1SMUA

Crystal structure of cp rd l41a mutant in reduced state 1 (drop-reduced)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPACGVGKDQFEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title The unique hydrogen bonded water in the reduced form of Clostridium pasteurianum rubredoxin and its possible role in electron transfer
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1smuA00
1R0HA 1ZRPA 1RYTA 2KKDA 1YUZA 1R0GA 2RDVA 1E8JA 4AR5A 4POGA 3RZTA 1B2JA 1IRNA 1BRFA 2LCQA 3PZAA 1R0FA 4AR6A 4AR4A 4RXNA 1LKMA 4ME3A 1B13A 8RXNA 3KYXA 1BQ9A 2QL0A 2VL6A 1BFYA 1DVBA 4AR3A 1DX8A 1R0IA 1T9OA 1C09A 2M4YA 1RB9A 2PVEA 1IROA 2HR5A 3PWFA 1CAAA 1JYBA 2PVXA 1QYBA 2K2DA 1B2OA 3KYVA 2DSXA 5RXNA 1LKOA 7RXNA 1VCXA 1NNQA 4YWMA 6RXNA 1RWDA 1YK4A 1SMWA 2MS3A 4K9FA 1YK5A 1FHMA 4YWLA 1YUXA 1CADA 1SMMA 1S30A 3RZ6A 3MPSA 1IU5A 3QVDA 1QCVA 5AI2A 1H7VA 2KN9A 2V3BB 1LKPA 1SMUA 4TPUA 5IY0A 1LTLA 2GMGA 2PYAA 3A44A 3RYGA 1FHHA 1R0JA 1BQ8A 1B71A 1T9QA 4POFA 3KYUA 3SS2A 1YV1A 3KYYA 1IU6A 1S2ZA 1RDVA 5AI3A 1RDGA 3KYWA 1BE7A 1T9PA 1S24A
chains in the Genus database with same CATH superfamily
1R0HA 1ZRPA 1RYTA 2JI3A 2Z3QB 3GTOL 1YUZA 1R0GA 1PFYA 5GADc 2RDVA 3WWLA 1NXEA 1Z92B 5K2ME 3RZTA 2LCQA 2ZIXA 3J7Y1 3LWQB 4UY81 4WFN1 1B13A 3LPEB 3GTML 5EINC 1OWCA 4X6AL 3GTPL 1DVBA 2EY4E 5M3ML 3GTJL 1T9OA 3LWOB 2PVEA 2HR5A 1CAAA 2H12A 1JYBA 1QYBA 3HJWB 4BBSL 1TWCL 3FDJA 2B5ID 1B2OA 2R7ZL 1LKOA 2E2IL 4YWMA 1YK4A 3I4NL 4LHLA 5C44L 4ZN3B 3PKJA 1I3QL 4QIWP 4JAEA 4K9FA 1YUXA 4E6YA 2BE5D 5MF6A 2CKAA 1TWGL 3VPBE 2C6BA 4XGHA 5MFPA 3P2AA 1IU5A 2KN9A 3M4OL 1LKPA 4TPUA 5IY0A 3K7AL 2GMGA 3A44A 5H1Sc 3HOUL 2JA8L 5M5WL 4A3DL 5DM61 2PPTA 3PO3L 1OWBA 3LWPB 4C2M1 3JR7A 5AI3A 4AHXA 5IP7L 3LNLA 3S1NL 4AI2A 4A3EL 2KKDA 2WAQP 3MQKB 5JVG1 3PO2L 5DM71 2ERSA 3LWVB 1VZGA 4AR4A 3PIP1 5M5YL 2J9UB 3KYXA 3B08B 2QL0A 4AR3A 1DX8A 2JA5L 4Y7NL 2M4YA 2APOB 2ERJA 5MGNA 3RZOL 3S14L 1F4LA 2PVXA 3H0GL 1PZXA 3PL5A 3KYVA 2Y0SP 3H9BA 3FKIL 7RXNA 3MSUA 3GTGL 4JAGA 3HOWL 4C3IL 3PKIA 1FHMA 4ZN1B 3S2HL 4YWLA 4B8CD 1TWHL 2RFKB 3M3YL 3S2DL 1SMMA 1P7PA 5M5XL 2A69D 1S30A 3RZ6A 4A3CL 3QVDA 2VUML 5AI2A 3HOZL 5FJ8L 4A3BL 1PFUA 3LWRB 1ODHA 4AI0A 3RYGA 2XJSA 3H3VM 1BQ8A 5EIOC 1B71A 4LHNA 1YV1A 3HOYL 4XXBB 5FLML 1IW7D 4AHZA 1RDGA 4AI1A 4BBRL 2A6ED 5MLC3 2NVTL 3H97A 1PFWA 2M6PA 3HKZP 1E8JA 2V0FA 5IYBL 3GTKL 2JI2A 4AR5A 4POGA 2PSMC 1IRNA 2XJVA 2CR8A 2WB1P 4AR6A 4ME3A 4AHWA 1Y1WL 1SFOL 2PMZP 1BFYA 4A3GL 3HAXC 1TWFL 1QQTA 5MFZA 2YU9L 3WWNB 1IROA 4Y52L 3PWFA 4C3HL 4BY1L 2JA7L 1NXGA 2K2DA 2V0EA 2M6OA 2B63L 5C4JL 5RXNA 6RXNA 3S17L 3H9CA 2JA6L 1WCML 1WJVA 3CQZL 1SMWA 1K83L 4A3FL 5JVH1 1YK5A 4U671 5C4XL 4A3LL 4AI3A 2XJPA 2XJUA 2M4VA 4V196 2R92L 2V3BB 1SMUA 2JI1A 2NVYL 2PYAA 3I4ML 1FHHA 1R0JA 3PIO1 1T9QA 3HJYB 4POFA 3KYYA 5C3EL 2XJRA 1RDVA 1RYQA 1Y1VL 3HOXL 3HOVL 3KYWA 1BE7A 2XJTA 3K35A 1S24A 4BXXL 1I50L 2NVXL 1B2JA 1BRFA 3PZAA 1R0FA 2R93L 4RXNA 1LKMA 2L0ZA 8RXNA 1BQ9A 5IP9L 2VL6A 1VZIA 2O5JD 1R0IA 4A3KL 2A68D 1C09A 1RB9A 5GAHc 4TVMA 4G6BA 3ZG6A 4JAFA 5M3FL 2C6AA 2A6HD 2NYDA 1TWAL 4C3JL 2E2JL 5IYDL 2DSXA 2E2HL 2HVYC 1VCXA 1NNQA 1RWDA 3J7Z1 3S15L 5IYCL 1I6HL 2AYJA 4BY7L 2MS3A 1VZHA 4AHYA 2XJQA 4A3JL 1R9TL 3P8BA 5GAGc 3GTLL 1CADA 3S1ML 3MPSA 1QCVA 1H7VA 4A93L 4A3IL 5AN9H 5GAEc 2NVQL 3H99A 1LTLA 1PFVA 3IU3I 3S1QL 2AUSB 3NFPI 2AQCA 2Z3RB 3S16L 4AYBP 2CKCA 3KYUA 3SS2A 4A3ML 1IU6A 3RZDL 1S2ZA 3GTQL 3S1RL 4GS7D 3QQCE 3B0AB 1T9PA 4JADA
chains in the Genus database with same CATH topology
1R0HA 1ZRPA 5MLC3 1RYTA 2JI3A 4AI2A 2KKDA 2Z3QB 1YUZA 5JVG1 2M6PA 1R0GA 5DM71 2ERSA 2RDVA 5GADc 1E8JA 2V0FA 3WWLA 1NXEA 2JI2A 4AR5A 4POGA 1Z92B 2PSMC 1B2JA 1IRNA 5K2ME 3RZTA 1BRFA 2XJVA 2LCQA 2ZIXA 3J7Y1 2CR8A 3PZAA 1R0FA 4UY81 1VZGA 4AR6A 4AR4A 4RXNA 3PIP1 1LKMA 4ME3A 4WFN1 2L0ZA 1B13A 4AHWA 3LPEB 8RXNA 5EINC 2J9UB 1OWCA 3KYXA 3B08B 1BQ9A 2QL0A 2VL6A 1VZIA 1BFYA 1DVBA 4AR3A 2O5JD 1DX8A 1R0IA 1T9OA 5MFZA 2A68D 1C09A 2M4YA 1RB9A 2PVEA 2ERJA 5GAHc 5MGNA 3WWNB 1IROA 4TVMA 2HR5A 3PWFA 1CAAA 4G6BA 3ZG6A 2H12A 1JYBA 2PVXA 4JAFA 1QYBA 1NXGA 2K2DA 2C6AA 2A6HD 4AI1A 2B5ID 2NYDA 2V0EA 2M6OA 1B2OA 3KYVA 2DSXA 5RXNA 1LKOA 7RXNA 1VCXA 1NNQA 4YWMA 6RXNA 1RWDA 1YK4A 3MSUA 3J7Z1 4JAGA 4LHLA 1WJVA 4ZN3B 1SMWA 3PKJA 4JAEA 2AYJA 3PKIA 2MS3A 1VZHA 4K9FA 4AHYA 1YK5A 5JVH1 2XJQA 1FHMA 4ZN1B 4YWLA 1YUXA 4E6YA 4U671 2BE5D 5MF6A 3P8BA 2CKAA 4B8CD 4AI3A 5GAGc 3VPBE 1CADA 2XJPA 1SMMA 2C6BA 2XJUA 4XGHA 5MFPA 2M4VA 2A69D 3P2AA 1S30A 3RZ6A 4V196 3MPSA 1IU5A 3QVDA 1QCVA 5AI2A 1H7VA 2KN9A 2V3BB 1LKPA 5AN9H 1SMUA 5GAEc 4TPUA 5IY0A 1LTLA 1ODHA 2JI1A 2GMGA 2PYAA 4AI0A 3A44A 5H1Sc 3RYGA 3IU3I 1FHHA 1R0JA 2XJSA 3NFPI 3PIO1 2Z3RB 1BQ8A 5EIOC 1B71A 2CKCA 1T9QA 4LHNA 4POFA 3KYUA 3SS2A 1YV1A 3KYYA 5DM61 2PPTA 1IU6A 4XXBB 2XJRA 1S2ZA 1OWBA 1RDVA 1IW7D 4JADA 1RYQA 4AHZA 5AI3A 4GS7D 1RDGA 3KYWA 4AHXA 1BE7A 2XJTA 3B0AB 1T9PA 3QQCE 3K35A 3LNLA 2A6ED 1S24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0H A;  1ZRP A;  1RYT A;  2KKD A;  1YUZ A;  1R0G A;  2RDV A;  1E8J A;  4AR5 A;  4POG A;  3RZT A;  1B2J A;  1IRN A;  1BRF A;  2LCQ A;  3PZA A;  1R0F A;  4AR6 A;  4AR4 A;  4RXN A;  1LKM A;  4ME3 A;  1B13 A;  8RXN A;  3KYX A;  1BQ9 A;  2QL0 A;  2VL6 A;  1BFY A;  1DVB A;  4AR3 A;  1DX8 A;  1R0I A;  1T9O A;  1C09 A;  2M4Y A;  1RB9 A;  2PVE A;  1IRO A;  2HR5 A;  3PWF A;  1CAA A;  1JYB A;  2PVX A;  1QYB A;  2K2D A;  1B2O A;  3KYV A;  2DSX A;  5RXN A;  1LKO A;  7RXN A;  1VCX A;  1NNQ A;  4YWM A;  6RXN A;  1RWD A;  1YK4 A;  1SMW A;  2MS3 A;  4K9F A;  1YK5 A;  1FHM A;  4YWL A;  1YUX A;  1CAD A;  1SMM A;  1S30 A;  3RZ6 A;  3MPS A;  1IU5 A;  3QVD A;  1QCV A;  5AI2 A;  1H7V A;  2KN9 A;  2V3B B;  1LKP A;  1SMU A;  4TPU A;  5IY0 A;  1LTL A;  2GMG A;  2PYA A;  3A44 A;  3RYG A;  1FHH A;  1R0J A;  1BQ8 A;  1B71 A;  1T9Q A;  4POF A;  3KYU A;  3SS2 A;  1YV1 A;  3KYY A;  1IU6 A;  1S2Z A;  1RDV A;  5AI3 A;  1RDG A;  3KYW A;  1BE7 A;  1T9P A;  1S24 A; 
#chains in the Genus database with same CATH topology
 1R0H A;  1ZRP A;  1RYT A;  2JI3 A;  2Z3Q B;  3GTO L;  1YUZ A;  1R0G A;  1PFY A;  5GAD c;  2RDV A;  3WWL A;  1NXE A;  1Z92 B;  5K2M E;  3RZT A;  2LCQ A;  2ZIX A;  3J7Y 1;  3LWQ B;  4UY8 1;  4WFN 1;  1B13 A;  3LPE B;  3GTM L;  5EIN C;  1OWC A;  4X6A L;  3GTP L;  1DVB A;  2EY4 E;  5M3M L;  3GTJ L;  1T9O A;  3LWO B;  2PVE A;  2HR5 A;  1CAA A;  2H12 A;  1JYB A;  1QYB A;  3HJW B;  4BBS L;  1TWC L;  3FDJ A;  2B5I D;  1B2O A;  2R7Z L;  1LKO A;  2E2I L;  4YWM A;  1YK4 A;  3I4N L;  4LHL A;  5C44 L;  4ZN3 B;  3PKJ A;  1I3Q L;  4QIW P;  4JAE A;  4K9F A;  1YUX A;  4E6Y A;  2BE5 D;  5MF6 A;  2CKA A;  1TWG L;  3VPB E;  2C6B A;  4XGH A;  5MFP A;  3P2A A;  1IU5 A;  2KN9 A;  3M4O L;  1LKP A;  4TPU A;  5IY0 A;  3K7A L;  2GMG A;  3A44 A;  5H1S c;  3HOU L;  2JA8 L;  5M5W L;  4A3D L;  5DM6 1;  2PPT A;  3PO3 L;  1OWB A;  3LWP B;  4C2M 1;  3JR7 A;  5AI3 A;  4AHX A;  5IP7 L;  3LNL A;  3S1N L;  4AI2 A;  4A3E L;  2KKD A;  2WAQ P;  3MQK B;  5JVG 1;  3PO2 L;  5DM7 1;  2ERS A;  3LWV B;  1VZG A;  4AR4 A;  3PIP 1;  5M5Y L;  2J9U B;  3KYX A;  3B08 B;  2QL0 A;  4AR3 A;  1DX8 A;  2JA5 L;  4Y7N L;  2M4Y A;  2APO B;  2ERJ A;  5MGN A;  3RZO L;  3S14 L;  1F4L A;  2PVX A;  3H0G L;  1PZX A;  3PL5 A;  3KYV A;  2Y0S P;  3H9B A;  3FKI L;  7RXN A;  3MSU A;  3GTG L;  4JAG A;  3HOW L;  4C3I L;  3PKI A;  1FHM A;  4ZN1 B;  3S2H L;  4YWL A;  4B8C D;  1TWH L;  2RFK B;  3M3Y L;  3S2D L;  1SMM A;  1P7P A;  5M5X L;  2A69 D;  1S30 A;  3RZ6 A;  4A3C L;  3QVD A;  2VUM L;  5AI2 A;  3HOZ L;  5FJ8 L;  4A3B L;  1PFU A;  3LWR B;  1ODH A;  4AI0 A;  3RYG A;  2XJS A;  3H3V M;  1BQ8 A;  5EIO C;  1B71 A;  4LHN A;  1YV1 A;  3HOY L;  4XXB B;  5FLM L;  1IW7 D;  4AHZ A;  1RDG A;  4AI1 A;  4BBR L;  2A6E D;  5MLC 3;  2NVT L;  3H97 A;  1PFW A;  2M6P A;  3HKZ P;  1E8J A;  2V0F A;  5IYB L;  3GTK L;  2JI2 A;  4AR5 A;  4POG A;  2PSM C;  1IRN A;  2XJV A;  2CR8 A;  2WB1 P;  4AR6 A;  4ME3 A;  4AHW A;  1Y1W L;  1SFO L;  2PMZ P;  1BFY A;  4A3G L;  3HAX C;  1TWF L;  1QQT A;  5MFZ A;  2YU9 L;  3WWN B;  1IRO A;  4Y52 L;  3PWF A;  4C3H L;  4BY1 L;  2JA7 L;  1NXG A;  2K2D A;  2V0E A;  2M6O A;  2B63 L;  5C4J L;  5RXN A;  6RXN A;  3S17 L;  3H9C A;  2JA6 L;  1WCM L;  1WJV A;  3CQZ L;  1SMW A;  1K83 L;  4A3F L;  5JVH 1;  1YK5 A;  4U67 1;  5C4X L;  4A3L L;  4AI3 A;  2XJP A;  2XJU A;  2M4V A;  4V19 6;  2R92 L;  2V3B B;  1SMU A;  2JI1 A;  2NVY L;  2PYA A;  3I4M L;  1FHH A;  1R0J A;  3PIO 1;  1T9Q A;  3HJY B;  4POF A;  3KYY A;  5C3E L;  2XJR A;  1RDV A;  1RYQ A;  1Y1V L;  3HOX L;  3HOV L;  3KYW A;  1BE7 A;  2XJT A;  3K35 A;  1S24 A;  4BXX L;  1I50 L;  2NVX L;  1B2J A;  1BRF A;  3PZA A;  1R0F A;  2R93 L;  4RXN A;  1LKM A;  2L0Z A;  8RXN A;  1BQ9 A;  5IP9 L;  2VL6 A;  1VZI A;  2O5J D;  1R0I A;  4A3K L;  2A68 D;  1C09 A;  1RB9 A;  5GAH c;  4TVM A;  4G6B A;  3ZG6 A;  4JAF A;  5M3F L;  2C6A A;  2A6H D;  2NYD A;  1TWA L;  4C3J L;  2E2J L;  5IYD L;  2DSX A;  2E2H L;  2HVY C;  1VCX A;  1NNQ A;  1RWD A;  3J7Z 1;  3S15 L;  5IYC L;  1I6H L;  2AYJ A;  4BY7 L;  2MS3 A;  1VZH A;  4AHY A;  2XJQ A;  4A3J L;  1R9T L;  3P8B A;  5GAG c;  3GTL L;  1CAD A;  3S1M L;  3MPS A;  1QCV A;  1H7V A;  4A93 L;  4A3I L;  5AN9 H;  5GAE c;  2NVQ L;  3H99 A;  1LTL A;  1PFV A;  3IU3 I;  3S1Q L;  2AUS B;  3NFP I;  2AQC A;  2Z3R B;  3S16 L;  4AYB P;  2CKC A;  3KYU A;  3SS2 A;  4A3M L;  1IU6 A;  3RZD L;  1S2Z A;  3GTQ L;  3S1R L;  4GS7 D;  3QQC E;  3B0A B;  1T9P A;  4JAD A; 
#chains in the Genus database with same CATH homology
 1R0H A;  1ZRP A;  5MLC 3;  1RYT A;  2JI3 A;  4AI2 A;  2KKD A;  2Z3Q B;  1YUZ A;  5JVG 1;  2M6P A;  1R0G A;  5DM7 1;  2ERS A;  2RDV A;  5GAD c;  1E8J A;  2V0F A;  3WWL A;  1NXE A;  2JI2 A;  4AR5 A;  4POG A;  1Z92 B;  2PSM C;  1B2J A;  1IRN A;  5K2M E;  3RZT A;  1BRF A;  2XJV A;  2LCQ A;  2ZIX A;  3J7Y 1;  2CR8 A;  3PZA A;  1R0F A;  4UY8 1;  1VZG A;  4AR6 A;  4AR4 A;  4RXN A;  3PIP 1;  1LKM A;  4ME3 A;  4WFN 1;  2L0Z A;  1B13 A;  4AHW A;  3LPE B;  8RXN A;  5EIN C;  2J9U B;  1OWC A;  3KYX A;  3B08 B;  1BQ9 A;  2QL0 A;  2VL6 A;  1VZI A;  1BFY A;  1DVB A;  4AR3 A;  2O5J D;  1DX8 A;  1R0I A;  1T9O A;  5MFZ A;  2A68 D;  1C09 A;  2M4Y A;  1RB9 A;  2PVE A;  2ERJ A;  5GAH c;  5MGN A;  3WWN B;  1IRO A;  4TVM A;  2HR5 A;  3PWF A;  1CAA A;  4G6B A;  3ZG6 A;  2H12 A;  1JYB A;  2PVX A;  4JAF A;  1QYB A;  1NXG A;  2K2D A;  2C6A A;  2A6H D;  4AI1 A;  2B5I D;  2NYD A;  2V0E A;  2M6O A;  1B2O A;  3KYV A;  2DSX A;  5RXN A;  1LKO A;  7RXN A;  1VCX A;  1NNQ A;  4YWM A;  6RXN A;  1RWD A;  1YK4 A;  3MSU A;  3J7Z 1;  4JAG A;  4LHL A;  1WJV A;  4ZN3 B;  1SMW A;  3PKJ A;  4JAE A;  2AYJ A;  3PKI A;  2MS3 A;  1VZH A;  4K9F A;  4AHY A;  1YK5 A;  5JVH 1;  2XJQ A;  1FHM A;  4ZN1 B;  4YWL A;  1YUX A;  4E6Y A;  4U67 1;  2BE5 D;  5MF6 A;  3P8B A;  2CKA A;  4B8C D;  4AI3 A;  5GAG c;  3VPB E;  1CAD A;  2XJP A;  1SMM A;  2C6B A;  2XJU A;  4XGH A;  5MFP A;  2M4V A;  2A69 D;  3P2A A;  1S30 A;  3RZ6 A;  4V19 6;  3MPS A;  1IU5 A;  3QVD A;  1QCV A;  5AI2 A;  1H7V A;  2KN9 A;  2V3B B;  1LKP A;  5AN9 H;  1SMU A;  5GAE c;  4TPU A;  5IY0 A;  1LTL A;  1ODH A;  2JI1 A;  2GMG A;  2PYA A;  4AI0 A;  3A44 A;  5H1S c;  3RYG A;  3IU3 I;  1FHH A;  1R0J A;  2XJS A;  3NFP I;  3PIO 1;  2Z3R B;  1BQ8 A;  5EIO C;  1B71 A;  2CKC A;  1T9Q A;  4LHN A;  4POF A;  3KYU A;  3SS2 A;  1YV1 A;  3KYY A;  5DM6 1;  2PPT A;  1IU6 A;  4XXB B;  2XJR A;  1S2Z A;  1OWB A;  1RDV A;  1IW7 D;  4JAD A;  1RYQ A;  4AHZ A;  5AI3 A;  4GS7 D;  1RDG A;  3KYW A;  4AHX A;  1BE7 A;  2XJT A;  3B0A B;  1T9P A;  3QQC E;  3K35 A;  3LNL A;  2A6E D;  1S24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...