4AHZA

Flo5a showing a heptanuclear gadolinium cluster on its surface after 60 min of soaking
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
b'GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
molecule tags Cell adhesion
source organism Saccharomyces cerevisiae
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
total genus 57
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahzA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahzA01
4COVA 4COYA 4AF9A 2XJTA 4COUA 4AFCA 5A3LA 4AI3A 2XJRA 4COZA 4CP1A 4AHXA 4AI0A 4AHWA 4AI2A 4AFAA 4CP0A 4ASLA 4A3XA 4GQ7A 2XJPA 4LHKA 4COWA 2XJSA 2XJVA 4CP2A 4AHZA 4AFBA 4AHYA 5A3MA 2XJUA 4AI1A 4LHNA 4D3WA 2XJQA 4LHLA
chains in the Genus database with same CATH superfamily
2JD9A 5T3NA 1LB2A 5J09A 3PKIA 2Y0SP 5F3EA 2JX9A 1W0PA 3OGGA 4LITA 2ZCWA 1ALYA 2PTMA 2XUEA 4IE7A 2ZGRA 1OPOA 1SFOL 4KI5M 4LUKA 4PDWC 1REFA 3DPRC 3TN91 3VBFB 3BTXA 5KHKA 1MZ6A 1W8WA 4OFGA 3N9MA 1GOHA 3GBGA 1AL0G 3WG4A 2VPVA 1N3QA 2UWCA 1H2LA 2YPDA 4BXXL 1SLTA 3AYAA 3TNPB 2D44A 4L92A 3QQCE 4M3CA 1ENSA 2XLAA 3NJYA 1B09A 4A7YA 4P9WA 1C8M3 2NMNA 3I8TA 5CB7A 1OXCA 5FZLA 1EAH3 4QPGC 4A41A 1S2EA 3GZUC 3ACLA 2PLV2 1DX8A 3I3DA 4PT6A 1W2UA 4XJ9A 4XQDA 3LIHA 1REDA 5D8AA 5DPNA 3VHNA 5LW9A 1LULA 5FP7A 4URTA 2QTWB 1TWAL 1JODA 2QQUA 2ZBJA 3B93A 1SPPB 3NV2A 4IV3A 3BALA 3TWIA 1VR3A 3U78A 4YVWB 3RG0A 4QU1A 1O5UA 1AL22 2WA4A 4CXYA 1BZWA 3WLUA 2JA8L 1DGWA 4AR2A 4Y4YA 1VAKA 5LBEA 3POFA 2OX0A 1NCRC 2P17A 2ZOEB 2VOTA 1EY2A 1N1YA 4S2GA 3SITA 4HSLA 1DQ4A 1OUSA 1RUD2 2BFUL 5LA0A 3DKQA 1UO9A 2OXBA 2RHPA 1KS5A 5FYVA 5F32A 2QQIA 4XZPA 3ZYBA 4NIHA 3LNLA 2W1WA 1J3PA 5FZIA 1G9CA 4LIVA 2WLPA 3BTAA 1GWKA 5AVAA 4IEXA 2VY0A 2WBKA 4GXLA 4FT8A 4S2DA 3V0AA 5FYZA 3K2OA 3BI3A 5J96B 1DQ1A 1PIV2 3A0NA 6RXNA 4N53C 3WDYA 4LO6B 2DUPA 3B9CA 3ABZA 5JR2A 4AHXA 3WG3A 3ZOIA 1R092 4GH4A 3H99A 3MIFA 4XF3A 3VKLA 2H0VA 3AKQA 1BBT3 2VUML 1CAAA 3S1QL 3OPTA 3B5LB 1QH7A 1KFUL 1X50A 1QQTA 1AVBA 2JDKA 4M01A 3IU3I 2A1XA 3KV9A 4CVUA 2B8MA 2VQUA 1FV3A 2BYVE 2WS92 2X53S 3OSDA 4HG6B 1PIV3 4KH9A 3VBSA 3KYYA 4X6RB 3WQBA 1F8VA 5GZFA 1M06G 4BK4A 1EPWA 4D94A 5IK5A 3HOWL 4IESA 5E1RA 3I2JA 2RV9A 2XL9A 4ZPIA 4A3DL 3TOJA 2I2SA 4CEYB 4PBPA 4EN7B 3GCXA 2Z3QB 4CCJA 2OS2A 3T4HB 2A68D 4DXTA 1R083 1QJX3 1WLWA 2B4KA 5D8AC 4DOUA 4EWAA 5ACA1 1ZZ6A 3B69A 1RYTA 1SPPA 4Y52L 3HQRA 1JZ4A 1U5ZA 1V9U2 4OYUA 1IPKA 2DYCA 3B08B 2ERFA 5M5WL 1G7YA 2EVXA 1AXYA 4BK5A 3SEEA 1IQAA 1ZBA2 4GALA 4QGNA 4YGBA 5EYXA 5FZBA 5GLZA 3UGGA 2WQZC 3H0GL 1R1A3 3G7DA 1W9WA 4AHYA 2VQ0A 1GZCA 3LEIA 4AI1A 1B13A 1OHFA 4NPLA 4CDXC 3UL2A 2JIJA 4E8DA 2YY1A 4BY7L 2WYSA 3DPRA 3VLBB 5AC91 5KXEA 2PHXA 3DEMA 3OJBA 3S14L 1BVP1 2WO3A 3ZN5A 4L9BA 3MEPA 1D4M1 4PDWB 1ZRFA 1GQHA 1V0AA 1XNKA 2J1RA 4N53A 2C9AA 1JZ8A 2PSMC 4EROA 3ZKUA 1EYBA 2AC1A 3ZVXA 3CMGA 1BFYA 4I3PA 1V6NA 4AFBA 1YK4A 3OD4A 1KRIA 4XTMA 5LA2A 3POGA 4Y1UA 2WSUA 5I0DA 3LB9A 3HWJA 4E27A 1BQ9A 2FCVA 4LHLA 1ULGA 1AZDA 4FXKB 5IVBA 4GH4B 5BNNA 4AR3A 3VBSC 1VRH1 2X09A 2XXZA 3ZFEB 2R1DA 4A3KL 3K75B 1IPJA 3LDKA 5IK4A 4XCAA 3RMXA 4AI3A 1FOD2 3T4VA 1W90A 2ZZQA 3N4MA 2CKCA 3OF1A 3RZTA 2DCTA 2QE3A 3WW2A 2ZPXA 1QJY1 1V6JA 5FUNA 3CHXA 1AHSA 3DKWA 4RR3B 3POWA 4BIOA 5BNPC 5JI9A 1PM4A 5EPAA 5IW0A 3BTYA 1ULCA 4CP2A 4Q4X3 4YVSC 2XHNA 2AR6A 2ARAA 3H8OA 1OFNA 2OUJA 1PHMA 2ZGMA 2Z2SB 3B02A 1S0GA 1XNTA 2GN3A 3D3AA 4RL7A 3ST7A 4OUEA 2R072 3S2HL 1GKBA 1RHI1 3CU7A 3PMSA 4DB5A 1W2OA 1G9DA 4ORFA 2IUWA 4PLOA 3OUHA 2DFCA 2C9KA 3AZXA 1LOAA 2WAAA 3QACA 1QXJA 4QKBA 4QKDA 1RMU3 2AUSB 2Y33A 2E51A 3M3EA 4L97A 1S30A 2R073 3BPZA 1F5FA 4J1WA 1VBA2 3FZ3A 1WBFA 4IE5A 3M3OA 1PFVA 2DU1A 2WZ8A 5EYYA 3LWQB 2Q8EA 3OYWA 5H9QA 2K2SA 2D98A 3NJXA 3WZ1A 5F6KA 4QXCA 2WWUA 4NE9A 4DPNA 1SMVA 2ENRA 5IP7L 2D3RA 3HAXC 3RYKA 4CDXB 4HK8A 3ZSJA 2IXJA 1J1LA 1D0GA 4NAOA 2C26A 1JS9A 2G9ZA 2VJXA 3AYCA 3M4FA 2WWSA 4ZONA 2QQWA 5JZGB 1US2A 5I8TA 1VBD2 2ARBA 1W6OA 2JENA 4OZOA 1IPSA 4BU2A 2Q0AA 4LK6A 2NLRA 2XJRA 2GNDA 4YW2A 1FI2A 3E97A 4HXCA 1ZBE1 4IV3C 5IYBL 4AHWA 2WR9A 4XXAA 5GLVA 3PWFA 3OTFA 5FMOL 3MLJA 5D8AB 2B5ID 2XVGA 4I0BA 1X9PA 5FKCA 3RZHA 1L7RA 1FYUA 4CSWA 1RB9A 1N3PA 4KNCA 1VBD3 3D0JA 1S0EA 4UFHA 2W2IA 3RZZA 2WIIB 4JZRA 3ZFEA 2N7GA 2R063 3L2YA 2X05A 5C71A 5L36A 4FOYA 2WJSA 2ZEXA 2PQQA 1QYBA 5FYCA 3ZR5A 5FO7B 5DXDA 4CDWC 1RUF3 4AAXA 2D3PA 2WN3A 1W6MA 3GTLL 5CZKA 4AYBP 1DBNA 5FYUA 3S57A 3I2IA 1NKGA 2QCSB 3AZYA 2XBO2 1QU0A 2IXLA 3JB4C 4XJAA 3LA3A 4BLJA 4A4AA 2FD8A 2E7QA 4IXLA 3UGFA 1UOBA 1RUF1 1GNYA 1ZBE3 2Y60A 4ATEA 5M3FL 1T9PA 4MOAA 3N36A 5L9BA 3MLKA 1ENRA 4QX3A 1LHNA 1YHFA 2YU2A 3FLTA 2MNGA 1J1TA 3NRUA 1WCQA 4Y4RA 5ANNA 2JI3A 2WFF1 2PXJA 2RS51 4QAWA 1BQPA 2PLV1 1C3HA 3IMNA 3ZYHA 3NMBA 2QQLA 3NW4A 4ZU4A 2EXKA 4MX3A 3U10A 2VVFA 1RUJ3 1V00A 2YU9L 3DGTA 3KQRA 4A3GL 2HWB1 3Q8EA 2VMIA 4MGKE 1BK0A 5IHRA 3NJZA 1COV1 1SLAA 2VMEA 5K8SA 4LOTA 1XNAA 2NQYA 4XQ4A 3EYPA 1HB3A 3GHMA 2BE5D 4CA9A 5IVEA 1LOBA 2WAOA 2R7EB 2V72A 1UMHA 2YBSA 1AUYA 4OHWA 3U14A 5I91A 2B45X 3IAQA 2K46A 4UW4A 4RQPA 5HBAA 4Y1XA 3ZDSA 1U5XA 3C7EA 3E5UA 2P3YA 4GWNA 1JU4A 4Z8BA 1EV13 4QQPA 5F5IA 4GB32 5JSPA 5JR7B 4RFRB 4D6QA 4MSVA 5CG8A 3WEZA 4NR1A 1S0DA 3WWNB 1WLTA 2XJUA 4JGYA 5D1IA 2VW0A 5C4WC 4JKLA 1IROA 1HQWA 4E2QA 4JRLA 1AYN1 1WCSA 4FP3A 3KCCA 2OVUA 1ULEA 1EV11 3LCPA 3AZZA 1JZ6A 4Z82A 4CCCA 5FXVA 3QBQA 2PYAA 1ZA7A 1RB8G 1VBE3 2CHHA 2CKAA 2D6MA 1W9SA 4O9GA 2HWD1 5FLJA 1JYCA 2RDNA 3AKSA 1US3A 4MGYE 5FXZA 4EZ4A 3AFKA 3BIEA 2IVJA 4HN1A 3L2HA 5BNOB 1B35C 4KU7A 3V56A 1ZYBA 3PIGA 5DAXA 4IEQA 2BBVA 3D4KA 4Y5TA 1UXXX 4D0QA 5J3UA 2EIEA 2DVAA 4GH4C 1CAXA 2GH2A 2VZQA 2LCQA 3C3VA 1VBE2 2I07B 5FK8A 5FY7A 5JPNB 5HCHA 1V6LA 1TWFL 3USUB 4E2SA 1AJOA 3OGVA 1XSQA 3KT4A 5FXWA 3WY6A 5KC5A 4NROA 5CU1A 1TG7A 3KYXA 4HBNA 3IKWA 4OHZA 4HK9A 1S0CA 3N9LA 3LDBA 1Y7BA 5C8CB 2P3JA 5F2SA 5MFPA 4AFCA 5CADA 3GTPL 2WT1A 1V6KA 2HWF2 3CL1A 3FBMA 3K46A 3N7MA 4LBOA 5EJ1B 4V196 2DU0A 2DTWA 2HWC2 3H8RA 1CJDA 1DZQA 1HX6A 2AEZA 5AFEA 1PZ9A 2BGOA 5FRAA 5BNNB 4COWA 3S6PA 2A69D 1YFYA 4D7TA 5APAA 1F9KA 2FDFA 2VZ3A 1UYPA 3MI8A 2BV4A 4QB1A 1CGPA 1PVC3 5I0RA 1YUXA 1WD4A 5AC92 4D3WA 4B3NA 4M00A 4DO0A 1DDLA 4LO5B 1SG3A 2G1MA 2YFUA 1UQXA 1C1FA 1H9PA 4LE3A 1FHHA 1JYTA 4N9HA 4DY5A 3JBG3 1YI9A 4JDNA 4UI9L 4YWLA 3D6EA 5T5OA 3EQEA 3UYJA 5I8YA 3CF6E 4JC1A 5JSRA 2RDQA 2OKXA 4XUQA 1DYKA 5JZGA 1AR62 2YPJA 5DMYA 4Z1VA 1BLZA 4B7EA 4A93L 3C8XA 3MPPG 2WDBA 3PIO1 2DDUA 5D2AA 3WW3A 3ZLIA 5BNOA 4QX2A 1GUIA 4XURA 5GZCA 2HLEA 1MZ5A 3NO8A 3NQHA 5BPXA 5L7OC 1OA4A 1OVPA 2MS3A 1PZ8A 4M4PA 5FUIA 5CFDB 1UOGA 4URAA 1Y3TA 4QHBA 1F2NA 3RPQA 5FCCA 1I3HA 3KYWA 2EY4E 2ID4A 2VULA 3ATGA 2ZGSA 3JCIA 1S2BA 1PO11 2RG4A 4KG8A 3PO2L 1P7PA 1ND2C 1J58A 1LODA 1RUG1 3HOBA 3HT1A 2CGOA 2L9LA 4GMP0 3VL9A 5C8CA 1OURA 1XQNA 3GBWA 1PO22 3QVDA 3AM2A 4XPVA 3U37A 4PLNA 3OD0A 1MS1A 1ZREA 3DCQA 2D40A 3N35A 4IE4A 3VZLA 1BEV1 3EB7A 4QQHA 1NZCA 4WVZA 1W9TA 5LRSA 1MZEA 2JDHA 4BMBA 4MLOA 1PFYA 2PQSA 5FZOA 2DV9A 1H6YA 2PHTA 4FPJA 4GB31 4W50A 5A80A 1RUOA 1Y4WA 1OH3A 1BMV1 4UBHA 4LLFA 3PTRB 4W6WA 5FPZA 1UU6A 1UZVA 5LBFA 1FAYA 2J1TA 4IEYA 5EJZB 2VH9A 3RFRA 1HRI2 4NVPA 1JUIA 4H7MA 4JTOA 2QVSB 1LOEA 4RXNA 4OMDA 1YV1A 2G4IA 3AMNA 1XYOA 3PVOA 3BU7A 1LEMA 1K5MC 1RYYA 3NNJA 3WNPA 3ZFGC 3MV11 2HWD2 2JD4A 3JQWA 5CFDA 4YM3A 4QPIA 1REEA 2V5DA 2F17A 2H12A 1OLQA 3MW4A 4NUBA 2GMEA 4CDQA 1AYM2 3AZWA 3KM5A 3BN6A 5IAVA 3JXSA 1RL3A 2NPIA 1V6IA 5IFTA 3J7NA 4YGDA 4AW7A 1UZZA 1HV1A 2D6NA 1W04A 3GZAA 3RRDA 3ACIA 1Y9QA 2VZ1A 3FHQA 4Q0PA 4C91A 1R082 1DIWA 1PX4A 4IERA 4JKKA 4B4RA 1VBC2 2WN2A 4JGZC 5A7PA 1VZGA 4G9SB 5DUVA 3MIBA 4R9CA 4NMIA 1V9U1 1WMDA 3LOIA 4EV0A 1T9QA 2RS13 1B2JA 1H2NA 1XE8A 4BDVB 5A6ZA 1BXHA 1AJKA 3IWZA 1YC61 1NQJA 5A3PA 1UYXA 2DVBA 5JMOA 1V9U3 4H7LA 2HBUA 3W58A 3T08A 2A71A 4AVTA 1PX3A 1C8M1 3KGZA 4CPBD 4XE9A 3IBMA 4FBFA 4XACA 2HEVF 4ZKTB 1MS0A 2ZABA 4MYEA 3WNLA 4GS7D 4DRVA 1S0IA 4XZUG 4YW1A 4JHTA 2RS12 3B3QE 3PURA 2AZ5A 3LZZA 3RYGA 3NNGA 5FZ4A 4LORA 3KV5A 3USUA 3KF5A 2ZGKA 3MF9A 2IXIA 3OYWB 4IE6A 4AFMA 2DUQA 4FAGA 2YC0A 4COZA 5C4WB 2CYFA 1AXKA 1W6MB 5FZKA 1NYWA 2R043 1UX7A 2FDKA 4ZXEA 1N47A 2BJSA 1PK6A 2NVXL 1OA2A 2J1EA 3T1MA 3DPRB 3VBFC 2YBPA 4EZHA 1AR61 4FPHA 2D7FA 1AR93 2B9UA 1ST8A 1TE1B 2Z69A 5FYIA 3HBKA 4Z07A 5IT6A 3WHUA 1OF4A 2BPA2 1QHDA 3FUQA 3JBG2 5F8PA 4YW5A 3O0WA 1QQP1 4YVWA 4C1WA 3BB6A 2QDNA 3AXEA 4EN9B 2X8KA 2M6PA 1S0BA 2JDUA 3ACFA 4LO4B 1OT5A 4PI2A 4DS0A 2PFWA 2R061 2W1SA 1W6QA 1PMHX 1IS3A 5I0UA 3S15L 3MV01 4I0AA 2WZR3 4U36A 2BNOA 4UWDA 1RUC1 3AX4A 3LEKA 4AXOA 5DDJ2 5BXXA 5LK5A 1KJRA 1X8EA 5C4XL 1DGRA 4R4XA 2J42A 3LEGA 4KBBA 3WG1A 4C90A 3CZUA 3A4UA 4Q4W1 4JDOA 4I3GA 2WZR1 2R041 1CPMA 3PO3L 2XGXA 3ZFEC 1W28A 3I4ML 3HOZL 3FUOA 3JU9A 5C8WA 4NJ4A 4YZ3A 2YHJA 3IMMA 1RVF2 2MEV1 2IZWA 5FREA 1ULOA 1CIYA 2RVAA 4UF0B 1Y9GA 3NL1A 4S2HA 4AEDC 4DUWA 3LAGA 5K9YA 2CSGA 3NNLA 3SKVA 3UT0A 2R92L 4Q0UA 3FKIL 4Y5SA 4QMAA 1RUJ1 4XAEA 5CEHA 1FOD3 2VMHA 5FXXA 3VHOA 2JEMA 3WXPA 1DQ2A 3PMEA 1VMFA 2W94A 2BZDA 1HRI1 5A3UA 1ULPA 4L2NA 1O3QA 1HRV3 5JIUA 1UU5A 4LT5A 1OQ1A 4HT1T 2R30A 1MPXA 4CDQC 1DQ0A 1R1A1 1NT0A 2LROA 2WNEA 4LBQB 5EQUA 4CU9A 1K83L 3WNOA 1RUE2 4QPYA 2A6YA 2VUCA 1PK6C 5IVFA 2CY6A 1DZRA 4XGHA 1LU2A 3ALQA 4E4ZA 2TBVA 1QJX1 2VZSA 3H0OA 4A7ZA 2IXKA 4LBMA 4AOCA 5AC93 3I7DA 2FMDA 4NRMA 5DZEA 3MBWA 3JD71 4PIXA 4UW6A 4WBBA 2UWBA 3LKJA 3NJVA 4LHSA 2D6LX 3IB3A 3PU3A 3PUAA 2DCYA 2ZJCA 1VCXA 4PCRA 3WINE 3O1TA 2GNBA 2NN8A 1F4AA 4ITCA 4K9SA 2BU9A 1T9OA 3LD8A 3J7Y1 3ZSEA 2WNUC 5IWFA 2ZEYA 4DMIA 2PVEA 4GQ7A 3THCA 2WYFA 4QHZA 2UWAA 4Q4V3 4GMP3 4FFGA 5EFUA 4FVVA 1I5ZA 3GF6A 3N7JA 2YG0A 1MZFA 5EIYB 2CL2A 1NCRA 1QNYA 3ETQA 3IPVA 1MS4A 5LB6A 3VDAA 2XKOA 5FZCA 4JADA 1GP4A 1LTEA 4Q26A 4UY81 1EUTA 3ZN6A 2GP3A 2OPWA 2ZAHA 4LBNA 4Q8LA 4COYA 1WW5A 1Z0HA 5RXNA 3AJZA 1CVNA 5SV8A 3MIDA 4NIIA 1NXD1 4E4SA 4XF9A 4ZN3B 4A3LL 1BE7A 2R6QA 4CDWA 4BLIA 1X7NA 3M3IA 5CIRA 5FLIA 1GOFA 2EAKA 4QQ2A 4BWOA 1R0JA 3LGRA 2R93L 3AFGA 2R7ZL 1QIQA 1QJFA 2KXLA 1VJ2A 3ZXEA 5FLHA 1K5MA 5MF6A 1KGYA 3CKHA 1NA1B 3APBA 5BNPB 3AL5A 4ISQA 3GJBA 1HLCA 1OC1A 1UWWA 1OA3A 3JQXA 3PJQA 4UAPA 3KT7A 3AB0A 4Y26A 3WNMA 5FKBA 4IEVA 3WNKA 1DF0A 2SLIA 1PO12 1YFWA 2XQXA 4YM1A 5GALA 3VGIA 2F6BA 4GULA 1HIXA 5FPVA 1H1IA 4BYYA 1GMMA 2W95A 1H2KA 3BKZA 4OLLA 1CZVA 3UJQA 2CTVA 1QJZA 2Z5WA 3AP9A 2GMGA 4PQQA 3O1SA 2W91A 2EA7A 1GZWB 4WM7A 4QKNA 1PO21 2ETEA 3J26N 1RUE3 2L0ZA 5GAGc 1HJFA 4CDUA 3U0ZA 2B7YA 4FOQA 2A7AA 4AI2A 1N3OA 1NA1A 3CZJA 1CAUB 2M4VA 1BJQA 1K5JA 3O1RA 5M5YL 5FZ3A 3BODA 1C57A 4A45A 1A3KA 2UY9A 2R042 5KBFA 2QL0A 3HNMA 1B35B 4AQSA 4AVVA 3LOBA 2CWSA 2YBKA 4H55A 4UW3A 4XABA 3W9AA 1A78A 3NV4A 1IZ3A 4FPEA 3WCRA 1LAJA 1MS3A 2XLGA 1GBGA 4OHYA 3C7FA 2OW4A 4Q1RA 1JN2P 2ZMLA 5EINC 4Q4Y3 1RWDA 4FQZA 2ORXA 4JAAA 1SMUA 1HB1A 3KSCA 1LNSA 2FDGA 1JMUB 3AYEA 3LWCA 1NLRA 5E6HA 1V6OA 1U5YA 2WQ8A 1S1AA 4AI0A 5EIOC 1YCIA 1U12A 4FQ4A 1YNAA 2B5HA 2VW1A 1KD7A 3D5OA 3WCSA 2YYOA 4XDPA 4XJWA 1BCXA 1Q8QA 3RWKX 4TSVA 2VZPA 4IW3A 1YQ8A 1K12A 3PIP1 1G86A 3MUZ1 4HPKA 2BERA 2HWE1 1W05A 2M6OA 5K4LA 4HETA 5J36A 4YG6A 2BOJA 5EP9A 4XUPA 1KDMA 4KL1A 4NHLA 1XBFA 1GANA 1HXS2 4FCAA 2V4AA 3OEBA 2I45A 4FP2A 1LENA 1P8JA 2RS32 2WNVC 2A70A 1IRNA 4GJZA 5CAZA 4M3CF 1SCRA 2E7TA 1HXS3 4XUNA 4V2WA 1T6GC 3MLLA 1SBFA 2RJKA 5BNNC 4ZHNA 4M3CE 4BXFA 3NVCA 4QPGB 4B8EA 2E33A 2EIBA 1H2MA 1TMF1 4H2AA 4BHPA 3M7AA 1Y1VL 4YSFA 4JAEA 4INDA 2QKDA 4ISRA 4OI1A 3ZYRA 1XXNA 4K3UA 4QPGA 5JAXA 3H9CA 2CGNA 3DXUA 1F4HA 2CDOA 1W8HA 2WT0A 4E8CA 4RD7A 4Y3OA 1QJU1 1W8OA 1KQRA 1JYBA 1H4GA 1HKDA 4FPLA 3ZO0B 4AQ6A 3WX5A 4X6AL 2RR13 3K3NA 1U0AA 4YW3A 1COV3 1A6CA 4NAMA 5MFZA 5H9PA 3TEZA 5EV7A 4YWMA 3U11A 4CCMA 1W6PB 5C8CC 3RYPA 3AYDA 3VBOC 4HKWA 1LKMA 2E2HL 2FZ1A 3VBSB 1W06A 1C1LA 2QQVA 3UESA 1C4RA 1W2NA 1S55A 3DUIA 3HEIA 2WFPA 3OGJA 3TN92 1Q8VA 5JWPA 5IYCL 1XJAA 2AREA 3F2ZA 5JXGA 5JUVA 2E32A 4FTBA 2VZUA 1R0IA 1D2QA 3H50A 4META 3ZM8A 1GNZA 1QOOA 2BBAA 2F4PA 2PYTA 3INAA 1GZ9A 4XOGA 2QZ2A 3PNAA 3F95A 3FHIB 2Y34A 3WG2A 4HVQA 4BQ5A 4K7JA 1WMEA 3H97A 1W8ZA 5C3PA 5IVCA 3ACGA 2XH6A 2GSYA 4LO7A 4JGZA 5BNOC 1NE6A 1YJLA 1QGLA 2V09A 4PIZA 4NIAA 2OQ6A 5CFCC 2AUYA 3AP7A 5BY5A 2Y0OA 2OQ7A 3MIHA 4AVSA 1GICA 1SDWA 1UKGA 3ZG6A 4FFFA 4JRAA 4D8MA 3MPBA 4ZXKA 2PHWA 4C1XA 5MGNA 1NCQB 3ZSLA 1XNDA 1LOCA 2EXJA 4GIQA 4JKMA 4Y24A 2W08A 3ZFFC 3K4ZA 4XFBA 5CA6A 5GZGA 2IVIB 2ZS6B 5HI0A 4UF0A 5A3NA 1Q8OA 3TB0A 1PZ7A 2VMGA 2I74A 5BNQA 4YARA 1IS4A 1XYPA 3M8LA 2RS33 5CFCB 4PF5A 2BVVA 7RXNA 1RMU2 3S0MA 2G9GA 1J3QA 1APNA 1OOPB 4FI9A 4QIWP 1ND3C 2XWBB 3M3QA 4D6RA 2V3BB 2PN5A 4WM7C 3S7EA 4KG0A 2K0GA 4AVBA 5GLTA 4BQYA 2RJLA 4DXZA 1UY4A 4ET7A 1R091 4GWMA 4PI0A 3MSUA 2LUWA 5GZEA 2BFUS 1UY1A 4CUAA 2BDRA 1QH6A 3MPSA 1DZTA 1LHUA 1O4ZA 2HWF3 1LCLA 3SS2A 2P6CA 4AQ2A 4QXKA 5FJKA 3SH4A 3DV8A 4LNVA 2W1UA 3HN3A 5GLWA 1WA6X 1ZZ7A 3P1IA 4PHZA 4G6BA 3OBAA 2B9VA 3I4IA 1WGPA 2WS91 3EO6A 3FJSA 4Q4W3 5FY1A 3RI8A 5LZ6A 1DLCA 1Y1WL 5GAHc 3SCFA 3RJ2X 4AZZA 2BW8A 2ZGTA 3VBHB 1DYOA 1OLME 4PLMA 2FCUA 4R9BA 4ZU7A 3KVBA 5DZFA 1WBLA 1QDOA 3DECA 5T5PA 5FO9B 1BBT1 5F3GA 2XOMA 1WMFA 1R081 3QCWA 2WS93 5K0UC 4DY3A 4FO9A 1CPNA 2JICA 5AVPA 1FMD3 5E16A 3J7HA 5ACA2 1G9FA 3LSDA 4XCBA 2WA3A 2KD7A 2Y38A 4DEVA 5CFCA 2MHFA 4BPZA 1R093 1NZIA 1UMZA 2ADEA 3N9OA 5A1LA 1UPIA 5F1RA 4XDOA 5ISLA 1ENQA 2XB6C 3WOGA 1Z92B 4IV3B 3VV1A 1FMD1 5FO8B 4OQ9A 2HH9A 2XJPA 2X5IB 3ZFFA 1OI6A 2XQRA 1TNFA 2BNNA 2WNVB 2FDIA 3RI9A 4A3EL 3I49A 4A3ML 4TXWA 4HLTA 2XR4A 1SHWB 2AH2A 1EAH2 3QOPA 1PFWA 3Q8BA 4WZCA 2JDYA 1K45A 2WABA 4HVOA 1AL23 3RZJA 1O59A 4Y22A 4XFFA 2CGPA 1L7QA 4RA0A 1OOPA 4A2UA 4IUGA 1DGWX 1J83A 2YZ4A 2KR2A 3OBTA 5BNPA 3IDCB 5DM61 3D0SA 1HQNA 1RXFA 4XVHA 4D6SA 1XSRA 2XMLA 5LEJA 4OI0A 2DF7A 4JV4A 1C8NA 1ZBA3 3BVCA 3OY8A 2ERSA 2UU8A 3CJIC 4IGQA 2HYKA 4JHZA 5LA9A 1FT9A 1QQP2 2YGLA 3KD4A 5FBZA 4DRRA 2ZTNA 2R1BA 3O0XA 2R32A 3P3PA 5FDBA 1VRH3 1D4M3 2ZHMA 1PNGA 3H9AA 1OUXA 3WP6A 4TTGA 3H8XA 1RUG3 3GGLA 2JE9A 4A3FL 1CJPA 2WRAA 1YUDA 2OA2A 4Q2FA 4AR4A 4C3IL 4CCOA 4C0HA 5LWBA 3RZGA 2DBIA 1AL21 1H1MA 3I97A 2AENA 2WNVA 4Q4W2 4WZFA 4BQ1A 1ZRRA 2J1UA 1RDVA 1COV2 1NX9A 2BTVC 3VKMA 1JZ5A 3ZPYA 5FZAA 1O3SA 2A6ED 1CR7A 1QKQA 1QY4A 3NAPC 1BRFA 1ENXA 1H8TB 1K3IA 1H0BA 2JA5L 2O0OA 5FJHA 3LA2A 4UFIA 4C8DA 5A1AA 2BOIA 2P5BA 1XNCA 3KF3A 2W52A 2PMWB 4HZFA 3W5MA 3VBRB 1RHI2 4S2FA 4EQVA 1H8VA 1W8UA 4IEPA 4B8CD 2GP5A 3KGLA 2RMU3 2OPKA 1F31A 3AP6A 3H42B 4N53B 4YGEA 1N1TA 2Q5TA 4QPIB 3K4DA 1IS6A 2R071 4Q4X1 2FHRA 4EYUA 1AYN2 2LRPA 3FL7A 5EJ3A 3NNMA 3ZXJA 1VBB2 2DVDA 1XU2A 4AEKA 2D3SA 3R4SA 2D97A 4HPKB 1ONAA 1PMIA 3FWEA 2VW2A 2XUMA 3B9IA 2RMU1 4L0PA 2VCAA 1VBA1 1TNRA 4N43C 2CAVA 4V2VA 3SCHA 3FE5A 4CP9A 3T2QA 4ARYA 3T1LA 5C44L 1AXZA 1AR73 1VPHA 5C3QA 4MUVA 2C1FA 2VCMA 5I8SA 3VD5A 2VMDA 2VR4A 5J98B 4N8MA 4AR6A 2RR12 4ARXA 4LKFA 1LKPA 4YZ2A 2ZHNA 3MYXA 2VTXA 5G05L 1GP5A 1VMJA 1AR71 1HQLA 2X5IA 3PVEA 3HOVL 4NO4A 3ZFFB 5F3CA 2CR8A 3ILRA 1Y9MA 2DURA 3AVSA 3O1MA 2E7AA 4Z92B 4XJUA 3BTZA 1N1SA 1WW6A 4XXBB 1YQ2A 4RR3A 3RJRA 4R4ZA 1OFSA 2QQJA 3ZFGA 3W20A 2WNUB 3ZYGA 3I2FA 4W6YA 1GYKA 4B4QA 4C0BA 1DYPA 2C6SA 3OGSA 4XHBA 3RWNA 1Q3EA 1KFXL 5M5XL 1ND2A 4FOVA 1CZTA 2ILMA 2YV8A 2J1SA 3H1MA 4M0NA 5DQ0A 3H9BA 1UYYA 3I54A 1AR81 1X36A 2W0XA 3AJYA 1HN1A 1EPZA 4XAAA 1OD3A 2HYXA 1L3JA 1NG0A 3IDEA 5L7OB 1FNYA 4P5YA 2DWRA 1Z78A 2A6ZA 2VQTA 1XB9A 1DGLA 4FPGA 1IKQA 5AI2A 4COVA 2JG8A 2QJVA 3M70A 5DG1A 3E6CC 4Q0SA 2A6HD 1WZXA 1YWKA 2Y64A 4K20A 2PPTA 3LPEB 3H8UA 4XIKA 5FY0A 4JDMA 2PA7A 4WM8B 2AEYA 3FX3A 3CJIA 3S17L 2ZKLA 3HBZA 1ZNPA 3ITQA 3PUIA 4H3WA 4W4ZA 1CWPA 3VZOA 4IV1A 1IOAA 3URFA 1IU6A 4HKOA 4E2GA 5A7WA 4C2M1 3WDTA 2R49A 4G3YC 2Z79A 4YW4A 2QQPA 4WVWA 4WM8A 1RUH2 2TUNA 3CJIB 2MEV3 2WB1P 3B0AB 3SH3A 4YRDA 1S0FA 1NY72 1NUKA 2UYBA 1UIKA 5LRRA 3SCGA 1Q43A 2ZGUA 4B1MA 2JG8B 2VNGA 5T50A 1RINA 4ASKA 1FPN1 4LHNA 2HWB2 2VUDA 1PGL1 2VE1A 3K7AL 1GU3A 4R8HA 3TEXA 4Q5OA 4XFAA 3PUSA 2O5JD 1FOD1 1CAVB 2V5YA 3CLPA 4QX5A 1TME2 1RUH3 1LHOA 2DVGA 2W39A 2Y6FA 3LPGA 1MS9A 4GWIA 1HRV1 2GC2A 3ZYPA 5FZMA 4OVEA 3WP4A 3ETPA 4OHXA 1TME3 1O4TA 2OIIA 4MADA 4GWJA 2XHKA 2HWB3 2W9XA 4AI9A 4P02B 4YVWC 4AK3A 5A32B 2PAKA 1NAEA 3UK9A 5JVG1 2XBO3 3FMGA 2DTYA 3HOYL 3ZSMA 5KHGA 2JA6L 4NPRA 1UY3A 2P2KA 4P9IA 3OUIA 5IUQA 5IFPA 2CNAA 2W47A 2Q1FA 2GC0A 3ZIWA 1FV2A 3MQKB 4YPJA 1AR92 1HRI3 5DAVA 2VOVA 3C2UA 3LWOB 4A3BL 1LRHA 4N9IA 1W0NA 5A3OA 3I2HA 1DCSA 2HKXA 2V4VA 2VO5A 3THPA 5KXDA 1ODNA 5FQ0B 2CV6A 2W87A 4NPMA 5K2ME 3FN9A 4B1LA 3KCYA 1E8JA 1GOGA 1W3VA 5FYSA 2XL7A 3TYJA 5FV3A 2E2JL 1UZWA 4GD4A 2H6BA 1YFXA 5CKQA 3U4SA 3PDQA 2RMU2 1J3RA 2YC4A 4GMP1 1W3XA 3T0BA 4YZ4A 1VP6A 5ABJA 2XJSA 1VBE1 4Q8KA 1CX1A 3S5QA 1M4WA 1SACA 5JVVA 2JDMA 2BWCA 2P37A 1OLMA 1ZX5A 3AZVA 3NWKA 1HV0A 2VL4A 4OHVA 4XMIA 2EALA 2V0FA 1IS5A 1K42A 2EIDA 3J8F3 4I02A 1GR3A 4SBVA 5LBCA 2VVDA 3VZJA 3EMRA 2VUAA 3VD4A 3UGHA 4KQ7A 4J25A 4RQPB 1BBT2 2ORZA 1URXA 4AYUA 2D5HA 5K0UA 3OPZA 1OD5A 4MGSA 4XILA 2GMMA 4ZY9A 2HWC1 2ZGPA 5F39A 2ZIXA 2RE9A 3AKTA 5FZFA 2YFZA 3FBYA 3GTML 1QMJA 4P14A 1F4LA 5DZGA 4X8PA 5MLC3 1VMHA 2HWF1 4LA2A 2BQPA 4BE3A 4BOWA 4OUSA 3MHZA 3K77A 1X9TA 2OUHA 5L19A 1ZRIA 5HV0A 2EXIA 1OF3A 3CJXA 3AVRA 1OMIA 3NAPA 3IZOA 1X8MA 4AR5A 3OB8A 4QDQA 4FPFA 4RS5A 5LY2A 5FQ0A 3ZMOA 4O65A 2PHFA 3KB5A 3E6BA 4K1YA 2CDPA 4XJZA 2NZ9A 4L8QA 3G6JB 3IM0A 2C5DA 4MV2A 3GXUA 3Q8FA 2A3XA 2AYHA 3S7IA 3VZKA 1PVC2 3AP5A 4A7KA 4AGGA 4WM8C 4B7KA 5FWJA 4ZZ8A 2FDHA 2ZGLA 1SEFA 4JX0A 3PU8A 4DINB 1UY2A 4UFLA 4K21A 4N43A 1MQTC 4RGGA 4P08A 2V0EA 5FZ0A 4BIFA 4POGA 3DYMA 3PL0A 4NHYA 3N7KA 3Q8AA 1D0HA 4F3JA 4I09A 5A1FA 2A3WA 2BNMA 2ET1A 1G9AA 1ASJ2 4Q29A 4GKYA 4UOJA 3IT8A 4Q4V2 2XVLA 1J84A 1R64A 3N3HA 1VALA 2VMCA 3VBOB 1YQCA 1T6BX 1W2AX 5I0TA 1SQ4A 1W03A 3FLRA 5L7OA 5FMOS 1E57A 3MW2A 4TYSA 2XVKA 4OCTA 1GNHA 1WMXA 4YGCA 3WD5A 5FBJA 5K0UB 4WFN1 4BXSV 1HRV2 2YGMA 1DGRN 3O1PA 3I3QA 2OZ6A 4AGRA 3KV6A 3VUOA 5JZGC 2HWE3 1RJ7A 3T0DA 4IV1B 2WNUA 2VD7A 3NV1A 2KKDA 1R1ZA 1ODMA 1NCQA 3PVBB 2Q8CA 5C7GA 3OBRA 1RUD1 3TEYA 1UU4A 3LEMA 2RM21 1MEC1 4A6SA 1OBNA 3JB8A 1JZ2A 2MEV2 2RFKB 1W8FA 4XJ8A 2DFBA 2WO2A 4AF9A 2B39A 4RSUA 2G19A 1XRUA 1G8WA 3LFIA 4YG0A 3POJA 2IFRA 3ES1A 2JXAA 3PL5A 1KJLA 1TMF3 1RUJ2 3S1ML 4ZN1B 4M3CB 3H7YA 5IK8A 3C7HA 3ELNA 4E4HA 2D43A 5A3WA 3AMPA 4FPYA 5BV6A 1O3RA 2B42B 2NM1A 3HOUL 1UW8A 2GNMA 2VXJA 2QUOA 3H3LA 2YUEA 5IATA 3V0BA 3S30A 2VOKA 3LF7A 3BIWE 4JCKA 5FY4A 2RR11 1MVQA 4XDQA 2J9UB 3S2DL 1SZBA 1W8TA 2JA7L 2A75A 2Y6KA 4LA3A 3KZ4C 3U4XA 4PDWA 4DEQA 3MF6A 3PVNA 1JTZX 1H8TC 2QQMA 3HJRA 2ZEWA 4JGYB 1POV3 1RXGA 2GC1A 4CEWA 3ZMNA 3P2AA 2HVYC 3HJYB 1FMD2 5FZGA 4BQ4A 1EP0A 1CAWA 1S4CA 1WCDJ 3EBRA 4LO8A 5FP8A 3K4AA 3AMMA 4UW5A 1JU3A 4QT6A 2A6XA 5FPXA 1WD3A 4LBJA 3IN9A 2J1VA 5FOBB 1W6NA 4XYXA 5CKNA 4BY1L 4V1PA 5F5AA 4W65A 4AWDA 3ZXFA 3Q8CA 3P6BA 3SEPA 5M0TA 4AHZA 3GTJL 4TN7A 1FNZA 4X6QB 3FDJA 1EAH1 3PKJA 2HJIA 4QQOA 1W6NB 2A3YA 3VD9A 2ZX2A 4N43B 4IE0A 3RZKA 5IJRA 4NWVA 4A44A 3RZ6A 3AK0A 3HPNA 2ADDA 1UD1A 2KM2A 1VIWB 2D6KA 1CAWB 3THDA 3WDWA 4IDZA 3LWVB 1FATA 3PUQA 2NYYA 3U1XA 3S16L 1O91A 1TEIA 1WKYA 4H14A 3WV6A 4CEYA 5C4JL 3VBRA 1POV0 3KS7A 1MQTA 4HANA 2C4XA 4NWWA 5FY9A 5CISA 1QQP3 4CP0A 5E89A 4F7ZA 2W3JA 2O14A 2VZOA 3AKPA 3HN1A 4BQXA 3AMHA 1NY71 3R4UA 1JYXA 3CEWA 3I3EA 1MS5A 5LEKA 5FZ6A 3KWVA 5LK7B 4R9DA 4N90A 4QU2A 3SMHA 3TRSB 4LBLA 3EJKA 4RQPC 5A6QA 4EN0A 4QGLA 5FZ1A 2MPFA 3I2KA 1CAUA 1TQ5A 1YQ5A 3J9SA 1Q8SA 2WWJA 4A3CL 1TWGL 2FMYA 3B01A 3GTGL 5JSOA 2GMPA 1I6XA 3CQZL 4MGZE 3PTYA 1RUI2 2YB7A 1KEXA 4YFWA 3IDBB 2BRTA 2WZR2 4P9JA 1CAVA 2OYZA 1C5HA 1W6OB 3R6SA 1WCUA 3HJWB 1NXMA 1W6QB 5FMCA 3A0KA 1O4YA 3O14A 4D7SA 1IGOA 1VAVA 3WF1A 1FHMA 4DFSA 3ZXDA 1WW4A 3KV4A 1IG3A 4IEWA 1HN0A 1AR63 2OT7A 4ZS3A 1AR91 1CESA 2VBPA 3VBFA 3ZFGB 4CEYC 2JG8C 3D82A 3LQCA 3IAPA 2WSVA 1W9YA 2ARXA 1C09A 3MFAA 1VBB1 4XEZA 5FJ8L 4IQPA 2J7MA 2O8QA 3J7Z1 1STMA 5FZEA 3R4DB 5L73A 5FYHA 2R16A 3SXWA 4DXSA 3ILNA 4EJRA 5L9VA 2ZX3A 4KWKA 2E31A 5LATA 2WO7A 5JXJA 4RS5B 3ZXLA 1RUC3 1CAXB 3VDCA 3SQOA 1VBB3 5EWSA 5C3SA 1PIV1 5F3IA 5FZDA 1H1AA 5FMDA 1WA4A 4A3XA 3QD6A 3VB9A 1VRBA 1LR5A 3K3OA 4AQTA 4F83A 4OMCA 2P3IA 5T52A 3A7QA 3WHTA 5A6YA 3JD73 1JH5A 3LIGA 1QJX2 3J8F2 4CXXA 2FQPA 4D7YA 1JHNA 1HW5A 1NE4A 4Z2WA 5HXMA 2JI1A 4GA9A 1CN1A 3JD72 3BYWA 2HWE2 1XOYA 4PF1A 4B29A 4G4FA 3VN4A 4BISA 1C5IA 4YVSA 1O3TA 1ZVFA 2VL6A 3HD8B 1MQTB 4YM0A 1GWLA 2ZGQA 1E5RA 2XG3A 3KVAA 4IV1C 2VBBA 1B35A 1RYQA 1YQ6A 4I30A 4XFCA 3VKOA 2VBDA 4FTEA 2E2IL 1I6HL 5IVVA 2A6VA 3V0BB 1UF2C 5FZ8A 1RDGA 2UY8A 1ZBA1 2GALA 5GJ6A 4AFAA 1OVSA 2W68A 2Q1ZB 4IETA 5FZ9A 1W9FA 5T54A 3HQXA 4QXBA 1YLLA 3RNSA 1UOFA 1CX4A 2FZ2A 4JAFA 1OWCA 2LALA 2ZZJA 3ECQA 4I2OA 1F35A 1YIPA 5E8AA 1I50L 3RYRA 4E6YA 1IW7D 3C7OA 4YW7A 3NSTA 5LBBA 3H3UA 1DQ5A 2JECA 3RDIA 2VTFA 3CIHA 5LA1A 3OY8B 4LPLA 5DG2A 1QJU2 4FXGB 1DHKB 1JYIA 2ERJA 1BVVA 2JB4A 1PGW2 1ND3A 2QQKA 3GZTB 2PHLA 4OUMA 4QDRA 5HV4A 2WZPP 1QJY3 4QX0A 4QX1A 3P5BA 2ZMNA 2ZGNA 5GADc 2AQCA 1Q56A 1WW7A 3VDDA 2J1AA 5KXBA 2PHUA 2P4EA 1MS8A 1ZZCA 2D6OX 4A42A 4I0WB 2RDSA 5H9SA 3AKRA 4CCNA 1ZRDA 4CU6A 1ZM1A 4Q4V1 3MIGA 3FHAA 1PGL2 4KGGA 4KU8A 5A3MA 4UXAA 2Q1MA 4LJHA 3HAGA 1JZ7A 3TBDA 1PO23 2RS52 1PZXA 1IQDC 4A6OA 5IYDL 1CZSA 3DL3A 1B2OA 4AEJA 3VBRC 4P9LA 3VZNA 2WO1A 2XONA 2WAQP 2SBAA 2VECA 5KHIA 1SDDB 2VU9A 1VB4A 2GN7A 4QKFA 4XC9A 3UJOA 2BEOA 1SBDA 5C9AC 5FLML 1W39A 2IXCA 3LE0A 3MIEA 2ZGOA 3I4NL 1PNFA 1RUI1 2E26A 2CWMA 4CZSA 2ZX4A 2LTNA 3AP4A 4YG3A 1YK5A 5EXOA 4CE8A 4AG4A 1LOGA 4M0HA 5F5CA 5F37A 3ME2A 5DUUA 1JHJA 1LHVA 5HPOA 5C33A 1DVBA 5JOXA 4Q27A 3W5NA 2WL1A 4QPIC 4NHKA 3POSA 3FC0A 4CUBA 4BQ3A 1LGNA 3N9PA 5FYTA 1RJ8A 3BUCA 4Y20A 1YEWA 4E4DX 1QNWA 2P1BA 1RMU1 5DAQA 2XJQA 4OI4A 4UYBA 3V65A 3WSOA 4BH9A 5C6CA 1H4HA 5AN9H 5CYYA 1PMJX 1XNBA 1LJ7A 4KBZA 4WVMA 2RM22 2XJTA 1MEC2 5FP9A 3ZXAC 1WLDA 3MDPA 1OWBA 3S1RL 1EV12 4XXPA 5SV5A 5DUXA 3VBHA 4BJ0A 2IWGB 4EN8B 1NXEA 2ZHLA 3NAPB 1HDKA 1H7VA 2E53A 2QDRA 4Q4Y1 1RUE1 4QGMA 3K51A 3WUCA 2JG9B 4FAHA 1YRZA 2C24A 3LFMA 3M2MA 5EZWA 3UKNA 5H1Sc 1GV9A 4Y20B 1E5IA 3RMYA 2YMZA 2R0HA 4HMZA 3JZVA 4BB3A 3WQ7A 4MG2A 4WVMB 5BUVA 1WUVA 2E6VA 2QQNA 5A3TA 1UMIA 5HCBA 5FPLA 3J7LA 1ACCA 2JWPA 3S1NL 2YC2A 3AMQA 3HT2A 3V64A 5JOYA 4BA6A 1XC6A 1H6XA 2VUJA 2WQ4A 3O0VA 4MHRA 4CDXA 5JLVA 3RZDL 1F15A 2ET7A 2JDNA 3PIJA 1VBD1 2PHDA 4UFJA 3Q9OA 2Q30A 4P5HA 1GFF2 1U5IA 3I59A 2PAMA 5J48A 5JXIA 1H30A 1Q5OA 1UNBA 1OSGA 5GAEc 5JOZA 1Q8PA 1ZBE2 3T2TA 3OPWA 2WKKA 4LHKA 2A73B 5A7NA 1GZWA 4WM7B 4IGPA 1QXRA 2PLV3 1QF3A 4DQAA 1ZRCA 1D7PM 1UZ0A 3ZYFA 1FPN3 2O1QA 4RR3C 2P3KA 2J22A 3U75A 3VL8A 2QZ3A 3NKTA 2FCTA 1UZYA 4IEUA 1A34A 2VMFA 3ES4A 3WQ0A 2JDZA 5HCAA 3UNPA 1T2XA 3H3ZA 5KHHA 1NOVA 2FDJA 1HJGA 4BM8A 4CDUC 2QBXA 4GKXA 5TSWA 1D4M2 3MW3A 1SMMA 4FPCA 1JW6A 1ULDA 4LQRA 3JR7A 1OH4A 3AC0A 3PLQA 1LEDA 1OPMA 4MGQA 2VNRA 2KA3A 1HB4A 1DLLA 5FP4A 3O1UA 4NN0A 2XBO1 3I2GA 3MICA 4BQWA 2WFF2 2W1QA 5FWEA 5JIAA 1L7LA 1VE0A 2GNTA 3IIIA 5DM71 5C4WA 3TN93 3EHKA 4XQWA 5GM0A 4L99A 1MR5A 1YYNA 1PM7A 3ZR6A 3E5XA 2B63L 4J1XA 4ASMB 1TVGA 5A7QA 1VRH2 4O61A 3GM8A 5M3ML 1RTVA 1SMWA 1H9WA 4QPWA 5A6XA 3VBUC 5J1XA 5F9TA 4QWNA 1SLCA 1S2ZA 2P34A 3B00A 1Z7S2 2ZAAA 3DN7A 2FBEA 3ZYIB 4CP1A 4HN0A 3POBA 3H1WA 4NOTA 4BBSL 3LA7A 3CDZB 3A21A 1AF9A 1IG0A 2R0FA 3RZLA 3B7MA 3R0RA 3KHBA 5BYNA 3KYVA 3POYA 3KYUA 1KDKA 4YW6A 3DF0A 4L11A 1BQ8A 1F5JA 1XYNA 5C3EL 2ZHKA 5CKMA 4DXRA 1UX6A 1BEV2 3ZN4A 1ND3B 5C3RA 1UN1A 3SNMA 2JDPA 2DCJA 3SLIA 5KC6A 2G9FA 3VKFC 1BMV2 3PZAA 3K35A 5C9AA 3HIFA 3TAYA 3SKJE 3HNBM 4P9XA 3HVDA 1OKOA 1NCRB 2YDEA 4NHMA 4Q4X2 4KWUA 2V73A 1AYN3 5AFBA 1LKOA 3IDAA 2ZEZA 2NVQL 1CADA 3ZXKA 3POEA 4CU7A 4ME3A 1CIWA 1OLRA 2ZA9A 2BUKA 3J8F1 1NXGA 1GP6A 2DUOA 3PJYA 1DP0A 4XETA 3I3BA 3MFCA 3ZIXA 5C3OA 5FY5A 1CONA 2VTXJ 1VLNA 2VOWA 2YROA 2BGCA 2RS31 3I2DA 5C9AB 3GJAA 4NRQA 2NP0A 1IU5A 3A44A 3ENRA 4MXWA 2IFWA 1BHGA 2JE8A 3HNYM 2BGPA 1JOPA 3BCWA 4JGYC 5FZOB 3ZXGA 4CCEA 3P3NA 1MVEA 2QFEA 2VNOA 3WWLA 3FFQA 4CDUB 1KITA 5FYYA 3ORJA 1YI7A 2BVBA 3WQ1A 3OBZA 1DFQA 1GZTA 3OUJA 3MO4A 4CDQB 2VGDA 1LTLA 4AEMA 1LKNA 1PGSA 3E1F1 4IEOA 4Y1VA 1ZRPA 2C6BA 1IHMA 2EF6A 2P6HA 1QCVA 4YWAA 5FR3A 3M3YL 2X5IC 1SFPA 5ACA3 1JI6A 2C6AA 4LOSA 3X29B 5JOWA 1SLIA 3GCWA 2LW8A 4HVRA 5C5TA 5IVYA 4YZ5A 1JUHA 1SCSA 2JKXA 2VZTA 4XMAA 4F8AA 1S0JA 2Y26A 4TZDA 1WLCA 1YJKA 4CCLA 2GU9A 1PGW1 4GJYA 5A7WB 5A70A 4GAZA 4LXLA 4NHXA 4LE4A 4JVAA 3VDDB 1OQEA 1G6NA 1JBCA 5F5QA 4QM8A 2HBTA 2QNKA 2OZJA 3KQ4B 5IAXA 4P9GA 1W2TA 2XDVA 1B71A 1RUF2 2JE7A 2JG9C 3WR0A 4CU8A 3MZHA 4RYDA 2K2DA 3ZDVA 1JYWA 3N9QA 3O5SA 5A33B 1JYVA 1JOJA 3O1VA 5A7OA 2VAUA 3PHMA 4YFZA 1BKZA 2AACA 3T2PA 4IEZA 3AXDA 2XPJA 2ZX1A 1UOJA 1JOBA 3WVJA 4UT5A 4E9KA 5LY1A 2GAUA 3RVHA 3VDDC 5DAWA 3BOPA 1MEC3 1W6PA 4LBQA 1FX5A 2LS6A 5LASA 1UXZA 3VKNA 3J4UH 1E5SA 4K40A 4Y1ZA 5HCFA 2QQOA 4K8RB 2DBNA 1FPN2 1XPWA 4QHOA 5KXCA 2TEPA 4XUOA 5DABA 5KR7A 5IK7A 2Q8OA 1DG6A 3RS6A 1S2KA 2NVYL 5FYMA 3T2OA 3GTOL 3GHNA 3ZYJB 4NIDA 1RUG2 3NKGA 1PO13 5ABJC 3I3MA 4SLIA 2RM23 4RHV3 3ROUA 4DUXA 4DIQA 4FTSA 4AFDA 5IP9L 3TNQA 2GC3A 4R9AA 1VBC3 4BZ4A 3WP3A 4LLOA 1QDCA 1UPSA 4O7XA 1OQDA 2H6CA 4M4RA 2JIGA 5ABJB 3USSA 4UFMA 3T0AA 1SLLA 4C3HL 5DAPA 1NA1C 4QX8A 5T5LA 4PIYA 4COUA 4DZGA 2KN9A 4GB33 3HKZP 4Q0QA 2ZACA 4Q4Y2 8RXNA 3T3YA 4B4PA 2UURA 4LKSA 5B4NA 2AYJA 4LULA 3VZMA 3WDXA 3AL6A 1UL9A 1YFUA 2VZRA 3M4OL 2WNOA 3GDBA 4Y7NL 3H1YA 2AGSA 1ODHA 4FSJA 3HR9A 1R1A2 4O9EA 2E63A 4OQ8A 1JZ3A 4TVMA 4Q1PA 1LESA 4JQRA 1UYZA 1OOPC 4Q0VA 2E9QA 3WP5A 1I3QL 1PK6B 1VBC1 3KMHA 3WF3A 5A32A 3ON7A 4C3JL 2JJ6A 2Z42A 1AR72 1RHI3 2ZMKA 4QB2A 4LMFA 2RDVA 5T5JA 5FIXA 3UV9A 1N1VA 2BP6A 1NNQA 5A7SA 5A3LA 4XHXA 1NQDA 1XE7A 2EAAA 2CU5A 3B94A 2PHRA 1XU1A 3RGBA 1I5PA 1RC6A 2WINB 3CQOA 4CUCA 4ES8A 1PFUA 4N7IA 3SISA 3FFZA 1VBA3 4YVSB 3R05A 4LKEA 4LKDA 2RDRA 3ZSKA 2K9ZA 2IC1A 2VG9A 2ZKNA 2M4YA 3I59B 5JMCA 1R0FA 2X29A 4CPBA 4HKLA 3LWPB 3VHRA 2HEWF 2RS11 3OCPA 2YXSA 1OKQA 1AR82 1QEXA 4K6BA 4XTPA 5DDJ3 1K5MB 5JVH1 3BOWA 4UBGA 2O8OA 4AGVA 4ZZ5A 2DSXA 1AR83 5JPMB 4IL7A 2PELA 2VNVA 1HB2A 1AX2A 5FYBA 2Z3RB 3C7GA 4XFGA 4NIGA 1SBEA 4Y33A 4Y1YA 2TNFA 2IXHA 3OG2A 5GKAC 4XF4A 1LOFC 4BMEA 5EHDA 4ATFA 4NRPA 2HEYF 1D2SA 2VVEA 4RS5C 3ZN6B 1PVXA 1O6UA 4LUMA 1ASJ3 2W46A 1Z7S3 1I9RA 4CP9B 4MZUA 2EICA 4JTNA 4POFA 5IYYA 1J59A 2LM3A 3WT3A 4CXWA 2R062 1RUH1 1AX0A 3CNAA 5T55A 1SFNA 3O7OA 3VDBA 4A3IL 2JKBA 1TME1 1VB2A 1ASJ1 1ND2B 1Y43B 5DDJ1 3KT1A 1Z7S1 2RJ2A 3IPVB 3NNFA 4HFSA 5GZDA 2DVFA 4CCKA 2VM9A 2ATFA 2RS53 5B2GB 4DUVA 3GBFA 5F7UA 1RVF3 2JI2A 3VHPA 5F2WA 5FZHA 1W99A 3BPSA 2Y0IA 3VBUA 1RUC2 3S5AA 4MVTA 5C70A 3LWRB 1NLSA 4JQTA 5DUWA 4K8FA 2BWAA 1W0OA 4KMQA 2D6PA 1RVF1 4YZ1A 4RFT0 4Z2AA 4AEDA 1VZHA 2PAEA 5K7PA 2ES3A 4QB6A 3WF2A 1W8NA 5D21A 5C5UA 5CVRA 5HXVA 1SFYA 3WF4A 2WC2A 3GALA 3MGUA 4AI8A 4FFHA 1UKRA 4WV8A 3TEWA 5A33A 2APOB 4MO3M 3WNNA 2W5FA 2X10A 2VZVA 3DYOA 3ZKYA 4AL9A 1YO8A 1LECA 2D5FA 1KS4A 5ERLA 1VZIA 1DQ6A 2WLQA 3OEAA 3M3CA 5B4XA 3O1OA 3WF0A 5FY8A 4JGZB 3VBHC 1VAMA 1ZA4A 1ZZ8A 4RHV2 1AYM1 1WJVA 3ASIA 3IIAA 5FOJB 4QDSA 3JUUA 4ES9A 5FPUA 2HWD3 3GZEA 4QXHA 1LHWA 1JYNA 4AE2A 4W8JA 3GTKL 1BK1A 4RGAA 1S24A 1RITA 4N7UA 1RGSA 1LGBA 4A3JL 3QH6A 2XKPA 3E5QA 2Y6HA 3N7LA 4RGKA 2Y6LA 2DCZA 2Y6GA 4UFKA 3SC7X 1FXZA 4KWLA 4FOWA 3T30A 5CG9A 3NFPI 4K9FA 1TZOA 1X82A 5JDBA 4MGIE 1QXPA 5L9RA 5DN2A 5CBLA 5FUPA 2WZEA 5FP3A 4LTAA 1D4VB 4LK7A 4TWTA 2Y6JA 1EUUA 1O5LA 4CTEA 2Q8DA 5ANQA 1TWCL 1DU3D 1C8M2 3ZX7A 5LCWL 3VBUB 1A8DA 2XLFA 4TLFA 4EWDA 4I01A 3VD7A 2PVXA 3U07A 3QH7A 1AYM3 4AVAA 4XIOA 3UKTA 5FAXA 5KWRA 1RUNA 2EXHA 4DNYA 5IVJA 4LIUA 4XBNA 2A5ZA 3GTQL 4EE2A 2A6WA 1MACA 1R0GA 4TLGA 4XFIA 5CNAA 4MGTA 1ZZ9A 4U671 1QOTA 4KGQA 3ACHA 4ONUA 1GLHA 5FMBA 5G04L 4MHUA 1PVC1 4YLZA 4BCUA 4FPKA 4CYDA 4HOOA 2C0ZA 1O7FA 1NLQA 1CQ9A 1RUI3 3A23A 4MXVA 1XE0A 3WW4A 2HWC3 4YM2A 4RN5A 2VOXA 4LEJA 4QD2A 2Y8KA 2NVTL 4ASLA 1WCML 4QQLA 3JBG1 2GZWA 4HSJA 5FZ7A 4A3ZA 1RIRA 2JDAA 1POQA 2JB8A 4XBLA 3WDVA 1UCXA 3EXUA 1GQPA 1O8PA 4TPUA 5JI7A 2Q4SA 4Y22B 5F6LB 1LU1A 3V0AB 3H3VM 4HONA 4HL0A 4FFIA 4XBQA 3T09A 1LGCA 5I93A 4MH0E 4D69A 5FFOC 1QWRA 4XUTA 3CBNA 4W6XA 1YUZA 1LOFA 3ILFA 4XW3A 5JCTA 1O8SA 2NYDA 2ZX0A 3D8CA 1YIFA 4XF1A 1WWYA 5J7MA 3CO2A 4PJYA 5GLUA 3VBOA 3DYPA 1G9BA 4PBOA 3GNEA 4MXWB 4OI2A 1TWHL 1QOSA 4AAPA 1QJY2 5E88A 4CEWB 5CFDC 1V70A 2W92A 4CDWB 3UKVA 3M1HA 3PUHA 1H8TA 3SHRA 3LPFA 4J6GA 3N9NA 4P00B 1JXNA 3J7MA 1V6MA 3KCXA 3RSJA 3WDUA 4X8NA 2JG9A 3QLQA 1QJEA 3OGRA 3UETA 1GQGA 1X33A 3WW1A 3L9JT 4EWEA 1UY0A 2XWJB 1C28A 3THTA 3OOXA 1GWMA 3ZPOA 5JXHA 4FPOB 4LBQD 5IY0A 1UAIA 2F4LA 4GZ9A 4LR4A 3BU0A 3RZMA 2GH8A 2B46X 2VC9A 2PMZP 3I2OA 3A22A 3VPBE 3LSEA 3KLSA 2XJVA 4RHV1 1HXS1 1E5HA 2WT2A 2VCCA 3WNXA 4QM9A 1BEV3 3E6DA 4CUGA 3W59A 4EN6B 1R0HA 2WUHA 3POIA 2VXRA 5J37A 2NMOA 4XFHA 3FLPA 2HR5A 4ZS2A 4AEDB 1CD3G 3MUY1 1RUD3 1YXWA 3O12A 1NCQC 3K48A 4YNIA 5FK7A 1BYHA 3SH5A 2DCKA 3P8BA 3GYDA 2YU1A 1UIJA 3HQUA 3RZOL 1SLBA 1GSLA 5FPBA 5KHJA 4QX7A 2D93A 1AX1A 4XF0A 1TMF2 3W21A 2Z4FA 1ZZBA 1WCKA 3H7JA 3KHCA 4LBKA 1I1EA 5FPAA 3HOXL 4PQ9A 3DXTA 2VCBA 5AI3A 3LDRA 4CRQA 4R52A 4BQ2A 5H9RA 2H0BA 4CEWC 4AVCA 1QJU3 2ZXQA 1IKPA 5FTTC 4OZXA 4Y5Z0 3WUDA 4JAGA 1POV1 1A8MA 2WFF3 2UYAA 4IGOA 4ZU5A 5I0SA 3VD3A 1KXGA 3RQ0A 4KWJA 4BBRL 3HMYA 3BGAA 4OULA 2GDFA 1R9TL 2VQAA 4CCDA 3NV3A 4YYOA 4U2AA 2CAUA 4P9YA 1ULFA 4WVVA 2EIGA 2ARCA 4K1ZA
chains in the Genus database with same CATH topology
5T3NA 1LB2A 5J09A 3PKIA 2JX9A 1W0PA 3OGGA 2ZCWA 1ALYA 2PTMA 2ZGRA 1OPOA 3TN91 4LUKA 4PDWC 1REFA 3DPRC 3VBFB 5KHKA 1MZ6A 4OFGA 3GBGA 1AL0G 3WG4A 2VPVA 1N3QA 2UWCA 1H2LA 3AYAA 1SLTA 3TNPB 2D44A 4L92A 3QQCE 4M3CA 1ENSA 2XLAA 1B09A 4A7YA 4P9WA 1C8M3 2NMNA 3I8TA 5CB7A 1EAH3 4QPGC 3GZUC 3ACLA 2PLV2 1DX8A 4XQDA 1W2UA 4XJ9A 1REDA 5D8AA 3VHNA 1LULA 4URTA 4IV3A 3NV2A 4AGRA 2ZBJA 3B93A 3BALA 3TWIA 1VR3A 4YVWB 3RG0A 1O5UA 1AL22 2WA4A 1BZWA 3WLUA 1DGWA 4Y4YA 1VAKA 2P17A 1NCRC 2ZOEB 3SITA 4CEYC 1EY2A 1N1YA 4S2GA 4HSLA 1DQ4A 1RUD2 2BFUL 2RHPA 1KS5A 4XZPA 3LNLA 1J3PA 1G9CA 2WLPA 3BTAA 5AVAA 4IEXA 2VY0A 4GXLA 4FT8A 4S2DA 3V0AA 5J96B 1DQ1A 1PIV2 3A0NA 6RXNA 4N53C 3WDYA 4LO6B 2DUPA 3B9CA 4AHXA 3WG3A 1R092 4GH4A 3MIFA 4XF3A 3VKLA 2H0VA 3AKQA 1BBT3 1CAAA 3B5LB 1QH7A 1KFUL 1X50A 1AVBA 4M01A 3IU3I 2B8MA 2WS92 1FV3A 2BYVE 2X53S 4KH9A 1PIV3 3VBSA 3KYYA 4X6RB 1F8VA 5GZFA 1M06G 1EPWA 4D94A 5IK5A 4IESA 5E1RA 2XL9A 3TOJA 2I2SA 4CEYB 4PBPA 4EN7B 2Z3QB 2A68D 1R083 1QJX3 1WLWA 5D8AC 4EWAA 4DOUA 5ACA1 1ZZ6A 3B69A 1RYTA 1U5ZA 1V9U2 1IPKA 2DYCA 3B08B 2ERFA 1G7YA 2EVXA 1AXYA 1IQAA 1ZBA2 4GALA 4QGNA 4YGBA 5EYXA 5GLZA 2WQZC 1R1A3 3G7DA 4AHYA 2VQ0A 1GZCA 4AI1A 1B13A 1OHFA 4CDXC 3UL2A 2YY1A 3DPRA 3VLBB 5AC91 5KXEA 2PHXA 3OJBA 1BVP1 3ZN5A 4L9BA 3MEPA 1D4M1 4PDWB 1ZRFA 1GQHA 1XNKA 4N53A 2C9AA 2PSMC 4EROA 1EYBA 3ZVXA 1BFYA 4I3PA 1V6NA 4AFBA 1YK4A 3OD4A 1KRIA 4XTMA 4Y1UA 2WSUA 3LB9A 3HWJA 4E27A 1BQ9A 4LHLA 1ULGA 1AZDA 4FXKB 4GH4B 5BNNA 4AR3A 3VBSC 1VRH1 3ZFEB 2R1DA 1IPJA 5IK4A 3RMXA 4AI3A 1FOD2 2ZZQA 3N4MA 2CKCA 3OF1A 3RZTA 2DCTA 2QE3A 3WW2A 2ZPXA 1QJY1 1V6JA 1AHSA 3DKWA 4RR3B 3POWA 4BIOA 5BNPC 5JI9A 1ULCA 4CP2A 4Q4X3 4YVSC 2AR6A 1OFNA 2OUJA 1PHMA 2ZGMA 2Z2SB 3B02A 1S0GA 2GN3A 4RL7A 3ST7A 2R072 1GKBA 1RHI1 3CU7A 3PMSA 4DB5A 1G9DA 4ORFA 4PLOA 2DFCA 3AZXA 1LOAA 3QACA 1QXJA 1RMU3 3M3EA 2E51A 4L97A 1S30A 2R073 3BPZA 1F5FA 4J1WA 1VBA2 3FZ3A 1WBFA 3M3OA 2DU1A 5EYYA 3OYWA 5H9QA 2K2SA 2D98A 3WZ1A 4DPNA 5F6KA 1SMVA 2ENRA 2D3RA 3RYKA 4CDXB 4HK8A 3ZSJA 2IXJA 1J1LA 1D0GA 3AYCA 3M4FA 2WWSA 5JZGB 5I8TA 1VBD2 2ARBA 1W6OA 2JENA 2Q0AA 2NLRA 2XJRA 2GNDA 4YW2A 1FI2A 3E97A 1ZBE1 4IV3C 4AHWA 4XXAA 5GLVA 3PWFA 3OTFA 5FMOL 3MLJA 5D8AB 2B5ID 2XVGA 4I0BA 1FYUA 1RB9A 1N3PA 4KNCA 1VBD3 3D0JA 1S0EA 3RZZA 2WIIB 3ZFEA 2N7GA 2R063 3L2YA 5L36A 4FOYA 2WJSA 2PQQA 1QYBA 5FO7B 5DXDA 4CDWC 1RUF3 2D3PA 1W6MA 1DBNA 2QCSB 3AZYA 3JB4C 2XBO2 1QU0A 2IXLA 4XJAA 3LA3A 4BLJA 2E7QA 4IXLA 1RUF1 1ZBE3 4ATEA 1T9PA 3N36A 3MLKA 1ENRA 1LHNA 1YHFA 3FLTA 2MNGA 1J1TA 2JI3A 2WFF1 2RS51 1BQPA 2PLV1 1C3HA 3IMNA 3NW4A 4ZU4A 2EXKA 4MX3A 3U10A 2VVFA 1RUJ3 1V00A 3DGTA 3KQRA 2HWB1 5JSPA 2VMIA 4MGKE 3NJZA 1COV1 1SLAA 5K8SA 2NQYA 4XQ4A 3GHMA 2BE5D 1LOBA 1AUYA 4OHWA 5I91A 2B45X 4UW4A 5HBAA 4RQPA 4Y1XA 3ZDSA 1U5XA 3E5UA 4GWNA 4Z8BA 1EV13 4QQPA 5CG8A 4GB32 5JR7B 4MSVA 4NR1A 1S0DA 3WWNB 1WLTA 2XJUA 4JGYA 5D1IA 2VW0A 5C4WC 1IROA 1HQWA 4E2QA 4JRLA 1AYN1 1WCSA 4FP3A 3KCCA 2OVUA 1ULEA 1EV11 3LCPA 3AZZA 4Z82A 3QBQA 2PYAA 1RB8G 1VBE3 2D6MA 2CKAA 4O9GA 5FLJA 5ABJC 2HWD1 1JYCA 3AKSA 4MGYE 3AFKA 4HN1A 3L2HA 5BNOB 1B35C 4KU7A 3V56A 1ZYBA 4IEQA 2BBVA 3D4KA 5J3UA 2DVAA 4GH4C 1CAXA 2GH2A 3C3VA 2LCQA 1VBE2 2I07B 5JPNB 1V6LA 3USUB 1AJOA 3KT4A 3WY6A 5KC5A 5CU1A 3KYXA 4HBNA 3IKWA 4OHZA 4HK9A 1S0CA 1Y7BA 5C8CB 2P3JA 5MFPA 4AFCA 5CADA 3FBMA 2WT1A 1V6KA 2HWF2 3CL1A 3N7MA 4LBOA 4V196 2DU0A 2DTWA 2HWC2 1CJDA 1DZQA 1HX6A 5AFEA 1PZ9A 5FRAA 5BNNB 4COWA 3S6PA 2A69D 1YFYA 4D7TA 1F9KA 3MI8A 1CGPA 1PVC3 5I0RA 1YUXA 1WD4A 5AC92 4D3WA 4B3NA 4M00A 1DDLA 4LO5B 1C1FA 4LE3A 1H9PA 1FHHA 4N9HA 4DY5A 3JBG3 1YI9A 4JDNA 4YWLA 3D6EA 5T5OA 3EQEA 5I8YA 3CF6E 4JC1A 5JSRA 5JZGA 1DYKA 1AR62 2YPJA 4Z1VA 4B7EA 3MPPG 3PIO1 3WW3A 5BNOA 5GZCA 1MZ5A 3NO8A 5BPXA 5L7OC 1OA4A 1PZ8A 2MS3A 5CFDB 1Y3TA 4QHBA 1F2NA 3RPQA 5FCCA 1I3HA 3KYWA 2VULA 3ATGA 3JCIA 2ZGSA 1S2BA 1PO11 4KG8A 1ND2C 1J58A 1LODA 1RUG1 3HT1A 2CGOA 4GMP0 3VL9A 5C8CA 1XQNA 3GBWA 1PO22 3QVDA 3AM2A 4XPVA 4PLNA 3OD0A 1MS1A 1ZREA 2D40A 3N35A 3VZLA 1BEV1 4QQHA 1NZCA 4WVZA 5LRSA 1MZEA 4BMBA 4MLOA 2DV9A 4FPJA 4GB31 1RUOA 1BMV1 4UBHA 4LLFA 4W6WA 5FPZA 1UU6A 1FAYA 4IEYA 2VH9A 1HRI2 4NVPA 1JUIA 4H7MA 4JTOA 2QVSB 1LOEA 4RXNA 1YV1A 2G4IA 3AMNA 1XYOA 3PVOA 3BU7A 1LEMA 1K5MC 3ZFGC 2HWD2 2JD4A 3JQWA 5CFDA 4YM3A 4QPIA 1REEA 2H12A 1OLQA 3MW4A 2GMEA 4CDQA 1AYM2 3AZWA 3KM5A 1RL3A 2NPIA 1V6IA 4YGDA 4AW7A 1UZZA 1HV1A 2D6NA 3GZAA 3RRDA 1Y9QA 4Q0PA 4C91A 1R082 1DIWA 4B4RA 4IERA 1VBC2 4JGZC 1VZGA 4G9SB 5DUVA 3MIBA 4R9CA 1V9U1 1WMDA 3LOIA 4EV0A 1T9QA 2RS13 1B2JA 1H2NA 1XE8A 1BXHA 1AJKA 3IWZA 1NQJA 2DVBA 1V9U3 4H7LA 3W58A 2A71A 4AVTA 1C8M1 3KGZA 4XE9A 3IBMA 4FBFA 2HEVF 4ZKTB 1MS0A 2EIGA 2ZABA 4MYEA 4GS7D 4DRVA 1S0IA 4YW1A 2RS12 3B3QE 2AZ5A 3LZZA 3RYGA 3USUA 2ZGKA 3MF9A 2IXIA 3OYWB 4AFMA 2DUQA 4FAGA 2YC0A 4COZA 5C4WB 2CYFA 1AXKA 1W6MB 1NYWA 2R043 1N47A 1PK6A 1OA2A 3T1MA 3DPRB 3VBFC 1AR61 4FPHA 2D7FA 1AR93 2B9UA 1TE1B 2Z69A 4Z07A 5IT6A 3WHUA 2BPA2 1QHDA 3FUQA 3JBG2 4YW5A 4C1WA 3O0WA 1QQP1 4YVWA 3BB6A 2QDNA 3AXEA 4EN9B 2X8KA 2M6PA 1S0BA 4DS0A 4LO4B 2PFWA 2R061 1W6QA 1IS3A 5I0UA 4I0AA 2WZR3 4U36A 2BNOA 1RUC1 3AX4A 4AXOA 5DDJ2 5BXXA 5LK5A 1KJRA 1X8EA 1DGRA 4R4XA 4KBBA 3WG1A 4C90A 3A4UA 4Q4W1 4JDOA 4I3GA 2WZR1 2R041 1CPMA 2XGXA 3FUOA 3JU9A 5C8WA 4YZ3A 2YHJA 1RVF2 2MEV1 2IZWA 5FREA 4AEDC 3NL1A 4S2HA 3LAGA 5K9YA 4Q0UA 4QMAA 1RUJ1 1FOD3 2VMHA 3VHOA 2JEMA 3WXPA 1DQ2A 3PMEA 1HRI1 1O3QA 4L2NA 1HRV3 5JIUA 1UU5A 4LT5A 1OQ1A 4HT1T 2R30A 4CDQC 1DQ0A 1R1A1 4LBQB 2WNEA 1RUE2 4QPYA 2A6YA 1PK6C 2CY6A 1DZRA 4XGHA 1LU2A 3ALQA 4E4ZA 2TBVA 1QJX1 4A7ZA 3H0OA 2IXKA 4LBMA 5AC93 3I7DA 2FMDA 5DZEA 3JD71 4PIXA 4UW6A 4WBBA 2UWBA 3LKJA 2D6LX 2DCYA 2ZJCA 1VCXA 4PCRA 3WINE 2GNBA 2NN8A 4ITCA 4K9SA 1T9OA 3J7Y1 3ZSEA 2WNUC 4DMIA 2PVEA 4GQ7A 2UWAA 4Q4V3 4GMP3 5EFUA 4FVVA 1I5ZA 3GF6A 3N7JA 1MZFA 2CL2A 1NCRA 1QNYA 3ETQA 3IPVA 1MS4A 2XKOA 4JADA 4Q26A 1LTEA 4UY81 3ZN6A 2ZAHA 4LBNA 4Q8LA 4COYA 1WW5A 1Z0HA 5RXNA 3AJZA 1CVNA 5SV8A 3MIDA 1NXD1 4E4SA 4XF9A 4ZN3B 1BE7A 2R6QA 4CDWA 4BLIA 1X7NA 3M3IA 5CIRA 5FLIA 4BWOA 2EAKA 1R0JA 3LGRA 3AFGA 2KXLA 1VJ2A 3ZXEA 5FLHA 1K5MA 5MF6A 1NA1B 3APBA 5BNPB 4ISQA 1HLCA 3JQXA 3PJQA 1OA3A 3KT7A 3AB0A 4Y26A 4IEVA 1DF0A 2SLIA 1PO12 1YFWA 4YM1A 5GALA 3VGIA 2F6BA 4GULA 1HIXA 1H1IA 4BYYA 1H2KA 4OLLA 3UJQA 2CTVA 1QJZA 2Z5WA 3AP9A 2GMGA 2EA7A 1GZWB 4WM7A 1PO21 2ETEA 3J26N 1RUE3 2L0ZA 5GAGc 3U0ZA 4CDUA 2B7YA 4FOQA 2A7AA 4AI2A 1N3OA 1NA1A 1CAUB 2M4VA 1BJQA 3BODA 1C57A 1A3KA 2UY9A 2R042 5KBFA 2QL0A 4AQSA 1B35B 3LOBA 4AVVA 2CWSA 4H55A 4UW3A 3W9AA 3WCRA 1A78A 3NV4A 1IZ3A 4FPEA 1MS3A 2XLGA 1GBGA 4OHYA 2OW4A 4Q1RA 1JN2P 2ZMLA 5EINC 4Q4Y3 1RWDA 4FQZA 4JAAA 1SMUA 3KSCA 3AYEA 3LWCA 1NLRA 1V6OA 1U5YA 1S1AA 4AI0A 5EIOC 1YCIA 1U12A 4FQ4A 1YNAA 2B5HA 2VW1A 1KD7A 3D5OA 3WCSA 2YYOA 4XJWA 1BCXA 1Q8QA 4TSVA 3PIP1 1G86A 4HPKA 2HWE1 2M6OA 5J36A 4HETA 4YG6A 1KDMA 4KL1A 4NHLA 1GANA 1HXS2 4FCAA 4Y24A 2I45A 4FP2A 1LENA 2RS32 2WNVC 2A70A 1IRNA 5CAZA 4M3CF 1SCRA 2E7TA 1HXS3 1T6GC 3MLLA 1SBFA 2RJKA 5BNNC 4M3CE 3NVCA 4QPGB 4B8EA 1H2MA 1TMF1 4BHPA 3M7AA 4YSFA 4JAEA 4INDA 2QKDA 4ISRA 4OI1A 3ZYRA 1XXNA 4K3UA 4QPGA 5JAXA 2CGNA 2WT0A 4RD7A 3ZO0B 1QJU1 1KQRA 1JYBA 1H4GA 1HKDA 4FPLA 4AQ6A 3WX5A 2RR13 1U0AA 4YW3A 1COV3 1A6CA 5MFZA 5H9PA 5EV7A 4YWMA 3U11A 5C8CC 1W6PB 3RYPA 3AYDA 3VBOC 4HKWA 1LKMA 2FZ1A 3VBSB 1C1LA 1C4RA 3DUIA 1S55A 2WFPA 3OGJA 3TN92 1Q8VA 5JWPA 2AREA 4FTBA 1R0IA 1D2QA 3H50A 4META 1GNZA 2PYTA 1QOOA 2F4PA 3INAA 4XOGA 1GZ9A 2QZ2A 3PNAA 3FHIB 3WG2A 4HVQA 4K7JA 1WMEA 5BNOC 2XH6A 2GSYA 4LO7A 4JGZA 1NE6A 1YJLA 1QGLA 2V09A 4PIZA 5CFCC 2AUYA 3AP7A 5BY5A 2Y0OA 3MIHA 4AVSA 1GICA 1SDWA 1UKGA 3ZG6A 4JRAA 3MPBA 4ZXKA 2PHWA 4C1XA 5MGNA 1NCQB 3ZSLA 1XNDA 1LOCA 2EXJA 4GIQA 3ZFFC 5CA6A 2W08A 5GZGA 4XFBA 2ZS6B 5HI0A 1Q8OA 3TB0A 1PZ7A 2VMGA 2I74A 5BNQA 4YARA 1IS4A 1XYPA 3M8LA 2RS33 5CFCB 4PF5A 2BVVA 7RXNA 1RMU2 3S0MA 2G9GA 1J3QA 1APNA 1OOPB 2XWBB 1ND3C 3M3QA 2V3BB 2PN5A 4WM7C 3S7EA 4KG0A 2K0GA 4AVBA 5GLTA 4DXZA 2RJLA 1R091 4GWMA 3MSUA 2LUWA 5GZEA 2BFUS 1QH6A 3MPSA 1DZTA 1LHUA 1O4ZA 2HWF3 1LCLA 3SS2A 4AQ2A 4QXKA 3SH4A 3DV8A 4LNVA 5GLWA 1ZZ7A 4G6BA 3RI8A 3I4IA 1WGPA 2WS91 3EO6A 3FJSA 4Q4W3 5GAHc 3SCFA 3RJ2X 2BW8A 2ZGTA 3VBHB 4PLMA 4R9BA 4ZU7A 5DZFA 1WBLA 1QDOA 5T5PA 5FO9B 1BBT1 1WMFA 1R081 3QCWA 2WS93 5K0UC 4DY3A 4FO9A 1CPNA 2JICA 5AVPA 1FMD3 5E16A 5ACA2 1G9FA 3LSDA 2WA3A 2Y38A 5CFCA 2MHFA 4BPZA 1R093 1UMZA 5F1RA 1UPIA 1ENQA 2XB6C 3WOGA 1Z92B 4IV3B 3VV1A 1FMD1 5FO8B 2XJPA 2X5IB 3ZFFA 1OI6A 1TNFA 2BNNA 2WNVB 3RI9A 4HLTA 2AH2A 1EAH2 3QOPA 4WZCA 4HVOA 1AL23 4Y22A 2CGPA 4XFFA 4RA0A 1OOPA 4A2UA 1DGWX 2YZ4A 5BNPA 3OBTA 3IDCB 5DM61 3D0SA 1HQNA 5LEJA 4OI0A 2DF7A 4JV4A 1C8NA 1ZBA3 3OY8A 2ERSA 2UU8A 3CJIC 5JOXA 2HYKA 1FT9A 1QQP2 2YGLA 3KD4A 5FBZA 4DRRA 2ZTNA 2R1BA 3O0XA 2R32A 3P3PA 5FDBA 1VRH3 1D4M3 2ZHMA 1PNGA 3H9AA 3WP6A 1RUG3 2JE9A 1CJPA 1YUDA 2OA2A 4Q2FA 4AR4A 4C0HA 1AL21 1H1MA 2AENA 2WNVA 4Q4W2 4WZFA 4BQ1A 1ZRRA 1RDVA 1COV2 2BTVC 3VKMA 3ZPYA 1O3SA 2A6ED 1CR7A 1QKQA 1QY4A 3NAPC 1BRFA 1ENXA 1H8TB 2O0OA 1H0BA 3LA2A 1XNCA 2W52A 4HZFA 3VBRB 1RHI2 4S2FA 1H8VA 4IEPA 4B8CD 3KGLA 2RMU3 2OPKA 1F31A 3AP6A 4N53B 4YGEA 1N1TA 2Q5TA 4QPIB 1IS6A 2R071 4Q4X1 2FHRA 1AYN2 5EJ3A 3ZXJA 1VBB2 2DVDA 1XU2A 4AEKA 2D3SA 3R4SA 2D97A 4HPKB 1ONAA 1PMIA 3FWEA 2VW2A 2XUMA 3B9IA 2RMU1 4QQ2A 3TYJA 1VBA1 1TNRA 4N43C 2CAVA 3SCHA 3FE5A 3T1LA 1AXZA 1AR73 4MUVA 2C1FA 5I8SA 5J98B 4AR6A 2RR12 1LKPA 4YZ2A 2ZHNA 3MYXA 1AR71 1HQLA 2X5IA 3PVEA 4NO4A 3ZFFB 2CR8A 3ILRA 2DURA 2E7AA 4Z92B 4XJUA 1N1SA 1WW6A 4XXBB 4RR3A 3RJRA 4R4ZA 1OFSA 3ZFGA 2WNUB 3ZYGA 4W6YA 4B4QA 1GYKA 4C0BA 1DYPA 4XHBA 3RWNA 1Q3EA 1KFXL 1ND2A 4FOVA 2ILMA 2YV8A 3H1MA 4M0NA 3I54A 1AR81 1X36A 2W0XA 3AJYA 1EPZA 1L3JA 1NG0A 3IDEA 5L7OB 1FNYA 2DWRA 1Z78A 2A6ZA 1DGLA 4FPGA 1IKQA 5AI2A 4COVA 2JG8A 2QJVA 3M70A 5DG1A 3E6CC 4Q0SA 2A6HD 4K20A 1YWKA 4XIKA 2PPTA 3LPEB 3H8UA 4JDMA 2PA7A 4WM8B 3FX3A 4H3WA 3CJIA 3HBZA 2ZKLA 1ZNPA 3VZOA 4IV1A 1IOAA 3URFA 1IU6A 4HKOA 4E2GA 3WDTA 2R49A 4G3YC 2Z79A 4YW4A 2QQPA 4WVWA 4WM8A 1RUH2 2TUNA 3CJIB 2MEV3 3B0AB 3SH3A 4YRDA 1S0FA 1NY72 2UYBA 3SCGA 1UIKA 5LRRA 1Q43A 2ZGUA 2JG8B 2VNGA 5T50A 1RINA 1FPN1 4LHNA 2HWB2 1PGL1 4R8HA 4XFAA 2O5JD 1FOD1 1CAVB 2V5YA 3CLPA 4QX5A 1TME2 1RUH3 1LHOA 2DVGA 2W39A 4E2SA 1MS9A 1HRV1 2GC2A 3ZYPA 4OVEA 3WP4A 4OHXA 1TME3 1O4TA 2OIIA 2XHKA 2HWB3 4YVWC 4AK3A 5A32B 2PAKA 3UK9A 5JVG1 2XBO3 3FMGA 2DTYA 3ZSMA 5KHGA 4NPRA 2P2KA 4P9IA 5IUQA 2CNAA 2GC0A 3ZIWA 1FV2A 1AR92 1HRI3 2VOVA 3C2UA 1LRHA 4N9IA 2HKXA 3THPA 5KXDA 5FQ0B 2CV6A 5K2ME 3KCYA 1E8JA 2XL7A 2H6BA 1YFXA 5ABJA 2RMU2 1J3RA 4GMP1 4YZ4A 1VP6A 2XJSA 1VBE1 4Q8KA 1M4WA 1SACA 5JVVA 2BWCA 2P37A 1ZX5A 3NWKA 3AZVA 1HV0A 4OHVA 4XMIA 2EALA 2V0FA 1IS5A 3J8F3 4I02A 4SBVA 1GR3A 2VVDA 3VZJA 2VUAA 4KQ7A 4RQPB 1BBT2 1URXA 4AYUA 2D5HA 5K0UA 3OPZA 1OD5A 4XILA 2GMMA 2HWC1 2ZGPA 2ZIXA 2RE9A 3AKTA 3FBYA 1QMJA 4P14A 5DZGA 4X8PA 5MLC3 4LA2A 2HWF1 2BQPA 4BE3A 4BOWA 4OUSA 2OUHA 5L19A 2EXIA 3CJXA 3NAPA 1OMIA 1X8MA 4AR5A 4RS5A 4FPFA 5FQ0A 3ZMOA 2PHFA 3KB5A 3E6BA 4K1YA 4XJZA 2NZ9A 4L8QA 3G6JB 3IM0A 2C5DA 4MV2A 2A3XA 2AYHA 3S7IA 3VZKA 1PVC2 3AP5A 4A7KA 4AGGA 4WM8C 4B7KA 2ZGLA 1SEFA 4DINB 4K21A 4N43A 1MQTC 4RGGA 4BIFA 2V0EA 4POGA 3N7KA 1D0HA 4F3JA 4I09A 2A3WA 2BNMA 2ET1A 1G9AA 1ASJ2 4Q29A 4GKYA 3IT8A 4Q4V2 2XVLA 3N3HA 3VBOB 1VALA 5L7OA 5I0TA 1SQ4A 3FLRA 5FMOS 1E57A 3MW2A 4TYSA 2XVKA 1GNHA 4YGCA 3WD5A 5K0UB