2LCQA

Solution structure of the endonuclease nob1 from p.horikoshii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
161
structure length
161
Chain Sequence
MLRNLKKTLVLDSSVFIQGIDIEGYTTPSVVEEIKDRESKIFLESLISAGKVKIAEPSKESIDRIIQVAKETGEVNELSKADIEVLALAYELKGEIFSDDYNVQNIASLLGLRFRTLKRGIKKVIKWRYVCIGCGRKFSTLPPGGVCPDCGSKVKLIPRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative toxin VapC6
publication title Structural and functional analysis of the archaeal endonuclease Nob1.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Metal binding protein
total genus 37
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17146 PIN_6 PIN domain of ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2lcqA02
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2lcqA01
3QEBZ 3ORYA 8RXNA 4WA8A 1DX8A 1TAQA 3DBOB 2DOKA 2HR5A 3ZD9A 1A76A 4YWMA 3QE9Y 4AR6A 4TPUA 3H8JA 5H4GA 1TAUA 1VCXA 2PVEA 1EXNA 1R0FA 5L6MB 3ZDBA 5IY0A 1IRNA 1W8IA 5ECYA 2GMGA 1RWDA 1T9QA 5HP4A 5ECDA 1R0HA 1RXVA 2KN9A 4K9FA 2DSXA 2MDTA 3RZTA 2QIPA 1BE7A 1R0JA 2V3BB 1CADA 1RB9A 1UT5A 4AR4A 3Q8MA 5AI2A 3KYVA 2PYAA 4CHGA 1LKOA 3TNDA 2IZOA 5AI3A 3KYYA 1V8PA 1CAAA 1SMUA 1B43A 3H87A 3H8WA 1C09A 1YUZA 3A44A 1T9PA 1LKPA 1T9OA 3KYUA 1V8OA 3ZVKA 1Y82A 1IU6A 1YK5A 1RDVA 7RXNA 1B2OA 2WP8J 1LTLA 2PVXA 3H8SA 1RDGA 1FHMA 3H7IA 3ZDEA 3QEAZ 2FE1A 1MC8A 1BQ9A 1R0GA 4AR5A 2IHNA 5L6LB 1SMMA 2M4YA 3SS2A 1YV1A 3I8OA 1S30A 3RZ6A 3ZDAA 2QL0A 1IU5A 1SMWA 1RYTA 2KKDA 3QVDA 4AR3A 1BGXT 3Q8LA 1ZRPA 3MPSA 3ZDDA 4ME3A 1S24A 2HWWA 5ED0A 3PWFA 1E8JA 4XGRA 2K2DA 3RYGA 2MS3A 1B71A 4RXNA 1B13A 1BQ8A 1QCVA 6RXNA 1BFYA 1DVBA 1H7VA 3KYWA 1UT8A 1YE5A 1RXWA 5HMMA 1IROA 2VL6A 1FHHA 1XO1A 1BRFA 1R0IA 1V96A 4YWLA 1QYBA 1YUXA 1O4WA 1A77A 3PZAA 1LKMA 1B2JA 5HMLA 1YK4A 1UL1X 3IX7A 5HNKA 5SV2A 2H1CA 5ECWA 1NNQA 3ZDCA 5H4HA 4XGQA 5FV7A 1TFRA 3Q8KA 4POGA 5K8JB 2RDVA 4MJ7A 1JYBA 3KYXA 2HWXA 2H1OA 4POFA 2HWYA 2BSQA 1S2ZA 3ZD8A 5RXNA 2LCQA
chains in the Genus database with same CATH superfamily
1DQPA 1DJOA 1QBKC 2HY7A 4AZ0B 1YRQA 1UP7A 4C4PA 1NDQA 4W1RA 1DAMA 2IZ1A 1KRHA 2B0JA 4NK5A 4BKUA 1U9CA 4H15A 5ABPA 1PK9A 5C35A 1KZYC 4MGEA 4UVGA 3L7DA 1BX1A 1TJ3A 1XE3A 4LRXA 3KOOA 4B34A 1TAUA 1WBBA 1UFKA 1IWOA 3E7XA 2D8MA 3LWQB 3IQEA 1O8CA 1SG0A 1B74A 4GRAA 4JJGA 3OTOB 3ZWNA 3GWZA 5LU9A 4PLTA 4OFXA 3IP5A 621PA 1CS0B 1NE2A 1NONA 4IUCS 4NCIA 1VPDA 3TQOA 1AKYA 3A1VA 3OE7D 3WI7A 3A70A 3QU2A 1OGIA 1M83A 1A8IA 2I4OA 2V7WA 3S2DL 2QAGB 3X1ZA 4N3AA 3PRJA 3IIMA 3LT0A 4NS4A 4F5ZA 4ZYZA 4RD2A 4WNAA 2HHLA 3A3PA 1VCHA 2PX3A 2B6NA 1E1RD 1DIRA 2C4HA 5TMDA 4NY1A 4EHHA 4MGHA 1E2FA 1FP4B 4XI9A 4B3RB 4YV0A 1I3KA 3DZCA 4L5YA 1PJ2A 5ILQA 4AMUA 4D43A 1TZKA 4NOMA 3UXHA 3OM8A 4X64B 4D9FA 3H0EA 4B3BA 3A26A 1EXWA 2FG5A 3DZGA 3HRIA 2GVDC 3JRNA 1GNVA 4LC1A 1F0YA 4QFMA 5B2ZA 3HN6A 3TDMA 3TECE 2PBLA 2X1MA 4KEAA 3O21A 4RE5A 5J4KA 2CXRA 1RMQA 4YASA 4I9FA 3HSSA 4C0JA 1V5WA 4Q4HB 3RSZA 3E5MA 4HH4A 1YI0A 2PKQP 1UJCA 1VHWA 2VP3A 3A14A 2GARA 3VJRA 3AZQA 4ZVRA 1H5NA 3S1LA 5A5VA 4M8KA 5IX8A 2DBYA 4OG2A 3QV2A 2YWRA 3T9AA 2R751 3KZXA 4BO1A 4PAWA 5HKKA 1RWPA 3OZ7A 4WACA 5CM2Z 1ZQ1A 2WR8A 1KI3A 2Y1WA 1KDTA 2GKOA 2VXBA 1G20E 2E2JL 2GZDA 3NDIA 3OCCA 4G8JA 1FXWF 1ZJZA 2H8KA 2H5JA 4MGZR 4P83A 2YX1A 2X19A 5HS4A 1ADBA 1GDDA 3EE6A 4OA5A 5F3DA 4JT8A 4BNGA 1SU8A 1G38A 4AY6A 1UMKA 3JAWB 4IS3A 2KI5A 3OICA 4MXDA 4M8IA 1YL6A 4GI2A 1RM5A 3B48A 1PQYA 5BNFA 1PX0A 3ABRB 3ESXA 4Z9AA 1EJ0A 3HJFA 1ZRSA 3FI0A 1VJCA 4A6DA 5K0EA 3RRFA 4W82A 3GRYA 4JUIA 4QOFA 2QD5A 2KQUA 1Z3IX 1CZNA 4RZUA 5DM0A 1V16A 5ALYA 1SKMA 2ZAIA 2Q2OA 4LQLA 4Q0MA 5EKXA 2IUUA 3GTJL 3DOFA 3GELA 3NANA 2Q99A 3FNEA 4OBBA 5DWVA 3OZAA 1G20A 3OFKA 3I01A 3V5NA 3ZWKA 4W5RA 4Q02A 1EBFA 4OBXA 3SJ7A 5HA5A 3UGTA 1Z75A 2A7QA 3AFMA 4R7TA 3UHPA 4KIFA 3BMNA 2BOVA 4AN0A 4LRQA 5BVGB 5KTSA 3JWGA 1P2FA 1Y9AA 4PQRA 4G5HA 4TKUA 4R05A 3DBOB 3A9UA 4AAYA 3KB2A 3IAFA 4AROA 3DONA 3KSBC 3RSLA 4P0QB 3S15L 2A8YA 2C5AA 2C88A 3LP6A 4M55A 3L84A 3FETA 1R9TL 3UMCA 4OJYA 2EL9A 3RTCA 2I91A 4DYDA 3DT8A 1U7OA 4NICA 5FD8A 1LU9A 2GHTA 1XEXA 1FTYA 2J5XA 1QVVA 3P0JA 2QU7A 2BGUA 3PUYA 4H31A 2LIPA 4C9BA 1C8LA 2B20A 1O95A 1R00A 2FJ0A 3AVXA 3KAKA 4JYMA 3VBCA 1GU1A 2XVYA 1RQXA 5IUNC 5KTTA 3O4RA 4AF7A 2GKSA 2C2BA 3OF3A 2ENUA 2J0EA 4Z7NB 3RADC 2XUDA 3AHGA 1CX9B 3WGOA 4A4DA 4P0PB 1M1ZA 3U26A 1II0A 4MSUA 4RY2A 1UBCA 1LV7A 2ZRFA 4UCFA 3CJTA 1A7UA 5DX0A 1NQVA 1I9GA 2PXXA 1AF4A 4D8VA 4QU0A 4N82A 2P5YA 4CIAA 2BELA 3U5TA 2Y8EA 4JJ4A 4DR5B 1SCAA 1NLFA 1Y8QB 3WHPA 3L01A 1I30A 4QOGA 1D5CA 5L40A 5DFAA 3ZZ1A 1IZYA 5ALZA 1U99A 2AOWA 3PP8A 3WYEA 2J3IA 2JATA 3ZE0B 5FEMA 2P6NA 4K9DA 2R6AA 1XNQB 5JIBA 3R9KA 3ZS8A 3CGGA 3PRYA 2F4VB 1BXGA 3Q7IA 1GO2A 1XQWA 3DKPA 3VSCA 2I76A 3EZNA 4PGAA 3F1LA 1NMZA 3C6ZA 4HZIA 4MYSA 1ICIA 3IT1A 5DJ5A 4I9NA 4LMBA 4QRHA 3N8GA 4LAFA 5ARCA 2Z8ZA 1AA9A 4ME3A 1TO6A 2J7PA 4LOHA 2BHNA 3U3XA 1OZAA 4PZDA 2XNDD 4YVFA 1C50A 3VNQA 2ZTHA 4Z4GA 3RYCA 3NUQA 1XYGA 2R5WA 1RVV1 4MRMB 2G63A 1TRHA 3GZTB 2XMSA 1KAQA 3PQ6A 4JJ7A 1E1QD 2Y0BA 5HDQA 3HUUA 4CQMA 2PAAA 2AEJA 3LUDA 3FW1A 1JLHA 3B70A 3N86A 4WECA 3VR5D 5I4BA 5CNKA 4FBMA 2B99A 3TQFA 1QP8A 1UJ4A 2I1VB 2Q3HA 4JKOA 2O8EB 3R5HA 2Y3IA 3UAXA 1BS9A 4ISCA 2A86A 1ETHA 1E8DA 4YJHB 2GM4A 1SVMA 2WD8A 3N59A 2JFNA 4RVUA 4WFIA 1KXZA 3E48A 3BJEA 4OTZA 2ZSKA 3WK9A 2AR0A 2PH5A 2I8AA 3EGIA 1FX0B 1H5UA 2W90A 2OUIA 1D1QA 5H59A 4KLZA 3NPMA 4MLPA 1SCIA 4EUSA 4YRGA 5JRDS 2GT1A 2VSQA 4TYNA 3FN4A 4A5OA 2XZPA 5KQRA 2GUGA 3DLPX 4KGXA 5L8VA 3A04A 4YLYA 2VPWA 2WTBA 5AI6A 1GXSB 1OXKB 1C1DB 3ZV7A 3SI7A 1OR8A 3NR2A 3FCYA 4J0CA 4PIMA 1UWCA 5CURA 2WB2A 2NZWA 3CNBA 2W2KA 3IBYA 1XP5A 3BMOB 5ETJA 3VVCA 1GPMA 1VPEA 3LDUA 4DV3B 1DKOA 3PEFA 3NKVA 1I1OA 2OCKA 3ZV5A 4KVAA 1W0KA 3HYRA 5KHLB 2IYWA 1Z5NA 3H2SA 2J09A 3IR6A 5K0JA 1ULAA 2QL7A 4XD2A 4AZ0A 3DE0X 1KJYA 4ZOEA 2WAQP 4QBTA 4E6PA 1GQYA 3PK0A 3PXBA 2C2WA 5I5EA 4HBZA 1AGXA 5D86A 5IWCA 2VSOA 3CH5A 3DXXA 1UXIA 2HBQA 1RI4A 4RLSA 2SICE 1SUBA 1BZYA 4ZV7A 3KKMA 5EZSA 3MGCA 1VDZA 4BYGA 1H42A 1Y33E 2UDPA 5ADWA 4MTCA 4E21A 2HLPA 1H1TA 1PV2A 1ISHA 4HMPA 4I6GA 5ESWA 3T5MA 2B7CA 3D9QX 4DDHA 3E7DA 4NBKA 2GPTA 1SHUX 3AGQA 4UOQA 5K8CA 1WG8A 2QTAA 4NESA 1WDTA 5AI3A 2XADA 4U7DA 3KYYA 4YCMA 4GPD1 3RC9A 1T9KA 3BIOA 3HQ4O 3N6RA 1HFJA 5C3UA 4Z6KA 5HFNA 2F59A 3N3BC 5DK4A 1ZVVA 2Q5CA 1K5DA 2J46A 5CVUA 3H5AA 2G0NA 1LX6A 2OQIA 1EUZA 3RZDL 3F47A 3L4BA 4BBZA 1X1TA 2P41A 1H65A 3EEFA 1CQWA 3EG9B 4MZDA 2W2VA 2F3RA 4RD0A 3X43A 1G8KA 1R88A 1TDJA 1XFAA 3LPCA 4J4HA 3T1OA 3C8ZA 4PIVA 4AJHA 4MCJA 1JQEA 2PGOA 4UAUA 1PE0A 4NNPA 4LDNA 3BXXA 4TV9F 2DFNA 3K1YA 4V1CB 1RAFA 1D4OA 1W5SA 3K16A 5IK2D 2YMMA 4KN5A 3PRHA 3NIGB 2PV0A 4XM1A 1A71A 1KI8A 2QD1A 4U7GA 1LH0A 1N5JA 3ZCVA 1KDYA 1YL7A 5KTYA 1P7VA 3QG1A 4EKYA 3GTGL 3CUWA 1OWNA 4CTKA 1D09A 1V8DA 1JAYA 2C77A 2JIZD 2ZR7A 4LRUA 1P18A 4WVFA 2ATEA 4FYKA 4BP3A 2VUSA 3JQ9C 1VZ2A 2XJVA 3LT1A 4HLCA 2P9BA 4DA7A 3TLGB 4C0BA 3O92A 3UM9A 4G97A 2G07A 1WZCA 2G4VA 5JYCA 1QCCA 5ILOA 1JWAB 4PCAA 3VZBA 1T2AA 1M1XB 2WQ7A 1MB0A 2BKEA 3C43A 3UUFA 1QXSA 1CC1S 4K9PA 4ED9A 2HYIC 2AXNA 2HJGA 1D0SA 1T5IA 1Q0HA 4A93L 3C3WA 4L15A 4A03A 4B87A 1TAGA 4PQGA 2VC2B 2YJGA 4HWRA 5B58C 3T3OA 5G0VA 3KUUA 1WD7A 1JDVA 4RTMA 2JVIA 2ZIGA 3U3KA 3UWDA 3W8NA 1WB6A 1XWFA 3JAWA 5SY6A 3WP0A 4CNQA 1PF7E 4IFIA 4JDUA 3HNPA 3RSCA 4QYMA 3G0HA 5FWYB 1NURA 1D2AA 2DX7A 3O0DA 4I14A 2VJAA 1WMEA 2H2HA 3GJTA 4CM3A 4EHAA 1K2WA 2DCMA 2BSQA 1HDYA 2CNWD 4A3IL 1P0CA 4ZQIA 1EESA 1JJIA 2E21A 1E3JA 4R9VA 3S2SA 1MJ5A 3P2AA 5HW0A 4IPTA 2ADFA 1V35A 4PAOA 4RNCA 1WE2A 3LT4A 4EEXA 2XYRA 2HR5A 1XF9A 2RAVA 4NU8X 1F48A 1GUFA 1A76A 3GEIA 3PIDA 4FQ7A 1RWVA 4ALLA 3SS8A 4DAOA 1AJEA 1R7RA 1UDBA 4CJXA 2KW5A 5EZYB 3KOUA 1JHAA 3VR6A 3BQMB 4DEYA 5JJ5A 1UMDA 1Q7CA 2YN4A 3IT0A 3VX3A 2P35A 1IATA 1PL0A 4GVLA 5DPMA 2DLDA 5GAJA 2JEOA 4HX5A 4ZVMA 3DE2X 1TXGA 3VH2A 5J4LA 1SUEA 4QBHA 1I3QL 4F86A 1ENZA 4P58A 5K3FB 1J33A 1LB1B 3RJ5A 1D5WA 4XUGB 2BLNA 3L0SA 4K9FA 4O4IA 4IQ0A 2NVXL 5DYGA 3Q2KA 3X1KA 3CY6A 5C34B 3SF8A 4AUEA 4BO9A 2DR3A 3LUGA 3JXEA 2X7JA 1E3IA 4G1EB 5D3ZA 3PENA 3LLVA 4LWZA 2PYAA 1L8LA 2CEAA 4JBIA 1EK5A 4M1SA 1ST2A 4W6QA 3U4HA 1E99A 1VE3A 4BRUA 3LZ6A 4RJ2A 4F06A 4MDYA 4XSVA 4Y2QA 4CCSA 4L6AA 1RPNA 1TTQB 2YCBA 3WLSA 2LW7A 3GVHA 4IVQA 2F3TA 1OIXA 4JQYA 4JR2A 4OGKA 4QTUB 3UJ9A 2FXVA 1G5PA 2B9EA 3E18A 2DGDA 3C45A 2AK3A 3L8HA 1ESNA 1OCEA 3ZTYA 4B3XA 5FAKA 1ORRA 1GARA 1DX9A 2PZBA 3AUYA 4JU8A 4X85A 4ARSA 5KTKA 4M38A 3KB1A 2B4AA 3QPCA 5JAHA 5C1OA 2I8CA 1N6LA 2PHZA 2G1KA 3NHPA 1JLLA 1M2GA 3NW9A 4EEKA 5GMOA 3EFBA 3FCEA 3GLRA 3P4YA 1PSWA 2WZCA 2D1TA 2JEZA 1DZ3A 1JLSA 1YB7A 2G82A 2ZIUB 5JMOA 5BQXA 2YXNA 3A1WA 3UMSA 2ODAA 3GLTA 2NP7A 3EEQA 5JSUA 3UIEA 1SKYB 4YJ3A 4XQ9A 2IIQA 2DH5A 4Q4LA 5E6SA 3JQQA 4DILA 1FU7A 4CFYA 1IK4A 1IEVA 1Q6YA 1E6EA 3PCRB 2GFQA 4QHSA 5EPOA 4OQFA 2HRZA 4PQYA 2VP2A 2FW8A 1J8VA 4YO7A 5G0UA 3SF0A 3FB1A 4WEOA 5ED0A 4XVCA 3ET5A 4MITA 3IP7A 2JJ1A 3OX1A 1E0KA 4M53A 1ZCJA 2BM9A 1N1MA 3BTSA 4RHCA 4ZANA 4K81B 4NJEA 3FDJA 4ZOLF 4E30A 4GMFA 1ZDMA 1FYWA 4A82A 4HMQA 2XD9A 4FZ3A 3W9BA 3RS3A 2Z09A 2RK3A 1US8A 3S8EA 4NQRA 3PZAA 4KV9A 3CNLA 3V55A 1CVRA 3G0CA 4FYWA 3UV3A 2MU1A 1YCHA 2RFLA 4TRJA 3CH7A 2EFEB 1XMQB 1PYOA 4ZXPA 1CCWA 1CULC 1DXQA 2B92A 2HPAA 2ZT7A 2AJCA 3WYBA 1NM5A 2OXTA 3DXFA 3E3OA 4A8PA 4POGA 4CUJA 5K8JB 3DMFA 3FUWA 1EVLA 3ETHA 1BWRA 2GTHA 1XZFA 1HYEA 2Z2YA 1YDHA 2BTEA 2ERSA 2FSHA 3MYRA 4LCBA 2F17A 3H5IA 4X6UA 3MJEA 2GRUA 3LRTA 5K0ZA 4MYUA 3H11A 1HDCA 2XDAA 2CLKB 1QHIA 3TG2A 1NF3A 1JIUA 8RXNA 1XGKA 2VP9A 1DXYA 1JSCA 3A11A 3CCBA 4PPQA 4ABYA 3KYDA 5K6TA 5LZ4A 4OGFA 1MAWA 2A3NA 4IGFA 1UP6A 2Z57A 1P0QA 3STTA 1AGRA 1BSVA 4B6JA 3P4UA 1QVZA 3KU4A 5CB0A 5CDSA 2UYOA 5ALLA 1CUDA 3OMWA 1M0WA 3I76A 1RHKA 1C1DA 1UP4A 2AOXA 4L1KA 3U4AA 3USES 1QKKA 4B3JA 3N70A 4RFLA 1BXRB 3KV1A 2QRVA 4ZQHA 3UGKA 4ND3A 4JLOA 3KQPA 3AP2A 4R40A 1QHGA 2KHZA 5T4EA 3OEHA 2HHAA 1P33A 1OU0A 3ZWDA 5C51B 1DAPA 4Q1CA 4BZZA 4PSCA 2EGHA 2C57A 3D0OA 4IF4A 1FQWA 3EOAI 1DP4A 3IESA 3L02A 4CT0A 3FTEA 4DDKA 2ONYA 4R9NA 1AV7A 1LPMA 1RBMA 1N0WA 4EFMA 5J1SB 1QP7A 3WDLA 4Z9FA 1FFBA 1KIAA 3NDJA 2A4KA 1N3YA 4L0MA 5DOZA 4F5EA 3K70C 3PL5A 2HQRA 2AQIA 2LIVA 4C1NA 2WT9A 1FRFS 2J3MA 5IF9A 4BNHA 3EQ8A 2DAPA 2IDMA 1KYXA 4IGEA 5EXSA 3OUUA 3M6WA 4J4TA 4M9ZA 4AECA 1UFVA 3IOMA 2NZUG 5AM0A 3Q72A 1JB1A 3E8SA 1ZGGA 2YDYA 4NZOA 4PTZA 1T36A 2DUUA 2BW0A 3BJZA 1N6NA 3DCJA 4D3YA 2UVPB 4C5AA 2ALJA 1CP2A 3HI6A 4GM1A 1NJ5A 4O02B 1WS6A 3PDIB 3VTKA 3EGOA 2Q2WA 3NC4A 1ZK1A 3MBKA 3KIPA 3LC7O 1ADCA 4EHJA 4ZQEA 5EINC 3AKEA 3EIFA 1CUGA 3JYHA 1Z5PA 4MW2A 4A1OA 1NXTA 3DMTC 1DS6A 1SQ0A 4B3TB 1YJAA 2QP4A 1SVOA 3VOTA 2WJJA 1XR3A 3ASUA 1X7YA 1L4FA 5AW6A 4GI5A 2MYNA 2QN9A 4AJJA 2VTBA 3M4JA 1O89A 3PHGA 5D51S 4FBGA 4JUFA 1QU2A 2EFCB 3EIXA 4DC1A 5I51A 4OHOA 2XJUA 4EQZA 3GTLL 1XVAA 4C3HL 4OU4A 3OLVA 4H17A 3QE0A 1Z47A 2YBEA 4B75A 5E3IA 1NVGA 3DM9B 1AQLA 1G3RA 1MAAA 2FMHA 2HGZA 4M8SA 3UOAB 1KEKA 4D3XA 4JYZA 3T7AA 4I50B 3ZHVA 2JLUA 3ZQUA 3NTOA 4FKMA 4W8OA 2NVYL 3C15C 3JYOA 3LPDA 2DLCX 4P86A 1DKUA 4H08A 4JA0A 1CS4C 1MFZA 3F0TA 2CWWA 3AFGA 1OB2A 3THWB 2JGMA 1EBUA 3FNRA 4YT5A 4MI6A 2X7HA 2Z56A 2P4UA 1ZM9A 3QOXA 3DW3X 4FS3A 4R6XA 4WD3A 4KX3A 3WRVA 1JJAA 2A5JA 2Z5GA 3PIP1 3G7NA 1PJ4A 5AKZA 4H1UA 5HIIA 1JAHA 4POFA 3IXLA 4PZ0A 3V8RA 1SGWA 4G5YA 4O08A 3T9EA 2XKJE 3IVXA 1G5IA 2AYZA 3DDZX 5E3HA 1CNEA 1QIFA 4Z8XA 3JVDA 1GNQA 4PTYA 3L0DA 3LFTA 2IXEA 4OF4A 2PZJA 5J2UB 2OB2A 5I7EA 4LK2A 1SHZA 1SCKA 2BJHA 2CHGA 2OK7A 1MDFA 2EP8A 2VNHA 3D3KA 3MB8A 2RH4A 2EZUA 3FZNA 3QLVC 3QUTA 2JHCA 5DLPA 1AKNA 3D8HA 5IKMA 2BH2A 4LF5B 2P6MA 4JYCA 5I7OA 2PYZA 1Y6RA 5E38A 1YU6A 4EKNB 3CA8A 5BQ3A 1KC3A 1TWFL 1IULA 1NXOA 2RGXA 4MS1B 3BF7A 2ZYGA 4LV8B 3ZHCA 4PSAA 4MX8A 4L8FA 4BIIA 3L8DA 1WU7A 2H7YA 3F7TA 3GT0A 3B3AA 2JFQA 2F8MA 4ZXFA 1IFXA 1ZH4A 1U2DC 1WP9A 5KMGA 4R2HA 2V7PA 1UINA 4N8EA 2KN9A 2ZSBA 4E6YA 2NX2A 3HJBA 3IP6A 4CLXA 4ZI7A 2WSIA 1U8CB 1JIXA 2ZB7A 4HEA1 3LYAA 2DT5A 4PCVA 3RYIA 1JKJA 4QJ5A 1WMSA 2AYYA 2RHOA 2UVDA 2N1MA 1GU0A 3RYHA 3OSUA 3ZBTA 4Q6WA 3OT5A 2D5CA 5K3FA 4G5QA 3OPQA 4BB0A 4KUGA 3JVUA 5JC8A 4HEJA 4IW3B 3C3EA 3ONWA 4AD8A 2I1LA 3QE4A 3IIEA 3R75A 3H86A 3PC8A 5CCXA 2F64A 1MHTA 1FBNA 3VOBA 4X66B 1BHJA 3PQ5A 1A04A 1TCUA 3KQKA 1SKYE 3ETCA 3MQKB 3P71T 2O4UX 2ZI6A 3TF5A 1GAWA 1C29B 3C97A 3ETNA 3PICA 5FKJA 3NX4A 5LWHA 1ZJ6A 2CLIB 4ZQGA 4G1MB 4XFKA 5EIXA 2FFHA 4U39A 2XDYA 4CODB 3F6BX 5J4VA 2IHNA 1H4SA 2JI2A 2GRJA 3HGMA 1FNCA 3OJLA 4FLMA 4E5VA 1DARA 3K30A 3N2IA 3Q3HA 5EKUA 4J7UA 3BAZA 2XITA 3CLSD 4Q4JB 3AXTA 4TT3D 3P94A 5AO9A 1BXZA 3T0GA 3ZVMA 2DLNA 2H9YA 2XRFA 2GHIA 4ZGWA 3GNQA 5HGXA 1R0XA 2WD7A 4AKTA 4LJ6A 1GDHA 5A2QA 2NXWA 4RZQA 1U0LA 1U98A 4FW8A 1E2QA 3KHUA 1L5QA 1ISMA 3N75A 4FXOA 6ADHA 2W2OA 3Q6IA 3EGEA 1SXJB 1DAKA 1VA5A 3H4MA 5CNMA 4PO8A 1D9ZA 3A9SA 1LNQA 1EVJA 1MH9A 1T6BY 2DM6A 3AMVA 3TLYA 1W52X 1DHRA 3FGPA 5F33A 2YW9A 3CEMA 1KKLA 3IMCA 5L4LA 3QUAA 5GM1A 4WN9A 1YONA 2R6GA 5E1BA 3EW9A 4OQZA 2F62A 4UPDA 2I6TA 3WLRA 1PR6A 4C7MA 1KXJA 2PBRA 4F2WA 6Q21A 5K0TA 3KEGA 1E4OA 4QLOA 4ZVPA 1PNVA 3OZVA 4KSYA 2RD2A 2XCOA 2I5PO 1A7JA 3HV2A 4US2R 2AOTA 2HWYA 2VG8A 4NEQA 5EXTA 3J81k 4JLMA 5AUQA 3N0VA 2W6JA 1NQ5A 1MJGM 5LPNA 3AEUA 4EPVA 3N2GA 2IZ6A 1NVUQ 5CCDA 4BVLA 1MV5A 3CH6A 1QFMA 2O1SA 2ZUFA 4YJGA 5FR2A 4PONA 2YFHA 3ED1A 1KEUA 3HCDA 2APOB 3EC1A 4J16A 4BNKA 3GEMA 5C5IA 4PG5A 3H1AA 1BVRA 1TIPA 3NHJA 3FOAA 4IZIA 3ZYCA 4HAOA 2R47A 4K87A 5IN5A 2ZDQA 4BU0A 1E6UA 2XYHA 3PJRA 4U63A 1NYTA 3I9V1 4M89A 3WYFA 1AUOA 3ED5A 1SU4A 4QZVA 2WMOB 3E3MA 1C7RA 3WBBA 3SFZA 4LE1A 1SCUB 4QUGA 5FWXB 5CIYA 3WRXA 3M34A 4QWMA 1J09A 1ECCA 1IN8A 4AU1A 1R5JA 2IITA 1UPTA 4NFSA 4J7AA 1DNPA 1WHTA 2ZU0C 3SE7A 4MHOA 1JHUA 1T2NA 5JY1A 1UANA 4XGKA 4ZN1B 1U6KA 5KJEA 4MUFA 4XB2A 3R8XA 1XZ8A 2FV8A 4NV3A 2CNKA 1RYQA 5EN4A 4P82A 2ZJ7A 3GJSA 2BM8A 5CH3A 2NZXA 1NNLA 5GZ3A 1T9ZA 4FD3A 2BISA 3OQIA 1AO3A 4U2GA 1QX4A 2HNKA 4LXGA 2QRUA 2CHVA 4BLPA 4E1AA 5CCEA 4ODIA 2BBWA 4F4DA 5CFZA 1WWKA 4DJTA 4KWTA 4LHSA 4LA4A 3HKEB 1KOJA 1OT3A 4RFSB 4ZOAA 1GNTA 3F1KA 1GKKA 3RRYA 3JQAB 3SDBA 2PL5A 2QQFA 1K66A 1V47A 2ZRIA 5LYYA 1GTSA 2QVGA 1NI4B 3KL4A 5AJWA 5L6LB 3ZK8A 2FFBA 3M8KA 2DPHA 4TL7A 3FPFA 3QLJA 3DCNA 4BQRA 5IKEA 3D3JA 4AR3A 3W06A 1YR7A 2FW0A 1EEXB 3EXFA 4AI0A 4UUQA 3QM1A 3ULKA 2W8BB 1XZDA 2SBTA 2WJZB 4AHZA 2EZ4A 2AYJA 3RODA 1PG5A 1PNTA 2IPMA 2OGSA 5CH8A 5CH5A 5LQMA 2X0NA 1F4LA 3WE7A 3IQHX 1XRJA 1PK7A 2CXHA 5I4CA 5TGTA 2R2GA 2VHCA 3OT1B 1Y8RB 4ZYLA 4JAFA 3BHJA 1P6QA 1SCDA 5ALWA 4B32A 3I6IA 4QYSA 5TIIA 1JT9A 5J5VA 3CZCA 3I5UA 3DO5A 4F46A 2BCGY 1KF0A 2C96A 2R86A 4Q4CA 3EUAA 1J8MF 2K7ZA 1R37A 5ALMA 4HX9A 5IJ9B 2NO7A 2PYIA 4GZ6A 1RAIA 4O6VA 4XX0A 2WG1A 2A69D 4BY7L 3D43A 2P40A 1SHTX 1AKUA 3A10A 3NHBA 4FFNA 5CJ2A 2X0FA 4EW6A 2M6KA 4UHKA 2QUAA 4F71A 1K4YA 3OPMA 2JW5A 3ESYA 2PGAA 3K05A 1YR9A 3T7EA 5BSHA 1TD9A 2J1LA 4ECAA 2OAEA 4MKHA 1NN3A 1KEPA 1N0IA 4QDXA 4REQB 1NN0A 2ACWA 4F8EA 5ENZA 2AQCA 4MIEA 2AL7A 3ZWVA 4LF6B 4KR6A 5EPUA 2CB9A 1HT3A 2L42A 3A6DA 3AY6A 4NV1A 3WC4A 3BK7A 5IBQA 2CUZA 3FH0A 4QPNA 2IT1A 1OOEA 2HUNA 3QPVA 4L4UA 3TAHA 2ZQ5A 3MMNA 2DQZA 3JQFC 1BH6A 2X86A 4BLVA 2G5GX 3DLBA 2XHEA 1ORHA 5EP2A 1DRJA 1FNDA 1O57A 5EJ7A 2JHFA 1AOXA 1IG0A 3LFUA 1F51E 1ZESA 2HJWA 3QOWA 1HQYE 3R44A 3LY8A 3RTEA 3WKAA 5CEJA 4EVIA 2V1UA 3HBFA 5JJCA 3H75A 3GZ4A 2PH3A 1JYSA 5TR9A 4KVZA 4WOBA 1E7MA 5HBRA 3PPXA 1ELOA 3OTHA 1SRQA 3E7PA 3ORRA 1BYIA 3FTQA 3JALB 4IH4A 6REQB 3PHJA 2BGJA 4MVJG 4DWWA 5IABA 2PU7A 3JTEA 1TCCA 1IY9A 1JQJC 5A5FA 1E3SA 2OVBA 4IMJB 5IXJA 1Z28A 2C82A 4N5IX 2VHXA 1EE2A 3DYBA 3K1TA 3LUHA 3RU7A 1J1UA 4ZVQA 5CXSA 3RSHA 2OSBA 1D2CA 5GM2A 2CBXA 6AT1A 2Y4OA 3SHWA 3VZRA 1NSTA 4CDNA 5KTMA 2IZOA 3AP3A 5BWBA 3FVTA 3KB8A 1T43A 3KXKA 4F7WA 3LQ2A 2DY1A 4K6FA 3EF0A 1JHPA 1RBQA 2Q6LA 1ZMOA 1BEZA 1XZQA 4WLVA 2XTNA 3D8BA 1T9OA 3LPEB 1KIMA 4X24A 1W96A 1ZRMA 4LXTA 5GONA 1DEHA 2EATA 1YT5A 2C2GA 2IP1A 3K2EA 4QWWA 4TXHA 2QX9A 4O4JA 1HI9A 2ZRNA 4RH0A 5FPHA 3WK8A 2O6HA 5IVKA 3AIOA 4RDHA 1NG9A 3EMDA 4HAVA 3OQPA 3QVOA 1PJQA 2GN6A 4GG1A 4HUJA 4PQFA 4Y6SA 2WNSA 1QHNA 4M1ZA 4JFRA 4U7WA 4UE6A 1JEYA 3KPYA 1GD1O 2BONA 1M6NA 4TMVA 1YOVB 2DQYA 2PUJA 3BRSA 3O4IA 4N03A 4P53A 4U6QA 4CLRB 3AVUA 3R77A 5HR5A 2Q4DA 4BYMA 2BFMA 5KVCA 1BE1A 1ECGA 3OFND 4HG2A 1H0HA 3CM0A 1S8FA 2J9GA 1GSHA 1KU6A 2BCJQ 3V00A 3NH9A 2HSGA 2O5VA 4J0FA 3SZOA 3A3OA 3EZLA 1ODKA 4YREA 3DQZA 3A7DA 2IK8A 1UM9A 2PT7A 2DTXA 1YE3A 1ZAYA 5C7LO 3RS8A 1QCVA 3FNBA 2CF6A 1E77A 5H70A 2YMLA 3DS8A 1I94B 4LXQA 1QYXA 3ZCPA 5JQGB 4CMGA 4YCNA 5EIAA 5D5PA 2A4MA 3LLCA 3P0FA 2C4TA 3T8YA 1GCAA 3HCAA 2AXQA 4D9CA 3G49A 2PZKA 1B8VA 4RXMA 2Q46A 4RTKA 3JWPA 4WI1A 1YQ9A 3DPUA 2GWRA 4GZ5A 2QD3A 4M7PA 5B5SA 2Q6KA 1VIAA 4YC7A 3X1DA 2VAMA 3OPYI 4JN6B 1GPDG 1AQNA 1FLVA 1PQPA 2UUAB 3DKKA 1X1BA 3PDCA 1L3IA 1LV8A 1OIWA 3MIIA 1YHZA 1U2PA 2N9UA 4Q21A 1EFHA 3TKYA 4D3SA 3V7FA 5EJ4A 5GV8A 4XR4A 4UDOA 1J0XO 2AC7A 4F4IA 1U7ZA 2F1IA 4Q4DA 1MJFA 5E7MA 1TEZA 2EOAA 1CQIA 1ZC3A 2AN9A 2C3OA 5BN3A 1J9ZA 1S2IA 3N5KA 5DGDA 3PFFA 2C1XA 3DH0A 2VOJA 3R5KA 5C4GB 2J9RA 4AVYA 4E09A 3G89A 3HEBA 1BA3A 1F6BA 4GE3A 1TCVA 4IIXA 4QJ3A 4Y18A 3LY5A 4JR0A 1YR6A 3VSBA 4XWYA 1S0UA 5MGBA 2P9HA 1W4CA 3WY9A 4N0PA 1KH3A 1GAQA 4Z1MD 4BXXL 2NO1A 2D5BA 4UUAA 1V5GA 1CUZA 4LNUB 3PLRA 1G1MA 4GYYA 5BYKA 3FSGA 2PX0A 4WCVA 2BFCB 1E98A 4UM9D 3K6JA 5B1SA 1TYDE 1WU8A 4EB6B 5ALEA 2PM8A 2QIOA 2JK0A 1C7EA 2Q0XA 4HBGA 2EBFX 1E60A 5ALDA 2QNRA 3AM3A 3BYZA 4AWBA 1H6BA 3LPLA 4OYLA 1R6BX 3VC1A 2OG1A 2H85A 2I71A 2Y1EA 2W4IA 4NENB 5DTJA 5FOSA 3VR3D 4DNXA 2I03A 2FE4A 1M2OA 1U28C 3CJQA 4PLCA 5CTJA 3KJXA 4EUKA 3HRKA 1SUSA 4NWIA 3BDAA 2GJAA 1IJKA 3CJRA 5CIWA 4FOOA 1GZHB 4N49A 4DCMA 5BMVA 3QENA 4OAOA 1Z2EA 2F00A 3DMHA 2PUVA 3WS7A 1YK5A 2VZ9A 5FUWA 3NIDB 3BWCA 3EGXA 1FMLA 5KNDH 3OMLA 4GHWA 5JSZB 4OHKA 2HLDA 1LA2A 1SU6A 3QUCA 1XTRA 5DMXA 3RVPA 3T1QA 1GGFA 1QS0A 2XWBF 5ARBA 3GMSA 3R4VA 5EMJA 4JK3A 5BWNA 1T2FA 3I4LA 3PX3A 5D1NA 3O84A 3QXJA 1Q11A 1CZKA 2BBOA 1YV1A 2FN3A 2G9VA 2NOAA 4R1PA 5DWDA 4F2GA 5JAZA 3KFXA 2VHVA 4EW1A 1L4NA 2Q3MA 4L75A 3SZMA 2BEWB 1JR3D 3W4KA 3W8RA 1C9EA 5L53A 1W9HA 5LD2C 4ZYWA 4OK6A 2OV6A 3B1ZA 1JFSA 2YXDA 2O8NA 5F64A 5CBPB 4ZDWA 1GCGA 1J5EB 3D3QA 1IC6A 2GYUA 5A4MS 2EWWA 3G5UA 4RWZA 4YCSA 3HZRA 4TS1A 2HCTA 3V8QA 1P91A 1N2ZA 3KKOA 3LU1A 3QYJA 1RE0A 2WAXA 1B14A 1E3DA 1WZUA 4E3ZA 4YPOA 3SZ3A 1FTWA 1KDOA 1ZI6A 2V45A 3HI4A 3H5VA 1RBZA 3GTOL 2ABWA 3SSOA 3RQSA 1SC6A 5LA6A 1RPTA 3UA3A 4W5JA 2EAUA 3I6QA 4CG3A 5GINE 2X8JB 4ND8B 1B8NA 4EO9A 1J70A 5HNKA 1USUA 1LWOA 5J3JA 2MYTA 4JT4A 4BJHB 3R6GA 1DINA 3ZPXA 1Z56C 2OHOA 4ISBA 5JHHB 1R8XA 3FHCB 3MMSA 4MVJE 3CN7A 4MRSA 1KQGA 4QBGB 1AG9A 4EI8A 4G0NA 1CV2A 3JAMA 4G0YA 2HLNA 3IAEA 1CUXA 1V7PC 2PWAA 3IR5A 3O8BA 4LYDA 4F3KA 3X2SA 3S8YA 3TLEA 1OLUB 4KWIA 1SEPA 4R1LA 1RLOA 4AS3A 2FKNA 4E6EA 2WAOA 1CJSA 1V1JA 2XV1A 3UT5B 1VKZA 3EPRA 1Z12A 3QLUC 4REQA 5BYBA 4F0JA 1BHO1 4A6EA 4A8JC 5A9TA 1P6UA 4OH7A 8ATCA 3LF1A 3RUIA 3MW8A 3SYMA 3OETA 1NC1A 3RU9A 4MVJA 5KYYA 1SFRA 1A8UA 2QXYA 2PL9A 1G9XA 3V7YA 4E33A 2JFFA 1RWDA 1T9QA 3IBTA 1KYWA 2PKCA 3EHEA 4LJ4A 3VJLA 4ZTZB 4EA6A 1YASA 1S3FA 3FTCA 1V11B 1KOGA 1ZKMA 2P9JA 3COPA 3FA2A 4UBIA 4PO9A 4ZT3A 4H7HA 4MIOA 2R92L 4YECA 1ML4A 3GJ7A 2PT5A 4O4LB 1XTBA 3WBJA 4EO4A 3FLAA 3GUHA 4G9GA 4Y6PA 2WUEA 4IH1A 3PI7A 1VB5A 4IDBA 4LTMA 1WPGA 4FB4A 5L51A 4L8LA 1KY3A 4P6VF 2GD6A 3OTWA 4LF7B 3QYPA 4E12A 3II6X 3AQIA 4CHGA 3UWPA 2JFWA 3AY3A 1RWMA 1UQUA 4BWVA 1F1BA 1XKTA 3R74A 1NXWA 3FCCA 4KE8A 2XQFA 3FG9A 5CYOA 1KIFA 2I0FA 4CIDA 2F8SA 4B5KA 3REGA 4MMXB 1VL6A 1DX4A 2RJ3A 4MQMA 3Q7EA 2H2FA 2Y1LA 1AY0A 3B9BA 5AK4A 1NPTO 2VZ0A 3NYQA 3ML1A 1XZMA 3F6EX 5I7FA 4C7XA 5KSWB 4OHXA 3RVJA 4I4NA 3BE4A 5FA5A 3LDAA 5E6UB 3L9XA 1EK6A 2CNDA 2DQ4A 1RRFA 4CM9A 3SZLA 2AFHB 2VXCA 3D3EA 1XAHA 1RS0A 3NWBA 2QU8A 2BHSA 2C5BA 1SB8A 3JW8A 4M0LA 4R8RA 4DC0A 2Y9MB 1NSFA 3T3HA 4CKEA 4XM2A 4NX2A 3DFFA 2O48X 4OXKA 3DG9A 2OO7A 5B3JA 2IV3A 3VC7A 3C1UA 4KQXA 5B12A 3HDQA 1E1CB 2ERJA 1WD5A 1XQVA 3LNTA 3MUFA 1UAAA 4CLRA 4OM7A 3BSWA 5AHWA 5D00A 2ZCUA 4H7DA 3A25A 1Y4UA 5JJIA 3WGQA 3MS7A 2WMNB 3ECAA 3QPWA 3WWCA 1HH4A 1FY2A 1J0CA 2D1QA 3FPHA 4P84A 4R8KA 1NF9A 4DLBA 1ZEMA 4ON9A 1M1UA 1Z7WA 4XDZA 2B1GA 3P96A 4W9NC 1ECFA 2RBGA 3AV3A 3L3BA 4KXMA 2B63L 4JI3B 3LWZA 1VP3A 2PO7A 2VBIA 3FLEA 1NBOA 1QONA 1XX6A 2C7BA 5FPQA 1F9AA 3HB0A 5C31A 4BIMA 5EAIA 2RK6A 4EMTA 1LFDB 1OWPA 2GAIA 3U09A 1MQ8B 4WKGA 4B2LA 2R8PA 4WT7A 1JWBB 1W5TA 5CP8A 3H84A 5HIMA 1R0YA 1SVLA 1MO2A 2NSJA 1CE8A 3IPCA 4GOMD 4UNPA 4WASA 2WKWA 2Z83A 4CUKA 2WU3A 4HXYA 3HR4A 3IHKA 2ZITA 3RB8A 2PRJA 4TS9A 3DAFA 4A3ML 5BORA 2B8TA 2ZJ1A 4H60A 5C8VA 1O9GA 5T4HA 2C9OA 4RY9A 1QH9A 1QOZA 5T8KC 4ZYUA 4FZ5A 1IXZA 4A3EL 2XR1A 3PLAE 4TL9A 2FMXA 4TRNA 1MW9X 3CRNA 4LRYA 4WKOA 5EJ5A 2V6GA 4O3MA 1CUJA 2QSYA 3O26A 2OB1A 5C1DA 3FPSA 3KZ1E 3KC2A 4LQ4A 2VAPA 3R0QA 1T1IA 3PHHA 3NM5A 1EZ1A 16PKA 2JFPA 3OC6A 5CK5A 1A5TA 5DXAA 1DFIA 5EIBD 1UXKA 3CHYA 2ZVQX 1S2LA 4PLZA 5KYUA 1R0KA 3D4NA 4I3FA 4XVHA 3CLSC 3A1EA 1EDEA 5FI1B 5A1TA 3HVUA 5E7JA 3BTUA 2RJNA 1DRVA 2BGKA 1RJGA 3S17L 3ZV3A 1Y4SA 4HAZA 1NXQA 2D74A 3GD7A 4UKDA 3ZIDA 5JCJD 4UMVA 1KJNA 4G86A 3FR8A 4WJLA 2OHFA 2DKFA 4G0UA 1BS2A 1C30A 4L4YA 3QX7A 2DR2A 3PGA1 4TSRA 5BMOA 4RABA 4ZO9A 3AF5A 2JFZA 4PY2A 1CAAA 4JASB 2OLJA 4KBYA 5FL7A 3TMAA 1UXHA 4CKCB 3ICCA 1IZ9A 2ZJOA 1L5LA 4JHXA 3I92A 3K5WA 2ACEA 3PWKA 5EHQA 3SMVA 3VOSA 1R4MA 2EJUA 3NJ4A 3VMMA 5A2GA 5DT9A 1I4OA 5SYNA 4ENQA 1U1EA 3EA5A 5IDWA 4CMIB 1E1DA 4EITA 3WGJA 3MS2A 1E3MA 4DQKA 1UOPA 3D4LA 3VNRA 1QH1A 1QZUA 1RYYA 1K5HA 2V7EA 5JALA 2O2EA 1P9WA 4X61A 1BCSB 3USZA 4C2TA 3DF7A 3LWRB 1CR4A 4J3JA 2DWUA 3L9WA 2EFHB 4BZXA 1FSZA 4DLWA 1C7IA 2ZJ4A 3MHPA 4P3YA 3WFZA 3OQNA 2WW8A 4F4UA 2O0MA 4JEIA 1QLHA 5EWMB 3ZOKA 2HU7A 3DMNA 3FUCA 4DHWA 1NBWB 1ZRPA 5A6SA 3GY0A 1C8BA 1KI1A 4KYIB 5JEDA 5IM5A 1PEDA 3KAQA 4GOLD 2Y1DA 4R2LA 3ACBA 3KQSA 4ZC8A 2FAXA 5EHZA 2J5QA 3EVGA 4TQAA 1ZGBA 3ANMA 2ODBA 3M83A 5F23A 2VRNA 1N5IA 2AEFA 4FNGA 1XCPA 4IRMA 1QRUA 1F7VA 2JGDA 1BFYA 3WNCA 4FMDB 1YS2X 2B35A 2FWIA 3ZCXA 3D2AA 3D7KA 1BYUA 3TAXA 3PGLA 2YHUA 1TVKA 4LJAA 4X7RA 3IQZA 5IC6A 1PD0A 3DDUA 3LT5A 1FTGA 1ZKDA 5LQJA 2ZYSA 3G9TA 4OHPA 4X3CA 3U7QA 4HATA 4LNAA 4BAZA 1W25A 2XBMA 1H23A 3R3SA 1RXSA 4MWDA 4U8HA 5JXWA 2JAOA 1AIPA 1T6XA 1U3UA 4KN6A 2J7KA 2X2OA 2IWRA 3O82A 1CY2A 4CTJA 2RHHA 2H2WA 2JGIA 3PDHA 3TQQA 5JYBA 2HOQA 1OFTA 5D01A 4O4HA 5DT2A 1JXQA 2ZE8A 5FBQB 3LYHA 1Q7RA 3UXEA 5ICEA 4NARA 3FFAA 1M0TA 3BJMA 2X8JA 5CHEA 3RVDA 4YJ2B 5FNVF 3T06B 2A1IA 4EA8A 4HEHA 4IINA 1VE6A 5ALKA 3S5UA 1DX6A 1M2VA 3IOEA 3NTLA 2YASA 1RXCA 2FPLA 2XEDA 5C46F 5TMPA 1K7XB 3ZI7A 4LK3A 1Z6TA 2I6SA 3IBGA 5F35A 1N0VC 2Z4RA 4QUHA 4B7AA 4EA7A 5JDCA 3E6AA 3PCTA 1RM4A 1GHTA 2REXB 3NHYA 1ZWLA 2ZIXB 4NONA 3H0GL 4ZZ1A 3OZTA 2X9GA 3PXXA 4G56A 1DAHA 3TLAA 1IZ0A 1QVWA 4NZMA 3VPCA 2JFYA 3EOZA 3WICA 3U1BA 1YFZA 1PFKA 1Z5WA 5HUJA 2B3DA 4G6ZA 1P7WA 4I5GA 4XLLA 4OMCA 4B35A 4R83A 3FZEA 1NLUA 2JC3A 2POCA 4WFQA 1HTWA 2BE9A 2IYOA 3FYDA 3GGOA 2P9QA 3ONEA 4EJSC 4DG8A 4BXOA 1M6VB 1XMXA 4JX8A 3AF2A 2WVHA 2WIFA 3PQ8A 1BDMA 2AN5A 2G25A 4KW7A 4PZUA 1X9GA 3CVYA 1TM7E 5TJ9A 3FFWA 1IB0A 4RDXA 2DEUA 2VRWA 1TYZA 2QYTA 2X4DA 1TYCA 2PAFA 3EZ2A 3Q7SA 5TQVA 5KC9A 4K05A 5IKOA 3RG8A 2UYYA 3RTAA 4FT4A 4KFTA 3A05A 3LUBA 3F3MA 4UAJA 4LJ8A 5EIOC 3IP9A 1C4WA 1X0VA 2BEUB 5BUSA 1QP0A 5UKDA 3W90A 5IN4A 4G65A 3QFCA 4C88A 4YA6A 4F5WA 4ZKDA 1ZSVA 4LYJA 3RS4A 1N2CB 4G81A 4BJ3A 2OOKA 4IIHA 3LQKA 1WXQA 4MYHA 1JECA 1TF2A 1BKYA 2N0SA 4NMXB 4R9SA 3T34A 2OESA 4QOIA 2EG5A 2IDJA 3MG9A 2IW3A 3KUXA 5KWVA 5JPIA 2YVAA 3RS2A 4FDVA 1LTHR 1BS1A 2O8BB 3R9WA 2R1VA 4M0KA 2IYTA 5ADUS 4MJXA 1SD2A 3V42A 2NSHA 1OTXA 2OCDA 2CFTA 1PR5A 2QL5A 3F9CA 3K4HA 4HDNA 5L9AA 1GQSA 1UDXA 2FJPA 2ZIVB 3E9ZA 5FL3A 3S0JA 2ATIA 3MT8A 4YJ2F 4BFTA 5DHUA 5HIJA 1XRNA 1XRLA 3O8QB 3TRKA 5D3MB 4TM7A 1I5EA 1ARZA 4JC5A 4NNOA 5CT8A 4BV3A 1H0SA 4X3OA 3T1HB 2AEMA 4Q3OA 3HNRA 3G13A 1U8EA 3AHIA 3C5VA 1QO0D 1T4DA 3WLIA 2B4QA 1QFYA 4GWKA 4ADSG 2XGSA 2X76A 1N9GB 4LCJA 5EQFA 3WL3A 4BGUA 1ZCFA 1H2ZA 2P3OA 1CWUA 3E7WA 5ADHA 1H2FA 1R0IA 4OKNA 5DCUA 1I2AA 4CTNA 2I4NA 1LKMA 3C8HA 4HNAB 1FFWA 1ONSA 3ZHQA 2JLAA 4GUAA 5LZ5A 3OTQA 1VMKA 3LZCA 4O1HA 2WJAA 1VFPA 4QUJA 5DX1A 3MCZA 4C5BA 1T5LA 1G21A 3EBPA 3ZDCA 1OMOA 2CD7A 1Q22A 3MIZA 1HNZB 1SZDA 2IYLD 4AC9A 4JLJA 5GPBA 2LCFA 3GCGA 1AQIA 2PGDA 3SJAA 4GX1A 1NXPA 3EUWA 5FFNA 4B8ZA 1EUCB 3SEAA 4UUPA 3QXHA 3B5JA 2ZTUA 3HDTA 4LVUA 5FORA 4EKDA 2LCIA 5FX2A 1R8QA 4U671 3KQUA 5K2OA 3DTVA 3L1IA 3EAQA 1YNOA 2XAAA 5TB5A 4G89A 1KDZA 2ODWA 4IH9A 1XJ0A 1RQNA 1V8BA 3STYA 1GTL1 3SPXA 4ZK6A 3I4CA 3C5WP 4MUIA 5J59A 4J91A 3TLXA 2W58A 3WGVA 3PNKA 1XDGA 5CBPA 4P54A 1E0JA 4FXPA 4YACA 2ZZNA 2Y1OA 5ISMA 2GZ3A 2NZ8A 2ZBPA 3AHCA 3HKCB 4KXLA 3WNVA 1FS5A 1PZHA 3C3AA 3FMOB 4YP9A 2GMGA 3R7SA 4BQQA 4F6CA 3K9FC 3EVTA 2IYEA 4A73A 1HG1A 4XD7D 3RVNA 4WZBB 1T91A 3GFGA 3DOUA 2G4LA 3WMWA 1T3HA 2MINB 3A9TA 3E5NA 2PKQO 4KLNA 3HDGA 4OB7A 2QQGA 1CUEA 1JZQA 2JZOA 4G23A 5CT4A 4FOTA 3I0NA 4JB3A 1QE0A 3IH5A 3EDMA 4ZGBA 3W5AA 1SBQA 1VCOA 1J21A 2JI7A 4LHZA 3LK6A 3VPDA 1WVIA 1OLXB 3SM9A 4A91A 1GFZA 4C3IL 1MC1A 1NZFA 4X97A 1GZ3A 4FYPA 4KFRA 4RD4A 1UC5B 1GPKA 2Q5JA 3C6YA 3IA7A 3V9PA 1NBME 1ZGZA 3JZAA 2GBPA 4H7EA 3TQRA 2ASEA 4LNHA 2XMGA 4IBOA 4A7PA 1YDGA 4YRQA 1JFTA 3MB5A 1Z0DA 1YI8A 2O2IA 2YWJA 1WKVA 2EEZA 2Y2VA 5EIEA 2DHRA 3I0MA 5IYZF 1USKA 3G2HA 4XQGA 1QB8A 1Z6QA 2ES4A 3U39A 5BV2P 1A8SA 4DLNA 3BFVA 2XE6A 4HDAA 5E6RB 2O0JA 4PLHA 3QI2A 4CKCA 3MM4A 4LWPA 3LCUA 5AR1A 3FVWA 3RAGA 3EX7C 3H3JA 3KNZA 5G0SA 1W93A 2VAXA 3C16C 4U2BA 3T3PB 3TL3A 4O2BB 4Y2UA 2Y4NA 4NAVA 1Z29A 1GL9B 2OZVA 3VJMA 4BN0A 2A6PA 4Y6QA 3S1QL 3GAZA 2C20A 3OMXA 4QX6A 2JI3A 1NBMA 1HZJA 3OEEA 1ZR2A 5F2KA 1BCSA 1Q3HA 2PUHA 3K9WA 3OQJA 1CETA 3ESAA 4Z51A 1C4KA 3OEWA 1DXHA 4DBVO 1UDCA 3AH8A 2OFXA 3HFSA 1ZLXA 2C1ZA 2PUBA 2VSYA 2Q5HA 2PSMC 4N41A 1A0OA 2L2QA 3WWDA 5JE8A 1R6VA 1RWNA 3IQXA 1J0AA 3PQ2A 2B8JA 5EWMA 2OSVA 2I3GA 1F06A 3SEZA 4HQLA 4DMGA 4QELA 3GV0A 5DOVA 3UPUA 1N34B 4KJXA 2JCGA 1CLUA 3NQ41 5L3ZA 1XCOA 4WDQA 2CNLA 3PO3L 5K9ZA 4FDMA 3PUHA 4GGPA 5JW6A 4I55A 2REQA 4LHLA 2Z1NA 1SOUA 2F1HA 2QVYX 4KFSA 3WHLA 5FPYA 1JEQB 4HV4A 1SBHA 3GJ4A 3OOWA 1BDHA 4BMNA 3SC3A 4DMUB 1W46A 2VWGA 3A3YA 4Y7CA 5MHTA 1M3SA 1T0JB 3U4IA 3OWOA 4TYPA 3T41A 1H2WA 4AF8A 1H2AS 2JFBA 3Q3VA 4BB6A 2PUDA 4ZDJA 1E5QA 4HLNA 5DBEX 4P32A 3RNLA 4LF8B 1SBTA 2GCGA 2ODPA 3TZ6A 2VK2A 5DU2A 5CFLA 3HR7A 1R0RE 4FWTA 1PCXA 3TUIC 4D98A 4B1FA 4BY1L 3ETLA 5KYXB 1NOJA 2H63A 2XF8A 3ZVRA 5F9FA 1R18A 2OD2A 1UFOA 2Q2VA 3EIWA 2KLBA 3O74A 4ZK2A 2JPDA 4CM7A 3ES9A 1EXVA 4S1OA 3JQ9A 1AHNA 3K0AA 2WF6A 1A9RA 5EYPA 1N8NA 4J2OA 3T3MB 2VXOA 4DLXA 5LOVA 2ZJ6A 4I1RA 4ERNA 3QKTA 3AHDA 3C70A 5IDQA 1JXOA 5KAMA 1ZVKA 2HX1A 1EJ6A 2YIJA 1FFSA 3Q3CA 1IBLB 1T34A 3PFCA 4EMSA 3ZDFA 5AOAA 3MFQA 2NVWA 3VZDA 2ZIXA 1F7UA 2ZB4A 3G1WA 2O06A 5A3VA 2VDKB 3MHTA 3CC8A 3DCYA 3E2MA 4BFWA 5I47A 3W3ZB 4O59O 3ROFA 1P45A 2HHJA 2VJOA 1XKQA 2VR1A 5CA0B 1CQJB 1HPLA 4M88A 2YUIA 1N2CE 1S2NA 3BBPA 2BFEB 3FPKA 5M5XL 1SN7A 1W4AA 2JZNA 3A1DA 1IN5A 1YUNA 2HQ1A 4M1KA 1HSOA 1QTIA 1FYDA 2HA3A 1CR1A 1ODIA 3HZHA 3M6UA 5BR7A 5LKAA 1HNWB 2C42A 4ETNA 3JQ8A 2HLHA 2V3VA 2Z4TA 2V54A 1WSWA 1X1QA 2NUPB 4DN6A 3ENZA 2RGNC 4N5MA 2C3UA 3KCQA 4JLBA 1SUIA 3VSAA 3A2KA 1DG9A 1L5WA 4Y2PA 2OD7A 2DRIA 1NOKA 5E2AA 1K86A 4HMOA 3ER6A 4RV5A 2QDKA 3ZE2B 4ALIA 1FEZA 4YAKA 5BN4A 1X87A 1FYXA 1JT2A 2C8VA 2Q07A 2WLSA 1KDPA 3A1NA 1PJBA 3IT3A 4MQLA 1LWNA 2BEUA 5DM60 3WGIA 3CZ5A 3GJXC 4ZEVA 3SX2A 1DV1A 2Q5IA 3PQCA 4MMZB 4A6PA 3GGPA 3L05A 4XJTA 4J0IA 4L74A 5C8YA 1QTRA 4WTOA 1J99A 4Q03A 1AQYA 2LDXA 2BR5A 1E1KA 3NI2A 1OWMA 4F9GA 1NVVQ 3HB4X 2PVPA 4YXWA 1NATA 2VHWA 3ZQJA 4IV8A 3MTQA 3FBWA 3IELA 4BEJA 3QKUA 4MYDA 1OH8A 3AF4A 4N54A 2FZLA 4FGWA 4DCOA 3ZGVA 1EE1A 2FZVA 2YWEA 3PDJA 3R3ZA 3ZIAA 3JU3A 2TMDA 4P3XA 1UBSB 4HQOA 1WW2A 1RFGE 4UARA 2ZZMA 3NV9A 1BQ3A 1P4HA 1QGED 4EA9A 1F8YA 1D6JA 5M3ML 1IOLA 2FN8A 3A3KA 3NOXA 2WUDA 2QLFA 1VI2A 3OESA 4DJEC 1TKCA 2XVXA 4WXHA 5A9RA 3O8QA 2E55A 3OZFA 4YRFA 5D3MA 2BAGA 3M3PA 1WVMA 3PNVA 4Q9LA 5K8TA 3PSHA 3QFFA 3WG9A 1TWGL 2VK1A 2FEWB 2B0CA 4B4UA 5IU6A 1QYWA 1RRGA 2Y0EA 1V7ZA 4EDFA 3JX9A 4BNJA 2CXPA 1CY7A 3E9MA 2QT0A 4RCYA 3AEKB 3QELA 2WPDA 2P0EA 1E94E 3GLGB 5LZ2A 5EP4A 1QHHB 2QJRA 3E9NA 3QITA 1JLRA 3E22B 3IALA 1NQWA 4BJ1A 2JG3A 1NKSA 1M72A 1A4UA 2IEAA 2QMEA 3BGDA 3EJWA 2YW2A 3GA0A 1IBSA 3SLGA 1OSNA 1XCBA 4HNAA 1JHOA 1P0IA 5EL0A 8LDHA 2B21A 4RTNA 2GNPA 2GXQA 4KQ2A 1G8JA 3D64A 4QSHA 1R6UA 1YRYE 4RULA 1HYBA 4S1TA 1E59A 1KP3A 5HE9A 2JHGA 4ECEA 1LQTA 4JLKA 2C8KA 3FKSD 1OWBA 1JRLA 1KTVA 2NNWB 2B34A 2OT3B 3HADA 4IIJB 3DWGA 4MPJA 3JVVA 1QV6A 4IXNA 5D5QA 4E5SA 9ATCA 1X80A 2BN4A 1XLVA 3PO2L 1JXAA 4QM6A 1O97D 2WWFA 3QVGA 4F4JA 4ZFNA 4KPGA 3TW6A 3L8GA 4WY8A 1L5HA 1SBZA 2AGVA 4PLPA 2GO7A 1L7QA 5JCPA 1K8XB 3C7AA 2GZ2A 4M0UA 4R16A 4U7TB 5BQ5A 2JKZA 2VDRB 1ILEA 2VPPA 3A9CA 1P2TA 4AJEA 4CHTA 4EB0A 5KWEA 3M70A 4V196 5J5AA 3HZOA 2O9JA 1RRPA 5TVGA 2B1RA 2JL1A 3M5WA 1YQGA 4EL5A 5H3CA 1ODCA 3BJRA 2D1FA 2O2HA 3BL6A 3LXXA 3NOQA 1LVGA 1MHPA 1ATIA 3CUKA 3FPJA 3FJOA 1HXHA 3KKEA 5HF6A 4DJJA 1RB9A 5DM71 2FK8A 1G8PA 1Y4ZA 5DBOA 4AKSA 5JFGA 4R3WA 3JD0A 1IN7A 2O3SA 5DEOA 5ALJA 4G01B 3STXA 3TNFA 1ZH8A 1WDMA 1PZGA 2D0PB 2JJ2A 1BH2A 4J0EA 4UMEA 4Q7EA 1QIGA 1FPQA 5E8JA 1E7WA 2OAQ1 3U16A 2NW6A 1EFAA 1E20A 2FWPA 2Q9CA 1JDJA 1F17A 1G6HA 1XEWY 2I7VA 1T5SA 2Q4RA 4ZPJA 3THRA 1IHYA 2MSWA 2WC1A 4QTZA 1COZA 3TOSA 1E2JA 1RLUA 4BVEA 2V7QA 4L22A 2C2YA 5LXTF 4QGSA 4RTLA 4UE3S 1MB3A 4YB8A 2WFLA 5DM4A 5I9MA 4RZIA 3I8XA 4WINA 4GZLA 2XF2A 5JG7A 5H80A 3KXLA 3DDHA 4PRZA 6GPBA 2RARA 3FVRA 3ZGXA 1NI5A 2NTEA 1CB0A 5GJCA 2JJQA 2I8LA 3SIRA 3NJ8A 3WGYA 1S30A 5FTMA 5J2TF 2Q2QA 1IRIA 3JQDA 4PYRA 4CF6A 4HNVA 3BULA 1SMWA 4HOYA 3GFVA 5F12A 4D56A 3Q1KA 3SIWA 2XGOA 1DRUA 1OQAA 1FE8A 1TX4B 2G1UA 2VT3A 3ICOA 4Q15A 1UF9A 2G9UA 4QDJA 1AN0A 2FRXA 1TT7A 2FZGA 2YV5A 3PE4A 1KPHA 1TLLA 1WY5A 3EXIB 4M1TA 4M98A 1VKHA 3U2QA 4XVUA 2RB4A 4CCYA 1NHWA 2F9LA 4CU2A 3GFOA 4PTLA 1N2GA 4DSOA 4O2BA 2DPGA 1WB4A 1Z26A 2X8LA 3G59A 5EIBC 3ZNPA 4Q1BA 4B2PA 4MTLA 4PGMA 5BR8B 4OJMX 2A1TR 4FD2A 1TM4E 4DLUA 3M4OL 3UAVA 1AUQA 2Q6IA 5E8RA 2H18A 3IPYA 1G8YA 1GEGA 1N77A 1RWOA 1GPJA 2RCYA 3KKPA 4L51A 3H2HA 1YZYA 4G5GA 1JU4A 1H94A 1SVIA 3UPTA 3ZU4A 1RYBA 4B31A 3QFRA 4D79A 3LP5A 3H5OA 2LD4A 2WM3A 1KI2A 2RH5A 1ZRHA 4FONA 1EFVB 4WZAB 3DDSA 4EX6A 1X6VA 3O4FA 4KL8S 3R4CA 4FFOA 5CA1B 3P9ZA 1PG0A 3GWGA 4AM8A 1BOFA 3QHQA 4UHJA 4PG8A 4FPXA 3ZJTA 5JWRA 2Q5FA 3G6WA 1OKKD 3RS7A 1PGJA 2GZSA 4IYRA 4A2PA 1GJRA 5K99A 1JEQA 4IDPA 5IJXA 5B4TA 1C41A 4PAQA 3NC1C 3B3GA 4JZKA 2E5WA 3TRFA 1TTHA 3X0DA 2WLTA 4YMSA 3FTNA 3SEQA 1T10A 4FHCA 5HFJA 4OJNA 1KMIY 1ZZGA 4YMHA 5L7TA 4HWPA 4EGAA 3ESRA 1KK3A 4K7JA 2VJKA 4QQRA 1U1CA 2G80A 2FPSA 3HEAA 1I1NA 2BBTA 3DB2A 3HXOA 1EWQA 1W2HA 2WOOA 1V9SA 2C9CA 2R11A 5EQTA 4DA0A 5JNSA 1A9QA 4GUDA 1L5YA 1IQRA 4OK3A 4EW3A 5E1OA 5IMSA 1O5OA 1Z88A 1RKBA 3JZDA 4H1TA 4WJKB 1PZEA 2BI4A 1TA4A 1JAXA 1W48A 4V0RA 3TZBA 1RRVA 4RHTA 2B1QA 3LA8A 3OBBA 2CLFB 1WY7A 1C9KA 4Q9JA 4AURA 1TW2A 1USWA 2G1AA 2NUAB 2A59A 4KR2A 1XYVA 2A9KA 1WZEA 1U8TA 3A1SA 2V3BB 3ILSA 1E1RA 2O0HA 5CVEA 1J6UA 4MRRA 3TOZA 4BV9A 1Y7IA 4OQ4A 1GDTA 4MWSA 4B82A 3GLHE 2J9UB 1MB9A 3HVHA 4LHVA 5D85A 3PJFA 3NHMA 1CTQA 1DTWA 3KJHA 3KVYA 4HAUA 4QXQA 4U3JB 1FK8A 3X1WA 1DC6A 3Q0TA 2MYUA 3DBLA 3RBXA 4BNXA 1OI2A 1SVKA 3A44A 3FWPA 4GMGA 2PUCA 5CA0A 1CQJA 3UK2A 5E9JA 2JA6L 1C3XA 4LPSA 4WESB 5EE0A 3U37A 3ZZTA 2XT0A 3GFBA 4RHUA 3GVPA 1TMKA 3QLVA 5DWQA 4DYVA 3SC2A 4AJPA 2G17A 5FTKA 3TLCA 3SNHA 3ZW9A 1DV2A 2WB4A 3C5CA 3PGXA 5HILA 5AW5A 1FXWA 5EA2A 1D2HA 5TGZA 4BNDA 4LRSB 3F7OA 5K7SA 1LJUA 2QTVA 2Q3EA 3SS7X 1RDGA 3DOIA 3WHKA 5BN1A 4UOEA 4GD3Q 5HOQA 3BHNA 4WLFA 2R6CA 5TC4A 1BQ9A 1C4XA 1RBYA 4QFDA 2FG6C 4MKGA 2JASA 4P5DA 4C4YA 1QX3A 3TPCA 3GLHA 2FK7A 5A4KA 3P9SA 4KQJA 1U2DA 3V4LA 5KBYA 1UBKS 5AM3A 5JNWA 1FVXA 3NAMA 3UHAA 4X95A 4IV5A 1SUWA 4KO1S 3KELA 4MEBA 1ML3A 2APJA 1NT4A 5B1HA 5JAPA 2OCXA 1TWAL 4ND5A 3W7BA 4PPGA 3AFIA 5CJJA 5IDVA 1V6CA 1KH1A 1R2QA 1YWGO 1KR5A 4JSTA 4TMXA 4W5TA 4TQUS 1SA0A 4AI6A 2H11A 3L6OO 4TSKA 4X1OA 3U7FB 4B80A 2WT8A 1HDEA 1SD1A 2BBSA 2DFTA 2CXOA 4AG3A 1NR7A 2QV7A 3E27A 3JASB 4LBYA 4NKRA 2Q3DA 2E4AA 1Q91A 3UHOA 4CDGA 3S1SA 3FOFC 1NXSA 4GVXA 3RJZA 2NADA 4Q18A 2B36A 3TK1A 3GOQA 3PCXA 4K6GA 4HRVA 4U00A 4HNUA 1OPXA 5AVSA 5KOJB 2BLLA 2CDRA 1OH6A 4INAA 4CM4A 4Z3DA 4YY3B 1ZIPA 3JYLA 1H1LB 3R41A 1AGPA 1H6DA 1L3CA 2BFFA 1GN8A 3AUAA 4M1EA 3RUPA 3LWVB 3D5QA 4LYAA 1DEKA 1RKVA 4JEUA 4C08A 1W5AA 2A3RA 1MV8A 4XCQA 5T4BA 3D7NA 5AFSA 2H1OA 4IQ8A 2B30A 4XWGA 5IT5A 4J0QA 3JQPA 3ANXA 3R7LA 4E7OA 5AVYA 2TRSB 3AEKA 2PX4A 4URHA 3FPEA 2FOIA 2A5FA 3N9IA 1JEAA 4JUDX 4NJMA 3ZWPA 3UMJA 1UBFA 1EX7A 2OZLA 2XLCA 3QPAA 4K88A 3ICPA 3GPIA 3PL1A 4KOAA 1M1NB 5CT9A 1EGMB 5GV7A 4EK9A 4PAMA 4HDRA 3WKDA 4DA4A 4XEUA 4OK5A 2ZSEA 2IPXA 3UKDA 3AEXA 4HNGA 5BN5B 1WHSA 1XZHA 3M2TA 4OSPA 4TWBA 1HE5A 4PWZA 4E5KA 1Z39A 4OUKX 5I8WA 1BDJA 1Q2UA 3KEQA 4HRXA 3H9UA 4IIJA 4TWZA 2YZGA 4ENUA 3HOWL 1VSTA 2A1UB 3BH7A 1CUFA 5JTUA 1NHGA 3PLNA 4YLGA 4DA6A 3U7HB 5DIFA 2FSUA 3RNOA 1NLYA 2H3HA 3T15A 3TNJA 5JH7F 5ED4A 4ZREA 2OHHA 1L7AA 2GZAA 4H3VA 3K1AA 4CKXA 5FIUA 1T2DA 1WKCA 3L5OA 3NHAA 3P52A 4MGIR 1X7DA 1Y7TA 1H2XA 2Z08A 3QPBA 3TNDA 4QM7A 1URPA 1RCFA 3LPMA 1IWBB 2DPMA 3H1PA 3GFQA 2R7AA 4PGFA 3KT0A 3P9NA 4MUJA 4HYYA 4P34A 4WDRA 5G1OA 3ZJUA 4RVFA 2P9CA 3FYCA 4RZSA 1V8OA 2RC6A 3OG9A 3U4QB 4F2HA 2FEOA 1KHTA 3BWMA 1C1XB 1THZA 3BGWA 3CZQA 1XTVA 5ES3A 3CUTA 3HOXL 4RMJA 1N0HA 4A0RA 2KBEA 4A26A 1MIOB 2I2FA 3LUJA 2PR7A 1RW4A 2R84A 2B2XA 4FGLA 4FGKA 3VSDA 4ENPA 2ZDGA 2VDNB 4Y2SA 3V34A 4K6MA 4NYJR 2ISQA 4D2IA 2ZQZA 1MQSA 4KBFA 1MB4A 3DMGA 3F49S 3L1HA 2I87A 1IN6A 2M4YA 2GD1O 2IYUA 1XWIA 3G5AA 3FYUB 3H2KA 4XXBB 1PTJA 1T4MA 1G4AE 3HWX1 4AW9A 4JD5A 1C1HA 1JHZA 2V5AA 2IHVA 2WYVA 3A1FA 3LL4A 4PQEA 4B74A 2PK3A 3HNOA 1K3UB 2V9ZA 4QNNA 2E4ZA 1C8KA 1QK3A 4N0QA 3SMQA 2O5RA 1CUIA 4KWHA 5DI3A 5K2MA 2PGXA 1E1QA 2QAJA 3O1LA 4C21A 4F4FA 1E3LA 1H66A 2L19A 4AHWA 1E3WA 2J0VA 1SIUA 2WTAA 1Y1VL 3OPYB 4LI3X 4RSGA 3VR5A 3WGLA 5AI5A 4PYQA 4AYTA 2A0WA 4QGFA 1ZJ5A 3COWA 3LWPB 3D2BA 1IROA 4WZAE 3RRMA 3WGUA 1G66A 3LW7A 4AG6A 3A8TA 4DXAA 1OWLA 1XUOA 3KQYA 5BOSB 3X1XA 3MJVA 1SULA 1UDRA 2D00A 2VA8A 3HB9A 1JR6A 3N74A 3NU1A 5JPDA 4AQYB 4A15A 5AW2A 3PHCA 4DSUA 3AUFA 5GJBA 3RIYA 2XA2A 2A0FA 2BFWA 2R85A 4RA9A 3RLFA 4BFLA 5I4KA 1N2JA 3A6JA 4M1QA 2ZP1A 5HZMA 5LD2B 1GG8A 2H2GA 4OHCA 2B94A 3KYJB 2HK7A 2LWIA 2WSSD 2OBMA 4LEIA 4C7OA 3HYNA 1RI5A 4M0FA 5K3SA 3RW9A 1G16A 1CF2O 3KZNA 3B3QA 5IJ0A 1YVUA 3TH5A 2ZEJA 4MCAA 3HR8A 2XGGA 5HIAA 4AI1A 3GRFA 3VYRB 4L28A 4WZAA 1DXOA 1RQRA 1STOA 2VRBA 3FGZA 3KLBA 3OIUA 4BO0A 2A5LA 1MQAA 1Z38A 2E89A 3VO2A 4AULA 1QYIA 5LP6F 2YZ7A 1X42A 2ZS9A 3BG5A 1CF9A 4AZTA 1FDIA 4OKSA 4JFAA 5IAJA 4ZCTA 2ONZA 2QQ5A 2HHCA 1GRQA 1GQ2A 5JXGA 4L27A 1UOOA 3KOMA 4Y8VA 1RIFA 2NV2B 1Q0RA 4NU6A 4UJ3A 4O2RA 1OLSB 1GPH1 4K03A 3L6BA 1CF4A 4MMYB 3UWOA 5TQ2A 3QE2A 1Z3CA 1EP9A 3DMDA 4IZOA 1W19A 1RYMA 3D0KA 4YJFB 4NU5A 1IH8A 1U1FA 3B7GA 1R0BA 2JAHA 1TU3A 3MRXA 1KAOA 1FUKA 4JJAA 4KUHA 4RM3A 4TV9A 2HGSA 3EBLA 5DCWA 1T0IA 3PEVA 4CEJA 1CR6A 3L8FA 1RQ7A 2R7KA 3Q9UA 3CF2A 1PWYE 3PDUA 4CM8B 3IURA 2PUGA 5K3OA 2J85A 2IBMA 3KFVA 4QODA 3FHJA 3B0AB 2EXXA 2F55A 4DTCA 3IE0A 4Y2HA 2XIQA 4A8JB 4BLQA 3HB5X 3SY8A 3T7JA 3O1JC 4WY2A 2VH1A 3QEKA 4Y2GA 5JO0A 1LTQA 3ZU5A 3ZDZB 4JMLA 3BRWD 2UZ1A 3E35A 4Y9SA 2EU8A 4HDOB 4JX9A 5K0FA 4JT2A 3ELYA 1HBJA 4IIVA 4IHKA 1MVLA 2YC4C 3B13B 3JQFA 3IMGA 3OIVA 4IAOA 5IK2A 1KERA 4CMHA 4U3JA 5CEEA 5KOYA 2IXAA 1XZJA 3FROA 3QEMA 5G0TA 4S1NA 1N5KA 3OZXA 3T0FA 1ZBQA 4JBXA 3U49A 4CBVA 3DBHB 3N87A 5CM8B 3NP7A 4CRWB 4UDXX 3WXMA 5LYJB 2IH4A 1I3LA 2PS3A 2PGNA 3TS1A 5F1KA 2H12A 3PNSA 4R8MA 2G1JA 1ADYA 3QYAA 2UXDB 1R9MA 1SOWA 2P9TA 2JIZA 4QKQA 5AESA 3CF0A 3FUXA 1MNQA 3IP3A 4R1TA 4US1R 3TJMA 2ZSDA 2HTEA 3HXLA 3MT7A 4C87A 2C7VA 4OSOA 3BGSA 4O5OA 4WW0A 1UJBA 3ROQA 2JAUA 3C5HA 2WWVD 4M9CA 2C7RA 2A5YB 1E8JA 2DWQA 1ZUNB 3U7JA 1LGYA 2Q3JA 4FX5A 2J41A 1R8SA 3R5TA 3TOVA 1F2UA 2PSJA 4L9SA 3U0VA 1L9KA 3UATA 5DASA 4RO0A 4D0GA 2G71A 3EJ6A 5IJZA 1R64A 4BX2A 4NCBA 2ERXA 4MV3A 4U2KA 4Y2YA 3KCNA 3VQTA 5JTTA 4Z53A 3TSZA 3DD1A 3TW4A 1WLSA 3ITEA 3ETJA 4P33A 4UQLA 4PFKA 1TZJA 1YZKA 2DFDA 2LTAA 1SBIA 2X2EA 3OT4A 3Q15C 3ZUGA 1D6NA 4WLNA 1WZIA 4REOA 1E1YA 2J4CA 1Z17A 1ZVQA 1TC1A 3PQDA 4NYIR 1RQGA 2H29A 4XVRA 1U7WA 3QU9A 5H02A 1I1QB 1UPCA 2D0OB 4X7MA 3DAYA 3Q8XB 3NEYA 3LD9A 2CNWA 4IJ6A 1Z0IA 5KOJA 3QKRA 2YY7A 3KVRA 4G5OA 2XQKA 2R65A 2CVHA 1B42A 4HS9A 3VSEA 3ILXA 1T9GS 1JQ5A 2ODTX 1F0NA 3IHLA 1ISSA 1QZ3A 1U9YA 1YJ8A 2DSTA 2QJWA 2XMZA 2ZE5A 4GYWA 1KORA 4PBSA 2SCUA 1MVNA 1HT1E 2ZXFA 4YGXB 1PJSA 4MA5A 4EUFA 1S8NA 1V9LA 2A0UA 2C6AA 1JBQA 1BQEA 2WSBA 3HJCA 2Z3ZA 5LSAA 4YCCA 3HAXC 1RM0A 2H4WA 4FYIA 5DLYA 1I2MA 1M1NA 2GLTA 1DKLA 5J4HA 2GPAA 1PKEA 3B89A 1T2EA 3U48A 3ZY4A 1WQ4A 4RE6A 3OUTA 3ZKWA 2I6UA 4A16A 4WV3A 3HKBB 2F3UA 2QJFA 3RR2A 3MS4A 4W7HA 3C85A 3O1HB 1VB3A 4BEBA 1EIZA 2P2GA 3FIUA 4GKVA 4R5MA 3W05A 7AT1A 3Q0EA 2X0DA 3IO5A 4ZT7A 2A1UA 4QU9A 4CG2A 2FB9A 4JAGA 4GBED 4GEKA 5CLFA 2WJVA 3QBJA 4UNRA 4JKIA 4XA8A 3VU3A 2PNFA 4EY5A 1KMQA 1PS0A 2Y92A 4CDRA 2R2AA 5CJPA 3MINB 5JH7B 3BMQB 4PICA 3CVOA 2ONCA 4ETIA 1XVUA 3PQ4A 4TUYF 3AU9A 4Q12A 2UKDA 4CF7A 1EK0A 4H9GA 1XXHB 3HSKA 4Z99A 2WKQA 1QQTA 4UQOA 5FOUA 5SZHB 2BE5D 5HRAA 2OCPA 4A3DL 2FNAA 1RDVA 1NVXQ 3INGA 2NO0A 2P7IA 2UZAA 1BFUA 1VPLA 2ZUCA 3JPYA 1VL5A 4N12A 4ZOCA 2PL3A 2YOFA 3DT9A 1DC4A 4KAXA 4ZOLA 1ZJWA 2ORVA 4EH1A 1ZVJA 2TECE 3I45A 3S16L 5MN5A 3LUPA 3OKCA 1SMKA 3EEIA 4F1JA 1I4WA 3AVYA 1C1XA 2J3JA 2X9LA 5EJ2A 4CR8A 3A2MA 3N28A 1UKBA 5FLKA 3HL0A 2D1YA 3RFVA 1OTHA 3H3XA 5C5CA 5C1BA 1TJ4A 4UHBA 1K6JA 3R0JA 2HMSA 4FVTA 1GVNB 4U7HA 1NVTA 2AVNA 2IHYA 1CBUA 3AEZA 3KUCA 2AFIE 1HL3A 1ZQ9A 1D2EA 1U0FA 5FRDA 3RBZA 2QLBA 4PYKA 3HGQA 4Q1DA 2C2HA 5MFZA 1B6GA 2GK3A 2A88A 3B60A 1W4ZA 3TKLA 4AJLA 1UK7A 5MN6A 5HZKA 4RGQA 3EVNA 3E1SA 1U28A 3G2JA 1C9JA 1I7NA 1QIJA 4IMRA 3AUTA 1U90A 4LZWA 4UHHA 1OFUA 4BFVA 4WE3A 3PA6A 5GVSA 1KYVA 3SR4A 4MQBA 1O4WA 1RLMA 3NFYA 4MUNA 3TX6A 3AESA 4C2UA 1X1CA 3MRSA 3LX6A 3DZDA 5IYBL 2OO3A 4XM0A 4O2AB 5F4BA 5L45A 1Q1GA 4QFCA 1H8HD 4MR8B 1ZNXA 3B78A 3CNOA 1TA0A 3M3HA 1KO1A 4ZJYA 4YUVA 2FMUA 3WGNA 2AFIA 1USIA 3REQB 5EQJB 1RWBA 1DG3A 4TLLB 1U3TA 3UFXB 4HVTA 5CVVA 3KAPA 1CFZA 3RV3A 1Y5MA 2QMUA 3UYLA 2D5AA 4QJBA 1VTKA 3AR4A 2NVTL 4BLWA 4X6XA 2IPOA 5G4KA 1KFBB 4G5SA 5HG0A 1E5LA 2FSVC 2QPLA 3DUFA 5L3RA 3TFWA 5L7WA 1U4SA 2JCYA 3WQQA 5BVHB 1NUAA 4EG7A 1NVWQ 1ZMRA 2WAAA 3GTKL 1ZFNA 3CS3A 4IY1A 1U9IC 4TLMB 2XTAA 3RDPA 4TV8B 4Z9YA 3S3TA 4C0AC 1S1MA 2A6ED 1TU4A 3CURA 2GJ9A 1IIBA 3AIIA 4NBRA 5LP6B 5GTDA 1QRAA 4YONB 5JNVA 1UKCA 3CW8X 2WVAA 1PZMA 4OVKA 1T6YA 4XB6B 1RQPA 5GIPE 1U3FA 1PTKA 4RORA 1H4VB 3W2GA 4BO3A 5T5QA 4BMSA 1JDBC 3RZTA 5IFLA 4Q05A 5B6JA 5FWAA 3DVLA 4URUR 1HYHA 5BXQC 1JI0A 1J5XA 1R12A 1Q84A 3G8YA 1N6KA 1PW5A 2GYYA 2VPYA 4RFVA 2WEKA 2GDJA 4H6PA 3SZRA 3ZW7A 4YJFA 4TTQA 3R5SA 1LDBA 1FB5A 1HQKA 3BSSA 3Q6NA 2JI1A 5IAEA 2NSLA 3B1VA 3D7LA 5CM9C 5CVDA 5KCMA 5AVVA 1GNSA 1UKVY 4OSEA 3WJ1A 2X1HA 3C74A 5JQWA 1U0OC 4CEHB 3GLSA 5ERGB 4ILEA 3VH3A 2FCAA 5DTRA 4EJSB 4EX7A 2QBYB 1XK6A 2FF7A 3QLUA 2V6JA 4A8JA 1NW7A 2GEUA 3GQBB 4Z0HO 4DCPA 2EW8A 2ZXEA 2PG3A 3FAZA 2FRDC 3M4NA 4E2WA 4EG1A 2C3PA 2GLUA 3K8YA 2H51A 4L4RA 1A95A 2G7ZA 2IFTA 1N0UA 2ZIFA 5AUPB 1YTUA 3JQ7B 1NVMB 1N36B 3QOFA 1K8YB 3BFJA 1ZWKA 3SQNA 2RI0A 3UK0A 3VZCA 4YV1A 3CH4B 2BM0A 2QT9A 3P32A 3GJQA 3PB3A 3V8EA 1VSUA 2VQ6A 1VL8A 3ADKA 1JG1A 1BGVA 4TLBA 1P5FA 1QRTA 2GCPA 1XRPA 1FLDA 3PZBA 4TWJA 3LI2A 2IX3A 1KDRA 2GNAA 2GEBA 2D59A 3ND6A 5FADA 1THGA 4KN9S 2HIGA 3WLHA 2XCUA 1JIJA 1E79D 1P74A 1PU2A 1S89A 1ZM3A 2VDUE 3EY4A 3GN2A 4DMKA 1AMNA 3Q7QA 2ZR9A 3QUBA 2R6FA 5B7QA 1N1GA 4LFBB 3GDWA 2YJ6A 3GUZA 3F90A 1A96A 4H18A 3NEAA 4OHRA 3TUZC 3OZSA 2ORYA 2X7XA 4MLDA 4ROTA 1TU0A 1UZAA 3GPDG 4GXTA 1NZDA 3LC1O 2YYYA 2P2ZA 4A92A 1ZUNA 4EYQA 4TTJA 3IVAA 3Q3IA 1RJWA 1UDAA 5JNTA 1X7XA 3AEYA 4GGMX 5NLLA 1JE0A 2VYVD 3QKSA 3STWA 1YZHA 3G5TA 1F8FA 5HBGA 2J33A 1V48A 1FSFA 3ROGA 2O0LA 5C5DA 4XQCA 2P67A 5K8VA 5FP0A 3QFHA 1XU9A 1ODFA 2CC2A 3LGAA 1V1RB 2OORC 2L17A 1TUBB 4MWBA 3TSCA 2KPOA 4DS3A 4KXYA 1NAIA 2I1QA 2X6TA 3GRAA 3FRHA 4E3WA 1TF7A 1W36D 3CWQA 1IAVA 3F71A 2WZBA 2WQ6A 5AOVA 3O8OA 1FXSA 2JBAA 4WNYA 1KJ9A 1X19A 4Q9IA 4DRXA 1CRQA 1VKRA 2JH9A 2QUZA 3K6RA 4WH0A 3EWIA 4MR9B 3GLFA 3KYCA 4NMLA 3BH0A 1CJBA 3A6PC 3HRHA 3VHQA 2JA2A 3O8RA 1YB6A 4IWXA 4WEQA 5ESRA 4AO7A 4OXQA 3ZXYA 4WCFC 3RVBA 2AD1A 4ROSA 5C52B 4BV8A 3I6BA 3K1ZA 4QQ8A 1Z7BA 2P1RA 5I9BA 3H4IA 2PBFA 2ZK7A 1E92A 3ZH9B 2ZI5A 4C0LA 2CE2X 4J6EA 2V6FA 1A7AA 3D6UA 4RTSA 3L8YA 2Q45A 4W9NA 3SIXA 1H1DA 3I6YA 4B81A 3HO6A 4BCDA 1NM5C 3BWXA 4PLYA 2HMVA 3CRVA 4ZRDA 3V3KA 1TLTA 2FWJA 2R6JA 1KSHA 3OOSA 3C41J 4WOKA 1R5NA 1NVKA 4JP1A 1U2SA 2HLDD 2J0UB 3AERB 3U4DA 2UXCB 3ABOB 3P4XA 1IY0A 1LSOA 1YQQA 2R00C 4IHJF 3PC7A 4N6OA 4FEEA 5DBGA 3HCEA 2OVFA 3I2FA 3L6RA 4Y9DA 2QN1A 1XDSA 2W2NA 3QNWA 5EZ6B 3IOCA 2Q1SA 3T7KA 3UV7A 3W1VA