2LCQA

Solution structure of the endonuclease nob1 from p.horikoshii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
161
structure length
161
Chain Sequence
MLRNLKKTLVLDSSVFIQGIDIEGYTTPSVVEEIKDRESKIFLESLISAGKVKIAEPSKESIDRIIQVAKETGEVNELSKADIEVLALAYELKGEIFSDDYNVQNIASLLGLRFRTLKRGIKKVIKWRYVCIGCGRKFSTLPPGGVCPDCGSKVKLIPRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative toxin VapC6
publication title Structural and functional analysis of the archaeal endonuclease Nob1.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 37
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17146 PIN_6 PIN domain of ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2lcqA02
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2lcqA01
3ZDDA 1LKMA 2BSQA 5HP4A 1MC8A 1S30A 2QL0A 1QCVA 3ZDCA 4YWMA 2PYAA 1RXWA 1B71A 1W8IA 5ECYA 1S2ZA 2GMGA 4K9FA 3IX7A 3I8OA 1RWDA 4XGQA 3H8SA 5ED0A 2IZOA 5RXNA 5H4HA 1T9QA 4XGRA 1E8JA 1A77A 1LKPA 1B2JA 1V8OA 1C09A 1LKOA 5AI2A 3Q8KA 5H4GA 3Q8MA 2DSXA 5L6MB 1T9PA 5HMMA 1BGXT 1EXNA 4AR4A 5ECDA 6RXNA 5ECWA 3KYWA 1IRNA 2KKDA 5FV7A 4POFA 3KYVA 4ME3A 5IY0A 2RDVA 1BRFA 3ZVKA 1IU5A 1YV1A 3ZDBA 1UT5A 2V3BB 1R0IA 2QIPA 1R0HA 1IU6A 3MPSA 1SMUA 4AR5A 4POGA 1R0JA 3SS2A 3QE9Y 1QYBA 3KYYA 1SMMA 4TPUA 1XO1A 2HWYA 1YK5A 1A76A 7RXNA 1SMWA 5AI3A 3ZD8A 3ORYA 1T9OA 2HWXA 1BQ8A 3PZAA 4AR6A 1B43A 1JYBA 2VL6A 2MS3A 2H1OA 1R0FA 3H8JA 4WA8A 4RXNA 3ZDAA 2HWWA 1B13A 2WP8J 1CADA 1NNQA 1YUXA 4AR3A 1DX8A 1CAAA 2IHNA 1R0GA 3H7IA 1BQ9A 8RXNA 1UL1X 4MJ7A 3ZDEA 3QVDA 1RB9A 3KYUA 1UT8A 2LCQA 5HMLA 5L6LB 2HR5A 1TAQA 1H7VA 1TFRA 1Y82A 1FHHA 1BE7A 2H1CA 3RZTA 1V96A 1YK4A 4YWLA 3TNDA 4CHGA 1RDGA 2PVEA 3A44A 3RZ6A 2M4YA 1YE5A 2MDTA 2PVXA 3QEAZ 1DVBA 3QEBZ 3PWFA 1LTLA 1IROA 3KYXA 2K2DA 1VCXA 1B2OA 3RYGA 1RYTA 1S24A 5HNKA 5K8JB 1YUZA 1RXVA 1TAUA 1FHMA 1RDVA 1O4WA 5SV2A 3ZD9A 3H87A 1ZRPA 1BFYA 3H8WA 2DOKA 2KN9A 3Q8LA 3DBOB 2FE1A 1V8PA
chains in the Genus database with same CATH superfamily
1NN3A 5AJWA 5FUWA 3A3PA 3F49S 4DY4A 4JAVC 4XUCA 2Q1UA 4NATA 1TC1A 2IS2A 4W63A 1T36A 5J58A 4E30A 3CUKA 2GYUA 1XFAA 3BGVA 5AI0A 4AZ3B 1VCMA 3EXHA 5KDLA 3C4QA 4NP6A 1BN7A 1Z68A 2YTZA 1Z8NA 4KRYA 1QC5A 5JQGB 3HOXL 2AT1A 2QJWA 1KH1A 4EFNA 2XUFA 2J87A 3COSA 1P6QA 4XTCS 4MV3A 1LI4A 1A88A 2D7DA 1FS4A 1SVNA 5TB5A 5CBPB 5AW2A 1BKYA 1R6DA 2OLKA 2HMYB 2Q1YA 3ZHSA 4JI4B 1UKYA 1J99A 2Q6TA 4Q9DA 4Z53A 4HR7A 4G67A 2A4KA 3TX6A 1ZR4A 3QMWA 1SBTA 1AHNA 2JAHA 5LVAA 2G5TA 4BX2A 4ZIRB 1K0UA 1WNFA 3AU9A 3KLOA 4OK3A 2JFUA 3ROTA 3EGDB 3GF4A 4WNAB 3AH8A 1CETA 2FU5C 2HA5A 4N6NA 4MDYA 3W77A 4EPTA 2JDIA 4IM7A 2I2WA 2M98A 1XDDA 4K88A 2CUKA 4Q9IA 2VPQA 4ENPA 5ALRA 4PBTA 3P8ZA 4P7BA 1YZKA 1OGYA 2R87A 4KR3A 1H1TA 1M1UA 3RF6A 3MSUA 1I3KA 2I8AA 4IZIA 3U37A 4DC0A 1W85A 2VSOA 4QWMA 4URUR 3IOYA 4PCUA 4L5YA 4CRWB 4EWLA 2O3JA 1WXXA 3TFWA 2ZAMA 3DVRX 1V2HE 3OLYA 3TRKA 4Q7MB 2NPFA 4M9XA 5CFZA 4R9RA 3U4GA 1KPHA 5BVGA 5AI9A 5GAEc 3SZLA 1AA6A 2F3SA 5HW0A 3HO8A 4RD6A 4DNQA 1B7GO 2OCKA 2W2LD 4YJHB 2Z9DA 5KHAA 3KEOA 4DLNA 2CFIA 3Q0TA 1H2YA 1CB7A 2FEMA 4RQAA 3KQTA 3RYIB 3STVA 5A4DA 4F84A 3URMA 5G2OA 2FQXA 3P32A 4RY8A 2PWZA 1YUXA 4G26A 1DE0A 2O0LA 4TYMA 4BNVA 1KAMA 2B1QA 1YRHA 2AEFA 4X1YA 3UJDA 4EGCB 4OUDA 4DLAA 4HNVA 1CRZA 4FN4A 2VJPA 1K5HA 5I45A 5LOVA 4EF5A 5JJKA 4YR9A 2ZRDA 5KWIA 4PIPA 3DT6A 1QRUA 1E1CB 4EFKA 4YRFA 5ALNA 3RFUA 1DI0A 4QQKA 4DEYA 1KJJA 4BNFA 1XNRB 4O3MA 3E4CA 3UJAA 1V96A 1E2MA 2PT7A 3F9IA 4GZ5A 2KLBA 2EJBA 2GPJA 1DS6A 4CCSA 1MDFA 2A5GA 2ETXA 2QAGC 2UVPB 4ZEWA 3VNVA 3H0GL 2YWXA 2X58A 4EW6A 3EZYA 3NTRA 3U6KA 3FUTA 3NFPI 2QOEA 2XTNA 4NOKA 1SU8A 3E61A 4Q03A 3KOZA 1XVLA 4JBWA 1T9CA 3KYIB 4Q7LA 3R9IA 2FG6C 1AUQA 3VPCA 1E2KA 1JG2A 2J3EA 1II0A 1NIPA 7REQA 2YU9L 3FCCA 4RCZA 1CQJA 4G1CA 1AIPA 5K3EA 1IZ7A 1XT6A 3N05A 1CJVC 3B7WA 1FXWA 4IDGA 4EJ0A 3DXFA 3Q8WA 2MCFA 1WR8A 3LKBA 3PNKA 4R8SA 1KERA 5IKEA 1X6VA 4C76A 1K4YA 3MELA 1K7YA 1OBFO 1GA4A 1ACLA 1J0AA 1UM9A 2BF4A 2CLCX 2FHPA 2I80A 3OJOA 4H3HB 2NUTA 3MWKA 3DFIA 4UDOA 2QL0A 3JAWB 4HWOA 5CXQA 1LEHA 4N39A 4UUQA 1EINA 4DLTA 1JFFA 4NYIQ 4QELA 4R2LA 1B71A 1N33B 1VKHA 1L6IA 4M60A 4U2FA 1K7EB 3NNDA 3JU3A 5U9CA 4EECA 3TGLA 3NBAA 4NV3A 2IK8A 1JG6A 1ENOA 2IKSA 2UVDA 3QWHA 4TS1A 5THKA 1OT3A 1D6MA 1X3LA 4JITA 4JNCA 4NBSA 3WXMA 3I52A 1VQ1A 3G2MA 3REQA 3ZR4B 2HNAA 1A2OA 2Q2VA 1YOVA 2CJYA 1OWOA 1JKMA 2FRDC 2ONKA 3D5TA 5K1ZA 4C88A 1KI4A 1OI2A 1X80A 3BCHA 4TMVA 3SDZA 3O4FA 1C41A 3PU6A 4D9KA 2KB0A 3A8TA 4S04A 1YCFA 1XD2B 2OUKA 1AM4D 3HEBA 2XKBA 5JEDA 4GGPA 2PZLA 4XSGA 1L4UA 1M54A 1NN0A 2I33A 3GLSA 1YL6A 2HR1A 1AZTA 1JI0A 3MJRA 1PU2A 3S8MA 1DBIA 3CPSA 3PJGA 4HK4A 5AVXA 2VAPA 1O94C 2GDZA 1QZ3A 4IG9A 3KELA 1IOZA 3IEIA 4FWIB 2XB4A 3VR4A 3G23A 3GAAA 1TVMA 1CQXA 1D2HA 1XQVA 2X2EA 4H0NA 1B0ZA 2Q3BA 2EW2A 2ZSAA 4RPGA 3KEMA 5ILGA 3WK4A 3P9SA 1NLMA 5C5IA 2BL4A 4BKUA 2B0CA 3RUIA 1UDAA 2C9BA 2I66A 5FOWA 1D1SA 4ZQEA 2PTHA 4M9RA 4P3OA 2PG3A 1JQ5A 2GBLA 3MEQA 4KC0A 4TT8A 3I5YA 2RD2A 4XPIA 3NV9A 1Y6JA 3ZLVA 4F12A 3L5OA 4PG6A 4GMHA 1KY4A 1E7MA 1NTOA 2WM3A 3NAGA 4YCMA 5KX5B 1E9BA 4OLJA 5T57A 4N8DA 1RWWA 3CLUD 5C8YF 4FMCB 3IFSA 4ZV7A 1D6JA 4DQDA 1TFUA 4YRJA 3KTOA 2QQ5A 3AESB 3H1AA 4AWXA 3PTAA 2BUBA 3UGQA 3ZOZA 4HDKB 3KLBA 1RB9A 1DAEA 2OESA 3GYGA 4JKOA 4JN6B 2NSHA 5J59A 1YVUA 4ZVOA 2AYZA 3TJRA 1LPMA 3GJ0A 1LWNA 2EYUA 3A4YA 1GQ2A 2ILVA 4LC1A 4QVGA 4UUBA 5E6RA 4DG5A 4EY4A 3TNJA 5KTNA 2AOWA 4PONA 5EHXA 3WKCA 5I6DA 3FYUC 1S2IA 1FNSA 2JD1A 1L5VA 1IPHA 1X42A 3AFMA 4GE0A 5AKJA 4RIEA 3GJ4A 3WBFA 3T3MB 2OHXA 2F3RA 3TSYA 2FR1A 4CKWA 2HRRA 2QGFA 1YGYA 2PX5A 3JD3A 3X1ZA 1J5PA 1DL5A 3NBZC 4BFZA 5BN3A 3EXFA 3WI7A 1CS0A 2PV7A 1NW4A 4P08A 3FMPB 1JLSA 2R1VB 3BMNA 4Q16A 3WNQA 1P2BA 3FSRA 5MGNA 5DYNA 5B58T 4RQTA 1P39A 3UHJA 2ZM6B 1I4WA 3HFGA 1OBCA 3L04A 3LRPA 1PJRA 3LLVA 2I7TA 3DDUA 4U7PB 4GDFA 2EQAA 4WH0A 3RJTA 1NYQA 1D8AA 4J6EA 3LWBA 3THRA 1Z47A 2AJLI 2ID7A 1RRFA 4AHYA 4P81A 3SC6A 4XVUA 1IY0A 5IAEA 1LPNA 2EBUA 2ZANA 5HF6A 1JZSA 1FS6A 4GVXA 4ZCTA 3AF3A 1UC5B 2UV8A 4JI0B 4XWWA 1N2XA 3JYHA 2D74A 2IEBA 5JXWA 5EJ2A 4C1NA 5K0SA 3Q3IA 1IM5A 2GM9A 1OA1A 1WS6A 1W87A 3RRXA 4C04A 4W7HA 2CVHA 1XCOA 4FZ3A 1X92A 4LQLA 5D87A 4LSGA 1U2SA 3MIZA 1R0LA 4DUPA 1VIMA 3WISA 4IIBA 5JMWA 2JCXA 2G82A 3ADPA 1GL6A 4RWEA 1Z08A 1ZM7A 4TT3A 2J4FA 3AV0B 3CLSD 4ZZ0A 4ASUD 4BBZA 1DOZA 1KZYC 1VHTA 5BT9A 3S2ZA 2VAXA 3KKZA 1N78A 2H2IA 1XPOA 2FMUA 3LWRB 2VBFA 3GMIA 4R1OA 5I9MA 2I1WA 3TDMA 4DQUA 2ZIXB 3IOMA 4PS0A 2NSLA 5ECWA 2ZBVA 4JZKA 5KYGA 1HYGA 3NDRA 2ZUTA 1ZXLA 2YY7A 3R3SA 2A67A 1FY2A 1IZYA 1GNLA 3VPDA 3V46A 1BVYF 4I50F 3HYNA 3P0IA 3V4FA 1ADCA 4ARZB 5KWJA 3MLAA 2QQFA 1AQLA 3MWDA 4FHDA 4HFNA 3EVAA 4K8RB 3LWNA 3TVDA 4YAKA 1XAIA 2BDTA 2XE8A 1I3CA 1EGVB 1H1DA 3C3KA 4OU5A 4BQQA 1DQRA 6ADHA 2FFAA 4C7OB 2GJ8A 3GZTB 3SS2A 3GFGA 3JVEA 5D3ZA 1ZZEA 2CGEA 5AR1A 3S40A 1NJGA 1SXJE 3E5NA 2Q6KA 2F64A 3FGNA 4E4YA 1GR1A 2WZDA 2F43A 4YCSA 1NWHA 3UMBA 4MO9A 1ZGHA 2C2MA 2OCAA 1G9SA 4MITA 3KWLA 4JK3A 3EVBA 1OCEA 1DNPA 4C7MA 2VZ8A 4FNOA 4E0BA 4Q9HA 1TIBA 2GYVA 2HM7A 3A9WA 4E5NA 3FWHA 2FE4A 3DWIA 1GGMA 2IHNA 3S1ML 3BIWA 3M6MD 2B9EA 4YRTA 3X2FA 1YR8A 2C54A 1S8OA 3DZHA 1HR0B 1RMYA 1YDHA 2I2FA 3GWGA 5D51S 7MHTA 2BCEA 5KNCH 4QFBA 5J2TF 4LQ4A 4HNSA 3WYNA 2HADA 3HNOA 4GWLA 4S1VA 3OT4A 2V7GA 4K26A 1GPDG 3BD6A 4KX5A 1WZEA 1MDBA 4KFUA 1OA0A 5FAXA 5DBGA 3WS7A 3CINA 2OECA 2K5UA 3VV2A 2VF8A 1VB5A 3A0RB 3FTPA 3BKXA 5T8KA 3VX3A 3JWIA 3NBYC 4GKKB 4TVOA 1K3TA 4EI7A 2HY7A 5AOBA 4BZPA 5FWDA 4LMAA 1G8GA 1MO6A 5AJTA 1LZKA 4PPYA 5AIBA 3E2MA 2DAPA 2J07A 4LDPA 1E1MA 3C87A 2HRBA 2VJKA 2O8DB 1Q11A 1JQKA 3D3JA 2Z8YM 1TJ5A 2X76A 1Z83A 4LMRA 3KO8A 3VR6D 1GPKA 6GPBA 2GXAA 1BE6A 3E81A 2QA5A 4YEDA 1VJ1A 2FEPA 4V0ME 5KIAA 3EQ7A 1YTUA 3EEIA 4IV0A 4ZV9A 3SQWA 4TZ0A 4M9SA 3K96A 4DNXA 5BW5A 5T4EA 1SEPA 3TPCA 3B6JA 3EYWA 1PZGA 3QBVA 4ZT2A 1DC8A 4KP7A 2C97A 1HRKA 4HWKA 1K8QA 1AUPA 2ZJ1A 1NVGA 1L5LA 5CA1B 4G0ZA 4YRIA 5KPJA 4GC9A 2PMBA 1MRSA 1LBQA 3QXSA 4F7WA 2YWRA 3SE0A 4QREA 3FGOA 3FVVA 3QEKA 4QBIA 3SC2B 1U2GA 3FPFA 1QG0A 3W2TA 1VMEA 1YQQA 1Z4IA 2BM1A 5D3MB 1Y4ZA 2FP4B 3AB8A 1S2LA 1UP7A 5FEMA 1PV1A 4WEOA 5F2NA 2JC3A 2M2IA 4UU8A 2J9GA 1CUYA 3IKTA 1WB6A 4HZUB 3EIEA 1TWAL 4Z1MD 4V196 1L4MA 2E5FA 2ZBPA 3AUTA 4Y0NA 1QB7A 4Q4HB 2AZXA 4EI8A 4XYMA 2PX8A 4OV6B 1AHHA 3PE3A 3EZGA 3BQ9A 2FEKA 4G0VA 3L0PA 1JEQA 5DK4A 1E60A 4IGEA 3N86A 3Q3JB 2OV1A 3NNNA 1E3SA 3BX1A 1UK8A 4FFVA 5JJIA 2RKWA 3I32A 4ZOBA 5DGCA 1GQYA 1FP2A 1WXHA 2IYWA 1NF9A 3BMCA 1AZLA 2FOLA 2ZQYA 1HFEL 1NL3A 3LECA 3OE7A 3Q1LA 3UJHA 2DEUA 3VOAA 1BKSB 2P6PA 2TMKA 2H1FA 3GZNA 4BMCA 4NPHA 2P1RA 4U2EA 3NRJA 2YFYA 3PL1A 1GADO 3CG0A 4XM0A 3OBBA 4IDPA 4Y9TA 1NUUA 2PGNA 3ZX4A 1FJXA 4FFBA 1UT6A 3AU8A 4G41A 4LRTB 4WKCA 5H8WA 4AJKA 1KDTA 3I2GA 1T9OA 4DWWA 2C2ZA 1W5SA 2DH5A 2I1LA 3L41A 1FK8A 2QRZA 3LLUA 1E79A 2EATA 4JMLA 4B7CA 4DMRA 5KNDD 4PG4A 4UEJA 3NYIA 1WF3A 4H6VA 1TVKB 4PPQA 1U0JA 4KXMA 4IIJF 1IWBB 1UUFA 1KJ9A 1REQB 3OY2A 1P9NA 2GCIA 2WVGA 3SICE 2IBSA 5I01A 1MG5A 3AR2A 1RYHA 4NR0A 4X8LA 4DC1A 5IN5A 4E5KA 1K8XB 2Q6OA 1E0SA 3ST7A 2XAAA 1K66A 1VA4A 2W6QA 3FF4A 5DX8A 2OXFA 2ES4A 1X74A 2Y71A 2OM6A 4ZICA 1N6LA 2FWRA 2VJDA 2ZB4A 1GKIA 2ZTLA 2YNMA 3U4HA 4HDAA 5AXBA 2WIGA 2GK7A 3ASUA 1K4KA 3H83A 3M3PA 1GRRA 3LUDA 1QDLB 4K9NA 2VP5A 4ROSA 5DDIP 3NP9A 1GAWA 1UBRS 2OHFA 3K6RA 4Q9KA 4S05A 1YK4A 2AXNA 4C05A 1N6HA 2GEJA 4P84A 5PGMA 3VH4A 5F2OA 2M4YA 3TQQA 4CI0B 1KY3A 1L1RA 2QW0X 1E5TA 3GTJL 1ATIA 1JPUA 2JEYA 3DEYX 3C6ZA 5AK5A 1Y8CA 1NFQA 1JZQA 5FB3A 3U1BA 1AH2A 3UO8B 2HCTA 1JU4A 1TZBA 2PQ0A 2IITA 3RUCA 3ILYA 1PJ4A 1RR6A 1O6FA 1NOJA 5JROA 4JWKA 2ZREA 4FLFA 1HPLA 4K6KA 3KDPA 1WULS 2V58A 1EFTA 1K0FA 4G25A 3UIEA 3M83A 4QXMA 2G4LA 1I2MA 2IT1A 4A3ML 1Q15A 2CMGA 1F51E 4CT5A 3KZCA 3VR5H 3RVKA 4EOGA 2OBNA 3KZOA 4KXXA 4OJYA 3I6IA 4BB6A 4ZTBA 1ESCA 3D31A 3KE8A 1R74A 3H5OA 3LXUX 2R8RA 5C3EL 2Q27A 3L8MA 4CT0A 1ZK2A 2ZATA 5A1TA 1QCVA 3S1QL 3LYAA 1L5SA 1CP2A 1YMVA 3EIQA 2VUUA 1MEJA 1W1IA 3OEWA 3QI7A 3WLEA 1XP8A 4AS2A 2A5DA 2IHBA 2JIMA 3C5WP 4O02B 1UKEA 2C3YA 4X3CA 5IKOA 1T8WA 5AO9A 4ZAZA 3CUYA 5ICEA 1T2UA 1T91A 1XL0A 3L0CA 1YC5A 4RS3A 4F3NA 4BFVA 2XLCA 1XVTA 1QKIA 2Z58A 1UOOA 1MAWA 1BXGB 4EHKA 3ZKWA 4TX1A 3Q8MA 3HVKA 2RH4A 2P2LA 4J7CA 2YV3A 2WTMA 3HFJA 3KS9A 4ZAGA 4MS3B 5BRJA 1Z7YA 4M76B 3NVKI 2XIJA 5FPPA 2QMOA 2XQIA 3ELBA 3GC6A 4Q4LA 3FFAA 5ECYA 2C6AA 4ZGBA 5FV7A 2MT9A 3UC9A 4D81A 2ZPAA 3D4IA 1O0SA 1ULZA 4OQEA 3K0AA 3V7WA 1OJ7A 1D7AA 1E4OA 2GCOA 2XYVA 2AFHA 4UZEA 3KKKA 1EK2A 2Q29A 4Q24A 3D43A 4LTNA 4M1WA 2W42A 1SMUA 3JWHA 5C5CA 2WSIA 1G21B 1E2JA 1E3QA 1L5QA 2HCBA 3VNUA 2NSDA 1Q3KA 2WTBA 1ZSVA 1X8JA 4YAJA 2RAVA 2CZCA 4TYYA 3RF7A 2VXYA 1ZM3A 1JXQA 2YOHA 3F1KA 2NSYA 4M1ZA 3TO5A 3IDAA 4NCXA 4NYIR 5BPFA 3E5MA 4J3JA 5IKPA 1RBYA 1A50B 4FM9A 5KU1A 3MINA 2Y05A 1UXJA 4MAAA 3RHSA 4CIWA 4TQUS 1WCYA 3SVLA 1EESA 3PZBA 1G18A 1GXSA 1XWIA 3INYA 2FPOA 2VJCA 1RWVA 4RENA 3HZZA 3KYUA 4FFNA 4G8CA 1DKOA 3RFTA 9LDBA 4ZDJA 1KL7A 1TT5A 4KSBA 4HYEA 4AG5A 4CG1A 1FYDA 2WWRA 4R3WA 3MXTA 4WJLA 5E8RA 1MAUA 1D04A 1U7WA 2GEFA 2VTBB 2QEQA 3FB1A 4FCVA 4BNLA 3UMMA 3R8FA 2W71A 3P71T 4OD0A 4LHVA 1RDGA 2ODPA 4G8DA 2IU0A 1FUKA 1I1QB 5MLC3 3GJ7A 3A28A 4R54A 4EKGA 5EE3A 3UV3A 3AJ8A 2AW3A 1B6GA 1U7OA 3M1AA 4RZQA 3OKCA 4F4HA 3FTNA 1JYSA 2IEDA 1TIKA 5DCYA 1UFVA 3CCCA 2MINA 3GFRA 4LJ7A 4EB6B 4Z1MA 2OXEA 4EVSA 3SQXA 1TE2A 1FQKA 1ULUA 3JRXA 4IFTA 1TW2A 1ZM2A 1A5TA 1QVAA 1MQSA 5ABPA 3MCTA 1PTJC 3L79A 2HA4A 4F91B 1DLJA 1KFKB 2QUHA 2WIJA 3MS7A 5A05A 2P30A 1CDOA 1CUIA 1NMQA 3TAHA 4GPZA 4F0JA 4Q12A 1TQ2A 1QH1A 1SVKA 2G63A 1TYDE 2B2XA 2PWPA 3M4JA 4KQWA 5IG2A 3QU9A 2YHBA 3FAZA 4MV7A 1XZEA 3ED1A 1ZIYA 3GAZA 1TA9A 3PNPA 3HPRA 4QO8A 3ZNNA 1O9BA 2HUNA 2ZIVB 3CISA 3OC0A 4JMPA 4PW0A 5IX8A 4HF7A 3M6IA 1TUEA 2LZ0A 4FDLA 5CJJA 2HJVA 1KYXA 1Z4OA 3CEMA 3DMGA 1QS0A 3G5UA 4M0CA 2ZVQX 4LZZA 5BNFA 2A9PA 2OZLA 4MDEA 4KQEA 2OMKA 3BULA 1UK6A 4HMPA 1LZLA 1M10A 1J1ZA 3GCGA 3VUFA 3E9NA 5CK4A 2CB0A 4O4HF 3UGTA 5KVCA 3F1LA 4ZI3A 1T4CB 1XEXB 1YE8A 5B1DA 4ZDKA 3LUHA 2Z57A 2DSXA 2VSFA 2F1IA 1E2FA 3DXXA 4JU8A 2ZS8A 3S2SA 1XV5A 2J46A 2TYSB 3IBYA 5BN5A 3VH2A 4NZNA 4FFPA 1PK9A 2PX2A 4UEWA 4W4TA 2ZXUA 5B2FA 4BRSA 4QDTA 1HBJA 1NTRA 2VJLA 2OK8A 4RD0A 4U2DA 2H1VA 4L28A 4I3GA 5EQTA 5JPIA 4I9GA 5IHXA 5CBPA 2PM8A 4PLFA 2VK4A 4RZ2A 4UCQA 5D5PA 2HHAA 1J0CA 1DFHA 4X66B 3S2GA 4Z7QB 1SKYE 4KR7A 1IN6A 4Z9FA 1SXJD 4CBVA 2J45A 4ZIRA 3RZDL 1X15A 2XUOA 3TIGA 5EJMA 2X23A 3EGDA 3LRXA 4WNAA 2X9VA 2ONJA 3MC1A 4A6PA 4MYDA 2O9JA 4U9HS 4YJ3B 4DDVA 3FNBA 3V1KA 4ZZ1A 2B8NA 4N82A 4B3HA 4DMKA 3QFFA 5AN9H 3M9LA 3O4GA 5CP8A 4IS3A 4BO1A 2JLBA 4BAUA 1HYEA 2Q5LA 2B3DA 1C8BA 4E22A 1JKXA 4A3BL 4KMMA 5FNVB 2HLPA 3L7YA 4D98A 1DPFA 4RD2A 5AQEA 2GXQA 3LJKA 3GQBB 1T4BA 5A0FA 4BMDA 3RNLA 2ZB2A 4KFTA 1YRYE 5AUOB 1U8TA 3CR8A 2DWCA 3PIRA 1H7VA 1KHHA 5A9RA 5CB0A 1UEJA 3IQIX 3NG1A 5FA8A 1ISIA 2JRCA 4W5RA 1BO6A 3WGJA 1DJOA 3FUXA 4YJHA 4WNYA 4A3SA 5I7HA 3C8MA 1SRQA 4GX0A 3CSUA 4Q4AB 2GZRA 3ZE6A 5KNBH 2GCPA 3B1ZA 3B9PA 5C5DA 3LQ4A 1TMKA 1GTRA 4UUAA 3UBMA 4P4GA 1UXHA 4FBMA 1HDZA 1CIPA 1FNNA 1H94A 1ZVQA 2WSSA 2BEVB 1LY1A 3F71A 2WNHA 3LQ1A 4LNAA 5AKEA 1QHIA 3WLKX 3S5JA 2V0NA 5B57C 4KDRA 2HCFA 1J1UA 1D0SA 4BNGA 3A6JA 2EAUA 4Y2JA 1XCLA 5CDTA 1R66A 4FGLA 1M6NA 2ERCA 4D96A 2GN0A 5EQFA 1G59A 3KLPX 3FTEA 2CFCA 1VZ3A 4DQKA 4RTKA 3WLNA 1E1CA 3A9TA 4JUDX 4PZUA 3ORRA 5IDQA 4KVGA 4Y6RA 2AD1A 3WLQA 2C7VA 4DLWA 3FMGA 3BYZA 3NB0A 4HVAA 4PLWA 5HS6A 2KN9A 3K7AL 1AURA 2J59A 2R6ZA 3BD9A 1MMFB 4MUAA 1PX2A 4ZALA 3UT6A 3PNLA 3USCS 2XF8A 3FROA 3DG9A 4AF8A 1QG6A 2GBCA 2GN1A 4LYYA 4QOFA 4RZIA 3EBPA 4P34A 2O8FB 3F5QA 4PX9A 4BV2A 4EABA 4Z7OB 3FN4A 4O8CA 1T9ZA 3GPBA 5LLSA 5A3SA 1DRWA 5KJCA 1LGYA 3WLTA 3L9XA 4UXJA 1PR9A 2QLFA 4FGZA 4LVCA 3J81k 1VL0A 3PQ5A 1JUDA 2X9NA 5JNWA 2HC9A 4LBYA 4TQ9A 2KJQA 4OYRA 1RADA 1ABBA 1A77A 2G7MC 5TC4A 4BAZA 1FFXB 2OD2A 2QG9A 3B3GA 2ZIGA 3JXEA 3PJDA 3UMCA 2GPWA 2VIIA 3RFVA 3QFSA 3B5EA 4YUZA 4WK6A 2ZSKA 4RD4A 4PQRA 3JAWA 5KYXB 1NGSA 3OWXA 3UJ3X 4A03A 2QY6A 3QYJA 3KIPA 3T5MA 4FFSA 4XXHA 1F1JA 2FPWA 3HA7A 2XD9A 2IP2A 2GHQA 2IDKA 3F8SA 3MPUA 5BSRA 4B8ZA 1TMOA 2YIMA 4E1VA 4QU9A 4FWBA 1G0NA 1HOXA 2SBTA 4OBEA 4TWBA 2HNKA 4QXPA 4ND8B 4A16A 1I6KA 3H0EA 3HNPA 4GKVA 1BEEA 1KO4A 1Z0SA 3B7GA 1YI8A 3DP7A 3EMVA 4J1TC 3LG2A 4RKFA 2QPAA 3KHUA 5HIJA 4J9UE 3AR7A 2J3MA 1EXMA 2XOKA 3OQPA 1NJ1A 1XJWA 2GPTA 4D9GA 1XD2A 1KQOA 3GOQA 1RZ3A 4A2WA 4MGZR 2F55A 2P8JA 1V71A 5KKCA 3BK1A 4QICA 4EW1A 1B8PA 2ZJZA 3BCRA 2VZLA 4FYHA 4LV8B 4H7IA 4U8HA 1IVSA 5IPFA 4PYJA 3NM6B 1H0HA 3UHPA 2IZ0A 2CHVA 3CZ9A 4TTRA 2VYCA 4BGEA 4WBNB 1TKAA 1XTJA 4KLZA 5EXTA 3H1EA 4D1YA 3F73A 4NU8X 4CGZA 4GFDA 2PZAA 3T52A 1DEHA 3QJGA 4Q19A 4R0NA 1KEWA 4AYWA 4URVR 3KP1A 2EFJA 4XJVA 3UXHA 1E2BA 1FYVA 4EELA 3WQRA 1RQLA 1SUSA 3G9TA 1OXMA 4IHAA 3T12A 2W2QA 3BTUA 2JLUA 3PR2B 4TGLA 3EF3A 3AR4A 2ZUVA 1T4MA 3IIJA 3KQVA 4OVKA 1XVAA 1IQRA 4B2LA 3GLGE 2IHKA 3C7CB 2QTHA 3AYZB 3MN1A 2YJNA 4ZVMA 1DQNA 2QX7A 3I6MA 4I4IA 3P19A 1EJ0A 3WGGA 1NF3A 1NU6A 1XF9A 1BXKA 1RCTE 4BE7B 5FF9A 4ZCRA 1UQRA 4R1TA 3B89A 4LJ5A 4RV4A 1DIGA 1OIXA 2OC9A 3MAGA 1H23A 1MAHA 4WKBA 4CFYA 4AKGA 5IJAA 4HDKA 1PT8A 2AX4A 1FFAA 4WDQA 4PNEA 4ON9A 5ADUS 2JZNA 4YYZA 3WO1A 1KZ6A 5JR3A 1B16A 4G5FA 1Z0AA 3GCXA 1XZPA 3E35A 4LWQA 3RKSA 1XZMA 3P9ZA 4JB2A 3BFXA 2DF8A 1GTL1 3I9NA 5T41A 3RSSA 2BF7A 5GJWC 4KAFA 3ZTTA 1QTRA 3U16A 3NT2A 5BNIA 1OV6A 3TRHA 3LVFO 1Y3FE 4FFOA 1VHWA 1M0EA 3KVOA 1M73E 2AN1A 4PX3A 2W93A 4XKJA 3ZDDA 1IOVA 1W4CA 1VG0B 4TVKA 3G2QA 3PPIA 4U6NA 2OQVA 2MWMA 3FCOA 3P5BA 1FXWF 3KLNA 4C4XA 1OX5A 4YHHB 3EGOA 5J23A 1ZNYA 4DCJA 1Z0DA 4Q93A 1GDTA 1BQEA 3WB0A 1LA2A 2DCUA 2R1VA 4JQCA 3I28A 3WMXA 4CV3A 1PFVA 2PUFA 2J8ZA 2DPXA 2RC6A 2JZOA 3CPEA 1U4SA 2HA3A 4LPSA 3ZNPA 4TS3A 2CUNA 2Q9CA 5FAKA 3AC0A 2D06A 5C1PA 1MEOA 1N4DA 1LKOA 3QPVA 1Z82A 4B3RB 5B55A 4QBHA 5JVDB 3LA8A 5CITA 1P5FA 4PG5A 3SEZA 3U31A 1LK0A 2WA2A 4JSYA 4WXHA 3E8XA 4TYQA 3UPDA 4V0OA 4W5WA 1ZKDA 3CUTA 4I46A 1TL7C 3EIUA 1P29A 3CUWA 2IOQA 3G9UA 4FX5A 5ECDA 5K4AA 4ECAA 4HEHA 3PIP1 2FW1A 2NO9A 1F2UA 1BCSB 3VI4B 2I22A 2B69A 4LK2A 2X1VA 1DCFA 4Q3DA 1L4KA 2CXQA 4YMWA 3RJMA 2FSSA 1I50L 2G80A 2HO4A 2PX6A 3B6MA 3RVQA 1T9DA 3S2FA 3VDMA 4F2GA 1I13A 3S70A 2FUKA 4US1R 2I54A 2XE7A 3K16A 5LZ7A 3FBWA 3TIVA 3TQRA 2VDJA 1SZJG 4TYWA 2JI3A 1RWKA 4KZPA 3SXJA 2R5NA 2PGJA 5A2QA 1SCBA 3CPJB 1P0IA 5TGTA 3RR2A 4LQDA 4LTDA 1T9GR 3ENWA 3GPLA 2ZBDA 4A6DA 2ZIXA 4DDWA 5GZ3A 1WL8A 5C4IA 5B2ZA 4HVLA 3M5WA 1WJGA 2BKUA 2QL6A 3NRCA 4AP9A 2O6HA 3IBTA 2VQEB 3IHKA 4ARZA 2VZEA 1NY6A 1E98A 1MO5A 1KBZA 1R0YA 3AEXA 2ECFA 1T5DX 2C2KA 2EP8A 3VHLB 4L22A 3HLKA 4L4XA 2HJGA 2QUJA 3AEYA 3FNFA 3SLKA 1SK9A 3X0DA 4TXJA 1QNLA 4LHNA 1CADA 2QENA 1YRLA 3OWHA 5CJPA 3VVBA 4FB5A 3HSKA 5J4LA 4C7OA 3G2LA 3PCTA 1ZD3A 2W37A 1VRVA 3E70C 4B8WA 3QEMA 3WKEA 5FR1A 5LMZA 5E3JA 3DV9A 4FWTA 4LYJA 1ZLYA 4IDBA 1Z17A 1PFWA 3GRPA 1SQGA 2MTBA 4DGQA 4DJJA 1I6WA 2OENG 2HRDA 3N07A 1SVWA 1DUVG 3KOMA 2QHXA 1ODHA 2XUQA 3WIUA 3K70C 1FUIA 3PFBA 4ZYXA 3NTOA 5A71A 5IT5A 3AFNA 4N3NA 2G5PA 3AUXA 5BQ5A 1MB9A 2YVUA 1HUQA 3RVRA 3UNXA 5JCXA 1KI7A 3ASVA 2HFKA 2OY0A 4OM7A 4PSAA 4W1QA 4MHSA 4M89A 3I8SA 1K98A 4BX8A 1BDMA 4DIEA 3QEBZ 2VFAA 2HLNA 1ZS9A 4Y9DA 4DMGA 3OFVA 4Q9AA 1Z4LA 1ZJJA 4M0KA 4RZUA 4QNMA 4WLOA 4A82A 4DNPA 4F3TA 4TLDA 1RYTA 2G17A 3F6YA 5F5LA 5TT1A 4IXDA 4HWTA 4OI0A 1JBQA 1Q83A 4ARAA 5A3QA 1HEUA 3WGQA 4EG6A 3OCVA 9ATCA 2BONA 1GPYA 1HF3A 3EBOA 4MKRA 1CFZA 4BB9A 5LLDA 1NMSA 4A26A 4B71A 5TLSA 3OZTA 1I7LA 1E6KA 1R0RE 4B43A 2XGJA 3TEJA 5REQB 2WNIA 2D5BA 3QLUA 3GLFB 1WBDA 4BP9A 3CKLA 4XFDA 1V3UA 4GNKA 1K8ZB 5DLDA 1RHRA 4ZN6A 1P2FA 4PTZA 1JA0A 4UUOA 1JHPA 1L0BA 1GQRA 1XD8A 4CTOA 4K9FA 3OFJA 4TOIA 4TTTS 4AJHA 2O8DA 4BMYA 1COWD 2PSHA 1G8YA 1L7OA 5JJ5A 3PJEA 2RGBA 2XSZD 2C4HA 1LNQA 5G3ZA 1T9QA 1CV2A 3K5PA 3KB8A 4YUAA 3Q4GA 1E63A 3IA2A 1ZBQA 1EEXB 1IWOA 1Z6AA 1NWCA 2LDXA 3EVDA 2Y0SP 3H3FA 1I4OA 1JPVA 5K7SA 2PU7A 4KV7A 3GX1A 3NUQA 2A0UA 4KLCA 5HIMA 1O6CA 4KTVE 3SR0A 5A02A 3OQMA 5I4IA 3EAGA 1PSDA 3RTGA 1DEOA 1WLSA 4F45A 1Z92B 4UD2A 1HDIA 1OF1A 2HMAA 5CA1A 4REQB 1NG1A 4DSNA 5KOIA 2TECE 5CVCA 4MOWA 3SC2A 3O2JA 2FFQA 1VG1A 3ITEA 1DHTA 3GTPL 3HS3A 1QP0A 5A4AA 1H9CA 3U4IA 2ZIUB 5FTMA 1F4VA 1JHVA 1TM3E 1X9HA 2PJDA 1PJQA 3CRZA 4H35A 2PJRA 3DJFA 1LC3A 1BQ4A 2PQ2A 2RHTA 2VF5X 3N2ZB 4HZUA 4LHSA 5JE8A 4EJMA 1AC5A 2EL7A 4EHFA 4PPNA 5IZCA 4Q4HA 3VKVA 3IRVA 2PUDA 1U1EA 5U1PA 1IDOA 1OHHD 3FIUA 3QWIA 1Q3HA 3GCZA 5KJFA 3QVTA 3LNCA 4URFA 5EYPB 3WC4A 1X7XB 5A7FA 4N76A 3A7EA 5AM1A 3PZAA 3OAAA 5LJLA 5LQCA 3VMMA 2OE2A 4B9AA 1R0FA 1E5XA 4ZMBA 5JRJA 4GYYA 4YDSA 3I34X 5CLFA 3GVXA 2JEZA 5AW3A 1G20B 1HMYA 4WCFC 4BX3A 1G42A 1LUAA 3F2VA 3OQIB 4HNUA 3CRMA 5E2IA 4BRZA 3BDAA 3SQDA 3EIWA 1JX6A 2BE7A 2IBMA 3R5KA 1U0TA 3AZQA 4TTVA 2MJLA 1U4NA 4L2IB 4WCDA 2JATA 4HUJA 4AL4A 3NOXA 4AG3A 4D25A 1PCXA 1L7QA 2Q2OA 5KEIA 3G9XA 4BMPB 3V55A 1E7WA 2O7SA 3ZJYA 2BHLA 2W6IA 1KDZA 1E2UA 1Y3DE 3FTDA 4WESA 3Q40A 4HAUA 5DM0A 3NGLA 4NOLA 5A03A 1TVKA 4XX1A 3LP8A 3T5AA 4QJ4A 1REQA 2YMQA 2B8JA 3HOZL 5JNTA 3VR6H 1UDBA 1V39A 1Z73A 2VH2A 3LHSA 3QNWA 4LSWA 4LZPA 4YFYA 4EMUA 1OI7A 2EJWA 3IBGA 3T95A 1E18A 4OQLA 3CS3A 3IEVA 1XLWA 1LBTA 1E32A 2EKLA 1XJ5A 1FSPA 1T5OA 2BCJQ 2RHBA 2AJ8A 4FGKA 1U0SY 3WK5A 4Q21A 1E9VA 4QAQA 1J0XO 3KR2A 4E2XA 3ND6A 2YWGA 2WTXA 1FEZA 1MB0A 1K5PA 1WW2A 1F0NA 1WAMA 2KWIA 1L5OA 2WB4A 3DE6X 5AHRA 5ED4A 4YMHA 3HB5X 3DAFA 4BQSA 4DV2B 2R79A 2OP1A 2FQ1A 1XA3A 3UAXA 1VLMA 3E1SA 4D5GA 1RM3A 2FJ0A 2LIVA 3LF2A 1JSXA 1CRLA 3GEEA 4G1EB 3KJQA 3EXG1 3W8RA 1DP4A 5K8VA 1Z2PX 3HKEB 2XKKA 1KJWA 1XRLA 3CVJA 4G3XA 1QU3A 4D5EA 4NK4A 4ZREA 3HCFA 3ESXA 3MLBA 1K9VF 1PTKA 4EPVA 2IXEA 3PEUA 2P2CA 2BUCA 1N0UA 4FHEA 3IT1A 2QMYA 2CXXA 2NU7B 1L7AA 1AF4A 3DYIA 3F74A 1HX7A 5CT8A 1JNXX 5DIFA 1GPAA 2I2BA 2O2CA 1N7GA 2Q7XA 1YH3A 3PPYA 3UW1A 1O08A 5F51A 3HC7A 4G2TA 3ZHZA 1EXNA 5HZGA 3NANA 2IPMA 2HT6A 4JT2A 2J9FB 1PNTA 1RD4A 4CN8A 4DLBA 2OQIA 3RTDA 4RIIA 2RHMA 4LJ8A 4E5YA 1UC9A 3BIJA 1UBUS 2RHWA 4R2JA 2ODBA 3H2JA 5KTPA 1L8AA 3M4OL 3BD7A 2R6AA 4Q7KA 1WRBA 4IIFA 3FKIL 2WAXA 1HNXB 1WXDA 3LIIA 1BFKA 1MQAA 3UB3A 3GRZA 2XXAB 2AXQA 4HADA 3L92A 1RYEA 1US8B 1E0AA 3L4KA 3QVJA 4P2GA 5HFAA 3MJHA 3A1EA 5A4IS 3UKDA 1K7SN 3V8PA 3D7NA 4J3FA 4TMFA 2EYQA 3HCRA 4L02A 4ENRA 2X13A 4QLBA 4Z9BA 4U0JA 4ZJZA 2BEKA 3EODA 3AF6A 1HK7A 5EUQB 2QNIA 2D8AA 4MRRA 1GNPA 3EZ2A 4PAGA 4X00A 3PKIA 1BNCA 2Z6VA 2M32A 3BORA 3FCEA 5SZHB 3NPAA 3GL9A 1N5IA 3D3WA 2AQCA 1C7IA 3G88A 3PXBA 2QMQA 2G9ZA 1G21A 2G1PA 4IL5A 4YMSA 1CAAA 1KQ3A 3S81A 3H7IA 2OAQ1 3OF5A 1M2GA 3X2SA 3GEPA 4HFMA 3NVAA 3CMCO 2V45A 1SCNE 2H92A 5LDGA 4K2HA 5BSFA 1E2EA 3RLFA 1CCWA 5AK4A 3W2IA 3I37X 1UANA 1OFVA 3N59A 3HOWL 3R6TA 3HJAA 1EXDA 1MX9A 4QJ5A 3EXHC 5JARA 2B5ID 1JTVA 4DLUA 3RC7A 4CM4B 1XUOA 5AW9A 3GP3A 5A4JA 1XKQA 3QY0A 4CETA 1BMFA 3SS8A 3D3NA 1JNYA 2EERA 3QXHA 1NUPA 3EEOA 2EBWA 1VSVA 3EDYA 3L7KA 2HT1A 1HA3A 1EP2B 3OJXA 4DREA 4YRNA 3H1BA 3E27A 3CNHA 1WSBA 1RJDA 2XVYA 5DBOA 3UMRA 2NVXL 4RHYA 3WB9A 5KYUB 2PX0A 1D03A 3ZWXA 3QWFA 3G1WA 1R9MA 5IK2A 3DDOA 5CB8A 3NGMA 3UJCA 4CQMD 3AGPA 2CNWA 3ZXIA 2PEYA 3MWJA 3I12A 4CLOB 2F3PA 4YO7A 5JFTA 2VTBA 3ZD9A 4ILEA 2A9RA 4V2UA 3CV3A 2NP7A 2VK2A 3CZAA 3PUYA 1MP0A 5DEOA 3L7OA 3U4DA 1FRVA 1RPNA 1MQ9A 2PSJA 3UK7A 1AB5A 3FPBA 2NO6A 1XAHA 2ATEA 3FOCA 1CZNA 2BCGY 3DKKA 2RHLA 4WFN1 5BW8A 2DLNA 1PZHA 2FW8A 2HGSA 2ZE6A 1WXGA 4R2MA 1H2FA 2BMJA 1T0UA 3HADA 5JCJA 3TMKA 3IPLA 5ADHA 4HQRA 5DCWA 2EFGA 5TGDA 2DETA 1P45A 3IA7A 2FXIA 4IIEA 4FD2A 4V1CB 3ECSA 1K83L 1U80A 4FDMA 1L5HB 4DW8A 4UDNA 3ZI0A 4YRKA 3N0TA 1QGYA 1FFCA 1T6BY 3LT5A 2WI8A 1V8OA 1T3SA 1DJPA 3PNMA 4JT9A 2AH5A 2HDHA 4C5CA 1QYXA 3GJTA 4BY9E 3OZEA 1PWHA 1ZJ4A 4K6CA 2JJ1D 4OK5A 3BA1A 4KXUA 1I7SB 3TG2A 1D1PA 1JDSA 1OXUA 2AMJA 5L7YA 1DQPA 5M3FL 1ZO8A 2H4FA 5AWFC 5DGTA 2QU7A 3TDKA 3ZBUA 2LD4A 3K6KA 5HRAA 1OFUA 2VXOA 3DZGA 3UGKA 5B30A 1AKQA 1NW6A 4QJIA 1RLMA 3MD0A 2NTJA 1OIVA 4JHLA 3RLIA 4YDQA 1OOEA 3CNEA 1DAOA 1P61B 3KR9A 1XA4A 2JLCA 1EFKA 4LF5B 1Z4KA 1ZVKA 4DLRA 4P5PA 2P4HX 3KQMA 3DFKA 4OXQA 2Z09A 1XEXA 1GG8A 4Y2HA 5HE9A 5HZMA 2ZJ0A 4AR5A 2CF5A 3I2HA 4RA6B 4N03A 3G1UA 4C6HA 1C3OB 1DU4A 1F12A 1GFIA 3NYWA 3PFGA 3CT4A 3QF4B 3HJFA 4ID9A 1NLYA 1H8HA 4FE4A 2C8VA 2Z04A 2GBGA 1C14A 4DLKA 4BRUA 7ABPA 4W6ZA 2BFAA 4R1LA 5TVKA 4LS3A 4ZCMA 1SB9A 2ZB8A 4YMTA 2EY4E 2YFHA 4GYKA 5A0TA 4QZVA 2JLZA 1TZMA 2ZKIA 2WZBA 4HB2A 2HDOA 2WP8J 3DONA 1K1EA 5BUQA 1Q19A 2XYQA 2YXEA 1R0GA 2HA0A 3BKWA 5COBA 4L5IA 1H4TA 3FHJA 1GM5A 1RM4A 3W78A 4D9BA 1DIHA 5KTMA 2FPLA 4ZEOA 4PE5B 4QPDA 4ZZ2A 5LBTA 2DULA 2IKQA 2YOGA 2FGKA 2YICA 2LCIA 1JRLA 2YQZA 3Q1KA 2RSLA 3U3XA 3U7FB 4RLQA 2WU1A 2VEDA 1IRIA 3AF4A 3GYBA 1CX9B 2P3LA 2Z2ZA 1A5ZA 1D4OA 1CUWA 1UWVA 1VLLA 5DRYA 4CHGA 1R3UA 3HUDA 2NYDA 3CLRC 1GZ7A 5FNVA 3WXBA 1C7EA 1YE5A 1THMA 4JYBA 1PO7A 2ZSFA 1HKHA 3F4LA 3QUBA 4QRHA 5T3UA 4EBFA 3GFBA 3GLIB 5JEEA 3OA0A 5AM0A 4I1SA 3L6EA 5ALPA 3OEYA 1FXUA 3U3ZA 4JXKA 5BV2P 1QM5A 2CT8A 2I1VB 4B0OA 2AMLA 4EUEA 5EP4A 2ENUA 4XIIA 1PJ2A 3QX9A 4MV0A 3IXMA 1XIVA 3F3MA 5LQRA 1SPBS 4PBRA 3D7MA 4Q4AA 3U7IA 4UPDA 2BDEA 4MP3A 1JHZA 3K53A 4RC9A 3KQQA 1O95A 3NONA 3C6KA 4L75A 1QX4A 5DYTA 1KR2A 2D2EA 2Y1KA 1HT3A 3QG1A 1TOAA 4K6FA 1FTNA 3EW7A 3R44A 4GOJA 3R74A 3ZE1B 5DBEX 4YRZA 4NS4A 3ZHXA 2F1OA 1XSEA 3QKRB 3MERA 4DDMA 3GVCA 2Z3QB 3FSGD 5D85A 4NS1A 3TBKA 2VTDA 3DQPA 4G5RA 4KACA 5BXQC 2FZGA 2Z2JA 2IEZA 1NULA 5C1IA 1O5IA 1W1UA 1YQWA 3EC2A 1U28A 4WOPA 3UH0A 1JQJC 3WIBA 5B36A 2IU4A 3RRZA 2X40A 1U2TA 2WIFA 1ISGA 2JI6A 3P0RA 5CLHA 3TJMA 3CJTA 1PNQA 2GBLC 5E6UA 1KNQA 1NZFA 1NOKA 4P3NA 4RPIA 4NONA 4P7JA 3T15A 1MO2A 3C5CA 2P5UA 4YT4A 4HNHA 2ZBFA 1TWFL 2ZDHA 2NZVG 3A4TA 2MYTA 4WXPA 4XX0B 1U3GA 4MZXA 3OLVA 4XOIA 1ODKA 1TYCA 4DNFA 2O8FA 2H1RA 2SECE 3DKRA 1PGQA 4AJEA 3J81A 1UM8A 5IAGA 2XNCA 2CXRA 2QR3A 4XR9A 2W2VA 2IOYA 2ZUDA 3LTEA 2WD8A 5F3RA 5CDGA 3TXAA 2YHUA 2OCDA 4HWGA 1ST3A 5CW1A 3DAGA 1LQ2A 4YP6A 4DE5A 2X8LA 1CNFA 4BWYA 5M2QA 3PYLA 3QTBA 1TUBA 4ZK6A 1FFXA 3KVNA 4G07A 4CF4A 1D5WA 2AW5A 3GELA 5HF9A 3TTYA 3S1SA 4HGZA 4R81A 5E95A 5HG0A 1BD3A 4DJ5X 4Z51A 1MGPA 2EHJA 2ZJ8A 4EL5A 4DYVA 1UOQA 1VP9A 1EVEA 5KYXA 3HCBA 4A3GL 1GA6A 3K5IA 3SHFA 2ZZMA 1XHFA 2IYPA 3O1IC 5CXXA 3WO0A 3S2YA 2IUSA 7RXNA 3PS9A 4KGZA 3VZBA 1EWTA 1QIGA 1QFMA 3RYFB 4IH1A 5EHZA 3F5MA 4ZWNA 4W9MC 1B43A 3GRYA 2R3SA 2WAMA 3QY9A 4KW7A 4MGYR 4WD3A 4ND8A 5CPFA 4R6WA 4ZVUA 3OZXA 3RJ5A 4B33A 2AYXA 4E11A 3GLTA 4DBLC 2VUTA 5KU7A 4F06A 3HU2A 5J9FA 1X1SA 4EQ6B 3EEQA 5E9AA 3IHLA 1XC7A 5I9LA 2C9CA 2W6ZA 3CB2A 1T9AA 2NO7A 3ELUA 4EB0A 1PNOA 4WA7A 3E7WA 4QQFA 3RAGA 3RKRA 1Y0BA 5JZVA 1F5NA 2ZUUA 4OQQA 4DB2A 1CEEA 2WRZA 3L8DA 1VKJA 2GRUA 4X6LA 2C6BA 3V6LA 1AS3A 4FI3F 5EFOA 3AEKB 1L4GA 4INPA 3THOA 1S1MA 1NYLA 1FHHA 2W11A 1FDUA 2K7ZA 2QX6A 3VZQA 1DJQA 1E9FA 2DPMA 2ZTUA 3L77A 2J85A 3MTGA 2HNBA 1IG0A 5D3KA 1TDJA 2IA5A 4I1YA 2E2IL 1ZCZA 2XHZA 3HCOA 4AI2A 1YCDA 5H9VA 3GROA 1Q91A 4YN3A 3LCUA 1TAGA 4DR6B 5AVKA 4D3YA 4FC7A 1GR0A 4YFVA 2XODA 2ZI5A 4U7WA 3QPAA 4GU5A 2YWJA 1QUEA 1JG3A 1SIOA 1DOHA 1TTQB 3NEAA 4CM8B 4RMNA 1T3HA 1V5GA 4LXQA 3V1MA 3DL0A 2X4IA 3PCRB 3LQQA 3ZE0B 4RVUA 3H9GA 4LOLA 4UUNA 2X4LA 1D2EA 1GYQA 4KE9A 4JGIA 4A2PA 3LDFA 2YZMA 3IAM6 2XV1A 2HV8A 1MAVA 4MW0A 2OBFA 4RD3A 3SYLA 1RP1A 5HCNA 2P41A 2H29A 4A3JL 2VXCA 2CYBA 3GOHA 4CQNA 1CUJA 3I2JA 5CB4B 2PU5A 3NCHA 5DF1A 3T5GA 1I4LD 1Q44A 1RQRA 1LH0A 4IEFB 4IEIA 4KH0A 3LZ6A 3A9UA 4MYRA 1TAHA 3TKLA 5F21A 2HPAA 4RVDA 1FFDA 2RG1A 4G5OA 4E08A 4EW3A 2Q4EA 5EUBA 3TBFA 1TECE 1RC1A 3V3KA 2FW9A 2C1ZA 1SXIA 1FP4B 1T1GA 2J7PD 1E1RA 3BG5A 4X54A 5B1EA 3NHLA 4B3TB 1U1IA 4FZRA 2BJWA 1RP7A 2VAWA 2X5JO 1Y1WL 1F20A 4HLUA 2C31A 4UNPA 5T3YA 4KXYA 1OBOA 1J9EA 2Z9CA 2G1UA 4J1NA 2HO5A 4YTEA 5HBRA 3R7BA 3SYNA 2EQ5A 1EUCB 2SNIE 4ENVA 3ANSA 2VZ0A 4RK1A 1II8B 3IESA 5CD9A 1E7QA 5CURA 4KO8A 1YJBA 4POFA 1XN1A 2FMHA 3EXEB 5BVHB 2QTAA 2LV8A 3P26A 4H6PA 1OWPA 2XMZA 1MENA 2X19A 4DHEA 1NV9A 1OZGA 1Z6GA 4YJGB 3KJHA 4UHEA 3T7EA 3O4HA 2H5LA 1Y6FA 3GR6A 1TCAA 4EY8A 1M1YB 5T8KC 2OT3B 1EB8A 1SB8A 4LHZA 2B5WA 1P75A 3GPCA 5DI9A 4BU1A 1X94A 4QUEA 1KF0A 2SICE 4MQUA 4EUFA 3OUUA 2RIPA 1COZA 4CV0A 4ZYWA 4GM0A 1Z8DA 5AICA 5G02A 1EK6A 1G4UR 1BCSA 2PSDA 4FEAA 3NX4A 3PQ8A 3ZU2A 4D9EA 1TC2A 3DQZA 1AGRA 3QKSB 4B3SB 1JSZA 2P5YA 2JFNA 2YHIB 4CCAA 2OBLA 1F8GA 2Y9MB 1L1QA 1O2DA 3BXEA 2XUIA 5A7GA 5C37A 2C4WA 2XMSA 2OXIA 1VPTA 1ZJ5A 3F4KA 4RYLA 4F2PA 2B78A 4QYMA 4XB2A 4DBZA 3GAFA 2V1XA 1CSEE 3EWNA 2H18A 4TLMB 3RO7A 2R5WA 3F6PA 2IY9A 2VAVA 3LWZA 3PGXA 1IDN1 3BD8A 4O08A 4OHVA 2ZT6A 4ZCIA 4A1FA 3CRW1 1DTSA 2Y92A 1P4GA 3D0QA 3K9GA 3E9CA 2I0FA 3K9NA 3C3AA 3EDRA 5DNAA 2ZYRA 3VR2D 1P2TA 3OFND 1U2GC 4F46A 1LV7A 1RBMA 4KJZA 1BYUA 5I9SA 1JHOA 2QVBA 4AY5A 4CL3A 1HLFA 1EP9A 1KOFA 3DYBA 1PT7A 2DBZA 4F3CA 5BN4B 2WKWA 4ZEXA 1R9TL 5EHNA 1KQNA 5E4TA 1CJUC 2B92A 4N01A 4E07A 5ESRA 2QX9A 4BU0A 1SELA 3QKTA 3S15L 4FQ5A 4IFBA 3KVYA 3ZGOA 4D6YA 4JVMA 1A95A 1M34B 1WCXA 4NE9A 1BHO1 3H5NA 3OP4A 3P4XA 3TM5A 1TKRA 4R4JA 2H4HA 1YRAA 5BQPA 2E6UX 1CZUA 1TLFA 1GSAA 5JECA 1U99A 2Q5HA 3II6X 1FS5A 1QH8B 2JKYA 2VSQA 1IU9A 5TQ2B 3AKZA 3SHWA 1SUCA 1OSNA 1PJBA 4B85A 5C2JB 3V1LA 3FE2A 3FHCB 2GEUA 4KUGA 5FWXB 4PLPA 1Q2UA 1OGJA 2PX3A 4CM6A 4FT2A 4RTQA 1W36D 1VKRA 1Y9ZA 2E48A 3EF1A 4P32A 2PZEA 4MA0A 5EXSA 1TRKA 5GVRA 4Q47A 1UPUA 4NJMB 3BIXA 1ZN8A 5IJXA 3K0EA 3PDHA 3TQHA 4HVCA 2QRMA 3ROFA 1YZNA 1R9JA 4S1WA 5EHIA 4ENWA 1U6IA 2P2YA 3IP9A 4UCWA 1UZAA 3SBEA 3R5TA 1CUCA 2OVFA 5REQA 3TZ6A 3GLFA 4CYMA 1KXJA 3PNOA 5DJ5A 3DUFA 3K32A 3LTNC 2HIAA 3WHLA 1M8JA 4JI5B 3L8YA 4DM3A 1EEHA 3N8IA 4MNTA 5FKJA 4NJOA 4BFCA 4X6AL 4HNAB 4CEIB 2N3ZA 2ZBRA 2G8NA 2R7MA 2XR1A 3UFBA 2IXDA 3DB1A 2EQBA 3IDFA 2YNMC 3QENA 1JKJA 4FZ5A 1FQOA 2GN4A 4O5OA 1A5AB 3ZZ1A 1AGYA 1O9GA 1RXIA 1A69A 2QRQA 4DCUA 4EPXA 3KYJB 4K5QA 2XOEA 4MW7A 1PJ8A 2C9YA 2VF2A 4KGXA 4M9ZA 5GGXA 1MVOA 1QCCA 2EDAA 3MTBA 3IAHA 4L4YA 3DCJA 3FLBA 4FSDA 3GUVA 4M7WA 5FDFA 6CHYA 1T5HX 1YMUA 3CLKA 3RS8A 3V9AA 4CR7A 1B1CA 5G4LA 2IW3A 1IRXA 1IIRA 1IM2A 3Q7PA 3FDXA 3PHBE 3ILHA 1KC3A 2O0HA 2PH3A 4I5EA 4TV8A 1NQVA 3LKDA 3ZD8A 1IJBA 3BILA 4FFMA 4KMRA 5CVDA 2ECPA 1CHDA 3VU8A 4DIBA 4IHJB 4DA7A 5ICMA 4N5LA 4QPZA 1H6BA 2B30A 3K2QA 5DTMA 2D00A 2KE5A 4LXXA 4MYTA 1OYOA 3HV0A 3PKJA 5H80A 3OPYB 2PD4A 3B85A 5GAGc 3HXPA 1RXYA 4LYAA 4QHSA 2C2YA 4ZRMA 3WNVA 4D8TA 4GRIA 4NKRA 3FI0A 1LVHA 3DMFA 2QMZA 2IZ5A 1Z15A 2CY0A 2I4LA 4TWRA 5FUYA 4WACA 4A3FL 4OEHA 4RJJA 4GMGA 3KVVA 2EARA 5HPYB 4QOGA 1YR1A 1T9BA 1UXGA 3QIVA 1VRWA 4F5DA 1G8HA 4XGIA 3CVVA 1W47A 1X7XA 4NZPA 3RADC 3FTQA 2UXCB 4BLUA 5FYQA 1SCIA 5LZ4A 3ZQUA 5JYCA 2XGGA 3M70A 1YR6A 3WLAA 1G20A 2C7RA 2OBMA 4KIWA 1KZ4A 4OAQA 3VVCA 5K4GA 1P1FA 1TEHA 3N75A 3OQIA 2HU8A 1UBNA 3KPWA 3LY7A 1IN7A 3F5DA 5EJ7A 1J06A 2PVXA 3DMTA 5E9JA 2GRJA 1EUDB 5B6IA 2JKVA 4ZO4A 4L2IA 3WHKA 1V48A 3PUJA 2GBIA 2B4TO 1KYIA 1F9AA 1W48A 1KYTA 1X7DA 4RO0A 1U7PA 4MVJM 3T38A 2EF1A 2RARA 2RGAA 3QPCA 2EP5A 2I2AA 2XT0A 3FKQA 3GFOA 4HB4A 3WP0A 5LWHA 4BKMA 4MHTA 2F6RA 4N48A 3G3EA 3P96A 1R5NA 4ER3A 1LPAB 1OILA 1UBOS 1OWNA 3H9QA 1NNSA 4AZWA 4EKEA 4GP6A 1V8PA 4UBOA 5JIBA 3A6ZA 3N2GB 5FJ8L 4KWHA 5IEBA 3COWA 3WY9A 2XMBA 3CVOA 2OMEA 3W3AA 1OI3A 2I8CA 2PPVA 1Y8RB 4MJ3A 5EIBC 3U13A 4AF7A 4B31A 4EATA 5IMBA 4ZT6A 4J4BA 1URPA 3DZIA 4ND2A 1Z39A 4HC4A 5IYZF 1IUOA 5EZYB 3OPXA 3KSUA 5KQSA 5FO0A 2X3FA 1UXOA 4EY7A 4LOAA 4LA4A 2VUHB 3K73O 3JCZA 1QOQB 2AG1A 3P9RA 2RMKA 3WIEA 2IYFA 4YP0A 3RHFA 5C51B 1ORWA 2IYYA 4EF4A 3R0JA 1ODJA 2QUBA 5ALYA 1FUEA 3AGQA 1SRRA 3M9XA 3PIO1 1JE0A 4O3FA 3VSAA 1RWXA 4DIFA 1PJTA 2QTLA 3ND8A 4CVNA 3NW9A 4YX9A 2E3JA 3TOXA 5L40A 4K87A 1RM0A 1PUIA 3HKEA 3CMMA 3EH1A 1M8KA 5MDHA 3OOJA 4XWYA 1PE0A 5FADA 2VHXA 2PMZP 1UMDB 4BEBA 1DT5A 1JEOA 4IX9A 4E5SA 1JR6A 1P4AA 4NENB 5TXGA 4M88A 2FN3A 1P44A 4QUDA 5JYBA 4HGYA 1ZWLA 2DT8A 3RI3A 1WW8A 1BEUB 2R5FA 4HG2A 4YAFA 1H4SA 3TX2A 2JGEA 4U00A 4PN3A 1Z5NA 2IS1A 1GNQA 1U8ZA 3MT8A 1JHUA 3A0UA 3NPMA 2IP1A 3LWVB 3H6HA 4BKQA 3IEPA 3PIDA 2A69D 1SD1A 4HXFB 3DBVO 2FMTA 1JQ3A 2J9FA 3G2HA 1UMKA 1IZZA 3QE4A 4GPBA 2F1HA 1GL7A 4ND5A 4P53A 1YBFA 5JHGB 1JVBA 4M3NA 1C7ZA 3CZMA 1O8BA 4IAOA 2C0QA 3LLMA 1VIDA 5HBGA 2IYAA 4UE6A 5IDYA 3IODA 1DQSA 4COOA 3K1YA 1IM8A 1J21A 2W00A 3H18A 1XMPA 1KMHB 3MK31 3O3CA 4M22A 2JLRA 5EY5B 3ICPA 4H59A 1QBGA 3IVXA 3ECCA 2A3NA 3H7AA 4PY2A 2XXAA 4UVEA 5FOSA 3GDGA 3V7UA 2KYRA 5HDQA 1WXWA 1US8A 1R4ZA 4RHCA 4JH0A 1WW3A 3G13A 3I4ML 2ZPUA 4YQZA 4GBJA 1EFRA 5IYBL 5CNMA 2ZS7A 4TYPA 3NHSA 4RQBA 1P1HA 3A31A 2O1SA 3MAJA 3FGPA 2PD6A 3O75A 1Z34A 4PYLA 2XMGA 4FXOA 1RQ2A 3G0CA 4DEXA 1SXGA 1EU1A 2VLIA 1NZJA 1W73A 2B4YA 1V3TA 2QIOA 2WHXA 4JA2A 3SBOA 3UWPA 2A9JA 4B87A 3ZU6A 1ORRA 2H4JA 3H1TA 1U7ZA 2CV0A 1SVUA 4RMGA 5JS1A 1BHSA 1U63A 1XCGB 3IJPA 4I2VA 2PR2A 5F76A 2QZ9A 1SHJA 2D0DA 4JP8A 3IHWA 2QSUA 1XQ9A 1SUFA 3IPYA 5ELMA 3L1VA 4ZQBA 4OMCA 1HC7A 3ESCA 5E2BA 5MF6A 2D5AA 3TSWA 4F4UA 5D5QA 3ZY2A 5ERYA 1P2DA 4BNNA 2QLLA 4QX6A 3TDNA 1HFKA 1AHPA 1DG3A 3SX0A 3SKVA 3ZY4A 3ASZA 4JI8B 2JF0A 1QF9A 2FDXA 3GFSA 4W9RA 2Q3DA 4Y8VA 2FAXA 4YAOA 2LVBA 2P6NA 4L73A 1L4YA 1Y1QA 4F3YA 2GJ9A 1I7DA 5FUMA 3Q88A 2AI2A 5K3AA 4GHWA 4C43A 4OHRA 2IPOA 3FBTA 2GN6A 3A9SA 5JD3A 4PANA 5AK3A 3D02A 3WLOA 1T29A 1FC0A 3GEGA 2FMFA 3PFIA 4MLZA 1E8DA 5KYUA 3LT0A 4P0TA 1B2RA 3RIEA 5AJVB 3ROEA 4NEHB 4ZJUA 4HT3B 5EMKA 2GNOA 1DXYA 4CLOA 1GA1A 3R0VA 4IMRA 4PRYA 2JHFA 3GJYA 4UNQA 3H2HA 3A14A 3BL6A 3GGJA 4G81A 4A15A 3BT7A 3HYRA 4TWZA 4ALKA 1JWLA 1BJKA 4MVWA 3WYAA 1LKPA 1Y1LA 4U4AA 4JQZA 4EB8A 4HUQB 1FFBA 4GF5A 4UE2A 1ADBA 3A27A 3KZVA 4FI3C 4C22A 1TTTA 4EEZA 2V0GA 3IKJA 1N57A 5CGQB 2O54A 2IXFA 1CFJA 1FSGA 2H63A 1GKKA 3EGEA 1CD5A 4HV4A 5HVNA 4XTRA 2AFRA 2DTXA 4N6GA 3SC4A 3D4NA 3PFCA 3V4ZA 4AO8A 5K45A 1QK3A 2FPKA 2Z56A 3VSEA 1AUXA 2OOSA 3U9LA 3W5VA 5EIOA 1IMOA 4Y6QA 2O5VA 4V1CA 2X9QA 1L5HA 4HQKA 1Y98A 3P9PA 1OFHA 1WLYA 1NJ2A 3GLVA 4Y2TA 2H1WA 2GZSA 3T3OA 4RHEA 3DULA 2PSSA 1F8UA 1XTBA 1M6HA 3ILSA 3W8FA 4FOPA 1H6CA 2UYYA 2BHTA 2G72A 2A5JA 4ZVPA 3OIVA 2VK1A 1C50A 4R1MA 4FX2A 3U7QB 2ZI3A 4ZU3A 1VGRA 3C1TA 1PUXA 1P1BA 5TF4A 3CO5A 2JVKA 5THQA 1TWHL 4US2R 1JAHA 2JGJA 1LJUA 5JNSA 2R93L 1GCIA 2ILTA 3ETJA 2QI9C 3FCYA 3QBJA 2GYYA 4PX5A 3STUA 1RJWA 4D3FA 2W2XA 5TVGA 3GTLL 3OIWA 2QYOA 2C3UA 3MFQA 5DT9A 2F3UA 4DXDA 4M83A 4BC1A 4YQYA 3BN3A 3PICA 3PLRA 1EA7A 3PZRA 1JTEA 4H1UA 4JP5A 2P3QA 1JBEA 3LDHA 4RA6A 2PLAA 3T3GA 1C3OA 4AMUA 5K99A 3AM5A 4BZWA 4DLZA 3QF4A 3LUPA 1JFVA 1D0IA 2G0AA 3ZU5A 5IMSA 4L51A 1Z3CA 3OF2A 4LE2A 1P81A 3L8CA 3AF5A 4G4JA 3T7AA 1FYFA 4J0IA 5I7WA 1IOWA 4PLYA 3ZVMA 3L7NA 1GLVA 2V54A 3AHGA 3FH0A 3O93A 4Z99A 4CLEA 2EOAA 3PHJA 4EO4A 5E4JA 2HBYA 2FXVA 1OAAA 3IULA 3KKQA 3TNDA 3X44A 1JG4A 2HK6A 1YNOA 2PVEA 1BTOA 2NXJA 2D5CA 2X5NA 5H5JA 3NEJA 2WHYA 1ZVMA 1N9KA 4ZOLF 1Q6YA 2ZUWA 1ZZGA 3S7ZA 1NYRA 1X7ZA 3PIIA 3Q3HA 4C87A 1X8LA 4E14A 2QW1A 1DO0A 1F60A 5JAPA 1Y8ZA 3PWFA 2NTVA 2OL4A 4NH0A 4YAUA 3ZV3A 5FPSA 3M6AA 4AS3A 1XHEA 4ZP1A 3DHWC 3RBVA 1W75A 4Z4IA 3AWIA 4DV0B 1GQOA 2C29D 3FNHA 1M5UA 3WYEA 3A3YA 3AM4A 4KQXA 1X7YA 1N2CB 2AIRA 2JDID 2O2SA 2GZMA 1RHQA 1PWYE 2QSZA 1ZQ1A 3CHYA 1RWNA 1YI1A 1T8SA 3AOEA 4WKPA 4OB8A 5CGZA 2F9FA 4URZR 4ZCQA 2W6JD 1P3DA 3WRYA 5LIPA 3W90A 2P0AA 4MI9A 1FOEB 4D26A 3H5LA 4OGGA 1XGKA 2WU3A 1RC8A 4C4AA 1VPEA 4YP7A 2J3HA 2Z9BA 4QG7A 3V2UA 4RJTA 4KVZA 2R7LA 2YZGA 4J16A 3OM1A 3NT4A 1KZ7B 3I09A 3LO8A 4X63A 5DK6A 1JKFA 4URHA 4C07A 1XZNA 4LTMA 3RTBA 5ES4B 3E9EA 1MC5A 5F3DA 2GKOA 2MU1A 16PKA 1DC4A 1EE9A 3TQIA 4YLEA 1PL6A 5JUWA 5JJLA 2DT5A 3FPEA 1ZOPA 4FLEA 1GPBA 4HX2A 1SN7A 4Z2AA 4FMPA 4YQFA 1DJLA 2DBYA 2W98A 3IIIA 4EMTA 1G1MA 1UJMA 1USKA 3DO8A 3QKRA 1M2HA 4LNUA 4RK4A 4MTLA 1QQ6A 2H54A 2IYNA 3HCDA 3HWSA 3F7MA 1T9PA 3P97A 4YGXB 3I9V1 3RGGA 1NURA 4JP1A 1KO8A 5TGZA 2O23A 4CIXA 3D6NB 1DBQA 3D4BA 4NMWA 5C1OA 1K5DA 3FETA 3VYWA 4U9IS 1CEXA 4K9DA 1ELOA 1S3GA 2AJTA 4FQ7A 2A86A 4YV7A 5BV1A 1SULA 2ACVA 4YRAA 5M5YL 4Q3CA 3N8DA 2C5HA 5J63A 4LRWA 1QFXA 3HCEA 4EO9A 3PX3A 4QC2A 5AESA 1K9SA 3DV2A 3T7RA 1Z33A 3IRUA 4XSHA 1T6ZA 4Y6PA 5ESXA 4EDFA 1JQDA 4QSHA 1Q7EA 2V5AA 2D6FA 5PNTA 3SKXA 2JCYA 2IZ7A 4TM8A 2IUUA 4LRUA 1X1DA 2P6UA 1SXHA 5JJBA 2AJDA 2IQIA 3TZEA 1PS8A 1KSHA 3RYCB 3OOYA 1ZOLA 2CZGA 1IIBA 1UZNA 2JK0A 1XFDA 3IIEA 1QOPB 3LFHA 4IKEA 3SX2A 1NC1A 1P17A 3GH3A 3VDRA 4M7RA 3PUXA 4Q1CA 1GO2A 3T1VA 4BFWA 1LW7A 3E1KA 1KIFA 4LECA 1AXRA 2JLAA 3DCYA 4YXWA 4X90A 3X1XA 1F7VA 4JV5B 1S3SA 5CT4A 3DOCA 2VHZA 2ZSHA 3F7NA 3SQOA 3DDWA 1TCVA 4D8VA 4BS9A 3VZRA 1B1AA 3GRVA 3RYFA 3QQ5A 1JZTA 3EOAI 5JZMA 1B6TA 1XDZA 3VPFA 3VJRA 4CMJA 2C3OA 2CXOA 2MR5A 1N1EA 3TNFA 3ZH9B 4UAVA 1M75A 4UNSA 5E3IA 5AOVA 1EI9A 3ZE2B 4TLEA 2H2WA 1NBMA 4TMYA 4EQ6A 2IIVA 3AR8A 4NHEA 5K0GA 2E5LB 4F5WA 5CD1A 3RVOA 5BV8A 2MIIA 4B3MB 4K03A 3JVVA 4B80A 1E77A 4EW2A 3RAFC 5E6SB 1KDOA 3ZCVA 3MD9A 5K0CA 4EDHA 3COZA 4CLXA 3OD1A 1D2RA 3QVWA 4DL9A 4U5XA 2XZTA 3N2LA 3AEKA 5FNVF 4YPVA 1I3MA 2NNWB 3D6TB 4J07A 1LFAA 4B6GA 3FPKA 2C96A 1M2KA 3H5VA 5ITWA 2WJ3A 4GVPA 4ZPJA 3OMXA 3TS1A 1F3LA 3W8DA 2JGDB 4OLFA 3S3TA 3CX7A 2R6JA 3R3YA 1N7HA 2AVNA 3BM5A 2WKPA 1MR3F 4JX9A 3WIOA 4HZIA 4JFAA 2G8LA 5DXAA 3MLEA 3BH7A 2ZYUX 4RVCA 1IHOA 4B79A 1JJAA 4L9WA 2YMPA 3UAZA 1Q0PA 3RC8A 2XEXA 2ZRAA 3OBIA 3QUSA 3X1JA 4EYGA 2MSDB 3WOVA 4CM8A 1W8IA 3RVDA 1VMKA 3N0VA 1N34B 3MJDA 4UUMA 4Z0HO 1ZK3A 2CF6A 5JRDS 2BR3A 4DUZB 1RXCA 5CFMA 1IPEA 5FJJA 2WG1A 5CH5A 4UEKA 3SZ3A 2IEAA 5SY4A 1ZJ6A 3OT1B 1SVLA 5FHQA 1TADA 1VXOA 3KXKA 1VC2A 3I73A 3UYLA 5AW0A 4U3JB 4GS7D 4C3OB 4KIJA 4EA8A 9ABPA 3B2EA 5AJYA 4NWIA 4X1IB 2WUFA 1VL2A 1IG3A 3GXBA 4FFWA 1SCUB 1FDOA 4JLMA 2WSMA 1JE1A 4N6OA 1N0WA 1U6JA 2H11A 2NYUA 1KEEB 4A9AA 5TIIA 1FP4A 2E4WA 1Q22A 2GPBA 5K2ME 2LPMA 2PRSA 4QXQA 3V6MA 4V0KA 2DECA 5JALA 4TLBA 1YB5A 3JQDA 3MRVA 3K1JA 1XD9A 3NV7A 3WJ1A 2DPGA 2C5AA 3VQTA 1JT9A 1K6XA 2G6BA 2HYDA 1G7SA 1LDMA 1XN4A 1YBHA 1EUCA 2Z4RA 3EUWA 4IW3B 5KKNB 3FG9A 1EDZA 1AVTA 1II8A 4CDNA 4W99A 3D6JA 4AKTA 5KI6A 4CKZA 1ZVJA 5AI3A 3B1KA 1WV0A 2A4MA 4HY3A 1Z45A 3ZIDA 3DS8A 1QHSA 3GLUA 3T5BA 1BS1A 4BKOA 4F92B 2NNLD 5CVJA 4YJGA 1N5OX 3U4AA 3IXQA 2OORC 3SYRA 4HO1X 4PRLA 2HV9A 2AF3C 2A57A 2GEBA 3ZW7A 1O77A 2GFHA 1XZKA 2I03A 2Q6VA 1QR2A 2B25A 2WKRA 3HJBA 2V7QD 3I45A 4DYDA 1WEKA 4WX2B 4Z3DA 5JXGA 1RWBA 5J5CA 3AILA 1B76A 2LE0A 3FFBA 4JBLA 1SOMA 3QLUC 3ME5A 3TE6A 1RYFA 1VG9B 3L1KA 4U0KA 1SR8A 1W35A 2OWEA 5JNRA 4IJ6A 4BNKA 3B9BA 1NU8A 5DNDA 4LAFA 4PM4A 3ZYZA 1G5RA 2Y93A 4X9XA 4FU0A 1I7QB 1J0DA 4E2YA 1E1YA 3D1LA 3QKSA 1V8DA 4BNTA 3AJEA 1NVVQ 2YHIA 3IP6A 3NBQA 4LYFA 4UMEA 3RK0A 1IXKA 1TU0A 2CKCA 3WNDA 3T7SA 2FPGB 4ZCPA 1PL0A 3L3BA 5C46F 2BMVA 4CLHA 1Z6QA 3DKPA 4DA0A 4O2BA 5AVYA 1GZ3A 4E12A 4TT3D 1LJLA 4LDZA 1P8AA 4O25A 5EGSA 1YZUA 5KVSA 4HQOA 2X3UA 1E2LA 3PQ6A 3VTAA 4NVRA 1J8FA 2O07A 5F78A 5CDYA 5KINB 1ZMBA 2WT8A 2C61A 4TMTA 5MFZA 1H4VB 4IF6A 1YK0A 2JJ2A 1A8PA 2NPIA 3EDOA 2R7ZL 8ATCA 1Z56C 1ABFA 2GUWA 4N40A 1DLIA 4DMFA 3CRRA 4DSZA 2B98A 1Q0RA 1WCWA 1NSTA 2JIPA 4W82A 2WM9B 4E3ZA 3PA8A 5I7OA 2WPDD 2VF7A 1DWUA 3WHIA 1Q5PA 3RE1A 4JYPA 5BN4A 3V8QA 2AWOA 1KIAA 3WDKA 5IZCC 3EEBA 4KYIB 4CTJA 2BFBB 3FDZB 2ZYGA 3B2QA 2I7CA 4HDRB 4JB8A 5L4SA 4HLDA 3L6UA 4MUXA 1M34A 4QU8A 4EGJA 2VP9A 4CE6A 3VVLA 2BEUB 4GUDA 3WICA 2REBA 5JPDA 1Z6PA 2XRMA 3HRIA 3GLIE 6REQB 3EPKA 2PMCA 2VHTA 3H1FA 1E6CA 1AZSC 3MRSA 4S12A 3VDNB 3QFTA 2PYIA 1DBWA 1TQHA 5TQ2A 3MB5A 1KFBB 3O38A 1GCOA 1XLVA 3SOPA 1QPGA 2CFSA 1Q0QA 5FWXA 1UBHS 4PEVA 4UHKA 1P7CA 3MGAA 3IP7A 3FWKA 1P5ZB 4B4DA 4PQEA 4BVHA 1W52X 3DAOA 1SA0A 2JH3A 1FLNA 1ZOOA 2Z4SA 2NXWA 3O8OB 4I08A 1W49A 4NJMA 4QYIB 4XRGA 5CA0F 1K3FA 1R0HA 1E3IA 1T15A 2HSGA 3IAFA 3QRWA 3LNTA 4UU0A 3OIDA 5JWHA 3U44B 3SHVA 1KYWA 2HZ7A 4I9HA 4M1MA 1V7PC 1VBKA 1C1DB 3ERCA 3HJTA 4YDHB 3CPHA 1S96A 4ND7A 3RS0A 1C8KA 4LRXA 2JFOA 1KS2A 1H05A 1SMMA 5J5VA 4JAGA 4HNAA 4HUTA 3GA5A 5KNCA 1X8XA 1QO9A 2NPOA 2VJBA 3RG2A 3HQ4O 1FSZA 3IDOA 3WFIA 3QYAA 1J1IA 4RPLA 3L4BA 2FOIA 4IIVA 1M2WA 1RQGA 3H8JA 4C3ZA 3TUZC 5SY6A 3RDPA 5KTSA 1OLUB 2BRUA 1VBFA 2C2XA 2P67A 2RHDA 2QLMA 3H4VA 3H5AA 4Y6SA 2ZCUA 5CT9A 3E05A 3V2GA 4EG5A 3FX2A 4RKEA 5B1SA 2WPNA 1K63A 1VDMA 2H1IA 2VDRB 3DMHA 4JEIA 2CB9A 2PT6A 2QM7A 4OA5A 3W06A 3WLSA 1HO3A 3OE1A 2DBVO 4H7HA 4AG6A 4B46A 3WNCA 4DIUA 2J5XA 1EG7A 2BEWB 2D5LA 3C74A 2RHJA 4L5JA 3RU9A 4L50A 4RACA 5C8DA 4IHJA 5AKIA 4C4RA 4D44A 2P2GA 3AY6A 1NXQA 3OPYA 2BLLA 5AKKA 4OHMA 2IELA 3B70A 4J6FA 4GL2A 1QE0A 3GO4A 3C1OA 3V7FA 3U3KA 3K5HA 1HOTA 4NU0A 4DWOA 2CMDA 3QEAZ 2CYAA 4EHIA 1G98A 2C0CA 1GU7A 1JDNA 2AX3A 2XUDA 4OYLA 5ITZB 5AJHA 2K2DA 4GEGA 2ZITA 4JGGA 5CX1B 1CEQA 1Z0JA 3QX7A 4H4CA 5D3QA 4YCNA 3CIOA 3LOQA 3M4NA 5FX2A 1RAHA 2FRVA 1YZFA 2QVGA 2X1MA 2FTKE 2IOHA 3DMRA 3K15A 4MKZA 5FI1B 5CG1A 1ZHOA 1P5RA 3FJYA 1PKEA 5E9QA 2I76A 4Q9LA 3R6WA 1NR5A 4HLCA 1R4MB 1FBNA 1ZH6A 2X2PA 4BLTA 5BUSA 1ZAYA 3PEEA 1EUDA 1QGUB 2JGRA 3E23A 4MCJA 4XQ9A 3VZCA 2ZI6A 3ZYCA 5BSWA 5BY2A 3DWFA 4LC9A 4D4MA 4GLBA 2NZJA 4ZI7B 2ZRCA 2QP9X 1KXZA 1QIMA 3LZCA 3BE6A 3IPXA 1DELA 4IGIA 3I9OA 4RTOA 2NYRA 1UWKA 4QVIA 1I33A 3ICEA 1Y3HA 2Q4TA 1RFLA 3GRUA 4JHXA 5EFZA 5ALVA 5ADVA 2E21A 1GIAA 4KLNA 1G3UA 2PUBA 1NV8A 3INGA 2Z43A 4I55F 4MRPA 2E2HL 4QPNA 3X1KA 3I04A 1C09A 1H0KA 4KI7A 3F8WA 3N2GA 3Q8XB 2WM8A 5AM5A 3TUJC 5FTWA 3LAWA 1BS2A 4NZZA 3BGSA 3RWBA 1Y8RA 5G53C 4LNHA 4D0RA 4Y6LA 1PSZA 1LX6A 1NX6A 3HA5A 4I6JA 5EZYA 5LA6B 3WAKA 4DCCA 4DANA 1X3SA 5HF8A 2ARKA 1YB4A 2P65A 2OG1A 5CTAA 4LJKA 2Q3EA 4CU2A 4OGLA 1HTBA 3WFJA 4YH1A 1OXBB 5AUQA 4J3NA 1M2VB 4C0QC 1JSCA 3AY7A 4CDGA 3ZNQA 4E7OA 3K1AB 1DOAA 5HR5A 3UOAB 1NBHA 3Q5DA 4FNAA 4HZGA 3KYYA 1RT9A 5IBCA 1DDOA 1C0IA 3IELA 2RAFA 4J29A 4N7JA 3SZUA 3JQBA 1GUYA 2X5KO 3CRQA 5CXSA 4RHTA 3G6KA 3MRTA 1EFVB 2CXTA 1SKAA 2XVXA 1BX1A 3LHKA 3JSAA 4AN1A 1UMDA 1QIIA 4V3CA 1YBVA 3V8VA 1HQYE 3ANNA 3KOYA 4NENA 1T13A 3H6KA 3K8QA 4TXMA 2WM2A 5CDFA 3UKOA 3U61B 1U6KA 1BWSA 3A2NA 3IUEA 3PHGA 4FW9A 5FPHA 4ZTUB 3CW9A 1U0GA 2J31A 3AYXB 3OIGA 1V6CA 2AG8A 3FVQA 1JN0A 3LP6A 4I8XA 4YCJA 1DXOA 4KWEA 4ZOCA 5ETJA 1KSJA 5TDHA 4BP8A 4XWKA 3AR6A 5F4ZA 2R68A 4HD8A 1GD1O 1H0RA 3AUSA 1WO8A 1RHJA 4F8EA 2I6QA 3ZGLA 2PPLA 4L4UA 5IU6A 3I2KA 4PFSA 2N75A 2ABWA 1XF1A 2RGUA 2W6MA 3AP1A 3WRXA 4FYWA 1MRZA 1KMHA 1Y5NA 1QP7A 1XKLA 5FFFA 4C0SA 3RT1A 4QU0A 3L82B 5BWMA 4JJZA 3VR5A 4PAQA 1T5BA 2KI5A 2RH9B 3JVUA 2NTYC 3D2BA 3VMFA 2AVDA 4MICA 4PCAA 2D5IA 2P2ZA 2R9VA 4OB6A 5FOTA 3VNSA 1EWQA 1OC4A 1VA5A 3B38A 5JS7A 4YREA 3FYSA 4OQPA 3STHA 1N6RA 1TCBA 1FU7A 1OKKA 3A2KA 1RCUA 4RESA 2J6IA 4L6AA 4MUJA 5DHQA 3ICWA 4DGSA 3TSZA 1KK0A 1P3JA 3DFZA 4LGCA 3BHNA 2HQ1A 2C03A 4OU4A 1ZINA 4ZHSA 4E6PA 4QUGA 3W4IA 2D3WA 1PFKA 3DC2A 4PTLA 4B09A 4KDCA 4AUNA 2WMYA 3S0JA 2OV2A 1CY8A 1X14A 3B13B 3BHIA 2WTAA 2Z8XA 5KC8A 2V3CC 2OK7A 2H3HA 3AJAA 4J7XA 3QXCA 1CIVA 2ZVPX 3J7TA 3KETA 4BLRA 2I6XA 4MUHA 4WFQA 1O4VA 1L4BA 4UBKA 3GJ6A 1Z7BA 4B48A 4IV5A 4DA9A 3H5WA 5SYAA 2Z3WA 2Q4RA 8ABPA 2H31A 1WY7A 2K2WA 5JZOA 2OQRA 2PVPA 2A8YA 1MW9X 2R8YA 4KWIA 4WWHA 2O8BB 2Y0BA 4CKYA 1DG1G 4JC4A 1FJ2A 5CU7A 3KHSA 2XYGA 4XGRA 1QLHA 1QQTA 5DBIA 2PSEA 2BE9A 4QPCA 3PXUA 1BJRE 1PS0A 3NUGA 2LIPA 4MVJH 1FUYB 1X1QA 3AX6A 3RSGA 3KQKA 2GXSA 3AFOA 1QVVA 2PA0A 4PC2A 4WINA 5DH9A 4KN5A 3KB6A 1U8UA