2RDVA

Rubredoxin from desulfovibrio vulgaris miyazaki f, monoclinic crystal form
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
52
structure length
52
Chain Sequence
MKKYVCTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEFEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Structure determination of rubredoxin from Desulfovibrio vulgaris Miyazaki F in two crystal forms.
pubmed doi rcsb
molecule tags Electron transfer
total genus 7
structure length 52
sequence length 52
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2rdvA00
4POGA 1B71A 1YV1A 1JYBA 1S2ZA 3QVDA 1IROA 1FHMA 1T9OA 3RYGA 8RXNA 1E8JA 1B2JA 1BFYA 1YK5A 4ME3A 1RB9A 7RXNA 1S24A 1BE7A 1CAAA 1SMWA 1T9QA 3A44A 1SMUA 2PVEA 3SS2A 3RZ6A 1IU5A 5AI3A 4TPUA 2V3BB 2HR5A 3KYWA 3PWFA 1LKPA 4AR3A 1NNQA 1R0IA 4AR5A 2MS3A 1ZRPA 2KKDA 5IY0A 4RXNA 1DVBA 1RDVA 1SMMA 1CADA 1BQ9A 1T9PA 1BQ8A 4AR4A 1LTLA 1R0GA 1DX8A 2DSXA 2K2DA 3PZAA 1R0FA 1BRFA 1S30A 3KYUA 1YUXA 1C09A 1VCXA 1YUZA 6RXNA 4YWMA 1B13A 1H7VA 1QCVA 3MPSA 1R0HA 4POFA 1IRNA 5AI2A 2GMGA 3KYYA 2VL6A 1RDGA 1YK4A 3RZTA 4K9FA 1RYTA 3KYXA 1LKMA 3KYVA 1IU6A 2PYAA 2M4YA 1RWDA 4AR6A 5RXNA 2PVXA 2LCQA 1LKOA 1FHHA 2RDVA 2KN9A 1R0JA 1B2OA 2QL0A 4YWLA 1QYBA
chains in the Genus database with same CATH superfamily
2C6AA 3K35A 1S2ZA 4X6AL 2B63L 4C3IL 8RXNA 3S16L 1BFYA 1TWGL 1I3QL 3LNLA 2EY4E 1VZIA 5GAGc 3H3VM 3RZ6A 5MLC3 5AI3A 3PIO1 5M5YL 1LKPA 1SFOL 2V0FA 3J7Y1 2J9UB 1R0IA 5EINC 5IY0A 5DM61 4A3CL 3GTQL 1Z92B 1LTLA 2K2DA 5MF6A 1R9TL 2V0EA 4AI0A 4AHXA 5M3ML 4A3ML 1C09A 3S1NL 4YWMA 2JI2A 3ZG6A 1QCVA 1R0HA 2XJSA 2APOB 3M4OL 3PKJA 4JAEA 2ERSA 3IU3I 2NVQL 4JAFA 3LWVB 1IRNA 3LPEB 2PPTA 4Y52L 4AYBP 5H1Sc 2WAQP 2Y0SP 2PYAA 2H12A 3CQZL 2XJVA 3I4NL 2PSMC 1B71A 1YV1A 2A68D 2AQCA 3QVDA 5FLML 4JAGA 2VUML 3P2AA 4ZN1B 3PO2L 3QQCE 3S2HL 4GS7D 2RFKB 3RYGA 1P7PA 4XXBB 1E8JA 5IYDL 1B2JA 2M6OA 5C3EL 5C4JL 2L0ZA 3H99A 4ME3A 3I4ML 1RB9A 4BY1L 1VZGA 1CAAA 3A44A 1IU5A 4TPUA 3KYWA 1ODHA 4AHWA 2BE5D 4BBRL 3J7Z1 1WCML 4A3EL 1NNQA 1OWBA 4AR5A 2Z3QB 2KKDA 1DVBA 3WWLA 1SMMA 1BQ9A 4AHYA 4A3KL 1BQ8A 1R0GA 3GTJL 1DX8A 1R0FA 4B8CD 2WB1P 2XJRA 4A3IL 3HJWB 2O5JD 3MSUA 4JADA 1TWHL 1VCXA 2NYDA 1B13A 2E2JL 2PMZP 4AI3A 1H7VA 2A6ED 4WFN1 4POFA 2JA5L 3H9BA 1IW7D 3KYYA 2VL6A 3RZDL 1RDGA 3HOZL 1VZHA 3K7AL 2R7ZL 2M4VA 5RXNA 2PVXA 4AI1A 3PL5A 2A69D 2LCQA 5MGNA 1LKOA 1FHHA 5FJ8L 3PIP1 1TWFL 2QL0A 1PFWA 1Y1VL 1QQTA 2NVTL 3RZOL 3H9CA 5C4XL 1IROA 5MFPA 1FHMA 4U671 1T9OA 2E2IL 2AUSB 5M3FL 3LWRB 1RYQA 1YK5A 4A93L 1S24A 3HKZP 3GTOL 2PVEA 3SS2A 1I50L 3FKIL 5JVG1 3MQKB 3S14L 4AR3A 2A6HD 3S1RL 5MFZA 3NFPI 1WJVA 1ZRPA 4RXNA 3B0AB 1RDVA 1CADA 1T9PA 5EIOC 2ERJA 4AR4A 2R93L 2CKCA 3PO3L 1PFVA 4QIWP 2JA7L 5AN9H 2NVYL 5GAEc 2JI1A 3JR7A 3GTML 1S30A 3KYUA 3LWOB 2JA6L 2AYJA 2NVXL 1NXGA 4A3LL 1TWAL 1YUZA 6RXNA 1PZXA 3WWNB 3HOXL 3S17L 4A3DL 1F4LA 1NXEA 5IP9L 1TWCL 2Z3RB 3P8BA 3S1QL 2GMGA 2B5ID 3RZTA 4K9FA 3PKIA 3B08B 1LKMA 3KYVA 1IU6A 4E6YA 1OWCA 2JI3A 2RDVA 4C2M1 3GTLL 2M6PA 4YWLA 1QYBA 1PFYA 4POGA 3H97A 1JYBA 3HOWL 5JVH1 2YU9L 3VPBE 2JA8L 2CKAA 5C44L 4BXXL 5K2ME 7RXNA 1BE7A 3GTGL 3HOVL 1SMWA 1T9QA 5GAHc 3S15L 1SMUA 2V3BB 3S1ML 2HR5A 2XJUA 4ZN3B 3PWFA 3S2DL 5M5WL 5IYBL 3GTPL 4V196 4AHZA 3HAXC 2MS3A 3M3YL 2CR8A 4XGHA 1K83L 2DSXA 3PZAA 3HOUL 2HVYC 4BY7L 4C3HL 1BRFA 5M5XL 4G6BA 4A3JL 4A3FL 2E2HL 5GADc 4LHNA 1I6HL 4A3BL 1YUXA 4TVMA 3H0GL 2C6BA 4UY81 3HJYB 3FDJA 3MPSA 4LHLA 5AI2A 4A3GL 1YK4A 5IP7L 3HOYL 1RYTA 5DM71 4Y7NL 3KYXA 3GTKL 2ZIXA 4BBSL 3LWQB 5IYCL 2XJPA 2M4YA 1Y1WL 1RWDA 4AR6A 4AI2A 2XJQA 2R92L 4C3JL 2XJTA 3LWPB 2KN9A 1PFUA 1B2OA 1R0JA
chains in the Genus database with same CATH topology
4POGA 2C6AA 1B71A 1YV1A 3K35A 2A68D 1JYBA 1S2ZA 3QVDA 1IROA 4JAGA 5JVH1 5MFPA 3P2AA 1FHMA 4ZN1B 4U671 3QQCE 1T9OA 3VPBE 4GS7D 3RYGA 4XXBB 8RXNA 1E8JA 1B2JA 2M6OA 2CKAA 1BFYA 2L0ZA 1RYQA 1YK5A 4ME3A 5K2ME 1RB9A 3LNLA 7RXNA 1S24A 1BE7A 1VZGA 1CAAA 1SMWA 1T9QA 1VZIA 3A44A 5GAHc 1SMUA 2PVEA 5GAGc 3SS2A 3RZ6A 1IU5A 5MLC3 4TPUA 5AI3A 2V3BB 3PIO1 2HR5A 2XJUA 3KYWA 4ZN3B 1ODHA 3PWFA 1LKPA 5JVG1 4AHWA 2BE5D 2V0FA 3J7Y1 4AR3A 3J7Z1 2A6HD 4V196 1NNQA 4AHZA 1OWBA 2J9UB 1R0IA 5MFZA 4AR5A 2MS3A 3NFPI 5EINC 1WJVA 2Z3QB 1ZRPA 2KKDA 5IY0A 4RXNA 1DVBA 3B0AB 1RDVA 1SMMA 3WWLA 2CR8A 5DM61 1CADA 1BQ9A 1T9PA 4XGHA 1Z92B 2ERJA 4AHYA 1BQ8A 5EIOC 4AR4A 1LTLA 2CKCA 1R0GA 1DX8A 2DSXA 2K2DA 3PZAA 1R0FA 5AN9H 4B8CD 1BRFA 5MF6A 4G6BA 2V0EA 5GAEc 2JI1A 4AI0A 1S30A 2XJRA 3KYUA 4AHXA 5GADc 2O5JD 3MSUA 4JADA 2AYJA 4LHNA 1NXGA 1YUXA 4TVMA 1C09A 1VCXA 2C6BA 1YUZA 2NYDA 4YWMA 6RXNA 1B13A 4UY81 2JI2A 3WWNB 3ZG6A 4AI3A 1H7VA 1QCVA 2A6ED 2XJSA 3MPSA 1R0HA 4WFN1 4POFA 4LHLA 1NXEA 3PKJA 4JAEA 2ERSA 3IU3I 2Z3RB 3P8BA 4JAFA 1IRNA 3LPEB 5AI2A 2PPTA 1IW7D 2GMGA 2B5ID 3KYYA 2VL6A 1RDGA 1YK4A 3RZTA 4K9FA 3PKIA 1RYTA 5DM71 3B08B 1VZHA 1LKMA 2ZIXA 3KYXA 3KYVA 5H1Sc 1IU6A 2PYAA 2H12A 2XJPA 2M4YA 2XJVA 2M4VA 1RWDA 4AR6A 4E6YA 5RXNA 2PVXA 4AI2A 4AI1A 1OWCA 2XJQA 2A69D 2LCQA 5MGNA 2JI3A 1LKOA 1FHHA 2RDVA 2XJTA 2M6PA 2KN9A 2PSMC 3PIP1 1R0JA 1B2OA 2QL0A 4YWLA 1QYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POG A;  1B71 A;  1YV1 A;  1JYB A;  1S2Z A;  3QVD A;  1IRO A;  1FHM A;  1T9O A;  3RYG A;  8RXN A;  1E8J A;  1B2J A;  1BFY A;  1YK5 A;  4ME3 A;  1RB9 A;  7RXN A;  1S24 A;  1BE7 A;  1CAA A;  1SMW A;  1T9Q A;  3A44 A;  1SMU A;  2PVE A;  3SS2 A;  3RZ6 A;  1IU5 A;  5AI3 A;  4TPU A;  2V3B B;  2HR5 A;  3KYW A;  3PWF A;  1LKP A;  4AR3 A;  1NNQ A;  1R0I A;  4AR5 A;  2MS3 A;  1ZRP A;  2KKD A;  5IY0 A;  4RXN A;  1DVB A;  1RDV A;  1SMM A;  1CAD A;  1BQ9 A;  1T9P A;  1BQ8 A;  4AR4 A;  1LTL A;  1R0G A;  1DX8 A;  2DSX A;  2K2D A;  3PZA A;  1R0F A;  1BRF A;  1S30 A;  3KYU A;  1YUX A;  1C09 A;  1VCX A;  1YUZ A;  6RXN A;  4YWM A;  1B13 A;  1H7V A;  1QCV A;  3MPS A;  1R0H A;  4POF A;  1IRN A;  5AI2 A;  2GMG A;  3KYY A;  2VL6 A;  1RDG A;  1YK4 A;  3RZT A;  4K9F A;  1RYT A;  3KYX A;  1LKM A;  3KYV A;  1IU6 A;  2PYA A;  2M4Y A;  1RWD A;  4AR6 A;  5RXN A;  2PVX A;  2LCQ A;  1LKO A;  1FHH A;  2RDV A;  2KN9 A;  1R0J A;  1B2O A;  2QL0 A;  4YWL A;  1QYB A; 
#chains in the Genus database with same CATH topology
 2C6A A;  3K35 A;  1S2Z A;  4X6A L;  2B63 L;  4C3I L;  8RXN A;  3S16 L;  1BFY A;  1TWG L;  1I3Q L;  3LNL A;  2EY4 E;  1VZI A;  5GAG c;  3H3V M;  3RZ6 A;  5MLC 3;  5AI3 A;  3PIO 1;  5M5Y L;  1LKP A;  1SFO L;  2V0F A;  3J7Y 1;  2J9U B;  1R0I A;  5EIN C;  5IY0 A;  5DM6 1;  4A3C L;  3GTQ L;  1Z92 B;  1LTL A;  2K2D A;  5MF6 A;  1R9T L;  2V0E A;  4AI0 A;  4AHX A;  5M3M L;  4A3M L;  1C09 A;  3S1N L;  4YWM A;  2JI2 A;  3ZG6 A;  1QCV A;  1R0H A;  2XJS A;  2APO B;  3M4O L;  3PKJ A;  4JAE A;  2ERS A;  3IU3 I;  2NVQ L;  4JAF A;  3LWV B;  1IRN A;  3LPE B;  2PPT A;  4Y52 L;  4AYB P;  5H1S c;  2WAQ P;  2Y0S P;  2PYA A;  2H12 A;  3CQZ L;  2XJV A;  3I4N L;  2PSM C;  1B71 A;  1YV1 A;  2A68 D;  2AQC A;  3QVD A;  5FLM L;  4JAG A;  2VUM L;  3P2A A;  4ZN1 B;  3PO2 L;  3QQC E;  3S2H L;  4GS7 D;  2RFK B;  3RYG A;  1P7P A;  4XXB B;  1E8J A;  5IYD L;  1B2J A;  2M6O A;  5C3E L;  5C4J L;  2L0Z A;  3H99 A;  4ME3 A;  3I4M L;  1RB9 A;  4BY1 L;  1VZG A;  1CAA A;  3A44 A;  1IU5 A;  4TPU A;  3KYW A;  1ODH A;  4AHW A;  2BE5 D;  4BBR L;  3J7Z 1;  1WCM L;  4A3E L;  1NNQ A;  1OWB A;  4AR5 A;  2Z3Q B;  2KKD A;  1DVB A;  3WWL A;  1SMM A;  1BQ9 A;  4AHY A;  4A3K L;  1BQ8 A;  1R0G A;  3GTJ L;  1DX8 A;  1R0F A;  4B8C D;  2WB1 P;  2XJR A;  4A3I L;  3HJW B;  2O5J D;  3MSU A;  4JAD A;  1TWH L;  1VCX A;  2NYD A;  1B13 A;  2E2J L;  2PMZ P;  4AI3 A;  1H7V A;  2A6E D;  4WFN 1;  4POF A;  2JA5 L;  3H9B A;  1IW7 D;  3KYY A;  2VL6 A;  3RZD L;  1RDG A;  3HOZ L;  1VZH A;  3K7A L;  2R7Z L;  2M4V A;  5RXN A;  2PVX A;  4AI1 A;  3PL5 A;  2A69 D;  2LCQ A;  5MGN A;  1LKO A;  1FHH A;  5FJ8 L;  3PIP 1;  1TWF L;  2QL0 A;  1PFW A;  1Y1V L;  1QQT A;  2NVT L;  3RZO L;  3H9C A;  5C4X L;  1IRO A;  5MFP A;  1FHM A;  4U67 1;  1T9O A;  2E2I L;  2AUS B;  5M3F L;  3LWR B;  1RYQ A;  1YK5 A;  4A93 L;  1S24 A;  3HKZ P;  3GTO L;  2PVE A;  3SS2 A;  1I50 L;  3FKI L;  5JVG 1;  3MQK B;  3S14 L;  4AR3 A;  2A6H D;  3S1R L;  5MFZ A;  3NFP I;  1WJV A;  1ZRP A;  4RXN A;  3B0A B;  1RDV A;  1CAD A;  1T9P A;  5EIO C;  2ERJ A;  4AR4 A;  2R93 L;  2CKC A;  3PO3 L;  1PFV A;  4QIW P;  2JA7 L;  5AN9 H;  2NVY L;  5GAE c;  2JI1 A;  3JR7 A;  3GTM L;  1S30 A;  3KYU A;  3LWO B;  2JA6 L;  2AYJ A;  2NVX L;  1NXG A;  4A3L L;  1TWA L;  1YUZ A;  6RXN A;  1PZX A;  3WWN B;  3HOX L;  3S17 L;  4A3D L;  1F4L A;  1NXE A;  5IP9 L;  1TWC L;  2Z3R B;  3P8B A;  3S1Q L;  2GMG A;  2B5I D;  3RZT A;  4K9F A;  3PKI A;  3B08 B;  1LKM A;  3KYV A;  1IU6 A;  4E6Y A;  1OWC A;  2JI3 A;  2RDV A;  4C2M 1;  3GTL L;  2M6P A;  4YWL A;  1QYB A;  1PFY A;  4POG A;  3H97 A;  1JYB A;  3HOW L;  5JVH 1;  2YU9 L;  3VPB E;  2JA8 L;  2CKA A;  5C44 L;  4BXX L;  5K2M E;  7RXN A;  1BE7 A;  3GTG L;  3HOV L;  1SMW A;  1T9Q A;  5GAH c;  3S15 L;  1SMU A;  2V3B B;  3S1M L;  2HR5 A;  2XJU A;  4ZN3 B;  3PWF A;  3S2D L;  5M5W L;  5IYB L;  3GTP L;  4V19 6;  4AHZ A;  3HAX C;  2MS3 A;  3M3Y L;  2CR8 A;  4XGH A;  1K83 L;  2DSX A;  3PZA A;  3HOU L;  2HVY C;  4BY7 L;  4C3H L;  1BRF A;  5M5X L;  4G6B A;  4A3J L;  4A3F L;  2E2H L;  5GAD c;  4LHN A;  1I6H L;  4A3B L;  1YUX A;  4TVM A;  3H0G L;  2C6B A;  4UY8 1;  3HJY B;  3FDJ A;  3MPS A;  4LHL A;  5AI2 A;  4A3G L;  1YK4 A;  5IP7 L;  3HOY L;  1RYT A;  5DM7 1;  4Y7N L;  3KYX A;  3GTK L;  2ZIX A;  4BBS L;  3LWQ B;  5IYC L;  2XJP A;  2M4Y A;  1Y1W L;  1RWD A;  4AR6 A;  4AI2 A;  2XJQ A;  2R92 L;  4C3J L;  2XJT A;  3LWP B;  2KN9 A;  1PFU A;  1B2O A;  1R0J A; 
#chains in the Genus database with same CATH homology
 4POG A;  2C6A A;  1B71 A;  1YV1 A;  3K35 A;  2A68 D;  1JYB A;  1S2Z A;  3QVD A;  1IRO A;  4JAG A;  5JVH 1;  5MFP A;  3P2A A;  1FHM A;  4ZN1 B;  4U67 1;  3QQC E;  1T9O A;  3VPB E;  4GS7 D;  3RYG A;  4XXB B;  8RXN A;  1E8J A;  1B2J A;  2M6O A;  2CKA A;  1BFY A;  2L0Z A;  1RYQ A;  1YK5 A;  4ME3 A;  5K2M E;  1RB9 A;  3LNL A;  7RXN A;  1S24 A;  1BE7 A;  1VZG A;  1CAA A;  1SMW A;  1T9Q A;  1VZI A;  3A44 A;  5GAH c;  1SMU A;  2PVE A;  5GAG c;  3SS2 A;  3RZ6 A;  1IU5 A;  5MLC 3;  4TPU A;  5AI3 A;  2V3B B;  3PIO 1;  2HR5 A;  2XJU A;  3KYW A;  4ZN3 B;  1ODH A;  3PWF A;  1LKP A;  5JVG 1;  4AHW A;  2BE5 D;  2V0F A;  3J7Y 1;  4AR3 A;  3J7Z 1;  2A6H D;  4V19 6;  1NNQ A;  4AHZ A;  1OWB A;  2J9U B;  1R0I A;  5MFZ A;  4AR5 A;  2MS3 A;  3NFP I;  5EIN C;  1WJV A;  2Z3Q B;  1ZRP A;  2KKD A;  5IY0 A;  4RXN A;  1DVB A;  3B0A B;  1RDV A;  1SMM A;  3WWL A;  2CR8 A;  5DM6 1;  1CAD A;  1BQ9 A;  1T9P A;  4XGH A;  1Z92 B;  2ERJ A;  4AHY A;  1BQ8 A;  5EIO C;  4AR4 A;  1LTL A;  2CKC A;  1R0G A;  1DX8 A;  2DSX A;  2K2D A;  3PZA A;  1R0F A;  5AN9 H;  4B8C D;  1BRF A;  5MF6 A;  4G6B A;  2V0E A;  5GAE c;  2JI1 A;  4AI0 A;  1S30 A;  2XJR A;  3KYU A;  4AHX A;  5GAD c;  2O5J D;  3MSU A;  4JAD A;  2AYJ A;  4LHN A;  1NXG A;  1YUX A;  4TVM A;  1C09 A;  1VCX A;  2C6B A;  1YUZ A;  2NYD A;  4YWM A;  6RXN A;  1B13 A;  4UY8 1;  2JI2 A;  3WWN B;  3ZG6 A;  4AI3 A;  1H7V A;  1QCV A;  2A6E D;  2XJS A;  3MPS A;  1R0H A;  4WFN 1;  4POF A;  4LHL A;  1NXE A;  3PKJ A;  4JAE A;  2ERS A;  3IU3 I;  2Z3R B;  3P8B A;  4JAF A;  1IRN A;  3LPE B;  5AI2 A;  2PPT A;  1IW7 D;  2GMG A;  2B5I D;  3KYY A;  2VL6 A;  1RDG A;  1YK4 A;  3RZT A;  4K9F A;  3PKI A;  1RYT A;  5DM7 1;  3B08 B;  1VZH A;  1LKM A;  2ZIX A;  3KYX A;  3KYV A;  5H1S c;  1IU6 A;  2PYA A;  2H12 A;  2XJP A;  2M4Y A;  2XJV A;  2M4V A;  1RWD A;  4AR6 A;  4E6Y A;  5RXN A;  2PVX A;  4AI2 A;  4AI1 A;  1OWC A;  2XJQ A;  2A69 D;  2LCQ A;  5MGN A;  2JI3 A;  1LKO A;  1FHH A;  2RDV A;  2XJT A;  2M6P A;  2KN9 A;  2PSM C;  3PIP 1;  1R0J A;  1B2O A;  2QL0 A;  4YWL A;  1QYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...