9FA 3U0ZA 4D6SA 2GZWA 3OYWB 1YIFA 1IOAA 5DAXA 4Y7NL 1WCKA 4GWIA 4WM8B 2JB4A 4GAZA 4KBBA 5EJ3A 3KVAA 5MLC3 1YFWA 1VZGA 2QZ2A 3SKVA 3QQCE 3O5SA 1UXZA 5FPXA 3Q8AA 3U1XA 1AR71 1UOGA 4OI4A 4Y22A 5FMOS 3BTXA 2VUDA 1BCXA 3P5BA 4PF1A 2F4PA 4DS0A 1K12A 4IXLA 4LO5B 3ZMNA 3FKIL 4AG4A 4COUA 4LJHA 2JG9B 1I5PA 8RXNA 1JOPA 4JKMA 2FHRA 1JS9A 4UI9L 3I2OA 2ZEZA 2FQPA 3C7FA 4QGLA 1JYTA 3MV11 1LKNA 1VRH2 1ENSA 1WCML 1DG6A 1UX7A 2NM1A 2ZGSA 3M2MA 1VZHA 3ZN4A 2VCBA 4GXLA 2YFUA 4D8MA 1LKOA 4UFJA 3PUIA 4XJAA 2RV9A 4HXCA 5FZCA 5APAA 2ZIXA 1DFQA 1TZOA 3WF4A 3WVJA 2WSUA 1YK4A 1RUG3 3T09A 2JE9A 3C7OA 3MUZ1 1UXXX 2GP5A 4A7ZA 1ULGA 4W6WA 2CGPA 2RMU2 4CDQC 3VBHA 3R6SA 1OOPB 1DQ2A 4W65A 1RVF2 3JB8A 4MXWA 1WLDA 2XBO1 5F1RA 5JCTA 1TWCL 4YWLA 4Y5Z0 1R0IA 1Y43B 2OXBA 2W5FA 4RA0A 5JOZA 2QQPA 4DUXA 3HJWB 3CZJA 1W8HA 3I2HA 2ADEA 2A5ZA 4MGZE 1FPN1 4A3BL 5C4JL 1AR92 4FPFA 5C4WB 1WD4A 2W87A 2O5JD 3AKPA 2GU9A 2XJPA 4HVRA 4O61A 1QH7A 1KFXL 2DFCA 2HR5A 2A75A 2Z5WA 3R05A 4HL0A 4BLJA 3PUQA 1PZXA 1KITA 4BM8A 2BW8A 1AL23 2HJIA 1LHNA 5EYXA 2R92L 2F6BA 3WQBA 1DGRN 2DWRA 3UL2A 3LIGA 3WP3A 1HRV3 4BPZA 1MS8A 1FXZA 4BQ5A 3ILFA 3AYEA 1F4LA 2LRPA 1Y7BA 2HWE3 2PLV2 2JI1A 1UQXA 4N53C 1SMVA 2HVYC 3S1ML 4AZZA 2RJ2A 3GCWA 4AEMA 1MEC3 5L7OB 3V65A 2PN5A 5F5AA 2XVLA 3S17L 1W05A 2L9LA 2YXSA 2HWC1 4LBQD 3CLPA 4JTOA 5T52A 1S0EA 5AI2A 1G7YA 4RSUA 4XDOA 2AZ5A 2FDJA 4QQLA 5M3ML 4RL7A 3RZGA 1SQ4A 1D2QA 1AR73 3KHBA 3SC7X 4IEWA 3OY8B 1B35A 5IP9L 4GWNA 1XOYA 5FZLA 3FL7A 1E8JA 2OS2A 1LHWA 3WCSA 2X8KA 3WSOA 3N4MA 1Y9MA 3E6DA 4LA3A 1RUC2 5JR7B 1T9OA 1VIWB 4ZXEA 2FD8A 2ZJCA 1TME2 2JDUA 3POYA 2ZAAA 4XF1A 5K4LA 4GJYA 4QPIA 1REEA 4RR3B 5C3OA 2A6VA 4QHZA 2P3IA 2YU9L 1Z0HA 4ASLA 2E2HL 5JVVA 3KV4A 4B7KA 1ODHA 1QXRA 2VMFA 1U5IA 3M4FA 4PLMA 4XJZA 1ZM1A 4EZ4A 2HEYF 2DVBA 1OUXA 4Q8KA 3UK9A 3BTYA 3VN4A 2YC2A 5F37A 3HOVL 1D0GA 1V6NA 2ZGQA 2ATFA 5AVAA 2XOMA 4FTBA 3LOBA 1R1A2 3LEIA 3WP5A 3ZXGA 5C8WA 3WINE 4C8DA 1AX1A 1SBFA 3AJYA 4LBQA 1HV1A 2V5YA 4CXWA 2CDPA 5JPNB 4IE5A 2OZ6A 2WWUA 1VBD1 1XSRA 3AL5A 2O1QA 3B0AB 2BNNA 3CQZL 2JENA 4Q1RA 4CDUC 3S1NL 1PIV1 4Q4X3 5FP7A 3AMNA 1SMMA 5A7PA 2K2SA 1B71A 1PVC2 1WMEA 3MPBA 4W4ZA 1VJ2A 3N3HA 5F6KA 1ENRA 1QJU2 2BV4A 2BWCA 1UY1A 1FV3A 1GP6A 1VBA2 2M4YA 4Y20B 2Y6FA 3KLSA 3GALA 2VBBA 1A6CA 4FPCA 4URAA 2DCYA 3CBNA 1DLCA 3LNLA 1XE7A 1VBB1 4MGKE 3K48A 4AW7A 4CZSA 5IVVA 1VBE3 5FZ1A 3V0BB 4LK7A 3ASIA 2ENRA 5HBAA 4HANA 2ZOEB 3BVCA 3BGAA 2CKAA 1S0BA 2JA5L 1W0NA 3M3QA 3J8F3 1R64A 2VZ1A 4YFZA 1X82A 2PHTA 5FZ7A 2Y6JA 1TG7A 1CPNA 1SLAA 4Q2FA 3WLUA 4LEJA 4AVTA 1JYWA 1W6MA 2VMHA 3NV2A 2Z3QB 2WNVA 4OHVA 5EJ1B 2PYAA 2P3YA 4Y1ZA 1BMV1 3HJRA 4IW3A 4TWTA 1SG3A 2KR2A 4WVMA 1V6MA 3ME2A 4QX8A 4CDWC 4XF9A 4LO6B 3KYYA 5F3CA 3HQXA 4N9HA 2JA7L 4LBOA 5GLTA 3RPQA 2GH2A 5FZ4A 5E1RA 1AYM3 2RS11 4W6XA 4IGQA 1EAH1 1WUVA 3SS2A 5M5WL 3ON7A 1IQAA 4FOQA 4NPLA 1GNHA 1J59A 2EALA 3IDAA 4UBHA 5CKMA 1S0FA 3H99A 3HNMA 3LFMA 2FDGA 4A3IL 4J1XA 3NAPC 4J1WA 3H0OA 1NLQA 1AYN2 4ZXKA 4CDXB 2MHFA 3DPRA 4ATFA 4X6QB 4FSJA 1QH6A 2J22A 5FKCA 3SQOA 4EN0A 3AP5A 4IV1B 2WWSA 4AEKA 4CPBD 3MIBA 4P00B 5IT6A 2LW8A 4M0NA 2VZ3A 3H3ZA 2WL1A 3NV4A 3GTJL 2D6PA 3AYDA 5FMCA 5JAXA 1EV13 2PPTA 1S2KA 2JE7A 5FLJA 1CZVA 4QHOA 4PI0A 2UYBA 1GZTA 5F6LB 4NIHA 3EBRA 1UMHA 2P3KA 3OOXA 4FPLA 3BU7A 4Y26A 3K46A 4BBSL 3TBDA 3GHMA 1JN2P 3ES1A 2R1DA 3RZDL 1T2XA 3PUSA 1RUC3 2CWMA 2VOKA 2ZMLA 4CU9A 2JI2A 3K7AL 2BYVE 2HWF2 3E5QA 5LEJA 2VXRA 1BJQA 4Y1UA 3ZFFA 2QKDA 3I2KA 3HBKA 1YIPA 1Y4WA 3PZAA 2VW1A 4AWDA 2XHKA 1UY0A 3MBWA 1PZ9A 1LU1A 2AUYA 5DAVA 2AYHA 3FZ3A 1GICA 3T1LA 1MS1A 2Q5TA 2UY8A 2RS52 4QB2A 3UGGA 2UWCA 3GZEA 3W20A 1IS5A 2WBKA 4GQ7A 4XUTA 5FXXA 4LORA 5DDJ1 5A7NA 2VUML 2WAOA 3WXPA 5FWEA 2I45A 2RS12 2VNVA 4AGVA 1PNGA 5H9PA 1CAWB 4W50A 1POV0 2WN3A 3GBFA 1YLLA 1PFUA 3HJYB 1DGRA 1KS5A 4FPHA 4GULA 3LWOB 4S2DA 4X6RB 5ISLA 3HVDA 2FDKA 4A6OA 2PHWA 4FAGA 1GWKA 4OVEA 1AYN1 3AP6A 1IKPA 4OHWA 2W2IA 4B8EA 4FT8A 2ZX2A 4XQDA 4K6BA 5FQ0A 4WV8A 3OB8A 4E2GA 4YVSA 3B02A 3P8BA 2WS92 2GMMA 1AR93 1UAIA 4NPRA 2Q8DA 2E2IL 5C71A 5JSPA 1PM4A 1W3VA 4TXWA 2ZZQA 3HOBA 2Z4FA 3MIEA 4NRMA 5DN2A 3AL6A 5FZ0A 5FKBA 4FBFA 4ZN3B 2MS3A 5FREA 5CFCB 4P5YA 4AGGA 1QQP3 1XYPA 4A7YA 3BU0A 3LDBA 5EIYB 4JGZA 3BTAA 3ENRA 5FZEA 3WF0A 2NLRA 4QXKA 2GMGA 5IK8A 4P9GA 2Y6LA 3VBOB 2OPWA 1IZ3A 1E5HA 4OULA 1GNZA 2JJ6A 1ZA7A 5GZCA 2NVTL 2D6MA 2YB7A 2V4AA 3VBOA 2DCTA 3KYWA 3MFAA 1X36A 1DGWA 1YQ8A 2Z2SB 4Z2AA 3MLJA 3WX5A 3O1RA 2QE3A 2BQPA 3DL3A 4M4PA 3O1SA 1PZ8A 3TWIA 4B4QA 3H7JA 3HOUL 3BB6A 3OUHA 1DLLA 2BOIA 5F7UA 3IIAA 5ABJA 3DPRB 1U0AA 2R7ZL 2CSGA 3ZN5A 3EJKA 5RXNA 3WY6A 3B93A 3RZJA 4CCOA 3SCGA 3OEBA 3A44A 4TVMA 1W6PA 2FMDA 4YG0A 3RZKA 1BZWA 2WA4A 4CUGA 5KXEA 4FPGA 4A3LL 4CCKA 2JA8L 3JB4C 1GWLA 4I30A 3INAA 4P9YA 5FWJA 4NIDA 1K3IA 1OFSA 1OQ1A 1XRUA 5GALA 4DPNA 4NWWA 4ASKA 1FMD3 2ZKNA 1UZYA 3H1YA 4QKDA 2KN9A 1R081 3GTPL 2VOTA 4ES9A 3K51A 4MO3M 2VBDA 3IT8A 1S2ZA 1ASJ2 1PM7A 4HKOA 5A7WB 2D6OX 2WC2A 2YPDA 4NUBA 4XE9A 4B3NA 4F7ZA 3D3AA 2B4KA 3HAGA 2D7FA 1KFUL 1T6GC 2EIGA 2VTFA 3LPFA 1NT0A 2J1UA 1SFYA 3I4NL 1SFPA 1TNRA 5FOJB 1W0PA 2C1FA 2WJSA 4QQHA 5H9SA 1QCVA 1AHSA 3DN7A 3NSTA 4L9BA 5DXDA 4K7JA 5BNPA 3WDXA 3JBG2 1H1AA 4CCLA 2ZMNA 1ZNPA 1JXNA 3DXTA 1H7VA 3L2YA 4MYEA 1BK0A 3WNMA 1ZBE1 2HH9A 4HPKB 1DGWX 5T50A 4EWDA 1UMZA 4COWA 1FYUA 5SV5A 2VVEA 1UD1A 4UF0B 3VBRA 1IGOA 1COV1 2F4LA 1G9AA 1BQ8A 3FUOA 1XNBA 3LEGA 5A3UA 1XYOA 3M7AA 5LWBA 2C9AA 2B9VA 2D6LX 3Q8FA 1DVBA 2DUOA 2C6SA 2Y34A 1ND2B 3K77A 4D7SA 2Z69A 5JIUA 2YGMA 4AEDA 5FZ6A 1DQ5A 3AZXA 4COZA 1ZZ8A 5IVJA 1SEFA 3ZM8A 3VBUC 4DNYA 4YGDA 1LKMA 5I91A 2Z3RB 2A6YA 5IJRA 3ROUA 5GADc 1XNAA 4A44A 4F83A 3N9PA 1BBT1 2VG9A 2V09A 4P9WA 1JTZX 5JZGB 2P4EA 2VZTA 3HN3A 4MXVA 4UFLA 4CEWB 4DY3A 1GZ9A 4ZU7A 4XDQA 1D0HA 4KI5M 2E7QA 3MLLA 1C8M3 3AVRA 4JDNA 4Q4W3 1YNAA 1MR5A 4LOTA 3PKJA 4L11A 3WW2A 5LBEA 1NXD1 1XU1A 3BOWA 3VKOA 3ZYIB 4B1LA 3H0GL 1RMU1 4AXOA 4MG2A 1OH3A 4JV4A 3OGVA 3HMYA 1Q5OA 3WWNB 1R1ZA 1HN1A 3NV1A 1HB2A 3UJQA 2Q8EA 4C2M1 3H9AA 2X29A 4OFGA 3ORJA 1JBCA 4QDRA 4V196 4E4ZA 1VRH1 1RVF1 2Q1ZB 3CF6E 4I3PA 4QPGB 5BPXA 3ZFEA 4CCNA 3T2QA 2BNOA 5KC6A 1FMD1 2P6CA 4NE9A 3S30A 3DEMA 2R061 1JZ7A 3I4ML 1CAXB 1W8TA 2QCSB 3J26N 1UX6A 3VL9A 2HWB1 5B4NA 4HN1A 5I8TA 3I54A 4FVVA 3KS7A 5ACA2 4YFWA 1H6YA 1SBDA 3K4DA 3IAPA 3LWCA 2GC0A 4MLOA 1VBC2 3MQKB 1RUF2 4QPIC 3T2OA 4A3EL 1GQHA 1KD7A 2O8OA 2YBPA 1VBB2 3GTKL 3AKQA 1BVVA 3RWKX 5GLZA 3TEWA 2VUAA 3AZWA 2GP3A 5CISA 5L36A 2GALA 1POQA 1XE8A 1CAAA 4KBZA 1JW6A 4QQ2A 3KT1A 2VXJA 2JKBA 4QWNA 2ZPXA 2PHLA 2V3BB 1UIKA 1W3XA 3WNKA 1G8WA 2A6XA 4LA2A 2RDVA 2DBNA 1MS9A 3A4UA 3R0RA 4OUMA 1PMHX 2QQOA 3X29B 4AHZA 3PURA 1HDKA 1VE0A 5J3UA 2JKXA 4I01A 2R6QA 3VZMA 3I3BA 5JZGA 1JUHA 2A3XA 4AI1A 3KYUA 5FTTC 2PHFA 5IFPA 3ZXJA 5FYMA 2R1BA 4LMFA 2ARBA 1XQNA 3LEMA 2DVAA 3DKWA 5F5QA 2YBKA 1Q56A 4CXXA 2Q1FA 3OTFA 1OPOA 5CVRA 2YC0A 2J1VA 2QUOA 2XJUA 3ABZA 4QPIB 2JB8A 4XUOA 1ULPA 1V70A 4YVSC 3NNMA 4WM7C 3S6PA 3B5LB 1KGYA 5FPLA 2RS13 5I93A 3NAPB 1H4HA 3HNBM 4CEYB 1PFWA 4KGGA 3WQ0A 1MEC1 1JYCA 2DTWA 2WNUA 1WCDJ 5AI3A 1B35B 4Y4YA 3ZR5A 4DUWA 2VUCA 3PDQA 3CJIC 5DG1A 2B5ID 2A69D 1V6JA 4A3JL 1O6UA 3NJVA 4LBLA 2VNGA 4OMCA 2VQUA 4M3CE 3RFRA 4RXNA 1YC61 2WZR3 1QJFA 3OEAA 4FOYA 1J3PA 3VBHB 2W47A 2WNVC 3BALA 3GNEA 2QBXA 1IG0A 2BUKA 3GGLA 2JIGA 4QKNA 3MW4A 3VBFA 2VECA 4XBQA 4EWEA 4Y1VA 4GKXA 3IDCB 1SHWB 1TME1 2VTXJ 3ZN6A 3LA2A 2BTVC 5C3SA 5CA6A 3UNPA 2NPIA 3LCPA 4AVCA 1EV12 4E4HA 3CU7A 1HXS1 4IE6A 2NVYL 4E27A 1OWCA 1ND3A 1SZBA 1RB9A 1RUI3 4N53A 1NA1A 5AC93 3AMHA 4XZUG 2Q8OA 1IS4A 2GN3A 1Y3TA 5FJ8L 4LXLA 4C3JL 4AFDA 2XH6A 2A6ZA 1MS0A 3ZKUA 3V56A 2OUJA 2E7TA 4FFGA 4LIVA 1JU3A 1D4M2 1ZZBA 2YMZA 3AZVA 5A1LA 2QFEA 3OBRA 3PL0A 2CKCA 4Q4W1 2L0ZA 1QKQA 4Q4Y3 1AYM2 2N7GA 4BDVB 4BQ3A 3D8CA 1IPKA 4QPGA 2XJVA 3S15L 3FFZA 3ZFEB 2GNBA 1TEIA 1RINA 1NY71 3RZOL 1SFNA 1POV1 1RMU3 1CADA 2VQTA 3LOIA 2WO7A 4ISQA 4PT6A 3S57A 4LHNA 4DRRA 1Y1WL 4B8CD 2PAKA 3ETPA 2YV8A 3WUCA 3NVCA 1LOAA 4E4DX 4C0HA 4EV0A 4QM8A 4E9KA 3LWPB 3QOPA 1W99A 1W2NA 3KYXA 3DKQA 3B9CA 2FCTA 1TMF2 2ZX3A 3I3EA 5KXCA 4JAGA 1YYNA 4G6BA 2NMNA 3POJA 5CEHA 1QWRA 1UPSA 3TEYA 4P9IA 4PF5A 4Q0UA 4K8FA 2ZA9A 2RM21 4EZHA 4YWAA 2VZSA 3T4VA 1QNYA 1U5XA 4ZS3A 3PU8A 2B42B 1LOEA 4JGZB 4NN0A 4QM9A 1NLRA 2P1BA 4JQRA 1JI6A 1MS5A 3SCHA 3AP4A 4MSVA 2BERA 4UW4A 1VB4A 1OD5A 2X5IC 3GF6A 2J1EA 3LDKA 3H9CA 3ZYBA 1H1MA 2CDOA 3VBRC 1AZDA 2P3JA 1PHMA 5C3RA 4JGYA 5CKNA 2QDRA 4PQ9A 1PVC3 3VDCA 4YYOA 4D6RA 2PQSA 2W1WA 3RZLA 1LEMA 4HSLA 5KR7A 2Y33A 3UT0A 1LGNA 4ASMB 3P6BA
chains in the Genus database with same CATH topology
1IPJA 3OYWA 3JU9A 2JEMA 4MX3A 1PGL1 1PK6C 2X5IA 4PBOA 2BGCA 3H1WA 3IU3I 4BMEA 2LALA 5KXBA 4R4ZA 4KL1A 2D5FA 2PFWA 1IS6A 4PJYA 5HI0A 3VDDB 4OHZA 3VHPA 4SLIA 3PIO1 1E57A 2CTVA 1AJOA 1LECA 4LUMA 2XJRA 3PLQA 2W68A 4PDWC 2HWD2 4Q1PA 4LNVA 1B2JA 1YRZA 5T54A 3KT7A 3R4SA 3D0SA 5TSWA 4YZ2A 5H9QA 3AFGA 1UCXA 4A3XA 1R093 1RUF1 5AFEA 2C0ZA 4JRAA 4M3CB 2UURA 2DF7A 4XFGA 4URTA 4GMP3 4NO4A 1GANA 1QF3A 3RMXA 4O9EA 2XWBB 3IBMA 1VR3A 1CAUA 1CD3G 4Z92B 4GS7D 2DYCA 5BNOC 2P34A 3LA7A 2HWE2 5ABJB 3ILRA 3TB0A 2RM22 4JAAA 2OIIA 1F5JA 1MZEA 5J96B 1VBE2 1UU5A 3FLTA 3ZSJA 1AL22 4E2QA 2H6BA 2HWC2 1NZCA 3ZSLA 1SLLA 1HQLA 1I3HA 1QQP1 5FCCA 3M3CA 2JG8A 1COV2 4KU8A 4PIYA 1UPIA 2AGSA 1ZRCA 4LLFA 1QDOA 1ZBE2 3ZFGB 2M6PA 1H8TC 3SNMA 4S2GA 5HCBA 1LEDA 1NCQA 1QXPA 2OUHA 3HR9A 4WBBA 5JIAA 4TZDA 1EP0A 1XNCA 4BWOA 2RMU3 4RD7A 2JG8C 3VL8A 4D3WA 3MPSA 4BA6A 5KWRA 2HWD3 3S7EA 1YJLA 1RUI2 4MV2A 3VDDA 1Z7S1 5T5LA 2XVGA 2DVGA 2D3PA 4QPGC 3VLBB 2ES3A 3VV1A 1OLRA 4EWAA 2WT1A 4XW3A 3HT1A 3JZVA 3FMGA 3ACLA 2RMU1 2HEWF 1CESA 2K9ZA 2A68D 2A3YA 4Q4Y1 1RWDA 2EAAA 3OGGA 4Q8LA 3ZFGC 3Q9OA 4JGYB 4Q26A 4S2HA 4WFN1 4LULA 5DUVA 3ZSKA 3MGUA 3VBFB 2Z79A 1RUD1 1G9CA 1B09A 3M3OA 4QGNA 1YFYA 5K7PA 1LOCA 3BIWE 3VZJA 1RYQA 1IW7D 2ETEA 3GHNA 3OF1A 4XFCA 1MEC2 5CFCC 3SH3A 3SH4A 1PGW2 5E89A 4C0BA 3KSCA 3N7KA 4C1WA 4C90A 2WA3A 3MIFA 1C28A 2PELA 1DQ4A 1C1LA 1HRI1 1WLTA 1HRV2 2IXKA 3H8UA 5GLWA 2ZX4A 5JOWA 1FOD1 4XFAA 3W58A 1EYBA 3IKWA 2D97A 5JVG1 2ZKLA 3WZ1A 4WM7B 3MEPA 2FZ1A 2QNKA 4YVSB 3WDUA 4RHV2 5C6CA 2WIIB 4HK8A 3FX3A 4JDOA 4YW2A 3VZKA 1BQ9A 2ZGPA 4YGEA 3KQRA 1HRI3 5L7OA 1QXJA 1NXMA 3MZHA 3PWFA 4CEWC 1U5YA 2VU9A 2WFF1 1Q8PA 3OD0A 5FLHA 2WLQA 1D4M3 1CPMA 1VBB3 3R4UA 4FPJA 4B4RA 3O14A 1I9RA 4XFHA 3VBHC 2PA7A 4XXAA 4IEQA 3JCIA 1VBC3 3ZXAC 3OPZA 1CR7A 1GKBA 3E5UA 5CIRA 1RB8G 3IMNA 2UY9A 3TN91 1FI2A 2R071 4YRDA 4C1XA 3D4KA 4QD2A 3ZSMA 2VVDA 4IL7A 2LCQA 1IROA 1TMF1 3RI9A 3RNSA 1VRH3 2ZX0A 2RS51 2VPVA 1N3OA 1RTVA 5HCAA 3RI8A 4JAEA 2H0BA 3RSJA 1C5IA 1PIV3 2DU1A 4Q4X1 2DSXA 4MXWB 4Y20A 2XG3A 4FTEA 4PLNA 1CJDA 3HBZA 4K9SA 3MLKA 1XNDA 3ZPYA 1Q43A 1SDWA 4N7IA 2O8QA 1G9BA 1GZWB 4R9CA 3SMHA 1BBT2 3RRDA 3W9AA 4OUSA 1NE6A 3QLQA 4ZU5A 2GAUA 2XJTA 4R9BA 3HT2A 2GMPA 2XB6C 4K3UA 4Q29A 1OPMA 4G9SB 1S0CA 2GN7A 4YZ4A 1G86A 3LSEA 4XIOA 4AE2A 1R0FA 1DU3D 1EV11 1ND3C 3FC0A 2C6BA 3J7Y1 1MZ5A 3VBUB 4OHYA 1SLBA 1LB2A 4FOVA 2VQAA 3WG2A 5BV6A 1OA2A 2RR12 4FO9A 4XF3A 5DM71 5BNNC 5L73A 1WCSA 3GZUC 4QX5A 1AUYA 2XGXA 3PIP1 4LHLA 2M4VA 4ISRA 3UKNA 5BNPC 4UW5A 1TE1B 2B8MA 3KD4A 1ZA4A 5GAHc 2RS32 5JMCA 4HPKA 4LBNA 4H7MA 4N9IA 3ZG6A 1LTEA 3IPVB 5CNAA 5CFDB 4HLTA 1W6NA 4N43C 1VP6A 1ZZ6A 3EQEA 5KXDA 1O3TA 3RMYA 1R091 1RUF3 2B7YA 4WZFA 5J09A 1RUH1 3E5XA 3NL1A 3QCWA 1IHMA 3AP9A 4P14A 4Y24A 2CAVA 1YHFA 5EYYA 3CEWA 5DUXA 4RQPA 1LODA 3KCCA 1MQTC 4WVWA 2CAUA 5KHHA 1AXZA 2HYKA 3ALQA 2ET1A 2KA3A 1SMUA 1IS3A 1SLIA 3WV6A 1RHI2 2B39A 4YLZA 2DV9A 2P17A 4LE4A 3PJYA 1PIV2 4K21A 3N7JA 3RYGA 3U10A 4IEVA 3MIGA 1VBD2 2JICA 3PMEA 3USSA 1YFUA 4I0BA 1DYPA 3N7LA 1RHI3 1XYNA 1GQGA 4E6YA 1W0OA 2BEOA 3UJOA 2CL2A 1LCLA 3G7DA 5A32B 2A6ED 2P2KA 4ORFA 4N43B 1BRFA 3MPPG 1IRNA 1F8VA 3VGIA 1DIWA 4ZN1B 1C8M1 2QZ3A 4LE3A 1PVC1 1DZRA 4RS5A 1W6NB 1H1IA 2E53A 1X8MA 4Z07A 4XTPA 2A71A 2WS91 4Q4V3 3ZXLA 1CAVB 2B5HA 1OMIA 3ZFFB 4I0AA 3ZVXA 3WOGA 3WP6A 3A0NA 4L99A 2PTMA 5CBLA 4PDWA 2ERSA 4WM8C 1HKDA 2ZS6B 4Z2WA 2ZTNA 5C8CB 1X33A 4K9FA 1QJX3 5CFCA 2BVBA 5JLVA 4QT6A 2VMIA 4YGBA 2VY0A 1GR3A 3FJSA 4HVQA 1T9QA 5DDJ2 2DUPA 3MYXA 1PNFA 3WDYA 1PO11 4YW4A 4UW6A 4TLFA 2E6VA 1YUDA 5SV8A 4B7EA 4XETA 4C91A 4U36A 1QJZA 1GZWA 1GLHA 2XL7A 2XWJB 1QMJA 4I02A 4BE3A 5EXOA 4AHXA 1HQNA 1HLCA 1LJ7A 5A33A 1F31A 4LTAA 3W59A 1OA4A 1KRIA 1V6LA 4Q0VA 1ALYA 2RS53 2AREA 1HW5A 2WFPA 1W6PB 3FBMA 2GC2A 3GBWA 3PVNA 4HKWA 4I2OA 3KYVA 4M00A 2YYOA 4YSFA 1IU5A 3VBOC 4UY81 3EXUA 4PIXA 1NCQB 3VKMA 3NWKA 2PQQA 2R073 1W6QA 5BNPB 2XBO2 2JD4A 3I59B 3LA3A 4AVVA 4HSJA 2A73B 3KM5A 1O91A 4QU2A 4IV1C 3RJRA 1WBLA 1AX2A 3RJ2X 2IFRA 3ZIWA 3ZYGA 1XNKA 1PO23 3GZTB 4FOWA 3TN93 3VHOA 1ZRRA 5K0UA 4IETA 3DF0A 4IV1A 1J1TA 2IXLA 3MF9A 4ES8A 2G9FA 5T55A 4NR1A 3NKTA 1WW6A 1NG0A 1RJ7A 2H0VA 3MFCA 1OHFA 2ERFA 1UIJA 1QOSA 4BMBA 3U4XA 3C3VA 3FWEA 4OI2A 4KU7A 5GLVA 2JDZA 2WS93 1F5FA 3ES4A 3ZFGA 1IKQA 2V0FA 2EA7A 2XLGA 3RDIA 2Q0AA 3SITA 3ST7A 5EIOC 1LU2A 2HWC3 3AZYA 1KS4A 1BQPA 4KQ7A 4PDWB 5KBFA 4MGYE 3JD73 3AMQA 4GH4B 4XBNA 4AEDC 2ZZJA 1W2UA 2RM23 2VQ0A 1ZZ9A 3OCPA 1JHNA 3ZFFA 2Y38A 4LBKA 1G6NA 4BHPA 5KHJA 1RHI1 4EROA 1UW8A 4NVPA 4H3WA 4XBLA 4N90A 3O0WA 1R083 1W6QB 3PNAA 2J9UB 2A6WA 4FPYA 4P9XA 2EXHA 4YM3A 3WP4A 3I8TA 1K5MC 1VBA1 3H7YA 4RGAA 1ZBA2 3N36A 1VB2A 1NCRB 2NP0A 2W39A 1FPN3 5FQ0B 1RUD3 1R092 1LKPA 2EF6A 2VOXA 1REFA 3J8F1 1A8MA 3BODA 2YPJA 1URXA 1R1A3 1ULDA 3KCXA 3MF6A 1YWKA 3ZFEC 5BNOA 4XFBA 1DYKA 1ONAA 4KWJA 1B35C 1MQTA 4JGZC 1MACA 3TNPB 1RUI1 2RHPA 3VBSB 4H55A 4PIZA 5CAZA 4B29A 5FO9B 1TME3 1O5UA 1HX6A 4YW1A 3E6CC 4LO8A 3FE5A 1C57A 3ELNA 3WNXA 3H50A 2VMGA 4FPEA 3B9IA 3FUQA 2QL0A 3ZXFA 5FDBA 1U12A 5FO7B 2WZR1 5MF6A 4AVSA 1SLTA 3QVDA 4I09A 1O3SA 2PHRA 3WD5A 1AYM1 4JVAA 4YZ3A 1COV3 3D5OA 1AR81 1FOD3 1RL3A 4FXKB 3R4DB 2IC1A 1S0DA 4X8PA 1HIXA 3USUA 2PLV3 2OYZA 1PO21 2XUMA 4LHKA 1XU2A 1UKRA 4GB33 4Z8BA 3WDTA 4FAHA 5HXVA 2D40A 1Q8OA 4HVOA 1V9U3 5JPMB 4AYUA 3ATGA 1NA1B 1MVEA 5KHIA 2FBEA 3P3NA 2C5DA 4AFCA 1FHMA 1RUOA 4AI2A 1GFF2 5K0UC 1RDVA 1O7FA 5H1Sc 4M3CA 1W39A 1CN1A 1WMFA 1NNQA 4FXGB 1AR91 5E8AA 4A2UA 4YW3A 4Q4X2 2V73A 3O12A 3EHKA 4N7UA 1EY2A 1TNFA 2HWE1 3S0MA 2D3SA 2AR6A 1AR62 3VBFC 3ZSEA 4TPUA 1FNZA 4AI0A 3ZO0B 2GNTA 2BNMA 1SLCA 4NHMA 3RYKA 5FO8B 1W6OA 4HK9A 1ZYBA 1NA1C 3EO6A 2W0XA 3NAPA 2OW4A 2R16A 2QDNA 3ECQA 2D6NA 2LTNA 4FP3A 4D94A 3QBQA 5CG9A 5JOXA 2R30A 2B45X 3LZZA 3RG0A 2WLPA 1RUJ3 3VHRA 4UW3A 3WW4A 2XBO3 3AKRA 3L9JT 3VDDC 5T5PA 2NYDA 4YM0A 4RQPC 1N1VA 3ZN6B 1WGPA 1AR72 5CB7A 3M1HA 1R0HA 2R0HA 1DF0A 4XF4A 3B01A 3URFA 3PTYA 2MNGA 5DG2A 2D6KA 5F9TA 4FQ4A 1YV1A 4IV3B 4XHXA 3LAGA 4XPVA 1AR61 4IEOA 2ZHKA 2ZGRA 1PGL2 4AQ2A 4AK3A 1WW4A 2FZ2A 2PAEA 5IK4A 4RR3A 2CYFA 1LGCA 3D0JA 4S2FA 4QGMA 5LK5A 3VPBE 1QGLA 1R0GA 4CYDA 1BFYA 1WA4A 2OA2A 5BNQA 4XFIA 4AR5A 2GNMA 3OY8A 2R043 1XXNA 2ZGTA 4KWKA 1HXS3 4H7LA 1RUE2 3V64A 3HWJA 4BLIA 1I6XA 4INDA 1RMU2 5MFZA 3C2UA 4LO4B 4AFBA 1POV3 3HN1A 2E51A 4IEXA 1A8DA 5AVPA 1ZRDA 2BPA2 3VKLA 4Q4Y2 2A70A 1D2SA 4YZ5A 1NCRC 1DGLA 5D8AB 2WT2A 1CX4A 4PCRA 4BQ1A 3IWZA 1GZCA 4XYXA 1AVBA 4YGCA 3WG1A 1J3RA 3U11A 5ACA3 4WVZA 2RE9A 4XOGA 3CJIB 5L19A 1PO22 3MI8A 1LTLA 4AFDA 1BEV2 1B2OA 4NOTA 4PLOA 3NV3A 3OGJA 5BXXA 2B46X 1BVP1 1OSGA 2LUWA 3NW4A 5DUWA 1D4M1 1AJKA 2IZWA 1AR82 4QQPA 3I2DA 3MW3A 2DURA 3JD71 1OQEA 1ZVFA 1N3PA 1VBD3 3WG3A 4JADA 2ZABA 5D1IA 1QJY2 4TSVA 4XJ8A 1OKQA 4R8HA 1DX8A 2WZR2 1AL0G 4PBPA 4Q0QA 2DUQA 3RZZA 3S7IA 2ET7A 1OOPC 5GZEA 2ZGUA 4MUVA 1PO12 3RYRA 3IDEA 3UV9A 3A0KA 1QOOA 3MIDA 4XJWA 5IK5A 4V1PA 4IEPA 4HKLA 1OI6A 1QJX1 3UKTA 4JGYC 2XKPA 2WQ4A 3RZ6A 2WNEA 2I74A 1UZZA 1L3JA 4Q0SA 4ATEA 1ZRPA 2R49A 4FP2A 3M3IA 3HIFA 1DZQA 4FQZA 3WHUA 4L97A 2ERJA 4AEDB 1Q8QA 4XZPA 5I0SA 2EAKA 5DDJ3 4BIFA 3USUB 2WNUC 1CIWA 3KGZA 5BNOB 2PAMA 4CRQA 1YI9A 3FHIB 3SXWA 3WUDA 1H8TA 4Z1VA 5ABJC 2D93A 1H0BA 4AI3A 3ZMOA 1UF2C 3ZXDA 2TNFA 4MZUA 1PMIA 1OFNA 4TYSA 4EN8B 1CJPA 2D5HA 3ZYPA 5HCFA 2Y0OA 3O0XA 2WQZC 1WW5A 3AMMA 5KHGA 4QMAA 1WMDA 4K40A 1VBC1 3V0AB 5I8SA 4QHBA 1JH5A 2JXAA 3RWNA 5ACA1 1LOFA 3NKGA 5K8SA 1ASJ3 1SCSA 5BUVA 1O3RA 1BBT3 2VNRA 3ZYRA 1B13A 2HKXA 2PVXA 4ONUA 1FMD2 2XLFA 4META 3FLPA 1PO13 5AN9H 2NZ9A 4XJ9A 4Y1YA 2X53S 4DY5A 5BNNB 2JX9A 2RJLA 4AVAA 4POFA 2G4IA 4JAFA 2LM3A 2SLIA 4XFFA 1NYWA 2ZHNA 4K1ZA 3RQ0A 2UWBA 1H9PA 2JG8B 1C3HA 1FX5A 1VALA 1LOFC 1UN1A 4Q0PA 1N47A 4DOUA 1KDMA 4NHLA 5C8CC 2V0EA 4HBNA 4JTNA 1AR83 4KWLA 1OQDA 3BCWA 3ZX7A 5C9AA 3N35A 4WM7A 1O4YA 4L8QA 4XTMA 1UU6A 3WR0A 2NYYA 5A3MA 4XXPA 2CY6A 3QH7A 4XIKA 5C4WC 4AVBA 1I1EA 1QJY1 5C9AB 2WSVA 2NQYA 4Q4V1 4GWMA 5DZFA 1V6IA 5FPZA 1H2LA 5J98B 4FPOB 2D44A 3DPRC 4XF0A 3OBTA 1NCRA 4R9AA 4R9DA 1RJ8A 5DUUA 4BCUA 5IUQA 4GH4C 2DVFA 2TEPA 3NJZA 4W6YA 1J58A 2E7AA 1KDKA 2YROA 3E97A 5DZEA 5GM0A 5B2GB 5H9RA 1LGBA 3H3UA 1SACA 1RUE3 1S55A 3TAYA 2BWAA 3ZXKA 1HXS2 2WZPP 1FATA 4DMIA 2R042 2RR13 3B69A 4E2SA 1MZ6A 1RUJ1 3WQ7A 2GNDA 1PK6A 3KCYA 4EN6B 3B3QE 4F8AA 1JUIA 1VLNA 2JG9C 3AB0A 1NXGA 4Y1XA 3V0AA 1FHHA 4CDWA 2CV6A 3ZDSA 1LESA 3ZIXA 3E6BA 5K9YA 3J7Z1 1IU6A 1ASJ1 4ZU4A 2R32A 1RUE1 1Q8SA 3RS6A 2GDFA 1PGSA 2I2SA 3JBG1 2VOWA 1N1YA 1ULFA 5FLIA 3JQWA 2VVFA 2WINB 3AM2A 1BYHA 3D82A 1H8TB 4OLLA 4UXAA 4AFMA 1S0JA 2IFWA 5CFDC 1X8EA 5I8YA 2AH2A 3QH6A 3FBYA 4XEZA 2MPFA 2ZCWA 2H6CA 4U2AA 3T1MA 1VAVA 2FMYA 5FBZA 1ZBA1 1YXWA 1QJY3 2HWF3 4BZ4A 2UWAA 2DFBA 1DZTA 1JOJA 3IN9A 1LR5A 1C5HA 2WFF3 4E4SA 4CTEA 2EXIA 4RGGA 2PHDA 1WLCA 1DBNA 2XL9A 3H1MA 4BOWA 4CDQA 2OPKA 4KG0A 1BEV3 1ZREA 3AJZA 3VZOA 4H14A 5J7MA 4AI8A 5JI9A 4IQPA 2E9QA 2ZACA 2PVEA 2RJKA 2ZGKA 3VZNA 2Y26A 1AYN3 4HZFA 4KH9A 1KJLA 4AQSA 1H2MA 2Z42A 6RXNA 1N1TA 2ZGNA 4YWMA 1WD3A 1K5MA 1R0JA 3AZZA 1YFXA 4AQTA 3QD6A 4FCAA 4COYA 2Q4SA 1SBEA 4LUKA 2UYAA 3WVJA 5JWPA 3P3PA 4HN0A 3AXEA 1HRI2 2AYJA 1V6KA 2BFUS 1ZBE3 4AGRA 1JYBA 1WJVA 4X8NA 1SMWA 5GAGc 3OJBA 3QACA 1LHOA 7RXNA 1AXYA 1PGW1 1H2KA 3BPZA 2MEV2 4P9LA 4RHV3 4YG6A 1GYKA 5A33B 3AKTA 3GYDA 5K0UB 1QY4A 5C8CA 1NCQC 2RS31 5JDBA 4DXZA 2QVSB 4LBQB 5DM61 2VULA 4CDWB 1ND3B 1M06G 1W6MB 5BNNA 4KG8A 4RS5C 2YY1A 3LPEB 2CWSA 4WVVA 4GB32 5AC91 1BK1A 3ILNA 1CAVA 3DUIA 1RUG1 4OZXA 5D8AA 3GBGA 2HWB2 1ULCA 3FFQA 4M0HA 3I59A 2GSYA 1ZRFA 1RUC1 1N1SA 3ETQA 2G9GA 2R0FA 1VBA3 3TOJA 4AHWA 1A3KA 1OA3A 2IXCA 4LLOA 5LRRA 4HMZA 3AXDA 5MGNA 2H12A 5JZGC 2DU0A 1NE4A 1DQ1A 1S2BA 5FRAA 4R52A 1NLSA 3KZ4C 1HQWA 4IEZA 4XHBA 2RR11 3BOPA 1EAH3 2O0OA 4CEYA 1BE7A 1RUJ2 2GC1A 3J9SA 2TBVA 5E88A 2W52A 1A78A 1YCIA 3JUUA 3CO2A 2R041 1X50A 4RS5B 1O4ZA 3KB5A 5I0RA 1S30A 3UKVA 3SH5A 2NMOA 2A7AA 1LOGA 2EVXA 3LB9A 4AHYA 1S24A 2GH8A 1YUZA 4AF9A 3PMSA 4COVA 4CDUA 5A32A 1WW7A 1V00A 2VW2A 4NHKA 3B94A 5IK7A 5JOYA 4GKYA 3I4IA 2OVUA 1LULA 1YUXA 1KJRA 3PVOA 1EAH2 4J6GA 1AR63 5C9AC 1LRHA 4EJRA 4LO7A 1FPN2 1AF9A 4K1YA 3M70A 2BVVA 3AK0A 2WNVB 1ZBA3 1J1LA 2IXHA 4YVWB 5J48A 4O9GA 2A6HD 4POGA 1YI7A 3AYCA 2BBVA 4RR3C 1T9PA 3LGRA 1R082 1BKZA 3RZTA 2K2DA 1YO8A 1ZX5A 2YZ4A 4XXBB 3NFPI 1Q8VA 2A3WA 1C1FA 1OOPA 3J8F2 1D4VB 1CAXA 5MFPA 1V9U2 3P2AA 1LHUA 3FLRA 3IDBB 5AFBA 5CFDA 1VCXA 3CNAA 4AR6A 2DCKA 4YNIA 4XQWA 4IERA 1QDCA 1APNA 1CVNA 5EINC 1GV9A 1I5ZA 1ND2C 2DTYA 1QOTA 5K2ME 4AFAA 1FOD2 2P37A 1HV0A 2VOVA 2HWD1 1S0IA 4MVTA 5BYNA 2MEV1 1QJU3 5CADA 1J3QA 4KNCA 2JG9A 4L92A 1H2NA 3VBUA 3N7MA 1EPWA 1OWBA 4RQPB 3WDWA 4EN9B 1RVF3 4G4FA 5GZFA 4CDUB 4FPKA 4M3CF 2W08A 5I0UA 4MH0E 3JQXA 4BYYA 1GBGA 4XQ4A 2VUJA 2ZX1A 4JCKA 2ZGOA 4IV3C 2VL6A 1K5MB 1S1AA 4WZCA 2CNAA 4ME3A 1KXGA 3O7OA 3IPVA 4D7TA 1V9U1 5JVH1 3I7DA 2M6OA 2YUEA 2ZHMA 5JSRA 3VBRB 4ITCA 5KHKA 4IEYA 5IY0A 1FAYA 4JRLA 4YVWA 1O3QA 3MW2A 3L2HA 1O4TA 1MVQA 1DHKB 3MDPA 4IV3A 5LRSA 2Y0IA 1RUD2 3THTA 4XJUA 1NQDA 1RITA 2VNOA 5LK7B 1Z78A 4UBGA 5J37A 1FNYA 2IXJA 4SBVA 4GMP1 3G6JB 4ZKTB 4CP2A 2DVDA 3CJIA 4XMIA 3WT3A 3PVEA 4HETA 4BH9A 1ENQA 5GAEc 1BEV1 1QYBA 5GKAC 3AKSA 1JYIA 2HWB3 1Z7S2 3ZFFC 3ZYJB 4LR4A 1MS3A 4LT5A 4D7YA 3JD72 2CR8A 2HWF1 1RC6A 2ZAHA 4HT1T 3U07A 1TMF3 1W6OB 1RDGA 1O5LA 1CAWA 1AL21 1F9KA 1H9WA 2QJVA 2PHUA 1S0GA 2MEV3 4Z82A 4A7KA 3K35A 1WLWA 5FOBB 3SCFA 2XVKA 2KM2A 2ARXA 2NN8A 5FAX