1PZXA

Hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
277
Chain Sequence
MPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQPSPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVELAKQNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISNIKPLLHVEDGALIPLEKWRGRKKVLKRMVELMGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIGSAIGAHAGPGTIALFFLNKYIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Hypothetical protein APC36103
publication title Lipid binding protein APC36103 from Bacillus Stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
total genus 96
structure length 277
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.50 Mainly Beta Single Sheet Rubrerythrin, domain 2 degv family protein 1pzxA02
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 1pzxA03
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 1pzxA01
1OI2A 4X9XA 3PNQA 2G7ZA 2IU6A 4LRYA 3PNOA 3PNKA 1UODA 1VPVA 3LUPA 3PNMA 4LRXA 3CT4A 2DT8A 1UOEA 2IU4A 1PZXA 3PL5A 3PNLA 3JR7A 3FYSA 1OI3A 3FDJA 1MGPA 3NYIA
chains in the Genus database with same CATH superfamily
2C97A 2I8LA 1KOGA 3ASUA 5HGXA 1QH9A 1FVOA 4O6VA 1WD5A 3K6JA 3OMWA 4M1WA 5LBUA 1NY6A 3AXTA 4CMIB 4Q1CA 1S1CA 1SGWA 5HCNA 1C3OB 3DMTC 5KVQA 4E1AA 3N0TA 3KYYA 4S1WA 3CVUA 5I4CA 2PUBA 1J21A 5BN4A 3RUDA 3AILA 2YRWA 4BFTA 2FRXA 4EA8A 1RMYA 2EZ4A 4KODA 3HA7A 4OUDA 4Q3AA 5K2OA 2VJYA 4V24A 2F59A 4QQNA 4YRMA 3GFOA 1ODIA 5JSZA 5HQTA 4RHCA 4AR5A 4O29A 2X19A 5F9FA 2LUOA 4XIIA 4UOEA 2QENA 4GAEA 1YR1A 1YACA 2OPBA 2XB9A 4CL8A 5JWOA 3ICCA 2GNAA 1XTKA 1CV2A 2HQBA 1WXIA 2O7RA 1P2UA 3H1FA 1ZGHA 3B6KA 3GAAA 3I0ZA 3JX9A 4OKSA 5J5AA 4AUNA 4KO2S 5HUJA 2WSBA 4B1FA 4G0UA 4DIKA 1XCPA 5ICMA 4OTZA 1QNLA 1YQGA 3HKCA 1BHO1 2ZQYA 3JQPA 5HQJA 5SZHB 4DJFC 1EM6A 1O1YA 3PGMA 5L3ZA 1NX9A 1NY5A 1PV2A 5C7YA 1M5RA 1BE6A 4YI3A 4BQRA 2HTEA 1U8CB 3PIO1 3KJXA 3FG9A 4WLFA 3ILYA 4JROA 3USES 4H6VA 5AJYA 2NSHA 3EZ7A 5LLDA 1BH6A 3KTOA 5LYJB 4OCZA 4URVR 3D6MA 5BY2A 1E7MA 1F0YA 2HA5A 2J5KA 4HXFB 3P94A 4QOEA 4BVEA 1MORA 5KQGA 3U6KA 1VIMA 1KVSA 1ZGZA 1V16A 1V1RA 1PGNA 3WGHA 5JRJA 4LYYA 3KJFA 4FILA 3ITNA 3S1QL 3G3EA 4L8LA 2XLCA 4A15A 1YTUA 2XGOA 1Z5NA 3D8UA 3FWYA 5CLGA 2SKEA 5TGTA 2OFOA 5JNWA 3OQIB 2XUPA 1H8HD 4MUYA 3A1VA 1QF7A 2C3MA 3I4NL 3U56A 3BL6A 1XP8A 3PUJA 4BO6A 2ONZA 1RJFA 1F6DA 1VMIA 4Z53A 4E2YA 1E4OA 3K9FC 3L77A 3FCAA 1B41A 5FH9A 2EW2A 4YYEA 2AXPA 2BIFA 3D6TB 2M4VA 3M5WA 3RQSA 2G28A 2GXAA 2PLFA 1OIVA 2JBAA 2IS6A 1T8RA 3FJOA 3W9YA 1O8BA 3RYTC 1FY2A 1W0KD 2GD2A 1ZGBA 4MI3A 5BQOA 1VL6A 4ALNA 3BMQA 2FP4A 4B44A 2IYPA 4CV1A 4YCAA 1R88A 2ZXEA 1JPUA 1EFTA 5AW5A 2CXSA 4UBJA 3SJAA 1FLNA 1H4SA 3IMKA 3DFFA 3TI9A 2OXFA 1NBMD 2A7QA 2KB0A 2WTXA 4W6QA 3IE2A 4BLOA 1DL5A 2O52A 3I01A 3CE9A 2ZIXA 3RV3A 4QREA 1VSBA 2POCA 3T9CA 1HBJA 1PR0A 1KZYC 4BC0A 3R3WA 2PV7A 1G8KA 4W8OA 4WY2A 4BO8A 2DETA 4H1VA 4IIJF 2X76A 2C2BA 1JWAB 5KTPA 1KAMA 2AOXA 2FOLA 2GRJA 3F4KA 2I9PA 2OEPA 1H9BA 4G5GA 2R7ZL 3LG2A 1D0SA 3Q3CA 3AUAA 4TTSA 4ZI3A 3CW8X 1T8UA 1O54A 2GQ0A 2WICA 5B4VA 1TAHA 3T34A 4IHJA 1W0KA 2YN4A 2GILA 2Y3IA 5LQSA 2XJRA 1V2HE 3QHAA 1PR2A 2JI1A 3K72B 2BHLA 3UAVA 3ORHA 4DLKA 2XNJA 3RC3A 4QECA 3E15A 1CHNA 1RM5A 4FOSA 3W9SA 1ATIA 1NBMA 3I58A 2C57A 2C7GA 1S8NA 2O7QA 5H1YA 3KRTA 4Z7NB 1ZOOA 3ROQA 3GG9A 4QFBA 5HBGA 2F8MA 3LQYA 4LYDA 4B6PA 1OOEA 2J9YB 3T3OA 3T5TA 1TWHL 5DCLA 1RAEA 3QTLA 3VVBA 2CB9A 2D7JA 3JQ7B 5AI0A 4BVJA 5CCEA 3HI6A 1ID1A 4NE2A 4BQIA 1MDBA 2CXPA 1C8VB 3E35A 4GM0A 3OQMA 3ZN2A 4IVQA 4RPHA 5FBRB 1E2NA 3V80A 4R1MA 2L17A 5LD2B 1WCYA 4I55F 3AJDA 1RBQA 3H42B 3GRPA 4S05A 1IROA 1E9DA 1L4YA 3TD2A 1UBGA 1GQ2A 3A1UA 2QF7A 3C6KA 3GDHA 1PTJC 2AXQA 2PAFA 3GNSA 1MN6A 4R2HA 4YPVA 3IDOA 1VSVA 2OHHA 1K9VF 1MO4A 3DYVA 4J90A 3Q2OA 1VI5A 4DUZB 2XYGA 3HBNA 1CUGA 3BL5A 1EBUA 2CD9A 3O8RA 5M04A 4GWLA 2V1UA 1NR5A 5C44L 3NJ4A 3LP8A 1GGEA 2DT8A 1UZLA 1IM8A 3NDRA 3I76A 1FZTA 5KSOA 1O77A 3ZE2B 4FI3F 2V4ZA 4NYMQ 4C4PA 4FW8A 1TZJA 2QMHA 3KJZA 5IXYA 1MXHA 2OO5C 3N2KB 4ND1A 5CNMA 4YMVA 3FUUA 4WD3A 4CG3A 1SU4A 4F91B 4W9MC 4U02A 2A0FA 2DH6A 4UU1A 5TY0A 1MVLA 2QTLA 3DMGA 2NO5A 3USZA 2H1RA 3IDFA 3CR3C 1IOWA 2ZJ8A 2AC2A 3GJ4A 4HGPA 5BUQA 2PMDA 1V96A 4FX5A 4M60A 5JSHA 2EWWA 1DVRA 4WBSA 2B1QA 3GZNA 3FPBA 2NPFA 2A1UB 2OHFA 1A4IA 1ZS9A 2PXHA 2XQVA 1UBNA 3VU3A 1DIGA 3RIHA 3U62A 2X86A 2O14A 5HZMA 3IXLA 3ZLUA 1TOAA 4M9RA 4G4IA 3S2GA 1NHGA 4BNNA 4L5JA 2NSYA 1XTUA 4JLDA 1RWXA 1E2MA 1FXUA 3TH5A 5LZ7A 2B9EA 2W2LD 3OCUA 5KX5F 2DSXA 2AFRA 2IOHA 2UVPA 2W4QA 3OTOB 1XTTA 5FLML 1KPHA 3OD1A 4EBBA 1VE5A 2WK1A 1W49A 1BA2A 1SBHA 3HL0A 2F3RA 3BXGA 3L49A 3NU1A 4MA5A 1F51E 1XCBA 1A9PA 3H8SA 3RIXA 5CAEB 3VVCA 5TLSA 1E8NA 1NXXA 2J9RA 3F8TA 3OU2A 2CVQA 4ARIA 1G7RA 3GLFE 2BM1A 2H63A 2FR0A 1ILEA 3DAPA 3HFSA 3K1TA 4B3BA 1JMVA 1ZVKA 1T0BA 4KK4A 4PPQA 4UKDA 2HMUA 5JDIC 2YV2A 1DAIA 4UATA 5AKZA 5FORA 4G0YA 4GM4A 4JD5A 1J1IA 1P5ZB 1XXHA 1T1IA 5IP5A 1CKEA 2Z2XA 5AD1A 3K7EA 2YY5A 3MJHA 4I9UA 3JCZA 1X7XA 2FW7A 2FPLA 2ILTA 4M0PA 3UB4A 4C06A 5G0TA 3QY9A 2AMFA 1D7OA 3F6YA 4TMWA 3RV4A 5AW6A 3BILA 2BHNA 4NL4H 4X94A 1HOTA 3NDIA 2WD8A 1S3SA 2Y9MB 3R6DA 4C6HA 1EGQA 5CA0B 4E07A 1V3QE 2WI8A 4KN9S 2PCLA 3Q1LA 1C5KA 1YZLA 2HBQA 1QIGA 3M6WA 4I9GA 4ZEVA 1T9KA 2GWRA 4D8WA 1JQ5A 3ID6C 1P0CA 1AGXA 4IDPA 4ZOBA 2C31A 3Q7TA 1XI2A 3FVRA 3BE8A 3CRNA 3KZNA 4UUNA 2F8TA 3CEHA 2HLPA 4Y0AA 1XQVA 2R6FA 4JUFA 1RZRA 3PNQA 4B75A 2E2JL 2PPVA 3D64A 5KQSA 4F1KA 2C61A 3TFOA 2GZ2A 3VDXA 1RPZA 3O2SB 3V3KA 3EXFA 2FU5C 4XGHA 4PZCA 5K4AA 4KDRA 2RGWA 1U81A 5AHRA 2QGFA 2W48A 1CRLA 1MZPA 2V3BB 1N6OA 4N54A 3LUBA 3FBGA 3P8BA 3DE2X 4MVWA 3U39A 1OFUA 3A36A 3IMFA 4HN9A 2H1IA 3AESB 3TR6A 5LR6A 3DV0A 5THQA 4F0JA 4X6YA 3CZ9A 3H9EO 5FFMA 4REQA 4B40A 2DWPA 2NXEA 3LUKA 3TTYA 4AP6A 1F5SA 1G60A 4BVHA 1XZHA 3SK0A 1UXOA 2G5PA 3R5FA 4QGGA 3KV1A 4IIBA 2D7DA 1RQNA 1N2HA 5GQSA 1DRWA 1DB3A 2OQ2A 4O3MA 4OVKA 1G0NA 2I3BA 3WGJA 3IEUA 4BQEA 5JVDF 3PRYA 5JD4A 3L7LA 3S5UA 2FGJA 1L4UA 1V5WA 1ZD8A 3C3DA 3C5VA 3HUTA 3O92A 5DNDA 3D1LA 3U49A 1R0CA 2HPHA 3JZAA 2FX3A 4ZZIA 1M2OB 2H2DA 4O4IA 4A6PA 3BPSA 2GLUA 1ZJ6A 1G9TA 2B6HA 3H5WA 4DIBA 1VI2A 2F9MA 3L1VA 3NIDB 3S15L 4F4UA 4KQ1A 2EX1A 4L74A 2VDRB 3HVUA 5DNYB 1HK7A 1UKYA 1Y5IA 1QOPB 2HPZA 3DUFA 3UMBA 1BVUA 2R5FA 4BNDB 1PFYA 3N0RA 4EF4A 3C3WA 3CEPB 1Z0AA 2X6TA 4S1NA 1AHIA 3LCUA 4JX9A 1PV4A 4BRUA 1Y5LA 4UASA 3DDNA 2PPTA 2IHJA 4CQLB 4TVSA 5AUNB 1XLTA 3U37A 2K7FA 1MIOA 4JR0A 4TMZA 2CVPA 4CFZA 5KYXB 1YIAA 3IJPA 4BFCA 2LIPA 5KYYA 1RP7A 3DFKA 4PHGA 3CLUD 2QQEA 2VYCA 2JA6L 2XZOA 1Z0FA 3J80A 2X4IA 3V9PA 4CLRB 2F4VB 3W77A 4K9DA 1NI5A 1QH0A 4MJ7A 1VJRA 3E9NA 4ZGBA 5JZVA 3IFSA 1P3Y1 3HVKA 3LPMA 4ODIA 3RASA 3T1QA 2HHAA 4B87A 4BRZA 4N7MA 1GPJA 3BWEA 4DQUA 4ZHQA 3VOBA 3PC3A 1ZRMA 2Q5QA 4IOKA 4M7WA 3RU3A 2NSLA 3D4BA 4KQ6A 3SOPA 4DJ5X 1J9GA 2OFPA 2V0EA 2DQYA 1KI6A 2HKIA 2GPWA 1XRLA 4XM2A 3W06A 1P3JA 1MMFB 1SB8A 1Y63A 1YC5A 2EGHA 2XXBA 3IVXA 1DQZA 1S7GA 1IUKA 1UFOA 4LZZA 4OGWA 4FB5A 4RXMA 1PLJA 2WJ4A 1L5SA 3FUWA 1KBZA 4PIPA 2VJPA 5JNVA 4ALMA 3LWBA 3KQHA 2JCVA 2Q9BA 3NTQA 4FGJA 4Q4DA 1NVFA 1R0WA 3DOUA 1M67A 1TDJA 2D2IA 3DTVA 1NVWQ 2H1HA 4OEHA 2XDAA 3KU4A 1W4ZA 3JQEA 1QG4A 3WMEA 3G1TA 2ZTMA 4QL3A 4IW3B 4L28A 4CM5A 1YGPA 1TU0A 4B34A 5FWXA 5ALIA 1DJOA 2FYTA 2GCOB 2VJMB 2XEDA 2YW9A 4HS9A 1K7EB 3SNHA 5KQLA 3Q87B 4L3VA 4NBWA 2EFGA 3PO2L 4LXUA 5ALYA 3IBFA 3PGVA 5KIAA 2J3HA 4EY7A 4IR7A 1CEYA 2D4HA 3IB3A 4NENA 4LOJA 5GJBA 4L57A 1SULA 2YXEA 2ZUSA 4L50A 1C1DB 4DNXA 1EIWA 5C8VA 1NQUA 1Z16A 3NC4A 2NO9A 1XDDA 2DUUA 2XE7A 4X1YB 1JFFA 1GKLA 2VAVA 3G2MA 1M2FA 3N5CA 4I3FA 3LYHA 4X8HA 4XLTA 5HDBB 1M7BA 1SUIA 1ADJA 3ILXA 5EXSA 1JN0A 3WNZA 1F4LA 4Y9UA 3EG9A 2I55A 4A1OA 1I33A 1H3FA 4ENVA 2CFCA 4WLVA 5KTOA 5D1NA 1JTEA 1HUQA 4FHEA 2V0FA 4Y3UA 1WB9A 4AS1A 4RSHA 2A9RA 3LIIA 3FGPA 5EIWA 2C42A 3PX7A 4D3SA 1U8FO 1Y3BE 1XZQA 2YYYA 3UT5A 1KF0A 2P6MA 4L4RA 2QD4A 4HXGA 2E9SA 4FGLA 4PG8A 1N2JA 5L6MB 1EB9A 5K01A 1DRUA 3CVJA 5FULA 4E5SA 2JD2A 3UOAB 2GXUA 4HN2A 3T4UA 1H9CA 3O73A 1VKNA 4IHAA 3BSWA 3VSBA 4DPKA 2ZUCA 2YZNA 1PYOA 4QBIA 4QDUA 1K5HA 4HAZA 3VXKA 1Y1KE 3N28A 1GEEA 1XTJA 2GJAA 1CZKA 2QRQA 3M34A 5HILA 4AG3A 4FWTA 3BGOS 1Q1EA 2G06A 3KEGA 3UKOA 3KE8A 3IMEA 3NYIA 1ZCJA 1C3XA 1ISSA 1UT6A 2KS6A 3JALB 4MRAA 2CJWA 1XUOA 2XAUA 2F8LA 2Q8PA 2GNPA 2R2AA 4G09A 2O5RA 1C1HA 1J06A 4CV2A 1SHKA 5E6RB 3O4FA 2ET6A 3WWDA 2PL3A 5CXQA 1D03A 3W5VA 1TYAE 2M1ZA 3O75A 3FETA 1QF9A 2NQ2C 3LQKA 3LCMA 3ILSA 1CW2B 1T24A 1YCHA 3NBKA 5FBKA 3TEJA 5B6PA 3S8YA 3FBWA 1GZ4A 2P5TB 4ZQFA 2PX6A 3TTXA 2FZGA 3TGLA 1EXNA 2B7CA 3RVDA 4IL5A 1C2TA 6GPBA 4KH1A 3A4IA 2FFHA 3DMYA 3KOZA 1J0AA 2JCGA 3VNQA 2DH5A 3W8NA 2WVAA 3ZI7A 1NTOA 3V4ZA 1G41A 2FSVC 4NBUA 4MI6A 4ZMBA 4OFZA 1CY4A 1PG5A 2QW1A 2HMSA 2G6BA 2EW8A 4NCBA 3IOYA 1WRBA 3I92A 3L0CA 4URYR 3BDIA 4N9QA 5E4YA 3S44A 1T9CA 4AICA 4P38A 1L8XA 2P4HX 2ZI7A 4PZDA 4QT4A 3K16A 2PR7A 3BSSA 2HMWA 2CVFA 3A2LA 4MGIR 5D3MB 5TSDA 4XPIB 3G6WA 3OT1B 3WHKA 1JPVA 2ATXA 4HJXA 1HDRA 4BUJA 3GMIA 1WZEA 2J9FA 2XYPA 5JZOA 4UHDA 3KR1A 2PT6A 1EP2B 4TQAA 2AG1A 3LBAA 3NFRA 2ODEA 2OP1A 4ZYUA 1T13A 4JP8A 3CO0S 4NAHA 3JS5A 4TOIA 3TTTA 3DHNA 2JFYA 5EAIA 4F85A 2X2OA 5HVNA 3GGPA 1XL1A 2QR3A 4MXDA 5D5PA 1NGSA 2H5EA 5CW1A 2VDJA 4U63A 3J81k 1NBWB 2EP7A 3A31A 4DCPA 3LF1A 1MF7A 4TQUS 4RX1A 4DW8A 3FLMA 5B2EA 4TWZA 4IKEA 5DM60 2AT1A 2X1LA 3I61A 4K9MA 4KE9A 3O8OB 4K9PA 4ZVSA 1AKTA 3K9WA 1SXQA 4FNMA 2IP1A 2GZRA 4GZLA 4R8VA 2WF6A 2PRZA 5I9TA 3UW3A 3VGPA 4DJDC 2A5JA 4YAKA 5JNUA 4EENA 2UYQA 5KOJB 1VMEA 3C24A 2O0MA 1JDJA 1E5QA 2VDLB 5AM3A 1IBLB 1KZGB 3GT0A 3D9QX 2IY9A 1QBKC 2CJYA 3E22A 1JEDA 2OHVA 1LNQA 1ZG3A 4LX0A 4OO3A 3X1WA 1GPAA 1V1JA 3MT7A 3JWPA 4QG7A 1W8IA 2HLHA 2Q5FA 3CF6R 2QK4A 3HUUA 2VUIB 1GAQA 1UDBA 3E23A 4KTVE 2F8SA 3VDRA 1QO0D 4ZYWA 3GFFA 2P9ZA 3NJRA 4GOLD 4X00A 2CKAA 3IOCA 2BP7A 3L0IB 1AGRA 1R74A 2CLEB 1ARZA 1P29A 1JHXA 1ZFNA 2JZOA 1COZA 1K2WA 2MYNA 3C4JA 5FPTA 3CLHA 1ZN2A 2Y2VA 2BUAA 1RJDA 3WMGA 2R7KA 5CVEA 1XRPA 3DTNA 5DTJA 3W8EA 1W5FA 1GD1O 1XG5A 4V0MA 4LWZA 4IHKA 3VKVA 4XWWA 2IH2A 4ZIRB 1UM9A 4PFJA 3RUAA 1RFGE 1GXSA 2Y0CA 2H1LA 4H0CA 4YRKA 5AVWA 2PH5A 4DM4A 3X2EA 3PRHA 2AEFA 1U2GC 2X3FA 4MAMA 4QYXA 4XARA 4KR7A 2XXJA 3LXMA 4A2PA 1NJ8A 2VPYA 3BCRA 1RHKA 1MIHA 5KAPA 3K73O 4MJLA 1P9WA 2G7ZA 1HDZA 2YICA 3R20A 3ET5A 5KOHA 1CDEA 2H9YA 1P45A 1RAIA 1OJLA 4DKJA 1HNWB 1FTYA 4JVOA 1R3DA 1SCBA 3DZIA 3TNFA 1GADO 3S16L 4WCFC 5D7BA 2FSSA 1WHTA 2HNAA 4DDKA 2Q28A 1T10A 4C22A 1PBTA 3DLAA 2ZJ5A 2MR6A 5B7GA 1FPQA 3V1TC 4C9BA 3DE6X 3CWCA 4JVLA 5EWMA 4GLLA 2QVBA 3OE7A 1CS4C 1Y9ZA 2P5SA 5G0VA 5DGXA 1G20B 3ISJA 3IUBA 3BGVA 1DAKA 1VKJA 3GGSA 2H92A 4QNNA 1FFHA 2C7VA 3V8EA 2LXNA 3GLRA 3Q5EA 2FF7A 3S1AA 3ZXSA 4CW7A 2R8RA 1A82A 4BFLA 4BIIA 1RPJA 2PYIA 1LBHA 3OIWA 4MA0A 4V39A 3ZWPA 2XTZA 3L7MA 2GCGA 3SJ7A 3QVGA 1VGQA 4PQEA 3V4RA 1UDWA 3H4VA 1A9XA 2IYTA 3T7DA 3NVKI 2NQ8A 3ZK7A 1GFIA 3FH0A 2QG6A 1XTBA 4X60A 3RROA 1MXFA 4GXTA 5LQKA 1FRVA 3PPXA 3S7ZA 3TVTA 2PGXA 4RTRA 5EE9A 1UJBA 4DMFA 3KYWA 4YUZA 5JXWA 5DYYA 4U5QA 2J32A 2RFKB 1YMQA 2A5YB 3AW8A 4DRXA 3GDGA 4CMEA 3W5CA 1HOXA 4XDGA 2V7VA 3GZTB 3BA1A 3OIYA 3A9RA 4AHZA 4QGSA 3DEJA 4JLWA 2FW0A 2EHJA 3SEAA 1AX9A 3D7MA 2CNOA 4U2DA 1M8KA 2VPQA 3FFTA 1W85B 3GVHA 2P9BA 2YFQA 3IT2A 4RULA 1VPEA 4RENA 1ZJ5A 1E9FA 3E8XA 1JDUA 5KJ6A 4C4AA 1YRHA 3QKWA 4I6GA 1CE8A 1UODA 2JH9A 5BSRA 4R1SA 2P6RA 2PZLA 3MJFA 4QA9A 3RE1A 5FD8A 1FFAA 1L0BA 2X9QA 1E64A 2VHEA 1NZDA 3IE0A 4FLFA 5HZGA 3WL8A 4FFDA 4RXTA 3GK3A 3GCDA 2PYZA 4JJZA 5J23A 2JFPA 3ZWXA 4NZYA 4WGGA 2QMEA 3DHEA 4AF7A 3TMYA 4B4OA 1Z6PA 4YCSA 5BSWA 2AHRA 4B2YA 4OGFA 3GGCA 3ZCTA 4WJLA 2A0XA 2V0NA 2FZ5A 1M2VB 1VC2A 4I50B 2JFWA 1MB2A 1RXUA 3FNBA 5EMMA 1OLSA 3PUWA 3KQQA 3STUA 2R93L 4DIEA 1JILA 1HYQA 3SXJA 4CKWA 3NOQA 1QHHB 4MYSA 3QU9A 3ITEA 5EXPA 3H3JA 2G25A 3INNA 4RACA 4WK4B 5J2UB 5SYAA 4ZO7A 3B52X 1GPLA 3RJTA 3F4LA 4C1NA 1C7QA 1ZU5A 4ZRNA 5EZ6B 3SYKA 3BIXA 5FAKA 1JXQA 3ANMA 3BA6A 2PKRA 4L72A 4Q4HA 4CG1A 5A4JA 1JDPA 5I7RA 2GM9A 4KHPB 4L3OA 2W8ZA 1JIQA 1JLHA 2X23A 1DX6A 2IYAA 3FOBA 1ZGAA 4J0IA 4X91A 3T1NA 3UAXA 1FDIA 3W1EA 1TZMA 2G5CA 4P8RA 5FOXA 1W5AA 1L8AA 4CR7A 2G83A 1TCUA 5JDCC 2W42A 1A9TA 1R8SA 4TS1A 3WNQA 2CT8A 3B1FA 3O95A 2ENWA 5K6AC 3L84A 4WAUA 4BFVA 3H86A 1F1BA 1QCVA 4GHWA 4FYVA 2V65A 2XIQA 4RNDB 2G0NA 4HUJA 3N7AA 4MO2A 4KO8A 2XPCA 2WYIA 1W94A 1T0UA 4OJTA 4MR9B 5CT4A 2QW0X 1WXFA 1RC0A 4IJVA 4EJSA 8ABPA 1XTQA 2M32A 2P3LA 1TADA 1ZNZA 2WKWA 3KSZO 1Z68A 4LCJA 4NNPA 4FGSA 4ZO4A 2I1WA 2ZUTA 1GSOA 1UIMA 2IVFA 3MRSA 2D1RA 1ADYA 2YNMA 1YL7A 2BLLA 2P5UA 3EZFA 3BMNA 1LXCA 1T2EA 2WWHA 1R4AA 5JWHA 4MUKA 4GMHA 5P21A 4EGSA 3GRUA 1U7XA 3D3EA 3QY0A 4NU0A 1QRRA 1RQRA 2GZDA 4RTSA 2DFDA 5CX1A 2LD4A 1TUIA 1PTKA 4ZHSA 5DX1A 1M8GA 9ATCA 1RYZA 1IXSB 2C84A 2WMDA 5BQ3A 5FTMA 1DC4A 4YDQA 1THZA 2R1UA 1ZZGA 2BN4A 4J94A 1F06A 1Y4SA 3KZVA 4X3PA 1KK0A 5IJZA 2XXAB 4B3RB 3ELBA 3KOMA 2D0DA 2HHLA 3WI7A 3AHEA 4B6FA 4E5VA 3FDXA 1XHLA 4J2OA 1WUJS 4IJQA 4MDFA 5DM61 1P7YA 1YDFA 3HU3A 2NO0A 4JP2A 1VHQA 2E4AA 3K5HA 4KFTA 2G9UA 3DKRA 2GDJA 1ZJJA 3E7PA 2DR0A 2C2YA 2HV8A 3ZZ1A 3GEGA 2PXAA 2HEIA 2I2FA 5ER9A 2TMKA 1N6PA 2NZUG 2R48A 2QZ4A 1S8FA 1F2UA 2VWGA 5IYZA 3C7DB 3GAFA 4CLOA 3HMKA 3Q3EA 4Y9DA 4NCAA 3GBPA 3IA2A 1U6IA 2A58A 1O6BA 3QBTA 4YONB 2A6PA 1AC5A 4IX1A 2TMDA 4DA7A 4A03A 2L19A 2B2NA 3ZNQA 2ZBVA 4MB0A 1J9EA 4PYOA 3DBOB 3IJ5A 4TKVA 5DYWA 3PBKA 5CFQA 4J1TC 1JKJA 2BSAA 1TM1E 2YHUA 1WE2A 3OCYA 1RRFA 2Q9CA 3QKRB 3B08B 4TL6A 4Y9TA 3RFFA 2QLLA 3KQTA 4D8VA 4WVLA 5IWAB 2Z6UA 2V7BA 4YJFA 5AM5A 2FGKA 3LP5A 4CG0A 3GTJL 1K9SA 1AUPA 1NVTA 5HF6A 4QQRA 3QTTA 2GJ8A 2PJRA 1J0DA 2QY9A 4G5RA 3SICE 5CDYA 1H93A 3W6PA 5L4LA 5DXAA 4LVOA 1IEQA 1UMDA 5FPPA 1EFVB 3F7TA 3ND5A 1SUEA 5C3EL 3UAWA 5KVVA 5DIFA 2AN9A 3FCYA 1Z2DA 1CUVA 5J40A 3TI7A 1S2IA 1GV0A 2JGDA 2W6ZA 4KYIB 1YAHA 2L2QA 1XRSB 4TWRA 4BX0A 5JH7F 3DJYA 5JAMA 5TGZA 2EIXA 4EO9A 3W5BA 4PS1A 4Z0PA 3K0AB 3Q9LA 1C9EA 2FAXA 3ISTA 3R8CA 3RODA 2ZU6A 5DXJA 2C5AA 5J3JA 3I34X 4ZANA 4BWFB 2FE4A 3WRVA 4B79A 5JSQA 5KVSA 2ZT5A 4B32A 3AB7A 3LWVB 4LYAA 3URMA 4CM8B 4JAGA 1F17A 2VCEA 3AJ9A 2J45A 3PX2A 1XCMA 2K7ZA 4MB6A 5M34A 4Y8VA 1GQOA 1NLUA 2MTBA 2NOAA 3C39A 4US1R 4XUCA 5TS3A 4TPKA 4V0QA 3L1JA 1B6GA 2IXEA 2X9VA 3N2NA 5B6IA 3ZHCA 4OP3A 1BJRE 1WX1A 4N48A 2Y27A 3DHWC 4O5OA 3NXSA 1JEQB 3F74A 4LBZA 1CJCA 3HP1A 4EA6A 1Y8ZA 1AZSC 5J63A 1W6UA 3BHMA 2QTWB 3LK7A 1SC9A 2WJWA 2AW5A 4C3UA 5JW6A 2VQ6A 3PUKA 3GGOA 4QUJA 2GTHA 1JMYA 3CURA 1KY5A 2GZMA 3DUWA 2HBZA 2XDYA 4C4XA 2DWCA 2EHDA 2WBLC 4R1LA 4EL5A 2WFZA 1ZIYA 1EE9A 3Q3GE 3I9MA 4EM6A 1WXWA 5COAA 5EE1A 4EDHA 2QNRA 4EY3A 5ERGB 1XAGA 1NE7A 1ZH2A 1TC2A 2IEDA 1Q2UA 3SQMA 4A6XA 1YZVA 4B0OA 2C9ZA 1KJ8A 2RGDA 1G8JA 4IWXA 1E20A 3H8JA 4KGVA 4GQIA 1JL3A 3AHIA 4RDIA 5KYGA 3A1TA 4BLPA 3T3PB 5FQOA 4YC7A 3R9XB 3C4QA 2YV1A 3UAYA 4GKAA 1GL3A 3SZUA 5CD9A 3UBTA 1TTQB 4ASUD 2QT1A 4BFYA 5KNLA 1YJCA 1FF9A 2PVSA 2R7LA 2NPOA 5AKXA 1VBMA 4BO9A 3O0TA 3GRYA 1JSXA 3P0JA 3IUMA 4OHVA 1P77A 3GFQA 3M3DA 1XCOA 3OTHA 1VG8A 5JMPA 4ZGWA 5HKKD 4ESOA 3ROZA 2MWMA 2NSJA 4M7OA 4RFLA 4H3VA 4BX3A 1DXHA 1H6DA 1T9BA 1TA9A 5BUSA 2O2CA 1E62A 3B9BA 5TC4A 2I3DA 2ADFA 3ELYA 3SBEA 3EA0A 4PQYA 1I36A 3P2MA 1MX5A 1E1CA 1QP0A 3G9ZA 4K9QA 3JYQA 4XB2A 3SHOA 3UTDA 3RO7A 3X2SA 4EWLA 1KHHA 2REQB 1D6JA 1PT8A 2VYNA 3MFQA 4QYIB 4W9RA 4ASUA 4CL0A 4XYLA 4MRNA 2V7XA 1HRDA 1TTHA 3L6DA 2GH1A 3GT3A 5ITSA 3ZOZA 3WDLA 5IYDL 3NWPA 2QJWA 3OBIA 1B2OA 5AVRA 5F2NA 3JD3A 4LDZA 5C34B 3RAEC 1KR2A 1Q7TA 2VDWB 3HOXL 3LOUA 2VHJA 2AD5A 3ACCA 3GC6A 3JD4A 4RM3A 2CK3D 3OZUA 2PMFA 5G40A 2F3UA 1X86B 4KQXA 5AHXA 1Z25A 3VI4B 4CV0A 1JB9A 1A9QA 1CBUA 4LPKA 5KJEA 3VYTB 1FW8A 3BAFA 1XZPA 3C43A 2D1SA 1H66A 3QPAA 4IDGA 4KAJA 4M1KA 5IJ9B 1W19A 3GEPA 5GAEc 3KJEA 4YP5A 1QHEA 3G8CA 4F5EA 1X13A 3T12A 3JVIA 2QL5A 4XVHA 4QZVA 5LWHA 4AYTA 4BYGA 4NC9A 2UYGA 3IUEA 2IGTA 4EW1A 1XZLA 2P9CA 1UM8A 2HO4A 4QAJA 2BGWA 2I4IA 4AJLA 1KMCA 3M3YL 2IL1A 1WMDA 3DPSA 3FNEA 3FRHA 1T2CA 4QDJA 3WQSB 4CODB 2R87A 1RMTA 4JIGA 3ZH9B 4LYHA 4XXHA 1MO5A 3HZRA 4JP1A 4A92A 5ECYA 4F7WA 2ZSAA 2GS9A 3BTOA 4ZCPA 3HOWL 2AQ8A 3BD6A 4HNSA 4O4JB 3VDNB 1H42A 4N5DA 4GBED 4DDTA 2IOFK 3N53A 1R7RA 2GLTA 1YR6A 2G63A 4HX5A 4PR0A 4DDUA 2NN3C 4LC0A 4CIWA 3C16C 1PWYE 4UBMA 3ZBPA 1EX9A 1T5BA 3S0JA 2OBBA 2J87A 3U4CA 2HK8A 2QVYX 5EPOA 4RJIA 4EJ2A 3EGDA 5AKEA 2HLNA 1JSZA 4CJXA 1FQOA 1JGTA 2GR9A 1IBCA 1NVKA 2PSHA 4YP7A 3X44A 4LQLA 3B48A 3ZWWA 2WHEA 1AMNA 2P2GA 1F2VA 1PEDA 3BEOA 3CC8A 1I01A 4CCSA 2FHPA 3W04A 4FBLA 3EXIA 1C9DB 1RYNA 5JPIA 1MQSA 4Y7DA 3ZE0B 2WE8A 5TQVA 5I4KA 4BNJA 4U3JA 2RB4A 1Z2NX 3G1UA 5EMKA 2AA3A 4D9HA 2A9VA 2O8VA 1T0IA 1Y3CE 2JJ8A 1KI3A 1YHNA 1DKQA 1W36B 1PSDA 4R1NA 1SIOA 4JJ8A 4TVMA 1FP2A 1ZXLA 3P0IA 2X5OA 1NULA 1SIUA 1Z5PA 1QK5A 5EUQB 2JFGA 2ATEA 3DBLA 3I4FA 4JITA 5JC8A 2PGOA 1IDN1 1VJ5A 4H59A 3TJRA 1FOEB 1NSFA 1O9GA 1KMMA 5KJFA 1H2XA 1JHAA 3AETA 5CYGA 1CC1S 5INTA 4N0QA 1QTNA 1DT5A 3WYCA 4LCBA 1E2FA 4MS3B 2XA9A 4F93B 4R9SA 5E4TA 4LHNA 1XTIA 3LM8A 2CVHA 2AFHB 2JJ1A 1YZUA 1RQXA 1T8PA 4YH1A 3U3MA 4AKGA 2IYSA 2GD0A 2VP6A 3VC1A 3ENQA 3PUYA 4BP9A 3CUVA 2XQJA 1QV9A 2B9VA 3DT6A 3U3ZA 5C8XA 1SBQA 3VC7A 2Q0SA 4GI7A 3N59A 2XY4A 3MCUA 3AR4A 3ZXYA 3EC7A 3QUSA 1FNMA 4OH1A 1QZXA 1OH6A 2HMYB 1NMYA 1RQGA 3NEPX 3QA9A 1JU9A 4OXKA 4JI6B 4S1VA 5HR5A 1XYYA 2I8CA 1IHPA 2LZ0A 4P4SB 2W6NA 1X70A 2QN9A 2JRLA 1LH0A 3P9NA 3TIVA 2C2MA 4BNTA 5FWYA 5HEKA 4OI2A 1OI7A 1E0DA 1WHSB 2OYSA 1B00A 2VF5X 5FTLA 1WTAA 4QBFA 4TLBA 1UWCA 2O4CA 3A0RB 3M83A 3QOWA 2N1MA 4RS4A 4DMCA 5E7QA 5IARA 2DWQA 1MO6A 2AC4A 4Q37A 4TUYB 1JAYA 3AJAA 4LZJA 4MYDA 4B8CD 4CEJB 6Q21A 1SCQA 5KDOA 4EI7A 1QYBA 4LEIA 4TV9A 5DP1A 5FYDA 1T91A 2J30A 2IV3A 4RL4A 2GF0A 3RC2A 1IHYA 5LYJF 1BGWA 3E8SA 3PDUA 2WQZA 1ZX1A 1QOQB 2XYVA 2G82A 3K3PA 3O26A 2WVJA 3PGJA 1QH1A 2EJTA 4OHCA 4RZHA 5F2KA 3EUWA 5DCWA 4I4TA 3FWNA 5JNTA 4ZVQA 2GVZC 5E6UB 1EXDA 1RHJA 2B37A 5B5SA 3M1LA 1MA0A 4RJ2A 5FPYA 4TYNA 4HDQB 1Z37A 4FT4A 2VPXA 3A6DA 3IVAA 4PYLA 1EA5A 2F64A 3KUCA 4HRVA 3HCEA 1FXWF 3GBSA 4KXQA 3CPSA 4XI9A 3TQTA 3I5XA 1GJRA 3QVTA 1U8XX 3QVDA 1Z0IA 1MOZA 2PT9A 3VPGA 3AR7A 3LHIA 5KSPA 1Z8FA 1FFXA 1WY5A 1VSUA 3CEAA 1YCFA 3DE3X 3RYFA 3O83A 1WQ1R 3MJCA 2FPXA 3UJAA 4BQOA 4DCOA 1K3FA 4LTMA 4TXJA 2GYVA 3CHYA 3QBEA 3U3OA 2VRNA 4ANFA 4IIHA 2B7BA 2K87A 2OHGA 4GP7A 1F8GA 1SG6A 1F2DA 1M1YB 5EZYA 4QD3A 5A4FS 1Y3DE 4DYVA 2ZB4A 2ZIVB 2Q2QA 3OCXA 4LTNA 4M0MA 4MWEA 4WY5A 2FG7C 1YQDA 2GM3A 2N42A 4D44A 3CGGA 4AM8A 1Z6XA 3SE0A 4XGNA 2QZPA 3B89A 4RD2A 1IU6A 4HDNB 1SKMA 3E5HA 1WKCA 5FLXA 3PFGA 3QUAA 4H7HA 2BKLA 4NU8X 4XFKA 2ZXUA 1X39A 4KQCA 5E2BA 2WWGA 2EZ8A 1MTZA 5FEUA 2HNKA 4DT1A 1IUOA 2W6OA 4YUXA 1GUFA 1P2DA 1W87A 3BTSA 1LVGA 3QUQA 2PBZA 2HIAA 4FWBA 4NU6A 2YHIB 1H5QA 3F98A 4UZSA 3WOHA 4B84A 2QRKA 2CJXA 4KRFA 3T3NA 4BBAA 4IF4A 3HB0A 2COUA 2VBIA 5M5YL 1XMIA 4IDAA 5HE8A 2GJKA 3QKSA 2QJRA 1TKCA 2VF8A 3LUCA 3IDAA 3HCRA 2YMQA 2UUBB 3OP1A 3MTGA 1DXQA 1BWQA 4C3HL 1LF0A 1RYBA 3JWHA 3GRFA 4I2NA 1PO7A 2ZULA 2XEXA 4HQKA 4JQSA 3ROGA 3L7AA 3R3UA 3UIEA 3HADA 4RK7A 3QOYA 1UH5A 2DUWA 2I34A 3AHCA 3BJIC 1SQFA 4G56A 4HTFA 2BFAA 3LHDA 2XQGA 1GDDA 4U671 1KAGA 1E2IA 1XDUA 2D8AA 2FJ0A 2IYZA 2ZSDA 4PC2A 3MNFA 4GBMA 4Q1AA 3WJ2A 2RC6A 3FSGD 3IHTA 1YJ8A 4H7JA 4PEVA 3WIUA 1GPYA 1ZIDA 2B1RA 5I3CA 1VLJA 2IDMA 1NBME 2QTVA 5TVKA 1A7KA 1Z62A 1HYBA 4ND4A 3A2NA 4BLSA 3QEOA 1FJXA 2GT1A 1HDGO 1VBNA 1L1RA 3VR2D 2ZIWB 3VH4A 2BONA 3PHHA 4NZZA 3UANA 4G37A 4G5OA 5J4LA 1V45E 1PGQA 1TCBA 3JD2A 5C1IA 4O5AA 5HGJA 5CBPB 2I3GA 5TMPA 1DBSA 2Z6QA 4HB3A 1SELA 1BVYF 1WUKS 1U28A 2A9FA 2F7SA 3R09A 5BV2P 1NJ2A 3U3JA 4C1BA 4AMZA 3EIQA 4G23A 1T4GA 3U80A 2JLXA 3AEUB 3BX1A 5CFZA 4GEKA 3REGA 3GRZA 4O1IA 3BWMA 4XGQA 4ABTA 4BB9A 3PWFA 2Z2ZA 4JQYA 2PKEA 1D2NA 1JA9A 2RG1A 4URWR 4XOUA 2ZBRA 5JFTA 1IAVA 2PGDA 1QQTA 4MTCA 4KO4S 3VR2A 1NG9A 4IDQA 1GQSA 3EDQA 5G1OA 4REOA 1TT7A 1ZVJA 2GEUA 3AU9A 1FDWA 4LF6B 3RHSA 1I4DD 1OILA 3R74A 3G1WA 3OHMA 1T34A 4KXXA 3TDKA 3SR3A 5AJVB 2O5JD 2QAGA 2UZ1A 4U2FA 4ZCTA 1GUBA 3M4YA 3ENVA 2RK4A 1U2QA 5DB4A 4JMLA 4DDMA 1ODKA 1H0SA 1THMA 1VBKA 2ACEA 2MMGA 4RJKA 5EP1A 1QMPA 4IQFA 3T3MB 1AH2A 3CW9A 3Q5GA 2WJAA 3MMXA 4OM8A 4X90A 1NI4B 1KGSA 2CWDA 3V8QA 5KWJA 1M2EA 2WPNA 5H68A 1UPUA 4LRUA 1JV2B 4DQDA 1UQTA 2O07A 1VI6A 5T57A 4PCVA 3UPDA 4EO7A 4XRGA 2VKQA 2BJWA 3RARA 1JPJA 2ZSBA 2XKAA 2AN1A 2O6LA 3UOGA 2ZCUA 4BJHB 5CDHA 3SXUA 1N32B 2P62A 1XELA 4FMBB 4OL0A 2Q07A 3AEZA 2HZ7A 3IQFA 4YAOA 3V1KA 1N34B 1YR3A 2OFXA 5JUWA 3MT0A 1R64A 2YCBA 1Q7CA 3RAPR 1RC8A 1KZ1A 4JB0A 1SZPA 3KQNA 3HKDA 3T7SA 5I3ZA 4F45A 4D80A 1RQ7A 4J03A 3IIKA 1DAFA 1S2GA 1P2TA 3ESAA 4HAIA 4ZAGA 3ZE8A 4F12A 1AXGA 3CX3A 1UP7A 2P2SA 4URFA 4KPUB 1V7CA 3OTWA 4WUVA 4JI7B 4IMPA 2YL2A 3I9LA 3MGKA 4JKIA 3ZLVA 4RZSA 1N2CA 2ZRIA 3TO5A 3D8SA 1P6XA 4JJKA 2FFAA 1DQPA 4P1ZA 4QDOA 4NZ9A 3C0KA 1O0BA 2CLLB 5JISA 3SQNA 1OI2A 1DI0A 3A37A 2DBZA 3GI1A 1Y8RA 2IUFA 3BH7A 1LFAA 3W2TA 1AKUA 2P41A 1LVUA 2I7VA 3AQIA 3CZRA 1X7ZB 1I80A 3DCJA 3HKBB 4PC7A 5LB2A 1YK1A 3RVQA 5EZSA 1H94A 5FX2A 4L85A 3IH5A 1QQ6A 2WNSA 4P0TA 1SMMA 1LF5A 3RZDL 4Q18A 4CMIA 4HYEA 1M34A 2BCJQ 4UHBA 2R6ZA 3HJFA 4IAOA 3LCRA 4LW8A 3WGGA 3I28A 4KIGA 5EMHA 2Q6IA 4D2IA 3IT3A 4MV4A 4F5ZA 4K9SA 5IABA 1VYVA 3PXBA 4Z4QA 3OZEA 4BMZA 3F46A 2ZUWA 1SK8A 1XXHE 5SZJA 3V1UA 1U04A 2DPYA 2CW5A 3LT0A 4KR0A 4U0KA 3BE5A 3W4KA 2H6EA 4B76A 4CTNA 1RRGA 3R7SA 5EEGA 2J3IA 1VFPA 3WGQA 2R6JA 1UOPA 2EZ9A 3EEYA 5AXBA 1MGPA 4GLBA 1NFRA 4M1EA 4X7BA 4IQ8A 4W5QA 2G1UA 4MS1B 5C4MA 3H9GA 3DHYA 1QAMA 3KLPX 1EEHA 2NNWB 4KLRA 2C20A 4N7BA 5H9VA 4QQFA 1H8ED 2DPHA 2R4TA 2G5TA 2CMKA 3SAJA 5EGSA 3TUJC 4A8TA 4CNBA 3CNBA 4KQIA 4OQYA 4F72A 1P1FA 4MV3A 2C4NA 5KTMA 2X9LA 4D98A 2M4YA 1T4BA 6REQA 4S04A 3AIIA 3THYB 1VPWA 3DW1X 3B60A 4DY6A 4US2R 3FKIL 4RPJA 2C3PA 2ORWA 1FUYB 1A88A 2Q3HA 4QFDA 4S35A 4Y6RA 1O0CA 3H13A 3AUXA 1QFJA 1Y8QA 2B8JA 3C48A 1V43A 1HDOA 4W9NC 5LYJA 4NFYA 5ENDA 3GEDA 1QYVA 3BICA 3B78A 3O3MB 4C0AC 3WK7A 4X6XA 3NYQA 4HDCA 5C7OO 3AFGA 1P1RA 2Z58A 1VE9A 3EWAA 1ECGA 4XTCS 4BEJA 5HA5A 2HIHA 2ZROA 3D4LA 3K0KA 4QOHA 4KN5A 3AWIA 3V7FA 3NHLA 4E5UA 3P9YA 3CKKA 3OQIA 4N82A 4C7KA 4DNQA 5IKEA 1YB5A 3CVOA 2WB2A 2H7XA 5HHTA 2EJVA 1W25A 3WQBA 3CKYA 4KWIA 2O8BA 3U48A 4IIDA 5B58T 4RVSA 2R8OA 1WDTA 5KC8A 4QAQA 1KQPA 1UJCA 4KVAA 4ND5A 1T5TA 4RM2A 4UPVA 3AEKB 1LK5A 3LK6A 1S01A 4MDHA 3AF1A 2EL7A 1JT9A 1JKMA 1ZCAA 3QXGA 2WHRA 5D6OA 1BGXT 1CNEA 1ECCA 4JDUA 4JFRA 4Z9AA 3Q2KA 2PZFA 1OFVA 1VLQA 2WTAA 2Z4SA 5DYTA 3TLKA 4MKIA 2ORIA 4X7RA 1SXJA 3BFKA 5F1OA 1Z4KA 2ODAA 1N7IA 1CUDA 4PLGA 3ZDEA 1G64A 3AK4A 3OIDA 1ECJA 3OJEA 3OLYA 1MH1A 3GUUA 5CXSA 4EA9A 4A3SA 5GINE 4JXZA 1QRDA 4AYXA 1WNTA 3PIIA 2AOUB 3W8RA 3HY6A 2K2WA 1GFSA 2I6QA 2CZCA 4ACBA 3OC0A 4PPGA 4R8SA 4UEQA 4A3KL 1DIAA 2IEYA 3GA5A 4RD6A 1SCAA 4R84A 3MYRA 3ZV3A 2JGKA 4QXPA 1K4KA 2G71A 5IVIA 2B4YA 4Q15A 3NS7A 4F11A 1TWGL 5ADWA 5RXNA 4LC1A 3LWDA 4KNWA 4LFCB 2NVWA 2DR2A 1SD2A 1T3HA 4KJXA 4D74A 4X6AL 2QRMA 5GTDA 2Q1SA 1PU2A 2O1XA 4ECEA 4AUKA 5F5XA 4M7RA 3KFXA 4KV9A 2C5EA 1EX7A 5IJ0B 5IXJA 1H6AA 3CH6A 3V00A 5JHGB 2CE7A 4B6RA 3MTQA 3ZVNA 4B45A 4Q9LA 1REQB 1I1HA 4ZYLA 3RSFA 1A7JA 2Z09A 5B6JA 5BW8A 2BGIA 4AO8A 3CY6A 3UA3A 1GRQA 1J7KA 3M6MD 5IVPA 4FKBA 4RH0A 1A9SA 2AXNA 3TSZA 4DHWA 3PDIA 5AXCA 2G1KA 3T1YB 2QX4A 1N1DA 1UXGA 4ZQGA 1XNRB 3HOVL 1HF3A 1J0XO 3HG7A 4YRQA 3S70A 1Q0TA 1Q0PA 3CZ4A 4Q4AB 4A8PA 3A3NA 2W58A 1TVMA 1W30A 1QLJA 3GQVA 1N78A 4NPHA 5HK8A 2O8FA 3CX7A 1XZBA 3O8DA 4B3TB 3RK1A 1S96A 3R76A 4U39A 5BWMA 5AUPB 1F3LA 2RHWA 2RBKA 3QKUA 5CGQB 5ALRA 3ZOKA 5IKMA 5BN1A 2Q5OA 2FEKA 3FHCB 2M6OA 4E30A 4YRPA 1E9BA 1ECBA 2BZ0A 4H4DA 4OKIA 2ZAIA 4ZEWA 1Q77A 2PX4A 3HCFA 5F3RA 4RSGA 2HWKA 2WTMA 4P5EA 5E2IA 4N3BA 3IAHA 3N2KA 1YUZA 3PXUA 3FGOA 4H4CA 4D96A 1EDZA 1XD2A 1QVAA 3UFXA 1VL1A 4P5DA 8OHMA 3B8EA 1J5XA 4DLLA 1EJ0A 2XUJA 2C07A 2C04A 5FLYA 2OD7A 4GO1A 2CDBA 3DEZA 3UHFA 2ORVA 4OHZA 3V3TA 4NJOA 3ZWAA 1NFQA 4QTYA 4UE6A 4J4HA 1XJ5A 1A7AA 4K6FA 4OYHA 5G3YA 2ZBGA 4NZNA 5DU2A 1PUXA 3MWJA 2PSDA 2GO1A 3MSXA 4GMKA 4MKFA 4LWOA 3NKLA 1KMHA 4X20B 4Y52L 3MUFA 5K09A 3LL4A 4UHHA 4JBHA 2BFCA 3A1WA 2OHOA 3FYSA 3H04A 1L5ZA 1YUBA 3G2NA 5CK5A 3TZKA 4A3DL 3C97A 1D0IA 2YC4C 3G7NA 1S89A 1ZCBA 3LT1A 4JENA 3JQAA 4C20A 5CNIA 2X0RA 4E7OA 1Q44A 1BU5A 1DWOA 1MABB 1LTQA 1SA0B 2SNIE 2M6PA 3H0KA 5ECDA 3THOA 4YV1A 5LQRA 2XE4A 3PFCA 4QTUB 5EUCA 4GI2A 4IOJA 2P1DA 1Z7EA 2XGGA 3LBNA 5DISB 5CAEA 2QUBA 2X5KO 3HPQA 1LQUA 1O94C 2V3WA 5ARCA 4BFUA 4BP3A 1GCGA 3UT6A 3DQZA 2VR1A 2EKQA 3EZ2A 1O97D 2AR9A 1M75A 2BEUB 2P6PA 2X13A 4IINA 1N1MA 4IJWA 1ULBA 3TPFA 4BB6A 5GIOE 4CE6A 2R00C 3RK4A 1AKWA 1R5OA 3EUAA 3O9MA 4C4YA 1E98A 1GTMA 3M6AA 4Z51A 4YJHB 5BURA 5JCJD 4D4LA 1ZOLA 3KOWA 5BV0A 4MR7A 3VO8A 5IXSA 3TVYA 5AI3A 2ZE7A 3EK2A 2QUIA 4J9VA 1R5JA 4F2DA 2UUPA 3LHSA 2DBVO 4PF1A 5BPFA 1B3BA 4DFDA 2LIVA 1M6NA 1V4VA 1Z33A 2ZIUB 3OUTA 4FP9A 1YDEA 3JRXA 1GKUB 4PZEA 5CA0A 1H05A 3OJOA 1U0EA 1W4BA 5H4HA 4Z1MA 3KQOA 2PS0A 3FKQA 4E0BA 4P2GA 3F6SA 3T7KA 2WD9A 3T7TA 4OHXA 4PLCA 4C4RA 4UUQA 3QJ5A 5CU7A 4QWMA 2JD0A 1HTBA 3ZUPA 1K8XB 3PE4A 1Z0DA 2G3YA 2NO6A 4POFA 2B4KA 5HJEA 1O58A 4B46A 4OGLA 2AKAB 4RIEA 2JI3A 3RSZA 3BUSA 1OLOA 3EGVA 2OUIA 3T8YA 4E32A 5EJFA 4YX9A 1T35A 2C6AA 3JYPA 2QQ5A 3H4MA 5ILQA 5TXGA 2NU9B 2BW0A 3VO2A 2H00A 1KQGA 2FLWA 2VQDA 3H8WA 4N03A 2BTOA 2W6JA 5EESA 4RO0A 4KV7A 4RUKA 5GV7A 1IW7D 3GCXA 3KQMA 4D79A 4TX1A 2ERCA 1FDOA 2CLSA 4NZPA 9LDTA 5JECA 5H80A 4U7GA 3LVFO 4X71A 2BFMA 4Q12A 4Z2YA 3X3HA 3JXEA 1NQOA 4KTTE 1SUAA 4TPUA 3A1NA 5AKYA 2R92L 1WB5A 1XJQA 3AF3A 3AESA 1NBAA 3KJHA 4BCBA 4BEVA 2E4XA 3R5KA 4HAYA 3TSAA 4N3CA 5DK4A 2C2XA 3EQ7A 3C74A 2YH2A 3P2KA 5TT1A 5KNDH 3LPAA 2Y0PA 3TQRA 1KAQA 1LRKA 4EI9A 1ETUA 4G1BA 3PIRA 2HU2A 1PE0A 4FN4A 1MAVA 1Z0ZA 4A10A 4X1KB 4MINA 1OUMA 2J4DA 3EYWA 4FC7A 4KAAA 4K6HA 3AHFA 1PZNA 1SIBE 3S2SA 3ZV7A 1ODLA 1YQQA 2Z1MA 3AQ4A 1UZAA 1P4AA 1STOA 1TO2E 3DM9B 1LSJA 3G9QA 4ZN3B 1Y8AA 2WV9A 2OXIA 4BLQA 4QO8A 5EINA 1AKQA 4ZT6A 7ADHA 5I5EA 1UXHA 5BUCA 4C2BA 4MCAA 5L4NA 1CVLA 4GPEA 2UZAA 3LOPA 2DR3A 4CQLA 1DPGA 2PA0A 3O9VA 4IYJA 3Q0TA 1KEWA 4F5DA 4JI8B 2IHYA 5KYXA 1JYFA 4E6PA 1Q84A 5E3HA 3NBMA 4V0ME 1LDGA 4B85A 5AVOA 1EM8B 3D4OA 5C32A 1N8NA 2VXBA 1NF3A 1XPUA 2Y0SP 1JTVA 2V8BA 3MINB 1WM1A 2VK2A 1AQJA 3BB4A 2B2XA 2DHDA 1EFHA 2BTQA 2X7XA 3DBRA 4DBLE 4ZDWA 4DABA 1ZISA 1KVRA 5DLPA 4CLRA 1RLJA 1FSZA 3AP1A 5GV8A 4L5AA 4YAEA 4KR3A 1DLIA 1ZBDA 2ZVPX 4TKZA 4C7OB 1PEYA 3ZD6A 3AHDA 3HN7A 4XASA 4ZVRA 5K3FB 3TW8A 1PQUA 1P9NA 1J8YF 4F8EA 1MC8A 1QQ7A 2C1ZA 2HJGA 1Y1LA 4HWSA 2LTAA 4LS3A 4Q9NA 4RABA 4YDHB 4IEIA 2YU9L 1QIKA 4PYJA 4BU0A 1POXA 4WECA 1QLHA 3LUPA 3FFAA 1M6EX 1GAJA 4ZI7F 2O5EA 4HQFA 4D97A 2SKDA 3NTVA 3RVOA 4UBIA 3S2HL 2GD6A 4EECA 4O4LF 2QJFA 4CCWA 1EFCA 5B36A 5AW0A 4UHFA 1AKRA 5AKGA 1UWVA 4NCIA 3FI0A 4A0HA 5BP7A 4KZKA 4ND8B 4AULA 3KX2A 1AHPA 3HDHA 2JF0A 3TG8A 3EWSA 1A98A 2WB1P 2WM2A 3IIMA 3EMDA 1GG8A 2GCOA 2VJMA 4R3UC 3ZWMA 1YZ3A 3ZX4A 2JIZD 3ZHXA 4CIXA 3I1IA 1D5WA 1V0JA 3LRTA 3RT9A 4EUHA 1H9AA 3B13B 1H7VA 1CUEA 3PT9A 1YZHA 3K0FB 1JYBA 1US8B 2IFTA 3ND9A 3IGFA 3NX4A 3TNLA 5M29A 3SQDA 4V3CA 5A6SB 5IBCA 3IBCA 1C1DA 2VHWA 3ZZNA 1E1RD 3GX1A 16PKA 4Y2HA 1QQBA 4UVEA 3SZGA 4CM6A 2OV1A 4EITA 4HADA 1E7QA 2LCFA 4X1YA 4I50F 3VKUA 4G0MA 1QJ4A 1Z63A 2DX7A 2X1VA 1UPBA 1V8ZA 2AQHA 4Q05A 3LPCA 5B58C 5JATA 2XB8A 3RVLA 1KDPA 5AN9H 4HMPA 4RPCA 1JXAA 1BE8A 3AGQA 4D41A 5BSKA 1KA9H 3K8YA 4U4AA 3V42A 3ESZA 3NBYC 3ZHTA 5J2UF 3HL4A 1BIFA 2WE7A 1JFLA 3CEJA 3ZBUA 1C3EA 1U0RA 2B4RO 3SVZA 2A59A 2QE6A 2WUFA 5DRYA 4DCMA 3ZWVA 4KITB 1O96A 4B82A 5BVHA 2G4LA 1RJ9A 2DY0A 2R85A 3GVCA 1LGYA 3FYUB 4LY0A 4E09A 2ZJ3A 1Q0ZA 1R0HA 1GQRA 4HLUA 4FFSA 4JBXA 4M0EA 1HQCA 5CFMA 2HD4A 5T8KA 2WWYA 3IP6A 3K8QA 4FFBB 4HRAA 3LC0A 2IYRA 2H5JA 4D3YA 1Z4OA 2JVJA 4PICA 4TMTA 3E3LA 3UJPA 3QVUA 5AJTA 3KZMA 5EPEA 3F6EX 5AVYA 2BMAA 1DV2A 1MJNA 2O06A 2C8LA 3RKRA 5JEEA 3D1VA 2YOHA 1PHPA 4CTKA 7GPBA 1ZK4A 2NTYC 1PS0A 2JAUA 1V7ZA 3ZBQA 3RKUA 5LP6A 4JJFA 2O3JA 3KOOA 2FX2A 4QUBA 4GSKA 5JYDA 1I3QL 3DVRX 3ZCXA 2GMGA 4FVTA 4RWZA 2LCIA 3GEMA 3DBHA 2D3TA 3BB1A 2GCEA 3HB1A 3GJ5A 1ZW6A 4JC5A 3SXPA 5I9LA 3M1AA 1E1QD 2C2ZA 2WSYB 5BOVA 1SG0A 2O7SA 4R51A 3ZY3A 1E3JA 1D2MA 1P6UA 3O7MA 5COQA 2QROA 5EP4A 1C1XB 5AJWA 5HM6A 1U2SA 3DHVA 1TKAA 3LQRA 1T9PA 3KLOA 1QK3A 3PGLA 4PO3X 4OX9Y 1KRXA 5TARA 1K7FB 3KYCB 4WINA 3R5SA 1FHMA 1KK3A 2O2ZA 3CQ9A 3E4DA 3NTXA 3W5UA 1QC5A 1T2UA 4B4UA 4CGYA 2CFTA 2OCPA 4R40A 4WX2B 5E9JA 1Y37A 1UQRA 3DB1A 1LBTA 1MT3A 1ST3A 1C2YA 2XHEA 1V4BA 3CRQA 4KYTA 4MV7A 3FR8A 2Z8YA 5DNWA 3REQB 1GTG1 2IZZA 1BMFD 4G1VA 1IXZA 1F14A 3GCGA 4HDSB 3WMRA 1VE6A 4DIFA 1XFAA 2W8BA 4Y6OA 3ZUGA 4JYZA 4PG6A 3BERA 4XDYA 2WNIA 2ZZNA 1MV8A 1OKKA 2DFLA 3QU7A 5D3MA 3CLUC 3TLAA 4BVFA 1U9YA 4WWHA 2VSYA 1P18A 4RKEA 3UXYA 5U9CA 3GN2A 3OJLA 4Y2JA 2XOKA 3OOWA 5HFJA 3P9QA 2I1LA 3STHA 1PJSA 3NANA 1JG7A 1PQ4A 1BZYA 3GT4A 4G9GA 2AZTA 1RLMA 5SY4A 2VJNA 4BO0A 1U9IA 1ZRHA 4L08A 1DJLA 1KK2A 1TJ4A 1XSEA 2X3YA 1JQBA 3JVEA 3RSHA 3GEBA 3IXMA 1AKEA 1OAKA 4IGFA 2ZUVA 4MRMA 3V8MA 4EI2A 5DW0A 4NJMA 3Q12A 4C3IL 1TIKA 5IWCA 5EY5B 2VATA 3OLQA 4H7IA 1PFGA 4ZO9A 5JJ5A 2GBPA 2IBMA 1V5FA 1CUBA 2DBYA 3ONEA 3QYPA 2PRYA 2Q4EA 2ZTHA 3BE6A 3AONB 2G76A 3O8OA 1P5JA 2Z1DA 3DZJA 1VLMA 4B7XA 2J3EA 4CQMB 3RK0A 5EIXA 3I01M 2P3QA 3FY4A 1KDRA 2YVUA 1TU4A 3QLUC 5CFRA 1R0YA 3UAOA 2PU5A 2AE1A 1LKPA 2ECOA 1DBIA 2R3SA 4PINA 1JIUA 1XKTA 1G291 4LQDA 5E7MA 1YK5A 1Z2CA 3SS8A 3WMFA 4AQDA 4R05A 2GJSA 4YRSA 2JRCA 5MN4A 4FJ1A 4P32A 3LQFA 4HWRA 4MQMA 5HZHA 1I14A 4DA4A 1E9SA 4R54A 2F9LA 2P7HA 4Y2YA 3TNDA 5C4XL 4Q4JB 1W2WB 1ZUHA 3L93A 1CNFA 2CDAA 1GPWB 3B1XA 4OPMA 5AT1A 4BKMA 3M4OL 1HZJA 4MVJI 1QGYA 2EKPA 4MRRA 2CCGA 2QAIA 1QANA 2CLDX 5C7IO 1EK0A 4FHFA 2I6GA 3VV3A 1UPFA 2HX1A 5DNCA 1R16A 1RIFA 2ERYA 3T7JA 4C3VA 2OBLA 2J9XB 1JPNA 1TZCA 2O2JA 3NAZA 3R77A 1P2GA 2Y1GA 3KG2A 4HWPA 3KUDA 1AKVA 3WL4A 3GZJA 5FO1A 4P33A 3BQ9A 1XZDA 4LJKA 4JN6B 2CXRA 3HU2A 4CTJA 1U0JA 2QB5A 3NHUA 1EWTA 2ACKA 4S12A 2G9RA 3D3KA 3AYXB 5ALOA 1YR7A 2E4WA 2FR8C 3UMVA 5B64A 3C15C 3GTGL 1XRRA 4B3CA 5FJ8L 3FPSA 4D3XA 4M1SA 3OOYA 4F86A 4UTVA 4H7KA 3L8ZA 3GBVA 5IFLA 4DV6B 3H6KA 4FCTA 3CH5A 3M4ZA 2C00A 3KTFA 4QOFA 2CBZA 5GAJA 1C4KA 1IRIA 5I9SA 2Q3EA 4MULA 1AURA 1FX0A 3RTGA 1NMSA 4XEUA 2MDTA 3KJIA 4Y9RA 3C3MA 3PGKA 1GPUA 1WQ4A 3GLUA 4ONEA 4YUVA 3VC3A 4DC0A 4HV4A 3MEQA 2XWPA 1A71A 4M0FA 1G8PA 3MZ0A 3NVMB 3A6ZA 4TMXA 3ZU6A 2PWAA 1UJ5A 4G5QA 5GWXA 4CR6A 3EEOA 4TL7A 3U44A 3BZUA 1E2JA 2DZDA 1OLUA 3JZIA 2JGMA 1C29B 1LBQA 1IZ9A 2P27A 3N75A 6RXNA 3SN6A 5L8VA 5G2OA 1UK8A 2IV7A 3NR2A 4MPDA 5H7XA 1U2EA 2UV8A 4UAVA 1NN5A 3E0XA 2EY4E 1KAHA 4OQXA 2XODA 1K0UA 2ZFUA 3AKCA 1M9NA 3TWOA 4EK9A 2Z0MA 4GNKA 3KQYA 2ZAMA 3LD9A 1GSAA 4XDZA 4PHHA 2OO3A 3I9JA 3ROFA 3FR7A 4J6EA 5A9SB 5TMDA 5LJIA 1Y89A 1YRYE 4ZI7A 1VQ1A 4F6RA 2AQIA 5C8YB 3HWX1 2GN9A 5B57C 3LDFA 4QXAA 3DMTA 4O4LA 3WYBA 3JW8A 3T6KA 4E11A 4B3GA 1PL8A 3O1HB 1A04A 3H6GA 1VYTA 4CU5A 1EVEA 4J9UE 4EYEA 4F3CA 2X40A 3BRWD 4OK6A 4H9GA 5EC8A 3SQWA 2XMZA 2A14A 3WAGA 2IK8A 1EZ4A 2N46A 3GA0A 2XRMA 4QOSA 1HE1C 2R4UA 1P7CA 3HEMA 2Q7DA 5C5EA 1L9XA 4M98A 2O3UA 4X63A 1ISIA 2MSWA 3T7AA 4PLHA 3PF9A 4H2DA 4LHLA 1G4UR 2WT8A 4GX1A 1RPNA 1S9HA 4UQOA 3RH0A 3VPXA 2O5CA 1P39A 3Q7PA 5DZSA 1E3IA 3DE7X 4EMBA 1PKXA 5J43A 1KH3A 3RAFC 1RKBA 1TAQA 1TUEA 4BV8A 1IWOA 4HNRA 1N7HA 2OBMA 3AY7A 5EFOA 2F00A 1M2VA 1X7WB 1TC1A 2YN0A 4G89A 3F6RA 3G5UA 1JJVA 1YT5A 3JATB 1NBEA 4H4EA 1ZC3A 4UVHA 4F84A 1Z5OA 2F48A 1UAYA 4KFRA 1ZINA 1I6MA 2HQSA 1NDUA 1NC1A 2MR5A 2QX9A 1Z0KA 3CO5A 3OO1A 2NXWA 3JQGB 1D2EA 1UXJA 1HSOA 1R0LA 3E0QA 4O2BB 4S1OA 4YK7A 4N1AA 5U4XA 3MPUA 1A69A 1NYQA 2B25A 1X0XA 5E7IA 3ZCSA 5JJCA 1O7JA 4FLEA 4Z3DA 1CVRA 3LFTA 5CA0F 3CUSA 5TPZD 3E9EA 3TSOA 1PNOA 1NF2A 4G0WA 2PX2A 1DBPA 4K5QA 1OIXA 3CRVA 4O4JF 4NBKA 2AMJA 1TJ3A 2PWPA 3R6TA 5DN6D 4CLDA 1C4WA 3UUWA 1SK9A 5IJWA 4I9NA 4O8ZA 2BTEA 1GDTA 1UKEA 1NM5A 3BS4A 4XH9B 3EFBA 3VTAA 3ZVKA 3E4CA 2Q6OA 3ILHA 3N8NA 4RC9A 1P4JA 4ED9A 4TYPA 2VTDA 1EVYA 2PS3A 2R751 2W2TA 2ZYWX 1QHNA 4WZBB 5AQEA 3W2HA 1UF9A 3I04A 2OVFA 5KNCD 1NNQA 1E3MA 1TZ2A 1XZMA 1BW9B 1FEZA 2A86A 2GKSA 3F7MA 5AHWA 1DJMA 3T38A 4TLCA 2D62A 2Q0QA 2QTRA 2POQX 2DPXA 1FTSA 1XOIA 2IDJA 1H69A 1X77A 2WUEA 2GKOA 2YHSA 1EFPB 4E21A 5IF9A 1N5LA 4A7PA 2AD1A 3GJ3A 1NU8A 1MLDA 1NE2A 2G7MC 3MCTA 3ZDYB 4EHAA 2VSFA 3BULA 1XAIA 3GP8A 3TZBA 3EZ9A 4KXLA 4UFOA 1FP1D 2CL5A 3VBEA 4XX0B 1QWSA 3ED1A 4I5DA 2FWJA 3KHSA 4F4IA 5J4VA 1OTYA 2PWBA 4GRAA 5JNRA 3CEMA 5DE3A 3PD0A 3WFIA 4H31A 4C89A 2CEKA 1KYYA 1MFPA 4FD2A 4TMVA 1QUFA 3SZOA 5LQMA 2I65A 2OTCA 4TMKA 1T1JA 3O1IC 1Z2AA 3A4VA 1E5LA 4YI5A 4WKBA 4B3HA 2XWBF 3CG4A 3IOEA 4LXIA 4G5SA 4UM8B 1ODFA 1TWFL 1YCDA 4JA2A 3UB3A 4UMFA 3WYAA 2YBDA 1JHVA 4XAQA 2AG5A 1KPIA 5KI6A 2A9OA 4HZUB 3WISA 1JLLB 1R27A 1NW5A 2NO4A 3OD5A 2CFSA 5EA2A 2CHFA 4TN5A 3AM4A 1INLA 5F35A 5LBIA 3RYCB 1KVTA 1LPOA 5K8CA 2C7QA 4WESA 5LA6B 1NKVA 3RT1A 3RFXA 1H1LB 1HDIA 5DX0A 3TLGB 1RTTA 3M2PA 2XYRA 3ESXA 5GJVC 3QEKA 4OP1A 1UFRA 5F1PA 1MVOA 5IG2A 4WFJA 1NT2A 3ZK9A 1T3TA 4LDPA 4M1OA 4PLTA 4M9XA 2RHOA 3PJFA 4R68A 1GG5A 5I7HA 1D1TA 2VDOB 1CQXA 1JHRA 2QYOA 1FTNA 3EC1A 2XLBA 1PTJA 4MQEA 4RHEA 1NMQA 3PQ8A 3B1ZA 3CBQA 4JADA 4ZEOA 5CFNA 1AQNA 3L43A 2OSBA 4MRPA 3TL3A 2BGGA 3OZXA 4TUYF 4DARA 4DSUA 4Q66C 3LCJA 1V11A 2OWEA 2XI4A 4RADA 3RIYA 4MW2A 1ZOIA 2OZKA 3HABA 4CKBB 1XTPA 2O54A 3A9VA 1Z22A 4ZT4A 4Z9XA 3TGWA 4EJFA 4LFAB 4V1CA 1CTQA 1PJ4A 2GEBA 4PCAA 1AO0A 1OC2A 3JWJA 2BFPA 1EFVA 3O9ZA 1ZNQO 3UPTA 3EGWA 1PVVA 3C5CA 1RXWA 2H54A 1PL7A 3OZSA 4E2FA 1KH2A 3JYLA 2BV3A 4GH5A 4OJYA 1JI0A 5FHRA 1HRKA 3RFUA 2OO5A 4MHSA 1E5VA 1FU7A 2QQ0A 5BWCA 5DWVA 1NW7A 4X1OA 2GZHA 4LZPA 3LC7O 2NU7A 4F2PA 5F76A 3IR6A 4HI0E 1LJUA 3GY0A 3LAWA 3ZV6A 4AW9A 4CM8A 3U60B 2MMCA 3C7TA 4OBBA 1GLVA 2JFNA 2BMWA 4MAAA 3RB8A 2P68A 4CVNA 4CKCA 4BXOB 5TDHA 2JHPA 3I1FA 3UG6A 3KWJA 4XA8A 2HHJA 3S7TA 5HMMA 3UWOA 1UMBB 1QS0B 1JHYA 4MV5A 2XDQB 1NW6A 4YPOA 5JTTA 1G55A 3QE2A 1G7SA 1RTKA 1ZHHA 1KQNA 5EHIA 4ZYYA 2MIIA 2K6GA 3U7QA 2WHPA 4KSBA 4Q3EA 4R31A 1Y0BA 1TLFA 3ET4A 1SOMA 3H83A 2C2HA 1S2MA 2BELA 2B7LA 2VZ9A 4LRWA 3F7NA 1AVTA 1X7GA 1G8HA 2QV7A 4IQ0A 3ZWCA 2Y6UA 4M0UA 2XMDA 2YV5A 3AL3A 1NXSA 1S8AA 2X3UA 3UENA 1DZIA 1GA6A 3OBBA 3RRJA 3X1JA 4FE7A 3ZY4A 3IP7A 3PKJA 1IY1A 3ANNA 1H5NA 4ZZ0A 3W1WA 1KI7A 3QVLA 3NTLA 3GYGA 4DNFA 2XUOA 4PHTA 2G9QA 2RAUA 1SEVA 3E81A 3Q6NA 3WIDA 2GZAA 2WQ6A 5K0SA 5CM2Z 5JDIA 3TR5A 3DDHA 2VOEA 3HH8A 4N0MA 5FBWB 5JALA 3L3BA 1R0BA 1X8LA 1CDZA 4ZTBA 2JPDA 5AO9A 5AQ1A 1OLXB 2CV0A 3ANTA 1IQUA 2AXEA 3P26A 4DR6B 4JAEA 3S4YA 3BJZA 2F1KA 1ZOSA 1Z4LA 2OV4A 2KBFA 4G9BA 2OA0A 4YRNA 1W47A 3X1YA 1J49A 1G9XA 3CLTD 4W5WA 4ZP1A 1N0IA 1QZTA 3HKEA 3Q9UA 1A76A 3VC2A 5JAUA 2FWNA 1J9ZA 2UYYA 5CT5A 4AMGA 3WGVA 3YASA 4CEIA 2VPIA 3OCWA 3NP7A 4JYPA 1AMOA 2ZJFA 1CUIA 3DKIA 5TT0A 5AVQA 1ZN8A 1JKXA 4YIKA 5HF9A 1PUIA 1GRCA 2BD0A 2JHAA 3DE4X 2NYUA 4YJGB 5EWJB 2FSHA 2HK9A 4YRDA 5DEIA 5HP4A 1W9MA 1EQAA 4PC1A 1AOXA 1GN9A 1RU3A 2QNIA 4IXWA 4P3KA 3ZWYA 2AUNA 2QR2A 5EZ5A 3W78A 5DCUA 1ODCA 4OXRA 2ONYA 4J0KA 1DQRA 5FDFA 2OG2A 1S2NA 2PAAA 3N8KA 3SF0A 2R44A 2JCXA 1Z5ZA 1H3NA 2BY4A 2W6CX 3HWWA 3BFJA 5CEEA 5EIBC 3RBVA 5TJ9A 1IEWA 4YXWA 3DNFA 1YVUA 2AJ8A 3OFNA 3G79A 3TIXB 2FKNA 4IFEA 2YIVX 4HX9A 4JOQA 5HQ3B 5C53B 3AVUA 2FI1A 2Q1UA 2VQSA 3AIMA 4DA8A 2ZI6A 3OF5A 4MWBA 5GONB 4MR8A 2PA3A 2RONA 2QAJA 2PGNA 1AS2A 3AUSA 3MUEA 4P0PB 1GUAA 1LZLA 3QP9A 5JMOA 3C5WP 3RCBA 1KFJB 3ENKA 2NO7A 3FMOB 1FIUA 3VTKA 3G0BA 3OECA 4U7JA 1ZVVA 4BEBA 1NUAA 3SEZA 2PSFA 5JXHA 3DMNA 4UU7A 3S2EA 4MVJF 1RFLA 1D4FA 1RXCA 3NWEA 3B3GA 3D3NA 1N5KA 3JTMA 3LW8A 5KTSA 2UUCB 1SHZA 1FYWA 1YMUA 4BMVA 3D6VA 1EHIA 3M49A 1GFZA 1BE7A 3BBLA 4FYMA 4FFWA 2GTIA 3TLYA 1Q16A 4KB5A 3BT7A 4BLRA 3A6FA 4ALJA 4Z6KA 3CBGA 1MB3A 5BSTA 4DYHA 4NNJA 1P80A 3N8HA 4N6NA 4DMHA 4C76A 3ZXIA 1F12A 1N0WA 3QF7A 3IAEA 2C8JA 3TF5A 1YCGA 3ZHSA 2DEUA 1U11A 1G8FA 3OC6A 4OXQA 4H18A 1QE0A 1E3QA 2IIBA 2H5IA 1W36D 1KYXA 2AFIA 2BR4A 2EIHA 1XZJA 2Z95A 4UXIA 1R0FA 4BMOB 2W93A 4YRTA 4YT8A 2R97A 4Y2QA 2BGNA 1E2QA 3KUXA 2RIPA 3SS7X 4LXQA 4NDAA 2Y1EA 2WR8A 1CG6A 4IXNA 1JFRA 3HJGA 2PX0A 2Q5LA 3DL4A 2B82A 3I8SA 1F38A 3WY9A 2V98A 4E31A 2YX1A 1B15A 3QYJA 5JY6A 2FXVA 1PDWA 2HCTA 3ORFA 1HZZC 4RVOA 1J00A 4X3OA 1TWAL 4BBRL 1BEZA 1USUA 5H5JA 1BCSB 1SZJG 4AXBA 3OKCA 4ZD6A 421PA 2FVXA 5FL3A 4PBRA 4A8JA 3Q6IA 5BR8B 5LOVB 1ESNA 3G02A 1MVNA 2ZAGA 1OWMA 1YTLA 2KMLA 5CB4F 2JZNA 4GSLA 1T3SA 2HBRA 1M66A 5LMUB 1FSSA 2G88A 3BHJA 2HSWA 5A5EA 9ABPA 4B3XA 2LE0A 2OY0A 2HLDD 1N2IA 1UBRS 4EFDA 4CMJA 4LJ4A 1HETA 3RI3A 4JHXA 1IUPA 4FGWA 4ZV7A 1JHMA 2I0FA 1HDYA 1OX4A 2HJHA 3Q7RA 3VH3A 4DIOA 3LCVB 5IDQA 2O8CB 1N5DA 3CX8A 1X2EA 8AT1A 3UVEA 2ZT8A 3AKYA 4NI5A 3ZU4A 5DGDA 2D5AA 3VZRA 1CRPA 3WYDA 4FBGA 2GEJA 2ZRBA 4D9IA 1MDFA 3FTNA 3ME5A 4OJMX 3E03A 1HTWA 5COBA 3S2UA 2XUFA 5KNBD 3EFHA 3W4JA 5HRUA 4NLLA 1VZIA 3ZGLA 4C01A 2RKOA 1ZBQA 3EFOA 4W5HA 1QKKA 1SEPA 3G2OA 1NVVR 1N2CE 1OX5A 2WWTA 1EB8A 1P4GA 1T25A 4GZMA 4G3XA 4DF3A 3K9HA 1G4HA 1OI4A 2HLDA 2WHQA 4CUJA 3KTAA 5K0TA 1OWBA 1N9GA 2P9GA 2P4QA 1ZL0A 3EDOA 5L7WA 3A6JA 2F67A 1BE0A 3IX7A 1E3SA 3NIBA 3V7UA 5BWBA 3EC2A 4HAOA 4WNAB 1VLLA 4LF8B 1M34E 4GMXA 2NYDA 3FMPB 1BQ8A 4R6WA 3Q7QA 3VAYA 5JANA 1R4MB 1LRLA 1JA0A 4PZAA 2W2OA 2UYOA 4UDOA 3DWGA 4LMBA 3RWOA 1KSHA 3S68A 3ZGZA 3B7WA 2UAGA 1EWQA 2EW1A 3GN1A 4JKOA 4WERA 4B7CA 2DBRA 2GFQA 2I4TA 2I4LA 3ITKA 1R2QA 1U7WA 2XIJA 3A9SA 1MGOA 1EDEA 4E2XA 4U6NA 4ARUA 2XE8A 2OYCA 3RJ5A 1J0CA 3O91A 4JY7A 3ZTYA 5ILOA 1OBCA 2PQ0A 1ENZA 1FA9A 1JVBA 5F1KA 5FYQA 4DMKA 3C5HA 5ITVA 1UANA 1Z7WA 4U9UA 4V02A 1TECE 4UM5A 4UZFA 2PJDA 4WOCA 3KT8A 3A3OA 4DG5A 4GI3A 4GI5A 2FXIA 3KYXA 1SNYA 2WYUA 4KXUA 1KY4A 1I1OA 1AZTA 1U8EA 4K6CA 3RKSA 2WMOB 5GY7A 1DWPA 2ONCA 4AJOA 1NVEA 1CP3A 1RVV1 1IM2A 1AIPA 3A14A 3NALA 1KZ4A 1WMSA 1ZSYA 2C0QA 2X7JA 4GOMD 3ZYCA 4OYRA 5BYAA 2EEZA 4I1OA 1P1CA 1RW4A 3EVFA 3RYIB 4XVRA 4E1VA 4YWMA 3CPHA 3N0XA 2R5NA 1ZWKA 2P9TA 2WMYA 2X8WA 4JI3B 3ZHRA 2BR5A 4L95C 5TF0A 4FDMA 3HWSA 1LS1A 2CNWD 2EWVA 1KVUA 1MG0A 4MUFA 1GZDA 1Q0RA 3MJEA 3D5EA 4LBWA 3VH2A 2V54A 4CDRA 1M1YA 4FS8A 1I94B 4BNGA 1B8UA 4LZLA 3TSYA 1CAAA 3TJMA 4YV0A 1A2KC 1DX8A 1NWHA 2RGCA 2DQ4A 3HLKA 1EP1B 2YXNA 1JE1A 2FSFA 1IMJA 3PWTA 1JX6A 1GTRA 1SXHA 4PTLA 3QYAA 3ZNOA 4BN5A 4IDHA 1JDTA 3AINA 2GN4A 2A68D 1KMNA 1TMYA 4HDNA 2TRSB 3DVAB 4NPCA 5BNTA 3HCOA 2PUDA 3STVA 1DDIA 5DIZA 1F2TA 4I5EA 3GFGA 4J0GA 1BFKA 3O1LA 3I52A 4KQJA 2IF2A 2RJOA 3CUYA 4K40A 4RVDA 1TM2A 2VNJA 3E1GA 2FSVA 4DXDA 2CNWA 3DDZX 3AUKA 3DDCA 3MCVA 1E58A 4II3A 4B3DA 3RIMA 3KS9A 2A5FA 1WLYA 4J3JA 1Q7GA 1GZ5A 1EA7A 5BVHB 4Z4GA 2QL7A 2WFLA 2IEZA 2V0CA 2Z04A 3HN2A 1K89A 2CEAA 1W34A 1SXJE 1QFZA 1YQEA 2JGAA 2YHIA 1R9TL 1L4FA 2QJTA 3COSA 3IAS1 2UZ3A 3MGAA 4NK4A 5DF1A 1AUVA 2QZSA 3JU3A 4C7VA 3A10A 1CUYA 1HGXA 4E5DA 3USCS 2C83A 1RM4A 1EK5A 1WP4A 1ZH0A 3QIVA 2OENG 1DFGA 4N0DA 1RXIA 3D02A 4XQ9A 3STYA 2XD9A 3GR6A 1Z2EA 1I4EB 1K88A 1PGPA 2C95A 3E18A 2PH1A 3LPDA 3KKKA 2IITA 5EOVA 4EPRA 3UK7A 4X6UA 2AMVA 2G5GX 5LC1A 1V71A 4DVGA 4Z2AA 4B2IA 1A97A 4DR7B 1BXGA 2PSEA 1R6TA 1YI1A 2IQIA 4FE3A 1KETA 4M22A 4WOBA 3ZDRA 4EYSA 1JSRA 4I5IA 2JBWA 1RWOA 4MVJD 1RKXA 3CNLA 3CUTA 3AVVA 3OQOA 4PRYA 4OMDA 3W2IA 1DJPA 4WBNB 2QTNA 1FK8A 4DRYA 1V47A 2E3JA 3BMOA 5CBPA 1B42A 1IN1A 3IB6A 3WBKA 3KQVA 4LOKA 1PT6A 2PUCA 1EVIA 2HT1A 2FN8A 2HSEA 1E96A 4IRXA 3MJRA 1T2NA 3B5IA 3MA0A 4R8LA 4D3FA 2WF5A 4WEOA 1K4MA 1N5JA 1P17A 4JLJA 3RANA 1VIAA 3AM1A 1KO7A 3AVTA 3RREA 3O82A 2YJ6A 3OTIA 1Z75A 3TD6A 3DEIA 3HDTA 2BMDA 4P84A 3ZGYA 3KSMA 2PXCA 1QR6A 2JIMA 2IXFA 4YJDA 3N76A 3VMMA 2O2GA 3WNVA 4XCQA 2JAHA 2QD1A 4BKOA 5GZ1A 1AQUA 1Y8CA 1F1JA 1JZTA 2E5FA 4RYLA 5AJZA 1V5GA 1UC8A 4E5PA 3KPVA 3W7BA 4JI1B 2A9PA 4GXRA 1N2BA 1KZ9A 3D7NA 4G8CA 3GU3A 4H6WA 4QPCA 1U5BA 3IPLA 1E0KA 1JBEA 3BCHA 5TQ0B 1I2ZA 1JDBC 1VA5A 2JL1A 4CYMA 5JQGB 4OAQA 3O2QB 1J8QA 5HJ7A 1T5DX 4AR4A 1U2GA 3RVBA 2PMZP 4K6KA 2JI2A 1E6CA 1GNRA 1T15A 3GB9A 3ZDXB 1Y3FE 1OREA 1Z8DA 4J4BA 4U7HA 3R1IA 4QXOA 1NI4A 2PMKA 3DMFA 2JCSA 3L6EA 5AK0A 2JFOA 3W5JA 3O2JA 2VN8A 2H1CA 4ZZ1A 4YQZA 3U9TA 4I4CA 3MQ4A 3OICA 3FWKA 3L7IA 3SQLA 1VE7A 4AK9A 3TECE 2JCYA 1P5HA 1SQSA 4G24A 5H02A 4WCFA 1RPAA 1XN4A 2BZGA 3G59A 2QIPA 3K0HA 1LKMA 1J25A 1TVCA 3SEQA 4GC5A 2QR5A 1OD6A 3L18A 1GNQA 2VZLA 3FMGA 4KE7A 3D2BA 2WAXA 4O3FA 3EXHC 5KTTA 4KR2A 4CKXA 2C0PA 4OI1A 2W2KB 7ABPA 3WSVA 4MYCA 1C14A 2GPAA 3H5LA 4L2IA 4WMLA 5KYWA 1SG9A 5EE3A 1G9SA 3RFVA 3JAKA 1AMUA 3SFZA 3OIUA 4HS4A 1WS6A 3EODA 3KP1A 4IGAA 2XQIA 1E8DA 2WJJA 1JT2A 2H4WA 3K4PA 3GLFB 3TLCA 1GYRA 4BQPA 4MI1A 3M3PA 1P72A 4ZU6X 5CB4A 4R69A 1YD7A 1UBLS 2GN6A 1B2RA 1NJ6A 5GOTA 4M9ZA 1YDWA 1JYSA 4QJIA 1DRJA 3OIVA 1XQXA 2HY7A 1GFWA 2FZKA 3IBTA 1JHUA 4UXJA 5AWFC 1E2DA 3HKBA 4N40A 5DNVA 4JASB 2PG3A 3K1JA 2NO1A 4F04A 1DAHA 2XBMA 1TYCA 1VGVA 1II9A 3MTEA 5C1BA 3W8DA 4G6BA 2HRCA 4BWGA 4CR8A 2HU7A 1I10A 1OHHD 3GMSA 4YQEA 1UBOS 4I19A 3R7WB 3EF0A 3GDWA 3AEQB 3N7UA 1FL9A 2GK3A 1M72A 2GYUA 2P9QA 2ZYGA 4RKWA 4RKRA 5LQAA 2GZSA 3D6NB 1YH3A 3FPJA 3MWEA 3PCXA 2Z98A 3PQ7A 4IFBA 2CF5A 5FTJA 3TW4A 4DLZA 3GH1A 2PBFA 4KIJA 1EVKA 1ORDA 4QU8A 4LF5B 5AVJA 1GPNA 5ELLA 1W0CA 2VEOA 1RXSA 1WXEA 1XAHA 2WA2A 3B20A 3G8DA 2BFBA 2VXCA 3CNHA 2NUAB 4I08A 1FUKA 4A5SA 2XT6A 2NNLD