1SMUA

Crystal structure of cp rd l41a mutant in reduced state 1 (drop-reduced)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPACGVGKDQFEEVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title The unique hydrogen bonded water in the reduced form of Clostridium pasteurianum rubredoxin and its possible role in electron transfer
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1smuA00
2M4YA 2PVEA 2QL0A 1BE7A 1BRFA 7RXNA 1LKMA 1T9QA 1NNQA 3QVDA 1B2JA 1QCVA 8RXNA 1R0HA 1B71A 1SMUA 6RXNA 5IY0A 1R0JA 1SMMA 2LCQA 5AI3A 1CAAA 5AI2A 3KYWA 1E8JA 4K9FA 1BFYA 1BQ9A 1RB9A 2DSXA 1YK4A 1R0FA 3PZAA 1IROA 1RDVA 3KYYA 1JYBA 1YK5A 1DX8A 3KYXA 1BQ8A 1CADA 1B2OA 1LTLA 1SMWA 2GMGA 1IRNA 2MS3A 4POFA 1YV1A 5RXNA 1B13A 2V3BB 1S30A 3RZ6A 4POGA 2VL6A 1DVBA 1H7VA 1VCXA 4AR4A 1YUXA 1ZRPA 4YWLA 3PWFA 1T9OA 1FHHA 1RWDA 1C09A 4TPUA 2PVXA 3MPSA 1RDGA 3A44A 1R0IA 3RYGA 4AR6A 2KN9A 2RDVA 3RZTA 3KYUA 3KYVA 4ME3A 1LKOA 1R0GA 2K2DA 1IU6A 1LKPA 2HR5A 1RYTA 4AR3A 2KKDA 1FHMA 1S24A 1IU5A 4AR5A 1YUZA 4YWMA 2PYAA 1T9PA 4RXNA 3SS2A 1S2ZA 1QYBA
chains in the Genus database with same CATH superfamily
5M3ML 2PVEA 1BE7A 1Y1VL 5C44L 3PO2L 1TWHL 5M3FL 2WB1P 3H97A 2XJUA 3S2DL 1R0JA 4JAGA 2LCQA 1CAAA 5JVH1 5GAGc 5M5WL 3MSUA 3P8BA 4A93L 1E8JA 1RB9A 1R0FA 1TWFL 2XJPA 3GTML 2AYJA 1DX8A 5IYBL 3IU3I 1B2OA 4A3LL 1YV1A 2JA5L 2JA7L 1PFYA 2R92L 3M3YL 3HOWL 3PIP1 2VUML 4C3HL 1VCXA 1ODHA 3HOVL 4AYBP 3S17L 4TPUA 3S1NL 2PVXA 2L0ZA 3RYGA 2NYDA 2KN9A 2RDVA 2XJRA 3RZDL 2Y0SP 3KYUA 2R7ZL 4V196 5IYCL 4X6AL 3QQCE 1FHMA 3I4NL 2JA8L 3J7Z1 2C6AA 3LWVB 3CQZL 2O5JD 3PKJA 1S2ZA 1QYBA 2QL0A 4U671 1NNQA 4A3DL 2Z3RB 5IP9L 1QCVA 4BBSL 4XXBB 1VZIA 2A6HD 2J9UB 2XJTA 3S1ML 2XJSA 5H1Sc 3S1RL 1PFUA 2NVQL 1BFYA 2HVYC 3PZAA 2V0FA 1IROA 5C3EL 3S14L 3MQKB 1YK5A 1I3QL 3K35A 1BQ8A 2V0EA 1OWBA 2M6PA 3NFPI 3H99A 5M5XL 3GTJL 5MGNA 1IRNA 5GAHc 5RXNA 1B13A 2V3BB 4AI1A 3ZG6A 2A68D 2M4VA 3FKIL 2VL6A 1DVBA 4WFN1 5IYDL 1I6HL 2AUSB 5AN9H 1T9OA 3GTLL 1R0IA 5IP7L 1I50L 1SFOL 3KYVA 5JVG1 1R0GA 2APOB 2JI1A 2HR5A 5K2ME 2A6ED 3LWPB 4A3KL 2RFKB 3H9BA 2ERSA 5MFZA 2CR8A 1R9TL 1IU5A 4AR5A 3LPEB 2PYAA 4AHYA 4A3JL 4A3BL 2PMZP 3HOXL 1T9PA 4GS7D 2EY4E 3LWQB 3S15L 3SS2A 4AHWA 4C2M1 4JAEA 1BRFA 1LKMA 4A3GL 3GTKL 1TWAL 4LHLA 5EIOC 5MF6A 4A3IL 1B71A 2CKCA 1SMUA 4A3EL 2WAQP 3J7Y1 2M6OA 5IY0A 5C4XL 3VPBE 1WJVA 2B5ID 1Y1WL 3HAXC 5AI3A 3PKIA 1VZHA 5AI2A 3LWOB 3KYWA 2BE5D 4K9FA 4AI0A 5DM61 1YK4A 2ZIXA 2NVYL 3HOZL 4ZN1B 3GTPL 4Y52L 1RDVA 5M5YL 1JYBA 2AQCA 3S1QL 1PFVA 1PZXA 1CADA 2GMGA 5EINC 2MS3A 1K83L 2XJVA 3GTGL 1F4LA 3B0AB 1PFWA 2E2IL 3LNLA 3RZ6A 4POGA 1OWCA 1H7VA 1WCML 3S16L 1ZRPA 4YWLA 4JADA 1FHHA 3WWNB 4QIWP 4AR6A 3RZTA 3PO3L 4ME3A 1LKOA 3HKZP 2K2DA 3K7AL 4JAFA 4ZN3B 2R93L 1RYTA 3P2AA 3HOUL 1S24A 1YUZA 4YWMA 3RZOL 1TWCL 3H3VM 3GTQL 3GTOL 4RXNA 1VZGA 3LWRB 2M4YA 7RXNA 3HOYL 3B08B 5FLML 1T9QA 3QVDA 1TWGL 1B2JA 4A3ML 2Z3QB 4XGHA 4BBRL 3HJYB 8RXNA 1R0HA 2NVXL 1NXEA 2H12A 2JA6L 4A3CL 6RXNA 4Y7NL 1SMMA 3M4OL 1P7PA 4TVMA 3PIO1 1BQ9A 2DSXA 5MLC3 1IW7D 2XJQA 3KYYA 2NVTL 4BY7L 2PPTA 3KYXA 4A3FL 5C4JL 1LTLA 4AHZA 4UY81 1SMWA 2C6BA 4BXXL 2YU9L 4POFA 3I4ML 4AHXA 5MFPA 1S30A 3H0GL 1Z92B 2JI3A 5DM71 4BY1L 3PL5A 5GADc 2E2JL 5FJ8L 4AR4A 1YUXA 2B63L 4E6YA 3PWFA 3WWLA 3S2HL 1RWDA 1C09A 3MPSA 2PSMC 4G6BA 1RDGA 3A44A 2CKAA 5GAEc 1QQTA 2JI2A 4B8CD 2ERJA 1IU6A 1LKPA 4AI2A 4AR3A 3JR7A 4C3JL 2KKDA 1RYQA 4AI3A 1NXGA 2E2HL 3H9CA 3HJWB 2A69D 4C3IL 3FDJA 4LHNA
chains in the Genus database with same CATH topology
2M4YA 2PVEA 2QL0A 4JAEA 1BE7A 1BRFA 7RXNA 4U671 1LKMA 3B08B 1T9QA 1NNQA 3QVDA 4LHLA 5EIOC 1B2JA 2Z3RB 2Z3QB 5MF6A 1QCVA 4XGHA 8RXNA 1R0HA 1NXEA 1B71A 2CKCA 2H12A 1SMUA 3J7Y1 2M6OA 6RXNA 5IY0A 2XJUA 3VPBE 4XXBB 1R0JA 4JAGA 1SMMA 1WJVA 2B5ID 1VZIA 2A6HD 2J9UB 2LCQA 5AI3A 1CAAA 5JVH1 3PKIA 2XJTA 1VZHA 5AI2A 5GAGc 4TVMA 3PIO1 2XJSA 3KYWA 4AHWA 2BE5D 3MSUA 3P8BA 1E8JA 5H1Sc 4K9FA 4AI0A 1BQ9A 1RB9A 5DM61 1BFYA 2DSXA 5MLC3 1YK4A 2ZIXA 1R0FA 4ZN1B 3PZAA 2XJPA 2V0FA 1IW7D 1IROA 1RDVA 2XJQA 3KYYA 1JYBA 1YK5A 2AYJA 1DX8A 3K35A 2PPTA 3IU3I 1BQ8A 3KYXA 2V0EA 1CADA 1OWBA 1B2OA 1LTLA 2M6PA 3NFPI 4AHZA 4UY81 1SMWA 2C6BA 2GMGA 5EINC 1IRNA 5GAHc 5MGNA 2MS3A 4POFA 2XJVA 1YV1A 5RXNA 3B0AB 1B13A 4AHXA 2V3BB 5MFPA 3LNLA 4AI1A 1S30A 3ZG6A 3RZ6A 1Z92B 2A68D 2M4VA 2JI3A 5DM71 3PIP1 4POGA 1OWCA 1DVBA 2VL6A 5GADc 4WFN1 1H7VA 1VCXA 1ODHA 4AR4A 1YUXA 1ZRPA 4YWLA 4E6YA 3PWFA 4JADA 5AN9H 1T9OA 3WWLA 1FHHA 3WWNB 1RWDA 1C09A 4TPUA 2PVXA 3MPSA 2PSMC 2L0ZA 4G6BA 1RDGA 3A44A 1R0IA 3RYGA 2NYDA 2KN9A 2RDVA 2CKAA 4AR6A 2XJRA 3RZTA 5GAEc 3KYVA 3KYUA 4ME3A 2JI2A 4B8CD 1LKOA 2ERJA 4V196 5JVG1 1R0GA 2K2DA 4JAFA 2JI1A 1IU6A 1LKPA 2HR5A 4AI2A 2A6ED 4ZN3B 1RYTA 4AR3A 5K2ME 3P2AA 3QQCE 2KKDA 1RYQA 2ERSA 5MFZA 1FHMA 4AI3A 1NXGA 2CR8A 1S24A 1IU5A 4AR5A 1YUZA 3LPEB 4YWMA 3J7Z1 2PYAA 4AHYA 2C6AA 2A69D 1T9PA 4GS7D 4RXNA 2O5JD 1VZGA 3SS2A 3PKJA 1S2ZA 1QYBA 4LHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4Y A;  2PVE A;  2QL0 A;  1BE7 A;  1BRF A;  7RXN A;  1LKM A;  1T9Q A;  1NNQ A;  3QVD A;  1B2J A;  1QCV A;  8RXN A;  1R0H A;  1B71 A;  1SMU A;  6RXN A;  5IY0 A;  1R0J A;  1SMM A;  2LCQ A;  5AI3 A;  1CAA A;  5AI2 A;  3KYW A;  1E8J A;  4K9F A;  1BFY A;  1BQ9 A;  1RB9 A;  2DSX A;  1YK4 A;  1R0F A;  3PZA A;  1IRO A;  1RDV A;  3KYY A;  1JYB A;  1YK5 A;  1DX8 A;  3KYX A;  1BQ8 A;  1CAD A;  1B2O A;  1LTL A;  1SMW A;  2GMG A;  1IRN A;  2MS3 A;  4POF A;  1YV1 A;  5RXN A;  1B13 A;  2V3B B;  1S30 A;  3RZ6 A;  4POG A;  2VL6 A;  1DVB A;  1H7V A;  1VCX A;  4AR4 A;  1YUX A;  1ZRP A;  4YWL A;  3PWF A;  1T9O A;  1FHH A;  1RWD A;  1C09 A;  4TPU A;  2PVX A;  3MPS A;  1RDG A;  3A44 A;  1R0I A;  3RYG A;  4AR6 A;  2KN9 A;  2RDV A;  3RZT A;  3KYU A;  3KYV A;  4ME3 A;  1LKO A;  1R0G A;  2K2D A;  1IU6 A;  1LKP A;  2HR5 A;  1RYT A;  4AR3 A;  2KKD A;  1FHM A;  1S24 A;  1IU5 A;  4AR5 A;  1YUZ A;  4YWM A;  2PYA A;  1T9P A;  4RXN A;  3SS2 A;  1S2Z A;  1QYB A; 
#chains in the Genus database with same CATH topology
 5M3M L;  2PVE A;  1BE7 A;  1Y1V L;  5C44 L;  3PO2 L;  1TWH L;  5M3F L;  2WB1 P;  3H97 A;  2XJU A;  3S2D L;  1R0J A;  4JAG A;  2LCQ A;  1CAA A;  5JVH 1;  5GAG c;  5M5W L;  3MSU A;  3P8B A;  4A93 L;  1E8J A;  1RB9 A;  1R0F A;  1TWF L;  2XJP A;  3GTM L;  2AYJ A;  1DX8 A;  5IYB L;  3IU3 I;  1B2O A;  4A3L L;  1YV1 A;  2JA5 L;  2JA7 L;  1PFY A;  2R92 L;  3M3Y L;  3HOW L;  3PIP 1;  2VUM L;  4C3H L;  1VCX A;  1ODH A;  3HOV L;  4AYB P;  3S17 L;  4TPU A;  3S1N L;  2PVX A;  2L0Z A;  3RYG A;  2NYD A;  2KN9 A;  2RDV A;  2XJR A;  3RZD L;  2Y0S P;  3KYU A;  2R7Z L;  4V19 6;  5IYC L;  4X6A L;  3QQC E;  1FHM A;  3I4N L;  2JA8 L;  3J7Z 1;  2C6A A;  3LWV B;  3CQZ L;  2O5J D;  3PKJ A;  1S2Z A;  1QYB A;  2QL0 A;  4U67 1;  1NNQ A;  4A3D L;  2Z3R B;  5IP9 L;  1QCV A;  4BBS L;  4XXB B;  1VZI A;  2A6H D;  2J9U B;  2XJT A;  3S1M L;  2XJS A;  5H1S c;  3S1R L;  1PFU A;  2NVQ L;  1BFY A;  2HVY C;  3PZA A;  2V0F A;  1IRO A;  5C3E L;  3S14 L;  3MQK B;  1YK5 A;  1I3Q L;  3K35 A;  1BQ8 A;  2V0E A;  1OWB A;  2M6P A;  3NFP I;  3H99 A;  5M5X L;  3GTJ L;  5MGN A;  1IRN A;  5GAH c;  5RXN A;  1B13 A;  2V3B B;  4AI1 A;  3ZG6 A;  2A68 D;  2M4V A;  3FKI L;  2VL6 A;  1DVB A;  4WFN 1;  5IYD L;  1I6H L;  2AUS B;  5AN9 H;  1T9O A;  3GTL L;  1R0I A;  5IP7 L;  1I50 L;  1SFO L;  3KYV A;  5JVG 1;  1R0G A;  2APO B;  2JI1 A;  2HR5 A;  5K2M E;  2A6E D;  3LWP B;  4A3K L;  2RFK B;  3H9B A;  2ERS A;  5MFZ A;  2CR8 A;  1R9T L;  1IU5 A;  4AR5 A;  3LPE B;  2PYA A;  4AHY A;  4A3J L;  4A3B L;  2PMZ P;  3HOX L;  1T9P A;  4GS7 D;  2EY4 E;  3LWQ B;  3S15 L;  3SS2 A;  4AHW A;  4C2M 1;  4JAE A;  1BRF A;  1LKM A;  4A3G L;  3GTK L;  1TWA L;  4LHL A;  5EIO C;  5MF6 A;  4A3I L;  1B71 A;  2CKC A;  1SMU A;  4A3E L;  2WAQ P;  3J7Y 1;  2M6O A;  5IY0 A;  5C4X L;  3VPB E;  1WJV A;  2B5I D;  1Y1W L;  3HAX C;  5AI3 A;  3PKI A;  1VZH A;  5AI2 A;  3LWO B;  3KYW A;  2BE5 D;  4K9F A;  4AI0 A;  5DM6 1;  1YK4 A;  2ZIX A;  2NVY L;  3HOZ L;  4ZN1 B;  3GTP L;  4Y52 L;  1RDV A;  5M5Y L;  1JYB A;  2AQC A;  3S1Q L;  1PFV A;  1PZX A;  1CAD A;  2GMG A;  5EIN C;  2MS3 A;  1K83 L;  2XJV A;  3GTG L;  1F4L A;  3B0A B;  1PFW A;  2E2I L;  3LNL A;  3RZ6 A;  4POG A;  1OWC A;  1H7V A;  1WCM L;  3S16 L;  1ZRP A;  4YWL A;  4JAD A;  1FHH A;  3WWN B;  4QIW P;  4AR6 A;  3RZT A;  3PO3 L;  4ME3 A;  1LKO A;  3HKZ P;  2K2D A;  3K7A L;  4JAF A;  4ZN3 B;  2R93 L;  1RYT A;  3P2A A;  3HOU L;  1S24 A;  1YUZ A;  4YWM A;  3RZO L;  1TWC L;  3H3V M;  3GTQ L;  3GTO L;  4RXN A;  1VZG A;  3LWR B;  2M4Y A;  7RXN A;  3HOY L;  3B08 B;  5FLM L;  1T9Q A;  3QVD A;  1TWG L;  1B2J A;  4A3M L;  2Z3Q B;  4XGH A;  4BBR L;  3HJY B;  8RXN A;  1R0H A;  2NVX L;  1NXE A;  2H12 A;  2JA6 L;  4A3C L;  6RXN A;  4Y7N L;  1SMM A;  3M4O L;  1P7P A;  4TVM A;  3PIO 1;  1BQ9 A;  2DSX A;  5MLC 3;  1IW7 D;  2XJQ A;  3KYY A;  2NVT L;  4BY7 L;  2PPT A;  3KYX A;  4A3F L;  5C4J L;  1LTL A;  4AHZ A;  4UY8 1;  1SMW A;  2C6B A;  4BXX L;  2YU9 L;  4POF A;  3I4M L;  4AHX A;  5MFP A;  1S30 A;  3H0G L;  1Z92 B;  2JI3 A;  5DM7 1;  4BY1 L;  3PL5 A;  5GAD c;  2E2J L;  5FJ8 L;  4AR4 A;  1YUX A;  2B63 L;  4E6Y A;  3PWF A;  3WWL A;  3S2H L;  1RWD A;  1C09 A;  3MPS A;  2PSM C;  4G6B A;  1RDG A;  3A44 A;  2CKA A;  5GAE c;  1QQT A;  2JI2 A;  4B8C D;  2ERJ A;  1IU6 A;  1LKP A;  4AI2 A;  4AR3 A;  3JR7 A;  4C3J L;  2KKD A;  1RYQ A;  4AI3 A;  1NXG A;  2E2H L;  3H9C A;  3HJW B;  2A69 D;  4C3I L;  3FDJ A;  4LHN A; 
#chains in the Genus database with same CATH homology
 2M4Y A;  2PVE A;  2QL0 A;  4JAE A;  1BE7 A;  1BRF A;  7RXN A;  4U67 1;  1LKM A;  3B08 B;  1T9Q A;  1NNQ A;  3QVD A;  4LHL A;  5EIO C;  1B2J A;  2Z3R B;  2Z3Q B;  5MF6 A;  1QCV A;  4XGH A;  8RXN A;  1R0H A;  1NXE A;  1B71 A;  2CKC A;  2H12 A;  1SMU A;  3J7Y 1;  2M6O A;  6RXN A;  5IY0 A;  2XJU A;  3VPB E;  4XXB B;  1R0J A;  4JAG A;  1SMM A;  1WJV A;  2B5I D;  1VZI A;  2A6H D;  2J9U B;  2LCQ A;  5AI3 A;  1CAA A;  5JVH 1;  3PKI A;  2XJT A;  1VZH A;  5AI2 A;  5GAG c;  4TVM A;  3PIO 1;  2XJS A;  3KYW A;  4AHW A;  2BE5 D;  3MSU A;  3P8B A;  1E8J A;  5H1S c;  4K9F A;  4AI0 A;  1BQ9 A;  1RB9 A;  5DM6 1;  1BFY A;  2DSX A;  5MLC 3;  1YK4 A;  2ZIX A;  1R0F A;  4ZN1 B;  3PZA A;  2XJP A;  2V0F A;  1IW7 D;  1IRO A;  1RDV A;  2XJQ A;  3KYY A;  1JYB A;  1YK5 A;  2AYJ A;  1DX8 A;  3K35 A;  2PPT A;  3IU3 I;  1BQ8 A;  3KYX A;  2V0E A;  1CAD A;  1OWB A;  1B2O A;  1LTL A;  2M6P A;  3NFP I;  4AHZ A;  4UY8 1;  1SMW A;  2C6B A;  2GMG A;  5EIN C;  1IRN A;  5GAH c;  5MGN A;  2MS3 A;  4POF A;  2XJV A;  1YV1 A;  5RXN A;  3B0A B;  1B13 A;  4AHX A;  2V3B B;  5MFP A;  3LNL A;  4AI1 A;  1S30 A;  3ZG6 A;  3RZ6 A;  1Z92 B;  2A68 D;  2M4V A;  2JI3 A;  5DM7 1;  3PIP 1;  4POG A;  1OWC A;  1DVB A;  2VL6 A;  5GAD c;  4WFN 1;  1H7V A;  1VCX A;  1ODH A;  4AR4 A;  1YUX A;  1ZRP A;  4YWL A;  4E6Y A;  3PWF A;  4JAD A;  5AN9 H;  1T9O A;  3WWL A;  1FHH A;  3WWN B;  1RWD A;  1C09 A;  4TPU A;  2PVX A;  3MPS A;  2PSM C;  2L0Z A;  4G6B A;  1RDG A;  3A44 A;  1R0I A;  3RYG A;  2NYD A;  2KN9 A;  2RDV A;  2CKA A;  4AR6 A;  2XJR A;  3RZT A;  5GAE c;  3KYV A;  3KYU A;  4ME3 A;  2JI2 A;  4B8C D;  1LKO A;  2ERJ A;  4V19 6;  5JVG 1;  1R0G A;  2K2D A;  4JAF A;  2JI1 A;  1IU6 A;  1LKP A;  2HR5 A;  4AI2 A;  2A6E D;  4ZN3 B;  1RYT A;  4AR3 A;  5K2M E;  3P2A A;  3QQC E;  2KKD A;  1RYQ A;  2ERS A;  5MFZ A;  1FHM A;  4AI3 A;  1NXG A;  2CR8 A;  1S24 A;  1IU5 A;  4AR5 A;  1YUZ A;  3LPE B;  4YWM A;  3J7Z 1;  2PYA A;  4AHY A;  2C6A A;  2A69 D;  1T9P A;  4GS7 D;  4RXN A;  2O5J D;  1VZG A;  3SS2 A;  3PKJ A;  1S2Z A;  1QYB A;  4LHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...