4AR6A

X-ray crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin at 295 k (in quartz capillary) to 0.92 angstroms resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Near-Atomic Resolution Neutron Crystallography on Perdeuterated Pyrococcus Furiosus Rubredoxin: Implication of Hydronium Ions and Protonation Equilibria and Hydronium Ions in Redox Changes
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ar6A00
4AR6A 2GMGA 4POFA 1R0IA 1RDVA 2LCQA 1YUXA 1YK4A 3KYXA 8RXNA 1BRFA 1T9QA 1RDGA 2K2DA 3KYVA 1R0FA 4AR3A 3RZ6A 1BFYA 1LKPA 1QCVA 3PWFA 6RXNA 3MPSA 1RB9A 1T9OA 1BQ9A 1S2ZA 1H7VA 7RXNA 4K9FA 2PVEA 3KYWA 4AR5A 1R0GA 5IY0A 1BE7A 4POGA 1B2OA 1QYBA 1VCXA 5RXNA 3SS2A 1YUZA 1B13A 1LKOA 1JYBA 1SMUA 1SMMA 5AI3A 4TPUA 4RXNA 1YV1A 1R0JA 3KYYA 3PZAA 1B71A 1C09A 1NNQA 1DVBA 1LTLA 2PYAA 2KKDA 4AR4A 3RYGA 4ME3A 1S30A 2VL6A 1ZRPA 1FHHA 2M4YA 1SMWA 3RZTA 2V3BB 2HR5A 4YWMA 1CADA 1RWDA 5AI2A 1R0HA 3A44A 2DSXA 2KN9A 1DX8A 3KYUA 3QVDA 1RYTA 2PVXA 1FHMA 1IROA 1T9PA 4YWLA 1S24A 1CAAA 2QL0A 2RDVA 2MS3A 1B2JA 1E8JA 1LKMA 1BQ8A 1YK5A 1IU6A 1IRNA 1IU5A
chains in the Genus database with same CATH superfamily
2APOB 4POFA 3GTML 3ZG6A 5IP7L 3S14L 4B8CD 2E2IL 1I3QL 3PIO1 1YK4A 3S1QL 5DM71 3LWPB 1SFOL 1QCVA 4UY81 4C3JL 1OWBA 3MSUA 5MFZA 2EY4E 1T9OA 2M6OA 4AR5A 1PFWA 5FJ8L 3LWVB 2JA8L 1Y1VL 2M4VA 2Z3RB 4JAGA 1SMUA 4TPUA 1YV1A 1R0JA 3KYYA 3PZAA 1C09A 3WWLA 5FLML 1PFYA 3HOWL 3HJWB 3GTJL 5H1Sc 1LTLA 2C6BA 2CKCA 3CQZL 2M6PA 2Y0SP 4QIWP 3FKIL 4XXBB 2E2JL 1VZHA 4A3IL 2HVYC 2PMZP 4X6AL 1K83L 4LHLA 1WCML 2XJQA 3RZOL 2R92L 1P7PA 1R0HA 2AYJA 3A44A 4A3LL 1DX8A 3K35A 2V0FA 3S2HL 1FHMA 1VZGA 2Z3QB 4A3FL 2QL0A 3HOXL 1TWHL 2MS3A 3PO2L 1E8JA 3MQKB 3S2DL 2ZIXA 1BQ8A 3S1ML 1IU5A 5GAHc 2ERSA 1R0IA 2J9UB 1RDVA 2AQCA 4XGHA 2YU9L 3B08B 3JR7A 5GADc 2K2DA 3KYVA 2NVXL 4AHZA 1R0FA 2JA5L 4A3GL 1BFYA 5M5YL 4Y52L 2XJUA 3GTPL 3PWFA 5MGNA 1BQ9A 3IU3I 2NVTL 1F4LA 1H7VA 3HJYB 1TWCL 1Y1WL 3WWNB 4POGA 5MFPA 2PPTA 2BE5D 1R9TL 2NYDA 1QYBA 1VCXA 1TWAL 3SS2A 4A3KL 3LNLA 1JYBA 1SMMA 3S1RL 1QQTA 1I50L 3LPEB 4E6YA 4AYBP 2L0ZA 2A6HD 5IP9L 1I6HL 5M5XL 4BY1L 5DM61 2KKDA 2B63L 4ME3A 1ZRPA 1FHHA 3RZTA 2HR5A 3H9CA 2NVQL 3PO3L 4YWMA 4BBRL 1RWDA 5K2ME 2DSXA 3KYUA 3PKIA 2PVXA 4YWLA 5JVG1 1S24A 2A69D 2R93L 2WB1P 5GAEc 3HOVL 5EINC 3LWOB 3S1NL 3GTQL 2JA6L 1B2JA 4AHYA 1IU6A 1IRNA 5C44L 5AN9H 4AR6A 2JI3A 1NXEA 2VUML 1YUXA 5MLC3 3KYXA 8RXNA 1PFUA 1RDGA 4ZN3B 6RXNA 3MPSA 3J7Y1 2O5JD 1S2ZA 1PFVA 4K9FA 2PVEA 1R0GA 1BE7A 2CR8A 1RYQA 1B2OA 3PKJA 4A3JL 1TWFL 5M3ML 5RXNA 4A93L 3FDJA 5C4JL 1B13A 1LKOA 5AI3A 4RXNA 2V0EA 2JI2A 1B71A 4A3ML 1NNQA 4C3HL 3S16L 2PYAA 4BBSL 3NFPI 5MF6A 4AR4A 3RYGA 3M3YL 2XJPA 4AI3A 1PZXA 2V3BB 3PIP1 3S15L 3P2AA 2JI1A 5IYDL 2A6ED 4C3IL 5C3EL 3J7Z1 4GS7D 2RFKB 3GTGL 3HOZL 5GAGc 2KN9A 1RYTA 4A3EL 4U671 4BY7L 1IROA 3RZDL 1T9PA 4ZN1B 4WFN1 2R7ZL 3LWRB 2RDVA 1LKMA 2WAQP 3H97A 4AI1A 3QQCE 2GMGA 1Z92B 1TWGL 2B5ID 4BXXL 5EIOC 2LCQA 5JVH1 5IYCL 4AHWA 5C4XL 1BRFA 1T9QA 3HOYL 4AR3A 4A3BL 3RZ6A 3I4ML 4C2M1 1LKPA 1RB9A 2NVYL 3GTKL 2ERJA 1WJVA 7RXNA 3KYWA 2A68D 3M4OL 5IY0A 2AUSB 2PSMC 4Y7NL 3GTOL 3H0GL 1IW7D 3H3VM 1YUZA 3I4NL 2XJSA 2C6AA 3K7AL 3P8BA 4TVMA 2JA7L 4JADA 2XJRA 3H9BA 1DVBA 4G6BA 1ODHA 2H12A 1VZIA 4AI0A 4A3CL 3HOUL 1S30A 2VL6A 4JAFA 2CKAA 2M4YA 3HKZP 1SMWA 4V196 1OWCA 4LHNA 1CADA 2XJTA 5AI2A 1NXGA 3S17L 4JAEA 3QVDA 3HAXC 4A3DL 4AHXA 2E2HL 4AI2A 1CAAA 5IYBL 3GTLL 3PL5A 2XJVA 3B0AB 3LWQB 3H99A 5M5WL 1YK5A 5M3FL 3VPBE
chains in the Genus database with same CATH topology
3QQCE 5GAHc 4AR6A 2ERSA 2GMGA 4POFA 2JI3A 3ZG6A 1NXEA 1Z92B 2B5ID 1R0IA 2J9UB 4B8CD 5EIOC 1RDVA 4XGHA 2LCQA 5JVH1 1YUXA 5MLC3 3PIO1 1YK4A 4AHWA 3KYXA 8RXNA 3B08B 1BRFA 1T9QA 1RDGA 2K2DA 5GADc 5DM71 3KYVA 4AHZA 1R0FA 4ZN3B 4AR3A 3RZ6A 1BFYA 1LKPA 1QCVA 2XJUA 4UY81 3PWFA 5MGNA 1OWBA 6RXNA 3MPSA 3MSUA 5MFZA 3J7Y1 1RB9A 2O5JD 1T9OA 1BQ9A 3IU3I 1S2ZA 1H7VA 2ERJA 1WJVA 7RXNA 4K9FA 2PVEA 3KYWA 2A68D 2M6OA 4AR5A 1R0GA 5IY0A 1BE7A 2CR8A 1RYQA 3WWNB 4POGA 1B2OA 5MFPA 2PPTA 2PSMC 2BE5D 3PKJA 2NYDA 1QYBA 1VCXA 5RXNA 3SS2A 1IW7D 1YUZA 1B13A 1LKOA 2M4VA 1JYBA 2Z3RB 3LNLA 2XJSA 4JAGA 2C6AA 1SMUA 1SMMA 5AI3A 4TPUA 4RXNA 3P8BA 1YV1A 4TVMA 1R0JA 3KYYA 3PZAA 2V0EA 2JI2A 1B71A 1C09A 3LPEB 4JADA 4E6YA 2XJRA 3WWLA 1NNQA 1DVBA 4G6BA 2L0ZA 5AN9H 1ODHA 2A6HD 5H1Sc 1LTLA 2C6BA 2H12A 1VZIA 2CKCA 4AI0A 2PYAA 2M6PA 5DM61 2KKDA 3NFPI 5MF6A 4AR4A 4XXBB 3RYGA 1VZHA 2XJPA 4ME3A 4AI3A 1S30A 2VL6A 1ZRPA 1FHHA 2CKAA 4JAFA 2M4YA 1SMWA 3RZTA 2V3BB 2HR5A 3PIP1 3P2AA 4V196 1OWCA 4YWMA 4LHLA 2JI1A 4LHNA 2XJQA 2A6ED 3J7Z1 4GS7D 1CADA 1RWDA 2XJTA 5AI2A 5K2ME 1R0HA 2AYJA 3A44A 2DSXA 1NXGA 5GAGc 2KN9A 1DX8A 3KYUA 4JAEA 3QVDA 1RYTA 2V0FA 2PVXA 3K35A 3PKIA 1FHMA 4AHXA 4U671 4AI2A 1IROA 1VZGA 2Z3QB 1T9PA 4ZN1B 4YWLA 4WFN1 1S24A 1CAAA 2A69D 2QL0A 5JVG1 5GAEc 5EINC 2XJVA 3B0AB 2RDVA 2MS3A 1B2JA 1E8JA 1LKMA 2ZIXA 4AHYA 1BQ8A 1YK5A 1IU6A 1IRNA 3VPBE 4AI1A 1IU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AR6 A;  2GMG A;  4POF A;  1R0I A;  1RDV A;  2LCQ A;  1YUX A;  1YK4 A;  3KYX A;  8RXN A;  1BRF A;  1T9Q A;  1RDG A;  2K2D A;  3KYV A;  1R0F A;  4AR3 A;  3RZ6 A;  1BFY A;  1LKP A;  1QCV A;  3PWF A;  6RXN A;  3MPS A;  1RB9 A;  1T9O A;  1BQ9 A;  1S2Z A;  1H7V A;  7RXN A;  4K9F A;  2PVE A;  3KYW A;  4AR5 A;  1R0G A;  5IY0 A;  1BE7 A;  4POG A;  1B2O A;  1QYB A;  1VCX A;  5RXN A;  3SS2 A;  1YUZ A;  1B13 A;  1LKO A;  1JYB A;  1SMU A;  1SMM A;  5AI3 A;  4TPU A;  4RXN A;  1YV1 A;  1R0J A;  3KYY A;  3PZA A;  1B71 A;  1C09 A;  1NNQ A;  1DVB A;  1LTL A;  2PYA A;  2KKD A;  4AR4 A;  3RYG A;  4ME3 A;  1S30 A;  2VL6 A;  1ZRP A;  1FHH A;  2M4Y A;  1SMW A;  3RZT A;  2V3B B;  2HR5 A;  4YWM A;  1CAD A;  1RWD A;  5AI2 A;  1R0H A;  3A44 A;  2DSX A;  2KN9 A;  1DX8 A;  3KYU A;  3QVD A;  1RYT A;  2PVX A;  1FHM A;  1IRO A;  1T9P A;  4YWL A;  1S24 A;  1CAA A;  2QL0 A;  2RDV A;  2MS3 A;  1B2J A;  1E8J A;  1LKM A;  1BQ8 A;  1YK5 A;  1IU6 A;  1IRN A;  1IU5 A; 
#chains in the Genus database with same CATH topology
 2APO B;  4POF A;  3GTM L;  3ZG6 A;  5IP7 L;  3S14 L;  4B8C D;  2E2I L;  1I3Q L;  3PIO 1;  1YK4 A;  3S1Q L;  5DM7 1;  3LWP B;  1SFO L;  1QCV A;  4UY8 1;  4C3J L;  1OWB A;  3MSU A;  5MFZ A;  2EY4 E;  1T9O A;  2M6O A;  4AR5 A;  1PFW A;  5FJ8 L;  3LWV B;  2JA8 L;  1Y1V L;  2M4V A;  2Z3R B;  4JAG A;  1SMU A;  4TPU A;  1YV1 A;  1R0J A;  3KYY A;  3PZA A;  1C09 A;  3WWL A;  5FLM L;  1PFY A;  3HOW L;  3HJW B;  3GTJ L;  5H1S c;  1LTL A;  2C6B A;  2CKC A;  3CQZ L;  2M6P A;  2Y0S P;  4QIW P;  3FKI L;  4XXB B;  2E2J L;  1VZH A;  4A3I L;  2HVY C;  2PMZ P;  4X6A L;  1K83 L;  4LHL A;  1WCM L;  2XJQ A;  3RZO L;  2R92 L;  1P7P A;  1R0H A;  2AYJ A;  3A44 A;  4A3L L;  1DX8 A;  3K35 A;  2V0F A;  3S2H L;  1FHM A;  1VZG A;  2Z3Q B;  4A3F L;  2QL0 A;  3HOX L;  1TWH L;  2MS3 A;  3PO2 L;  1E8J A;  3MQK B;  3S2D L;  2ZIX A;  1BQ8 A;  3S1M L;  1IU5 A;  5GAH c;  2ERS A;  1R0I A;  2J9U B;  1RDV A;  2AQC A;  4XGH A;  2YU9 L;  3B08 B;  3JR7 A;  5GAD c;  2K2D A;  3KYV A;  2NVX L;  4AHZ A;  1R0F A;  2JA5 L;  4A3G L;  1BFY A;  5M5Y L;  4Y52 L;  2XJU A;  3GTP L;  3PWF A;  5MGN A;  1BQ9 A;  3IU3 I;  2NVT L;  1F4L A;  1H7V A;  3HJY B;  1TWC L;  1Y1W L;  3WWN B;  4POG A;  5MFP A;  2PPT A;  2BE5 D;  1R9T L;  2NYD A;  1QYB A;  1VCX A;  1TWA L;  3SS2 A;  4A3K L;  3LNL A;  1JYB A;  1SMM A;  3S1R L;  1QQT A;  1I50 L;  3LPE B;  4E6Y A;  4AYB P;  2L0Z A;  2A6H D;  5IP9 L;  1I6H L;  5M5X L;  4BY1 L;  5DM6 1;  2KKD A;  2B63 L;  4ME3 A;  1ZRP A;  1FHH A;  3RZT A;  2HR5 A;  3H9C A;  2NVQ L;  3PO3 L;  4YWM A;  4BBR L;  1RWD A;  5K2M E;  2DSX A;  3KYU A;  3PKI A;  2PVX A;  4YWL A;  5JVG 1;  1S24 A;  2A69 D;  2R93 L;  2WB1 P;  5GAE c;  3HOV L;  5EIN C;  3LWO B;  3S1N L;  3GTQ L;  2JA6 L;  1B2J A;  4AHY A;  1IU6 A;  1IRN A;  5C44 L;  5AN9 H;  4AR6 A;  2JI3 A;  1NXE A;  2VUM L;  1YUX A;  5MLC 3;  3KYX A;  8RXN A;  1PFU A;  1RDG A;  4ZN3 B;  6RXN A;  3MPS A;  3J7Y 1;  2O5J D;  1S2Z A;  1PFV A;  4K9F A;  2PVE A;  1R0G A;  1BE7 A;  2CR8 A;  1RYQ A;  1B2O A;  3PKJ A;  4A3J L;  1TWF L;  5M3M L;  5RXN A;  4A93 L;  3FDJ A;  5C4J L;  1B13 A;  1LKO A;  5AI3 A;  4RXN A;  2V0E A;  2JI2 A;  1B71 A;  4A3M L;  1NNQ A;  4C3H L;  3S16 L;  2PYA A;  4BBS L;  3NFP I;  5MF6 A;  4AR4 A;  3RYG A;  3M3Y L;  2XJP A;  4AI3 A;  1PZX A;  2V3B B;  3PIP 1;  3S15 L;  3P2A A;  2JI1 A;  5IYD L;  2A6E D;  4C3I L;  5C3E L;  3J7Z 1;  4GS7 D;  2RFK B;  3GTG L;  3HOZ L;  5GAG c;  2KN9 A;  1RYT A;  4A3E L;  4U67 1;  4BY7 L;  1IRO A;  3RZD L;  1T9P A;  4ZN1 B;  4WFN 1;  2R7Z L;  3LWR B;  2RDV A;  1LKM A;  2WAQ P;  3H97 A;  4AI1 A;  3QQC E;  2GMG A;  1Z92 B;  1TWG L;  2B5I D;  4BXX L;  5EIO C;  2LCQ A;  5JVH 1;  5IYC L;  4AHW A;  5C4X L;  1BRF A;  1T9Q A;  3HOY L;  4AR3 A;  4A3B L;  3RZ6 A;  3I4M L;  4C2M 1;  1LKP A;  1RB9 A;  2NVY L;  3GTK L;  2ERJ A;  1WJV A;  7RXN A;  3KYW A;  2A68 D;  3M4O L;  5IY0 A;  2AUS B;  2PSM C;  4Y7N L;  3GTO L;  3H0G L;  1IW7 D;  3H3V M;  1YUZ A;  3I4N L;  2XJS A;  2C6A A;  3K7A L;  3P8B A;  4TVM A;  2JA7 L;  4JAD A;  2XJR A;  3H9B A;  1DVB A;  4G6B A;  1ODH A;  2H12 A;  1VZI A;  4AI0 A;  4A3C L;  3HOU L;  1S30 A;  2VL6 A;  4JAF A;  2CKA A;  2M4Y A;  3HKZ P;  1SMW A;  4V19 6;  1OWC A;  4LHN A;  1CAD A;  2XJT A;  5AI2 A;  1NXG A;  3S17 L;  4JAE A;  3QVD A;  3HAX C;  4A3D L;  4AHX A;  2E2H L;  4AI2 A;  1CAA A;  5IYB L;  3GTL L;  3PL5 A;  2XJV A;  3B0A B;  3LWQ B;  3H99 A;  5M5W L;  1YK5 A;  5M3F L;  3VPB E; 
#chains in the Genus database with same CATH homology
 3QQC E;  5GAH c;  4AR6 A;  2ERS A;  2GMG A;  4POF A;  2JI3 A;  3ZG6 A;  1NXE A;  1Z92 B;  2B5I D;  1R0I A;  2J9U B;  4B8C D;  5EIO C;  1RDV A;  4XGH A;  2LCQ A;  5JVH 1;  1YUX A;  5MLC 3;  3PIO 1;  1YK4 A;  4AHW A;  3KYX A;  8RXN A;  3B08 B;  1BRF A;  1T9Q A;  1RDG A;  2K2D A;  5GAD c;  5DM7 1;  3KYV A;  4AHZ A;  1R0F A;  4ZN3 B;  4AR3 A;  3RZ6 A;  1BFY A;  1LKP A;  1QCV A;  2XJU A;  4UY8 1;  3PWF A;  5MGN A;  1OWB A;  6RXN A;  3MPS A;  3MSU A;  5MFZ A;  3J7Y 1;  1RB9 A;  2O5J D;  1T9O A;  1BQ9 A;  3IU3 I;  1S2Z A;  1H7V A;  2ERJ A;  1WJV A;  7RXN A;  4K9F A;  2PVE A;  3KYW A;  2A68 D;  2M6O A;  4AR5 A;  1R0G A;  5IY0 A;  1BE7 A;  2CR8 A;  1RYQ A;  3WWN B;  4POG A;  1B2O A;  5MFP A;  2PPT A;  2PSM C;  2BE5 D;  3PKJ A;  2NYD A;  1QYB A;  1VCX A;  5RXN A;  3SS2 A;  1IW7 D;  1YUZ A;  1B13 A;  1LKO A;  2M4V A;  1JYB A;  2Z3R B;  3LNL A;  2XJS A;  4JAG A;  2C6A A;  1SMU A;  1SMM A;  5AI3 A;  4TPU A;  4RXN A;  3P8B A;  1YV1 A;  4TVM A;  1R0J A;  3KYY A;  3PZA A;  2V0E A;  2JI2 A;  1B71 A;  1C09 A;  3LPE B;  4JAD A;  4E6Y A;  2XJR A;  3WWL A;  1NNQ A;  1DVB A;  4G6B A;  2L0Z A;  5AN9 H;  1ODH A;  2A6H D;  5H1S c;  1LTL A;  2C6B A;  2H12 A;  1VZI A;  2CKC A;  4AI0 A;  2PYA A;  2M6P A;  5DM6 1;  2KKD A;  3NFP I;  5MF6 A;  4AR4 A;  4XXB B;  3RYG A;  1VZH A;  2XJP A;  4ME3 A;  4AI3 A;  1S30 A;  2VL6 A;  1ZRP A;  1FHH A;  2CKA A;  4JAF A;  2M4Y A;  1SMW A;  3RZT A;  2V3B B;  2HR5 A;  3PIP 1;  3P2A A;  4V19 6;  1OWC A;  4YWM A;  4LHL A;  2JI1 A;  4LHN A;  2XJQ A;  2A6E D;  3J7Z 1;  4GS7 D;  1CAD A;  1RWD A;  2XJT A;  5AI2 A;  5K2M E;  1R0H A;  2AYJ A;  3A44 A;  2DSX A;  1NXG A;  5GAG c;  2KN9 A;  1DX8 A;  3KYU A;  4JAE A;  3QVD A;  1RYT A;  2V0F A;  2PVX A;  3K35 A;  3PKI A;  1FHM A;  4AHX A;  4U67 1;  4AI2 A;  1IRO A;  1VZG A;  2Z3Q B;  1T9P A;  4ZN1 B;  4YWL A;  4WFN 1;  1S24 A;  1CAA A;  2A69 D;  2QL0 A;  5JVG 1;  5GAE c;  5EIN C;  2XJV A;  3B0A B;  2RDV A;  2MS3 A;  1B2J A;  1E8J A;  1LKM A;  2ZIX A;  4AHY A;  1BQ8 A;  1YK5 A;  1IU6 A;  1IRN A;  3VPB E;  4AI1 A;  1IU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...