1PZXA

Hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
277
Chain Sequence
b'MPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQPSPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDEYPEFRLTIIDSKCASLGQGLAVMKAVELAKQNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISNIKPLLHVEDGALIPLEKWRGRKKVLKRMVELMGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIGSAIGAHAGPGTIALFFLNKYIEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein APC36103
publication title Lipid binding protein APC36103 from Bacillus Stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Lipid binding protein
total genus 96
structure length 277
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.50 Mainly Beta Single Sheet Rubrerythrin, domain 2 degv family protein 1pzxA02
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 1pzxA03
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 1pzxA01
3PL5A 3NYIA 3PNQA 4X9XA 3LUPA 3PNMA 1MGPA 2IU4A 3PNOA 3PNLA 2G7ZA 3FYSA 1UOEA 3FDJA 1OI3A 3PNKA 2DT8A 3JR7A 1UODA 4LRYA 4LRXA 1VPVA 3CT4A 1PZXA 1OI2A 2IU6A
chains in the Genus database with same CATH superfamily
4BMVA 1LSOA 4MH0R 2YWJA 5GZ6A 1KJYA 3NMUF 3EGVA 2FPSA 3AUKA 4OV6B 4LGYA 1TF7A 3BHMA 3CCCA 3OY2A 2C2GA 2ZVDA 3OX2A 4US0R 4X93A 3TAUA 6YASA 2Q3HA 4OQQA 4QKQA 3IB6A 4X65B 3RGWS 4CKZA 5A5VA 1E7YA 3HVHA 3H3XA 4PPGA 3A4YA 1T8YA 1W581 1DCMA 1IU9A 3AF0A 5F3WB 1CNEA 3KSDO 4DUYB 2EZ8A 2BFFB 3ICWA 3NATA 4Y6PA 2Z2JA 3G0BA 2CF6A 3ZKWB 1G8PA 4FZJA 1XKLA 1GFZA 1KJQA 1RYDA 4IMIB 1EM8A 3FYUA 5BT8A 1CFZA 1PHPA 1THMA 4EA7A 1DBVO 3QIAA 2N47A 4QXAA 2ZPUA 4IDBA 4B4KA 1CQIA 4YIHA 3F9CA 3PFGA 3QVLA 3S68A 2ACWA 1D1PA 1IIBA 1OT5A 4JUAA 2C07A 4UQPA 2ZRIA 2EL7A 4UHKA 1P0PA 1WL8A 2G9NA 3C6YA 3S1LA 1BXGA 4B4DA 1PVVA 1BEZA 2WWIA 2IVFA 4JR2A 3W9YA 2O7NA 2COUA 4O4JF 4B3BA 1YQTA 5AVWA 1MVOA 1RRMA 3OOJA 5LZ8A 3ZBUA 4LSZA 3LZ6A 1BD3A 5AJZA 3C6MA 1XPUA 1VL6A 1C1DA 4N7RA 1ODLA 4NJMB 5EJGA 1BD4A 2RB5A 4F4DA 1EX1A 1I80A 2WD9A 1N2JA 4XI9A 5G0TA 2C9CA 3JATB 5LYJB 2QT9A 1IXSB 2UVQA 2XQIA 2BFCB 5CMLA 5LJIA 1AK2A 3BCRA 1RKUA 4ARUA 2O8DA 8GPBA 1X7GA 3MAJA 3OLQA 2C94A 2DTXA 2J9FB 2JAHA 1SXJB 4WE3A 1N1EA 5AVSA 4D9NA 3WIUA 2A5GA 4YRNA 1ZGBA 3PEWA 3T7KA 1K66A 4UARA 2HPHA 5FOQA 2L2QA 4UU1A 5CCBA 4B3SB 1Z26A 2Q5LA 2P2GA 1XEWX 4ZHQB 5FO0A 1FTGA 1GPH1 4C43A 1C50A 3ZHZA 3AB8A 2OCGA 2HO5A 4W6ZA 2O2EA 2J9YB 2JLAA 2A0XA 1GRVA 4NENB 1M8JA 3UWMA 3NBAA 3B6EA 2VXYA 4RUKA 3OEED 3CUYA 1YRWA 1I51A 3C0KA 4LDPA 3MSXA 5KHAA 1OC4A 1ZQ1A 5T8KC 1XGKA 1N5MA 4X92A 2PVCA 1YHZA 1BJKA 2HFKA 2QAGB 3B1XA 5AR1A 4E5MA 3LP6A 4LK3A 2FB9A 3GGDA 5A5FA 1R8XA 2HJRA 3ZJYA 3V80A 4B2IA 3TGWA 3F90A 4CL2A 5CBPB 1LKZA 4JHLA 4RFSB 1T9PA 3NIBA 1KEPA 5FQOA 5CT8A 2OILA 3P27A 2NLOA 3PITA 3CLSC 3ML1A 2F43B 4PX9A 2V96A 4ZAVA 4FT2A 3RUHA 1PV1A 5C7LO 2JLVA 2UKDA 4GKJB 3RVNA 3VI3B 2B21A 1RKVA 2B8NA 3P52A 1TCAA 3RSZA 3GLFB 2GARA 5DI9A 4Y7CA 4XJVA 1ID1A 4EF5A 4C3IL 1V8OA 3L1KA 4MXDA 3V8BA 5JYDA 1TYCA 4A2PA 4P5EA 1KI8A 3MRSA 2HWYA 3OWXA 5EIBD 3LC0A 4FHFA 3S2UA 1Y3BE 4I50B 4RTKA 2FSFA 4HD8A 1XZAA 5M2QA 1JHDA 2H1SA 1K4KA 3ZG6A 4QFDA 3ED1A 4Z9BA 1B4DA 3FNRA 3QU4A 5L53A 3BD9A 1EB8A 1I01A 2HD4A 2MYPA 1NR1A 2XNDD 3DF7A 3E8MA 1RXVA 4P80A 1C9YA 5JCXA 1YR2A 5SZIA 3PRHA 3UXYA 1C8BA 5C4XL 3ADDA 3K0EA 1V4NA 5A3RA 2O6LA 3S3TA 3GA0A 1U0EA 4OXQA 2AYYA 4PSVA 4XFJA 2QGNA 3RUAA 5J58A 1A27A 5JWRA 1CHDA 4OUDA 4TYPA 1YB2A 2IS4A 3IQIX 1BX0A 3D5QA 1M6EX 2ORWA 1KHHA 3NWBA 4XQ9A 1OLOA 2YWRA 4Q3LA 1T36B 4ZV7A 4PV7A 4KDRA 3WLNA 2Y1XA 3DJFA 1QHFA 4FCCA 5AWFC 5B57C 5KTNA 4MWEA 1XD8A 3EUFA 2FH5B 3I5MA 5H02A 1H2XA 2QL5A 2B8TA 2MMGA 2NU9A 4URXR 4OYLA 4KPFC 5AOAA 4ZPJA 1FFXA 1T9DA 1QIMA 1U04A 1X42A 1SK8A 1CZOA 4RHCA 1L7PA 3LWVB 4HDOB 4RXUA 5B30A 1THGA 4LHWA 3R7LA 3OJOA 2F3TA 2FMXA 3EAFA 3KR0A 1UC9A 2PMDA 4C4PA 1U2DC 4KR9A 2WWYA 2OR3A 3FRJA 4M2LA 2H9AA 1W88A 2ES4A 5F7XA 2I99A 2MWMA 1AF7A 1RQPA 1Y48E 4XYGA 1E1RD 4R9NA 5EE0A 1PS0A 1ODIA 2K4MA 1YIOA 1N5OX 4L9RA 1OXKB 1TYEB 4MKHA 5JH7F 5L3VA 1RHRA 3SMQA 5A05A 3LT5A 3K9BA 1GJRA 2CDNA 1BQ4A 1HGXA 2ODTX 4C5BA 2CNBA 5DE3A 1CNMA 1HDZA 1TA0A 1W34A 3IA2A 3IUPA 4X20B 5DBIA 2X8LA 3UG6A 3R4CA 1VMEA 4AY3A 1D1TA 4JUCA 5TARA 3CRMA 2IHKA 5FUBA 1GKKA 2PH3A 3AY0A 1USGA 2WUEA 1SMKA 4C3ZA 3GD5A 1CUEA 3UHOA 4CG1A 4TZ0A 1VDZA 2QAGC 3VPFA 1RAEA 5F5LA 3W0LB 3RYIB 4EA8A 4QGHA 3MQKB 3SLKA 5C4MA 4OFZA 3W1WA 2Y0SP 3HXLA 3GLFE 3T34A 3T5CA 1W93A 1Q7EA 3CUEF 3A0RB 3QJYA 4ZAFA 3PJRA 3DT6A 5EKXA 1TVMA 3DZDA 4HTFB 2A68D 1FBNA 2H0AA 2RKWA 3FYDA 1JU9A 3NIDB 5EYPB 3FWPA 4AHYA 3QX3A 3QQPA 1JR3A 3FLMA 5KCZA 1I0LA 3ANXA 2NM0A 4N54A 3GLGB 1DBSA 1KEUA 3L84A 1A9XB 4M9CA 4M88A 5U4XA 3RPEA 5CW1A 1N6LA 2HRQA 3P9KA 1HE3A 2GN6A 1Z5NA 4NJEB 1ZH0A 4WLUA 4D9MA 5DASA 3TIVA 2CYAA 5B6JA 5GM2A 4WTOA 3SEAA 4JJEA 4J0JA 2XMSA 4UMFA 2GN8A 4BAGA 3U6BA 4DIEA 1XL0A 1AK9A 5FFFA 4LJLA 1O77A 4QO8A 3LYHA 3PQ8A 3SHVA 4MPRA 1X13A 4OJTA 5JROA 1YS2X 2WTMA 4XLZA 2WC1A 4BVHA 3IAM6 5JSHA 5H8WA 2V8BA 4HAUA 1ND5A 1E0DA 3WVNA 2B37A 1T0IA 3EEQA 1LH0A 5JMTA 3NC1C 3K09A 1ANKA 2NUAB 1KDPA 1TJ5A 5BW4A 4U2CA 4F72A 3GJYA 3KYDB 3SDZA 1YA8A 2I6UA 5JAUA 2D8AA 2RGAA 4MQMA 3C6BA 3R9IA 1A8UA 1YULA 4QHTA 2DR0A 4LOHA 5LZ2A 1ITZA 1V9SA 1FFGA 2GESA 3H6KA 4KSYA 1TMGE 4I3FA 1J42A 2QRMA 4YO7A 5EXPA 3VOSA 2I4MA 1T4MA 3G7UA 2BCJQ 4W5HA 2C2XA 2BP7A 1W8DA 5AI4A 4JLSA 4RIGA 4KMOA 2IHVA 1RQXA 4RDCA 4BHTA 2VJQA 2RGBA 3INYA 1Z0ZA 1E6LA 1U9IA 4ZXFA 3PX3A 4ARBA 2IX3A 1VJGA 4GVXA 2IXBA 3WWPA 3DXXA 4RFVA 3GP8A 1L3IA 1V6SA 2EYQA 5CUQA 3PEUA 2XKAA 4QOGA 1D4ZA 1HT0A 4I4TF 4ZV4A 1NDHA 3JW8A 3JD1A 2H2FA 2QPTA 1CQXA 2JI1A 1S01A 2CFIA 2QL7A 1Q0QA 2REXB 1OV6A 3JYQA 4HEA1 4RA6B 3OT1A 2A5JA 1P2SA 2XVXA 2WIBA 3C5WP 5DULA 4ZARA 2GXAA 1E3IA 2VTKA 2ESRA 4MICA 4OVKA 5HZMA 3WE7A 2FRDA 3UV7A 2YW2A 4TTIA 1V3QE 4OHPA 3TQIA 1SVMA 1KVRA 1I50L 4GDMA 4BX0A 2FN8A 4X6XA 4CKWB 1G6HA 4CL0A 3GUCA 4Q9NA 5JMWA 1W0KA 3S8YA 1VKNA 3G9QA 5EESA 1BYUA 3GZTB 1WBJB 5GM1A 4ZK6A 4EEXA 4OP1A 3TRJA 2WP0A 3RVMA 1X87A 1OI4A 1OOEA 3AUXA 1Z5GA 3TJZA 2VDLB 2VJAA 1NF2A 1YV9A 3AF4A 2YKGA 3UYKA 3WAGA 5EMHA 2YHAA 2BDEA 1XZNA 2XXAA 1DWQA 5BN4B 2M32A 4BC1A 1UINA 4A73A 3AW9A 3GIWA 2Y1KA 4FPXA 4ES6A 1J25A 5F76A 5FNVF 1QDUA 2W8BB 4QPCA 1DMSA 2ZM6B 1XD2B 3HB7A 1I7QB 4QLOA 1F8FA 4IIXA 4LX8A 1FRNA 1E2UA 3CEMA 3QWHA 1CVIA 3M0EA 4D80A 3U4MA 9LDTA 4RESA 1UODA 1F4PA 2GN2A 1FDTA 1U0HC 2BY4A 4NPCA 1EJ0A 2NZXA 4BX3A 3PCTA 2PZKA 2IYVA 1AUQA 1NVDA 4GNRA 3SJCA 3FTDA 4DXDA 3F96A 1QDLB 4LDRA 5CB4F 2DR2A 5JQGB 5DU2A 5LL6P 4U2EA 4H6VA 4XX0A 1NJ1A 2RHMA 2ZP1A 1O94D 4RA9B 1ZH4A 5EPEA 4K9LA 4DG8A 3CKMA 4UAGA 5BVGB 4JI5B 3M2TA 3HHPA 5I7OA 2CCJA 3REOA 2CCGA 4H15A 4MYCA 3PC3A 4TVSA 4YMLA 1QPBA 2C9YA 1W5TA 1DO0A 3M1AA 4RD3A 4WXPA 1W9MA 5IEBA 3JARA 4HAZA 3NU1A 4RLHA 2G7MC 2CJFA 3BE5A 3OTWA 1Z47A 2VNAA 2X3FA 4CT4B 5K01A 4ZCSA 1NQAO 4CL8A 5JQWA 4RQTA 3FZNA 5AI6A 1PUXA 1TRHA 2P4HX 1KSHA 1IH8A 1JQEA 4IIUA 4L15A 4CMJA 4QSHA 1OZFA 4C21A 2A4MA 2CXSA 1LFDB 1TK3A 1XF9A 2O7RA 1R7RA 4MWZA 3I4CA 3PT9A 2AXNA 2Q4DA 2RAVA 4FFBB 1IY2A 2D06A 3TL3A 1JQ3A 3V34A 5DDIP 1SB9A 5H1Sc 4L02A 4O4IF 4M8KA 1QHHB 2NU6A 3HLYA 4CRWB 4EHDA 2QLFA 1E59A 1EWQA 4IFEA 1MUUA 1KQNA 4X1IB 1B6GA 4FOTA 4GP7A 5LPNA 2VEOA 2RG7A 3OAAD 4ZJZA 4XCXA 3G1TA 4INAA 2D6FA 1QQ5A 1C2YA 1WMBA 4H7KA 1C80A 1V6AA 1DJQA 1OMOA 2JI7A 4BNDA 1P1RA 4BCDA 2JZCA 3HRIA 5LP6B 1TK9A 2D7JA 5FADA 4BYMA 3GLHB 2CLEB 2CFOA 4CTKA 3BRWD 1Z4NA 4ZQBA 2GLUA 2H2IA 4RZQA 1GTG1 4X1KA 2O8FB 2HL6A 1TUGA 3FWHA 5DWQA 2WWFA 3FKJA 4Q1FA 3PPWA 3COJA 4MGIR 4J7AA 4QDJA 4L78A 3D6FA 2BKLA 3UGQA 4IICA 1XJQA 2C5GA 1QYXA 1VKOA 2EGGA 5I5GA 1DUVG 4L3VA 1E0AA 3L1IA 4P0TA 1ZY2A 2ZB8A 2R00A 4C6TB 2ZYDA 5T4EA 3I4FA 1DEXA 1DBQA 1K6MA 1YE8A 5EP2A 2MINB 2GTHA 3TW8A 1HLFA 1X77A 4AD8A 2QRGA 4PPYA 1TNDA 3WXBA 1QHXA 2XUJA 3GJ5A 3L8YA 1D3AA 1TE2A 3MUNA 2A59A 4M8NE 2ZUDA 2V6GA 3QGMA 4AI0A 3W2EA 2CZQA 4FFSA 1HTTA 4IFBA 2FNAA 2VJDA 5IJ0A 2YFYA 3ZVKA 1VZ2A 5I9LA 2GPNA 1G0NA 1JHAA 3VR6D 3O1LA 4MRAA 2QQFA 4F11A 1Z6QA 1EJ2A 1VG8A 1HY3A 3PGJA 2H4FA 4E11A 5FCDA 4A91A 4JEIA 3RHZA 1G19A 1JXAA 3EG9A 3FCAA 4QNMA 3E2MA 4B3MB 2H4HA 5KINB 1HDOA 1DJPA 2HSEA 2JIBA 4CF3A 3SHOA 1GYPA 2LKCA 5DHPA 2GCNA 5JSZA 1TZKA 3FNGA 3V6LA 1SULA 3P19A 1MBZA 3N86A 4PGGA 4PZEA 1UH5A 5ELXA 2PNFA 1ZZEA 3PE4A 2EKLA 3OIDA 3AJ8A 3ORRA 2Z56A 1RWQA 5AYVA 2JGFA 3NBMA 3T99A 1EHCA 1WDMA 3TM5A 4OXYA 1NSFA 3DWGA 4BWFB 4E3ZA 2A67A 2DFPA 1AH2A 3DL4A 1WTAA 2P4SA 5IF9A 3UMMA 1U7WA 1U8EA 4H1TA 4N3GA 4HEJA 5C1PA 2XZPA 1FDVA 1UFQA 2GZ1A 3CJQA 3EXHA 3UWPA 2HJ9A 3KUDA 2QZZA 4JDUA 3IAS6 4CCSA 3R40A 5DN6A 4CMKA 4FP9A 2B6HA 3DZFA 1CIJA 1X1AA 4UKDA 4YDSA 3UHPA 4D44A 4MNTA 3L0PA 5KX5A 1QJ4A 4X6AL 2ZI9A 4F3TA 1FPQA 4BVLA 3CX3A 4WW0A 1TF5A 5LP6C 4PZPA 1G16A 4FN4A 4HG2A 3R5HA 1ZI8A 4LBYA 3SIRA 1PBNA 4TX1A 2WTUA 3NB0A 2JC3A 3VKGA 5LD2B 3FE2A 5DBGA 3JASA 2XJQA 4HY3A 1TM7E 3G17A 3LUDA 5FX2A 1RMTA 5GZ1A 1Y1QA 4I1YA 4N0MA 3RFTA 1M2OB 3HJTA 1XZJA 3C1TA 4HNUA 4DDTA 1X7ZB 4AU1A 1MEOA 2Z2YA 1NZDA 3DS8A 3MBOA 3Q15C 3I04M 5H4HA 5JSKA 4XVUA 1A9ZA 2QD5A 3AF2A 3PGVA 2WV9A 1LLQA 4R8MA 2A88A 1F8YA 2NQTA 2WG1A 1BS1A 1CETA 1RXSA 3FZYA 1XLVA 4DILA 4L8VA 1LFAA 1MIOB 3A2KA 3AI2A 3P0HA 4FLFA 4EAAA 1BE7A 3SBDA 4EB6B 4RJTA 3M5WA 1UBTS 1TU0A 2EZUA 4YFYA 3UENA 3I6ZA 3PQEA 2CL5A 5BOVA 2PUWA 4G26A 2VNSA 4IJWA 1SQ0A 5EP4A 3KWFA 3TSYA 1OC2A 4ZK2A 3NBQA 1U63A 1ONOA 5JVH1 1U1DA 2H5JA 5FPSA 1EK2A 4DQUA 3NUZA 1JR6A 2FX2A 4PYRA 4ZIRA 3K1JA 3IOCA 2PBLA 5JO0A 2PKCA 3L8GA 3S14L 4GKAA 2EFJA 1EXWA 4B7XA 2WAMA 1T6ZA 2QVGA 1FS5A 2X5OA 3DMFA 3EC7A 3GLUA 2G67A 2ZQ5A 3KSRA 3SC6A 1E9SA 2AQHA 4WLFA 4CCYB 4HSGA 3T7RA 2VP6A 4BGUA 5D3ZA 4O3FA 3UPDA 3GT4A 3ZGNA 3RTCA 1B6RA 3B3AA 2PLAA 3R7SA 3QA3E 1TM4E 4FN5A 3E9CA 3N5KA 4DZRA 4ZYWA 1OR8A 2QMHA 3VSAA 2RHGB 1FOEB 3I6BA 4AUNA 1U1FA 2B5OA 1Z5WA 2E7ZA 3H3JA 5ERXA 3ZY4A 1W19A 3FHTA 1L3BA 2OFWA 2C0QA 4YXFA 3EFHA 3SYRA 1ZITA 2JIMA 4OHKA 1QBKC 1TQ8A 3ZE6A 1G6Q1 2XGSA 1CJUC 1XTRA 2MT9A 2X58A 4J8PA 4JQZA 4YJFB 3TLAA 4ZALA 4DUGD 4E1VA 5FWXB 4DOMA 5IS2A 4Z99A 1RB9A 2XHEA 2FSIA 2EIXA 4C7OA 2V0FA 1KMHB 3C8UA 2YV4A 3K9CA 4JAVC 3LUJA 3P0EA 1RLOA 1E1NA 1WQ1R 4I9FA 5AVQA 4YLGA 1M2VA 3L6UA 4IXTA 5HQJA 2HZBA 3D6MA 3EXG1 3HP7A 2IDKA 3IS3A 3QTBA 4W9NA 3WFZA 1D6NA 4NEGA 4N41A 4MLDA 3WK6A 1EHIA 5IJZA 5JZ9A 4U39A 4O5AA 4MI3A 1S2GA 2ZREA 3IU3I 5TR9A 2ON6A 4GWGA 3SI7A 2JLWA 3QZUA 1KEEB 5CDTA 3B48A 1QVZA 5A0FA 3SKYA 1CEQA 2RDVA 2XYRA 4MDYA 2JFOA 3UAYA 7REQB 1BQEA 3G0OA 4K26A 1F6WA 3ZDYB 3PQ4A 4L3WA 3O4GA 3WXMA 2JFUA 3CXRA 1T2AA 3NDPA 3UK6A 4F8JA 2DB3A 4CR7A 1PSDA 1Y5NA 2VT3A 2DYKA 2C0PA 3AJEA 4R40A 1A7KA 1GR1A 5JD4A 1KXJA 5KTMA 2H59A 2UYGA 3UATA 4EZEA 3VNVA 1XTKA 1XCMA 1UQRA 1FDUA 1XTQA 4NARA 4IEIA 3VA7A 3SQXA 5GJVC 4A8JB 3D0QA 5JVG1 4WOKA 3I2FA 3R9XB 1JHYA 3PL1A 1ESCA 1C41A 2QS9A 4ARCA 3ECAA 4PZCA 1CZHA 4N3CA 4L6AA 2Y76A 3N2EA 1LTKA 4KKVA 3DD1A 4HX5A 3JRNA 3LECA 3W8DA 1FCJA 2EBFX 2ZE5A 5EMNA 3W2TA 2RAFA 3AP3A 3DZ8A 3O8NA 3SS2A 3CW8X 4DV2B 1QH8A 3A4VA 3FNFA 3L7OA 5B3AA 3PC8A 4CM9A 1Z45A 4CHTA 5JZBA 1XP5A 3K1ZA 1EWTA 2IEBA 1FQWA 2ACKA 2GK4A 2R6R1 1LWNA 3I58A 3KLPX 3FYCA 5DGTA 1LW6E 4UHCA 1R8QA 1V25A 3I8OA 3TD2A 3JQCA 2EDAA 4TV8A 4UUOA 4MV9A 4NZMA 2BFOA 4RHYA 1AKRA 1GGMA 1FQJA 3I30X 3TZQA 4ZN3B 1CY2A 5SY9A 5CBKA 3SXUB 3IEXA 4B3FX 3MINB 1EUZA 1L7VC 1Z07A 5EOVA 1IAVA 2WEKA 4KXFB 4IG4A 3ZDRA 4N3NA 4EG5A 4OOEA 3QE2A 3E22A 3TRFA 1PTJC 2DTEA 4EG6A 4QOEA 1NM5A 1RXWA 4OO3A 1W0JA 1R9NA 1A97A 3BJMA 3IIIA 1VCOA 2PXHA 3E3AA 4OH7A 5KNDA 1RKBA 3CNBA 2ZRGA 1NUTA 2HIMA 4KQ2A 1F2TA 1UM9B 2KB0A 3A4MA 3EXIB 3KIPA 4KAFA 1MX5A 1JKXA 2D5AA 3HOUL 5C8DA 3S28A 2PGLA 3GDGA 1TA4A 2BR3A 2PS1A 4XW2A 1G8AA 4C0AC 4TM8A 1L6RA 1NW8A 3OAAA 4XIYA 2J0QA 2VTEA 3AR7A 5I9BA 2VUHB 2BAGA 3FTFA 2SKEA 2RDMA 2I3BA 5FB3A 2UVPA 3PIRA 3SVTA 3RF6A 1FMLA 4IW3B 2JCYA 3T1YB 2OV1A 4BBJA 4TQUS 4Z3OA 1R0YA 4PSUA 2QDXA 4IDCA 4XWTA 4TROA 2W22A 1KO5A 3ZWAA 1FP4B 4Y2SA 3E82A 4B6GA 3MJEA 2QGZA 2H8KA 2QWXA 3GXBA 3E9QA 2E2HL 3C7CB 3OPVA 2RGGA 1NLUA 1DARA 2ZIZA 5K3BA 5I8PA 4FWBA 3ZZUA 1JQLB 2YJ3A 2QSYA 1E2FA 2EJTA 1XQ6A 3TJRA 3OIFA 5LLTA 1A9OA 1PL8A 2JD0A 4PLWA 5TT0A 2F1HA 3EQ9A 4A8JC 2YHIA 1LBSA 2G82A 4CMEA 2XKJE 1DKUA 5I4KA 3GEMA 4GX2A 3KYUA 1VI2A 4MLCA 4EVQA 1BIFA 2FSVA 4P3KA 1BDBA 4WN3A 5GVSA 2FUCA 4L3OA 3R8XA 4FFDA 3ABSB 3L1UA 3N2GB 1OI2A 3R77A 4D82A 1YF3A 4XD7D 1PR4A 3V9AA 2ZOSA 3BL6A 3OECA 4FZRA 4ODIA 4WSOA 4MQFB 1FFHA 1PEKE 4Y30A 3FMFA 4HMQA 1ML4A 4A15A 3L8DA 3ELDA 1YACA 4ZCTA 4MA4A 4PG7A 5DGHA 5EINA 3ZWOA 9LDBA 1Y3HA 1PFVA 4R3UC 1MAWA 4FGLA 1RAAA 4RMNA 4YJ2A 1RLTA 1KAHA 2MSLA 4LN1A 1JPJA 1V6CA 2OBFA 3ZE1B 3FFAA 4GT1A 1IWPB 4P82A 4C7VA 4O08A 5EWLB 3S44A 3C7TA 3COVA 1UOPA 4GR9A 2VH5R 1TVCA 1GTRA 4F06A 1PR6A 4KO3S 3THSA 5IJ9B 1HI9A 3E7DA 1DC3A 1WMEA 3FXAA 1Y7IA 4U5QA 1P0MA 2YUIA 2V7BA 3Q5EA 4PU0A 1QCYA 4E12A 1RZUA 1GCAA 1AZTA 3GJ6A 2EF0A 3ZNQA 4ZYTA 4DKJA 1GKUB 5TLSA 1QM5A 3B85A 1CUVA 1K3UB 3N2YA 5A04A 1TJYA 4KWTA 2X0JA 3R0ZA 3VUEA 1G2OA 3SPXA 1Z25A 2EL9A 3UHFA 1PBTA 4RS3A 1SCAA 2ZRDA 4OKIA 2IYAA 1Z6AA 1EINA 3A7EA 4JI6B 3PD0A 3IXQA 2Q3FA 3AF5A 3PNSA 2XUAA 4NABA 3K8OE 4EH1A 5J1SB 3N9IA 4N9QA 3UB3A 1LF0A 1Q0SA 2SICE 3JWGA 4HJXA 3UT5A 3SAJA 1PGJA 4N1AA 3AILA 1QHEA 1ZM3A 2BGNA 3QVSA 1UBNA 5CX1A 4JV5B 1I9GA 1W46A 3VPBA 1EEXB 4YQZA 4JGIA 3WGHA 3DAPA 4QNNA 1UKVY 1Q1BA 4LE1A 3SSMA 3IC5A 5IKPA 1M83A 5G1NA 2BGLA 2AG5A 2HDOA 5K3FA 1GADO 1QKKA 4XEHA 3MG9A 4DTIA 2AX3A 2JDID 4MV4A 3C70A 3BK1A 3UWKA 2J30A 2EKPA 1POWA 1UZMA 3OPNA 1U3VA 2XVZA 3QWIA 1J1ZA 1YOVA 4MLZA 1QVWA 1PVDA 1FNBA 3H5NA 4EG3A 1GDHA 2W0SA 2V97A 1T9KA 1QQBA 2OZVA 1J8MF 2BPOA 3QFSA 4D9IA 4WUVA 2ZI3A 3DFIA 3U4GA 5KQPA 1MFZA 5LZ9A 1E79D 5KYUA 4WBXC 1HEYA 3OESA 4N01A 4PLYA 5HA5A 3TZCA 1EKXA 2X2PA 3NX4A 1OZHA 3ZH9B 3IBYA 2X15A 4ZYXA 3GEEA 2R47A 2V0EA 2V6MA 3QOYA 3M9LA 3TZ6A 3CVUA 4BO5A 4RTMA 5KYXB 3QV1A 2QAJA 4P8RA 4C0BA 2GJSA 3ADPA 4HJRA 5K0CA 4Q0MA 2PZGA 2FQ1A 1E7SA 3WQQA 2VL6A 1SCIA 2R8EA 1TC1A 3HU3A 2FZVA 5JXIA 1EWKA 3LXRA 1L4NA 3C5EA 3OE4A 4JC0A 1UDWA 5C35A 4ZVNA 2DEUA 3MOGA 1CULC 2WB1P 1T8PA 4D43A 1RI3A 4NJOA 2WIDA 4NL4H 3H5VA 4MUBA 1UWKA 4U7TB 1E0SA 2NXNA 5FFNA 1A2OA 2XLCA 3QLUC 4I5DA 3GDOA 4R8VA 3K9FC 1J0XO 3DE4X 5MF6A 3HCWA 4MVCA 4TUYB 1QUEA 1P3JA 1RAFA 2PM8A 3ODGA 3M5DA 5C7OO 4LRTB 2XCQA 4O8ZA 4PX2A 5BW8A 2RONA 3P9SA 1SKUA 3VHRA 1UBJS 4RDXA 1EQUA 2HSZA 2CNOA 3CG4A 4IIYA 4QYTA 4OXRA 1MAUA 3HXMA 1U8XX 4DW8A 2W37A 4EZBA 3DC7A 3H2BA 4EIWA 2H9YA 2JFQA 2GCPA 3IURA 3OCCA 4UEJA 1V96A 1RPZA 1GQ2A 4ZJPA 4BZPA 4F4IA 4CW7A 3GJ3A 1ISRA 4HXYA 4DMCA 4D3FA 5HG0A 2EZTA 1BYIA 1C9JA 3KSMA 4G25A 4L7VA 3LK6A 4CHGA 1STOA 1EAMA 3WYGA 1OXXK 3CZ9A 5C2JB 1EE1A 5EJ8A 2IYRA 4UOZA 5DCWA 2FN9A 2HN9A 3OZ7A 3M81A 3JQ6A 4NZYA 1TGVA 1B6TA 4QARA 3RVLA 3BGOS 3COPA 5AIAA 1Q14A 2DM6A 2RMKA 2R7LA 3MBIA 2A6ED 5KSOA 4KI7A 4Z7QB 5AW4A 4MV3A 3IPXA 2WHQA 1I3MA 1M73E 3OCZA 4RVOA 3TVYA 5C8YF 3PWKA 4QFMA 3AI3A 2NIPA 1QG4A 5JMOA 2HXSA 1F7UA 4DCTA 1MRZA 4DDHA 1U90A 2AR0A 3ICOA 1H1LA 4KK3A 5EXDA 2IYTA 4AN4A 3NAQA 3CCFA 4M4SA 3UMSA 2V1UA 2QM8A 1B0AA 1HZZC 2AFHB 5LXTA 3MGGA 1CDOA 3D3WB 1PDWA 2FV8A 3G0HA 1P1FA 5D3MA 5LMNB 3ZV6A 2R62A 3AETB 2Q9AA 4AZ3A 3UMVA 3RC1A 5C8XA 3NNNA 2O7VA 4DR7B 3GRRA 1A2QA 3BS4A 4IUCS 4TGLA 5G2OA 3VZSA 2V54A 5G40A 1W4LA 4QRIA 2O8VA 5KYKA 2PQ6A 3LPDA 3HKCA 4MTLA 3AFHA 2PX8A 3RIXA 2ZPTX 2MSWA 3K0HA 2B36A 1V1RB 4JC5A 2HHAA 5EJAA 1KWGA 2WPDD 1ZG3A 1XA0A 2B1QA 4Q48A 1Z4OA 3Q6IA 4A2QA 2BFBB 2DH6A 2JI3A 3AF6A 1USKA 3NLLA 2AI1A 3C7KA 3R3WA 1XJ0A 1TW3A 3PJEA 4PG4A 3RC7A 1QLWA 5JOQA 3T35A 1SC4A 2VO1A 4ID3A 1Q84A 4B6SA 1HLPA 4LV5B 4CM7A 3KZ1E 1WVIA 2C59A 4J29A 4J4TA 3O94A 3UUWA 5NULA 1ZJ5A 3FZGA 4R01A 1S8FA 4BO7A 5JFOA 4II7A 1U9CA 3KO8A 3D2LA 1PF7E 2F6RA 5ER6A 2I4TA 3S27A 5CNIA 1AT1A 1N6IA 3U4DA 4EF6A 5CA1B 4KHPB 1MMFB 2B99A 2CHFA 3LZDA 4PM4A 1SU8A 4J7XA 1CUBA 1ZH2A 1ZKDA 3KQSA 1UBMS 1PWEA 2J6CA 3LBAA 2Y9MB 4NECA 1IJEA 3K0KA 3OM1A 1Y80A 3U1VA 5FNZA 3K4HA 4QLAA 1WSWA 2FUNB 1DQZA 1UKCA 4HGPA 1VGQA 4HQKA 2XR1A 1LI7A 2IYYA 2YCBA 1F14A 3LPCA 1Q1QA 3R6TA 4QPZA 2OCIA 4RSRA 4V3CA 5ULLA 1EUCB 1I4WA 4BZZA 2Q9CA 1YS9A 2MSNA 5DSXA 5EIBC 2VCYA 4WXYB 2NVUB 2QXTA 1L5NA 1IY1A 1TEXA 3L8FA 4Y9SA 4JZKA 4ZCLA 4RHUA 3C7DB 2J5BA 3PRYA 5EKSA 4J4HA 5TGTA 3O95A 16PKA 3I72A 1D2RA 2BGUA 2O7SA 3GJ8A 4FIZA 1N2IA 2PCJA 3GBVA 5IN4A 2AFHE 3I8XA 2XUOA 4ZCMA 1UOOA 1W59A 2Y92A 2XB8A 4X62B 2Z2XA 1M6VA 3RUPA 1TU4A 2QIPA 2X6RA 4HDCA 1AXRA 2BHLA 4X1YB 1V7QA 1BH2A 1QQTA 3U4HA 1SK9A 4P31A 2WFAA 1BVHA 5U9CA 4AY5A 4OU4A 4ZDWA 1P4HA 3TK1A 5T7BA 3OZEA 2WTNA 3V7YA 3ETCA 3PHIA 3F2VA 2F3SA 3L8ZA 5JYEA 3KD3A 1J6UA 2IY7A 3HEMA 3M6UA 1YC5A 3QHAA 3NHUA 3UFXB 1E3WA 1WV0A 3V4OA 4Y2QA 3SC2A 5L51A 1T5TA 2QUKA 3GFSA 1X80B 3PWTA 3HZZA 4EBBA 2O8BA 3KYBA 4QJIA 1PL0A 2YNMC 3QKUA 3L7AA 4JBWA 1QYVA 1YJ5A 1DOAA 3SZGA 2OG1A 1FYDA 2IH4A 1ZIPA 4TV9B 5KNBH 2WTEA 2G7ZA 2PXAA 3CO0S 5A4MS 4I9NA 5B55A 3TUZC 4HDRA 4NS4A 2F4VB 4C29A 2BHRA 4NFHA 1DKLA 3PC4A 4IXMA 4G4JA 1J22A 1HRDA 3AV0B 1Q7GA 4N9WA 4PN7A 2Y05A 5TF4A 1SOMA 4K1XA 5DP1A 2GHRA 2P68A 3JYLA 4ITRC 4DF3A 1DKMA 4Z7OB 4UPDA 1Y6ZA 2FR8C 3QU9A 5AJXA 2RBEA 3OZVA 4JLPA 2X3YA 4E6PA 2YWGA 5K45A 3OLCX 4NU6A 3INTA 4NBSA 2IT1A 3LLCA 3NJRA 4FMDB 2OAQ1 3NTOA 3GWGA 4MS1B 4P7JA 4EL5A 1W47A 5H9VA 3ABOB 4FONA 2LRHA 4PNZA 1NPTO 1XVAA 1ZRSA 1A8SA 2JA6L 1REQA 3RSQA 1PYOA 2CJXA 2QX4A 4ISBA 1YGPA 5BV2P 2WAYA 1NURA 1E2BA 2B1IA 4QWWA 1C1XB 1R5NA 1KMNA 3HO6A 1KAGA 2DFTA 3TCKA 1ORTA 1BW9A 3PZRA 2GEUA 5L3RA 3ZUPA 3FUUA 3I5XA 1KQPA 1ZBDA 4IMPA 4RPHA 2CSXA 4LFBB 5ICMA 1E5QA 4PZAA 5FLYA 1G2IA 1ENYA 4UXJA 1M6NA 2Q1XA 1RXIA 2X7XA 3H97A 2JNWA 3BK7A 4K6HA 3RVQA 2HSWA 4DA7A 4EYSA 3OQJA 3G9UA 3T52A 2PO7A 421PA 4O2LA 2H08A 3ABQB 1Z7GA 2P65A 2X7HA 3HFRA 3HUDA 2VKTA 1SXGA 3L41A 4O2BF 5BURA 1SHKA 4JB0A 5EJFA 1Z6PA 3EQ8A 1VP3A 1U7DA 3LOQA 3H5TA 2OV3A 5ALSA 4D4KA 3LWBA 2M4VA 3OJ0A 3LWDA 4WESA 4ZI7B 4KLCA 3KSBC 3HA7A 2GN0A 3D3JA 4YAOA 1JHQA 5C52B 3GAAA 3DOJA 1VL8A 5I8ZA 1XXHB 1G1MA 2E1RA 2JB9A 1EB9A 2JCVA 4FSXA 4QQ8A 1GUZA 4N7JA 5L7WA 4ITUA 1K88A 1PJAA 3GJ4A 1PJBA 2XPCA 1N6HA 1QB7A 1SCDA 2PH1A 3RIHA 3NBKA 4JBXA 1IPHA 1BS9A 5TV2A 1JU3A 4BAUA 2EARA 3OEYA 1W7AA 3X2SA 4BVJA 4XA8A 5F1OA 4MHSA 1NUHA 4ZOQI 1NQXA 4FXOA 2ZCJA 1CR2A 1PR0A 2Y1CA 2W90A 3GA7A 2FP4A 3AM4A 1P1BA 2BM1A 4FBLA 4B7CA 3ZVNA 2SHKA 1XVLA 2DUUA 2OLKA 1E4OA 1BMFD 3KB6A 4REQA 3QTTA 1S2ZA 5G4KA 2OHGA 4PIVA 4OREX 2AS0A 4HUQA 4WXHA 5BNTA 3THWA 1E3MA 7ADHA 3DVAA 2C7PA 4Z4FA 3KYCA 2VSYA 1W4CA 1E3SA 4EF4A 3R09A 3RTBA 2Q5IA 1HH4A 3QEKA 5U4QA 1GVNB 3VH3A 3N74A 2QMEA 1BHJA 3H13A 3FFTA 5EP3A 1JG6A 1K6XA 5HZKA 4RH0A 1P6XA 1HE1C 2JGLA 1G55A 1KF0A 3WK7A 2L0ZA 1JJFA 2ECFA 4DANA 1M1NA 5A3JA 2E89A 5GV7A 1QOQB 2PSMC 2NGRA 1FP7A 4FI3C 4MIYA 4HVAA 1IHPA 3AHJA 1II8A 4ZO8A 1C4XA 2F3QA 2Z1NA 4AUKA 2NUPA 1Q0HA 2QT1A 5DNVA 3FKSA 3SX0A 1CUUA 1RYNA 3BB3A 4GI1A 3TE6A 3I76A 3VPSA 1RD4A 4EI9A 3V97A 2Y4OA 3OO1A 1OUMA 4C7MA 1YZHA 2Y77A 3NJ8A 4GRIA 2RGYA 1BS2A 5I8WA 1KMQA 4JUDX 3R76A 1OI3A 4YRDA 3MPUA 2OXFA 4FYVA 4RKEA 4PY2A 1ZA1A 3D0RA 2ATEA 4RS4A 4EY5A 5M5BA 5DZSA 1WLSA 3ZGYA 3B38A 3ROKA 2Q5CA 2FRXA 4R7ZA 3V8RA 3RZ6A 1ZAKA 2HMWA 2FJUA 3ONFA 3OY7A 3QVXA 1RYQA 5AW9A 2GCOA 1DELA 4M22A 2QTVA 1LQ2A 2RGNA 3MRXA 3O5AA 4UCQA 1GG2A 4PRLA 4X1KB 4MV0A 2W8ZA 3UHJA 4L76A 5EKTA 4HWRA 4C0QC 4CDGA 5CR9A 4B6FA 2P67A 2C3PA 1O58A 2VF5X 3FA2A 4XSHA 3NHJA 3SHWA 3GXOA 4NH4A 1JBEA 4TLCA 4XM0A 4DM7A 2WMDA 3EEFA 3BDVA 4KAXA 2QRUA 1PD1A 5SZHB 3HB4X 2VWHA 4H3KB 1XXHE 4LDJA 3QFRA 1Q83A 2XQJA 4YQYA 1NXPA 4A8TA 2XGJA 4DR5B 2PKQP 5AVXA 4YHBA 5H16A 4ZT5A 4PVDA 1OB2A 3MWYW 3BWXA 3PUHA 4B46A 2DFDA 3HB9A 1MC4A 5SYMA 4XVQA 2C7BA 1UL1X 1ZMXA 1WS6A 5KSWB 4LECA 3WTCA 1W1UA 1R0JA 1H2FA 3KB2A 1W5EA 1A77A 4TMFA 2J5KA 4H6PA 3S6JA 2FDXA 3FPFA 1O89A 4UTVA 1OWLA 1C0EA 1UMCB 3K7EA 1ZLXA 1R8SA 3RT7A 4JLUA 1DKRA 1RWMA 3BMQB 3NC0C 5CXUA 1H3FA 1M1ZA 1RKQA 2FTKE 4QUIA 1WW3A 1O94C 3FPGA 5FHRA 4BE4A 3UOWA 1KDTA 2ZYAA 2ET6A 2VPPA 1HSOA 5FO1A 4RE6A 5KPDA 4NCIA 1SC9A 1MJGA 2VK4A 1YUZA 4RVNA 4X6UA 3S5JA 5AH0A 2CNNA 3AJAA 3TKLA 2GEDA 3FDJA 1FYFA 2L0XA 2B9VA 2FPOA 2ZSEA 3DOUA 5IXJA 3HCDA 3F74A 3P8ZA 2V5VA 3TTYA 1GEEA 3JRXA 2Q5FA 1P29A 1V1MB 1S3SA 2AJ8A 4E08A 1I3QL 2Q0SA 3LXMA 3THXB 2AW5A 1SA0B 1UQUA 3PDUA 3PYMA 4K46A 3IP9A 3RVRA 3VMFA 1SH7A 2MJLA 2VT7A 1YZFA 5AO9A 3FVRA 3FPSA 4PG6A 4IHJF 4NQZA 4C88A 3IMKA 3WWLA 3HXKA 2WLSA 1ZMBA 3Q3GE 1RCTE 3L7DA 2PVXA 1ZIDA 3DBOB 4UNNA 3ZBQA 1A5SB 1V11B 4YRGA 1KARA 4H0FA 1GFWA 2PZJA 5T3YA 1F38A 1NSYA 1VIMA 2PGNA 5FTKA 2WINI 1P3Y1 5K05A 3K0SA 3AZQA 3IVXA 2ZU6A 4FYKA 4JENA 4N5LA 4RNCA 3R5KA 4TL8A 1CF4A 3UK2A 1W25A 3V1YA 3A3KA 1D1QA 3JALB 1JR2A 1KWKA 1ZHFA 4JMPA 1NW7A 2AV6A 1YQ9A 1F4LA 2BH9A 4ZODA 3W5BA 3KALA 2CEAA 1NN5A 1JSRA 3GZJA 1K2VN 1T2VA 1NULA 4BFLA 4DTCA 2WWGA 1UJ4A 1CRWG 1F1JA 3O8QA 3KT6A 3I0MA 1XNJA 4LY3A 2D00A 2I4NA 1F2DA 1FSSA 1U7OA 3TW4A 4IDNA 3VH4A 721PA 4PAOA 1IXYA 4MV7A 4S2EA 3M7IA 4K8RB 5T64A 3SLRA 3SM3A 2A5DA 3V8VA 4ER6A 2OAGA 4ROSA 1EA5A 4KFCA 1KI7A 4HBGA 5HIIA 3X1KA 3WQHA 4HV4A 4CEIA 2C96A 3HADA 2AMYA 1U0JA 1W87A 2G5TA 3CQ9A 3Q7IA 4I55F 4IUBS 2WU8A 5B58C 3MD0A 3ZY2A 1L2TA 2WT9A 2OC9A 3L4BA 4ZP1A 3HR4A 4C1BA 4YRAA 4V3BA 4K6KA 2OXIA 4PG8A 1Y6GA 1ZFNA 2VXCA 3DE6X 5K6TA 4AY2A 1ESEA 3RT1A 2IITA 5FAXA 1G3RA 3M6MD 5GJCA 3WWEA 1RIFA 2J3JA 3NHBA 1NNUA 1Z7EA 2J3MA 1NVMB 1ECGA 1U9ZA 4KAAA 4MAAA 3V2GA 2WKQA 3TIFA 3EDCA 1AQ6A 4GC9A 4D8VA 2EXXA 5L3SA 3SK0A 3EVFA 1SY7A 4MS4B 3CRQA 4ZVKA 3FWNA 3UB2A 4D3YA 1Z6XA 4PYKA 4YMUA 2H9IA 2M2IA 3I01M 1DEAA 1MF7A 6Q21A 2V4ZA 1UBSB 5EE9A 2HCFA 3GYBA 3OJCA 1RNLA 2W2PA 3SEQA 3VJMA 4A6EA 1CTQA 1VRCA 3HRHA 4LC9A 1R9MA 4TN5A 4P4SA 1E2EA 1XCGB 1BFUA 1Y63A 3ASZA 4HGOA 2NTJA 2X0DA 1NW3A 4LTMA 1B76A 3K20A 3N07A 1CDEA 3HFJA 3QU2A 3WMEA 1XVUA 5AKGA 2HB6A 1FQOA 1SOAA 4MAMA 3SM9A 2FG5A 3AKZA 1EWYA 4DEVA 4ZJYA 3GOHA 3ZOZA 5GONA 3RD5A 3AJDA 4U00A 1OXVA 2GR9A 2R5WA 2JIZA 4J2OA 4HDMA 4OH1A 4LA4A 5KYYB 4KYTA 4I19A 2ZBRA 2XGMA 4MR9B 1O6GA 4JY7A 2QE6A 2LE0A 5C3UA 1NHGA 1A8IA 2GJ4A 4G07A 4N5HX 2NP7A 2VWGA 3LVQE 4NYIR 3EVZA 3GAZA 4KV7A 3RZOL 4H16A 4EGFA 5C7IO 5CFPA 5SY4A 3DGEC 1QTQA 4LE2A 2HW8A 4GR4A 1Z4MA 2NMVA 1BKDR 3I12A 4GE3A 3B7PA 1QFZA 2PN1A 4EZIA 2BTEA 1OI7A 3AUSA 4NU8X 3RJTA 2PU7A 1M1XB 1F4VA 5J2TF 2E4ZA 3ZKAA 1MRNA 1YRLA 4KXMA 5LUAA 4OJNA 4GPTA 3EG5A 1F0NA 4L08A 2WAOA 2CXUA 2HXGA 3EA5A 3RS0A 1P7ZA 1YVPA 4YR7A 3IT3A 1IPFA 3I62A 1EFVB 5JS6A 4TWIA 1JXOA 4YAFA 1T4DA 2BFAA 3ZCXA 1AS0A 4G5XA 2JK1A 3BAFA 3LL7A 5HF5A 2ZM5A 3BQNB 3K70B 5JZVA 2JJ1D 1VFNA 4L1KA 4Y2JA 2GAAA 3DDSA 3RBVA 3KE9A 2DT8A 3DF9A 4V1CB 1V5IA 1KGDA 3DLAA 2QUAA 4DNXA 2WWVD 5EHZA 5PNTA 5B3JA 4DMUB 1FXUA 3LH5A 1N1DA 4CG0A 2AMVA 3SYNA 2ZSFA 3PDIB 4EFMA 3EBOA 2KI5A 3QVWA 3V8NA 1SXIA 3AHCA 4DAEA 3DCYA 2PUDA 1BH6A 1AGXA 5JI2E 1G6KA 1GQOA 2WW8A 1FVHA 1QH9A 2DWPA 1MGPA 1IHUA 2R86A 1F6BA 1WG8A 2UAGA 2V7QD 4QGGA 4F5YA 5MGBA 5DNWA 5BSTA 1Y9JA 4BEWA 1F9AA 3PO2L 3FFWA 1BMFA 4JUIA 3ZGOA 5C5CA 4GX1A 1AMNA 4C2TA 1PNOA 2QGFA 4OGKA 1L7QA 1USWA 1W8IA 3NALA 1M5RA 3HWSA 3B70A 2P0YA 1XWIA 3Q7EA 3HDQA 3B12A 3LPEB 4M1YA 1P4JA 2J41A 3DAGA 3CHYA 1ZC4A 3AYZB 3D3KA 3N6XA 3OHSX 1CS4C 1JLSA 1KPIA 3HWRA 3TI7A 4BRWA 3G8CA 2APOB 1J2JA 3HCPA 4CMCA 1LLUA 4D4IA 1PTJA 1NQ5A 4LYJA 1O03A 3SR0A 3TZLA 4DA8A 3HLKA 3R75A 4DCNA 2AG8A 1NXEA 1OB5A 3C8DA 1V9LA 2D4AA 4JADA 2VPIA 1XCLA 3ITKA 5T4BA 3UH1A 1P2UA 2P4UA 2W6NA 4AVYA 5ISMA 4HUJA 3QPCA 4K9RA 1NW6A 13PKA 2CUZA 1V8BA 2Y1FA 3AEZA 4F3NA 4F6CA 2BYTA 3ZD7A 1V45E 3QQ5A 4LE0A 3DJYA 5CCDA 1EBFA 3TCXB 3LWPB 3IRVA 3D2CA 4EUEA 2CGEA 2Q2OA 3A37A 3KT0A 3R6GA 4TS9A 4DT1A 3CKYA 3I9V1 4KMSA 4XB1A 2PKRA 2ZXFA 4PG5A 1R4AA 4N0PA 1Z7YA 3A6DA 4E5YA 2BF7A 1U6JA 3SS8A 3BL5A 4HSEA 3DLIA 1G8FA 3N3AC 5ALLA 4YHHB 4L75A 2RHWA 3RS7A 5B64A 2X5KO 4XGKA 2VZ8A 4PZUA 5C1IA 3W6PA 3OEHD 1LWOA 4P3PA 4ILEA 1CAAA 1EMDA 2YZMA 1DQPA 2ZIUB 1E8NA 5JEDA 1ACJA 5TMDA 4M3NA 1Y9ZA 3PIIA 4A3DL 1OASA 3LWQB 3RJMA 2MS3A 1A7JA 3LLMA 1AG9A 2QW0X 3EUEA 4YJ3B 4BRSA 2HI0A 4A3IL 2C8LA 3EVGA 3IQGX 1PFQA 2D3TA 1EE9A 1ADCA 4BLOA 4CIXA 4R8RA 2PL1A 4DQXA 4X3CA 2ZWMA 3K70C 2VHTA 2VQ6A 3AGQA 3A3PA 3MLEA 1V48A 3WHKA 1G8HA 1YUMA 2HRBA 3I61A 4BMXA 5T5QA 2D5BA 3P0IA 3D3NA 3ROMA 4RD1A 2EW2A 3ORSA 1Z12A 2AZTA 1TLTA 3L4EA 3HXQA 2YMPA 1M6WA 2O5VA 1L5OA 2XODA 1PT9A 1WUYA 2C42A 2EF1A 1XR3A 2GEBA 3IVCA 3SEZA 4Y2YA 1ENPA 1FK8A 1I4TD 1S7GA 2G4LA 5LOVA 5EWMA 4UVDA 4U3JA 3ZS8A 1C3XA 3QX8A 1YZNA 4YCMA 3DT8A 3ZWKA 3AHGA 1VLQA 1T43A 2VBGA 4RLSA 4WOCA 3AFNA 1P8AA 3PNOA 2E82A 3R4VA 4MJ3A 1DI0A 1V3TA 3KQUA 2XUIA 3HQ4O 4PLCA 4AJIA 2QD4A 3L4SO 2RD2A 1K6EA 1D2CA 1OFUA 1VPTA 2JAWA 2WU1A 3H2HA 3JRWA 4BJ5A 4BNKA 4QVGA 1SBTA 4R1PA 1SHUX 1A7AA 1SJ9A 3G2IA 3NTUA 4FHDA 3RHTA 1EP1B 3CNOA 5JZOA 2DPLA 5AW2A 2FZEA 2MOKA 3PHLA 4RY8A 1KIMA 2ZEJA 3V3TA 4RNDB 4CMAA 3UW1A 3VNQA 4B3GA 1OXTA 4MR7B 2BI7A 3P5SA 4UUMA 4FCWA 2KWIA 4D4GA 2PX5A 2O2ZA 1IWBB 1AN0A 5IYZA 5KYWB 4PX3A 1LZKA 4QEZA 3K94A 2Z9DA 1DG9A 4KQCA 4RM3A 1VHWA 2B0CA 5HKAA 1HQDA 4L8GA 1JEYB 1R0IA 4D41A 4TRJA 3LYUA 1RBZA 5HS4A 4M0PA 3OTQA 3BDIA 4RHEA 3WNQA 5CAEA 3VOBA 4D74A 2EP5A 4CIDA 2AG1A 1U2RA 3CKKA 4FYWA 4JCCA 1GUDA 1Z8DA 1Q7CA 4LYGA 2VDWB 2IXEA 5IYDL 2YN4A 4GI7A 3PRJA 1A8PA 2P7HA 1PZMA 2FDRA 5IH3A 1X0VA 1XTTA 3DCJA 3KFLA 3RS2A 2CB0A 1G4AE 3L0IB 2I76A 1OGIA 3M34A 4NRDA 4U6SA 3UUFA 1EK6A 4XH9B 3ET4A 1N4AA 4E2XA 1B1AA 3I92A 5LYJF 3I64A 2AN5A 1N2BA 4CIAA 3E3NA 1PO7A 3FCEA 2NVQL 1UK6A 3ONNA 2PWYA 3KHSA 4LZPA 4XARA 3ZJ4A 4AP9A 3TWOA 4D0LB 4ZAZA 4U2KA 2BFDB 5AK0A 4F12A 5J2UB 4J0HA 1E5LA 1K7XB 4HLCA 2AYZA 4ZHQF 1FSPA 5ADWA 2PV0A 2GYWA 2JA1A 3OMLA 4B6EA 2VRNA 1JHMA 1KQFA 4MUGA 1NAHA 1OIXA 2XBMA 4TLMB 5B1EA 1YHNA 3LJKA 1QB8A 1LPOA 3Q3JB 5REQA 4E5PA 6PFKA 4YDQA 4YJGB 2I54A 1XDUA 2RGUA 3MERA 3LD9A 5HDQA 1RW4A 2VL7A 4WKGA 2XH8A 4FFMA 3WX0A 4TVKA 2PA3A 3ZZTA 5HKLA 3I4LA 3IIEA 1VLZA 1XG5A 2Q4BA 4WADA 4NCKA 1LXCA 3DTVD 1UC4B 1RADA 4PTZA 2AXPA 3JAKA 4Z4IA 2D1FA 3EIQA 3QW4B 1QHYA 4YALA 1LLFA 1ZK4A 3P96A 3PGMA 5I9SA 5KYGA 5A06A 1JQDA 1SEPA 3HBJA 1V4VA 2FFBA 1DO2A 3COWA 2V4MA 4MS3A 3ZI7A 3IMCA 1GZDA 1RMQA 2J1LA 1FB5A 2DCUA 3PXDA 4IEEA 2G72A 3P71T 3ULKA 1S9DA 3D9QX 3O8OA 2LWIA 1XMVA 2XCIA 3ILSA 2F64A 4P3NA 1THZA 2IZZA 2CT8A 2C5SA 2OYRA 1NOIA 4A3BL 3VYSB 2Z3WA 1YBAA 3ND9A 1ABFA 1Q12A 1QXSA 2ID4A 3HJGA 4OSEA 2H4WA 5F52A 5HE8A 3JZIA 4TWRA 3TPCA 1QLJA 5F4BA 2C2WA 3A10A 3A58B 1GUAA 1M8FA 4FMBB 4PR3A 5D84A 1TA9A 4AHZA 3BTUA 3AL0C 3R0QA 4G8BA 3HJUA 3D4NA 1WCWA 3WL7A 1P74A 5AUPB 1ECCA 2ZBGA 3BXHA 5BOSA 1WPXA 1CJSA 3BSSA 4V39A 2ERSA 1A82A 3V4VB 2XRZA 1P1IA 4I1SA 1J70A 4K6FA 5F2OA 2C82A 4HADA 1J5PA 1R27A 3C4JA 3LK7A 4HAYA 4Q9IA 4H6WA 2IPAB 4TS1A 1JXMA 3P0FA 4TVMA 1G5HA 4TSRA 5F7JA 3DEAA 3RBXA 3RUFA 2XTMA 5KSYA 4KXVA 1G8YA 2DULA 3U3RA 5IDXA 4LJ9A 2WF8A 3ZVMA 2JJ1A 4YMIA 4BRUA 2PT5A 1SCJA 3O38A 3OQIA 1A4IA 2QJWA 4MKIA 3N3BC 1A5AB 1Z5PA 5FL3A 2ODQA 4B75A 3GDHA 1Y4SA 3NTXA 3PDHA 1U3UA 5HOEA 2EBWA 2H2HA 5I48A 4GNKA 2QRJA 4KO4S 4AJLA 5HDBB 3TLYA 2Q3BA 3THOA 2XKBA 3IUBA 4MGKR 5CVTA 1E9VA 1GVHA 2OD7A 1BCSB 3OLVA 3CSSA 3E7PA 4M6WB 5LBIA 2X1LA 5DTIA 2OWEA 3O92A 1J8DA 1XO1A 2R4QA 2HJSA 5IT5A 5DT2A 2I03A 2AKYA 3OUUA 1AO0A 1ID8A 2V7QA 1QH0A 1TIBA 5D8DA 5GV8A 3VNAA 3G2PA 4HZUB 3R6DA 4QAQA 4ZDJA 3QNUA 3MRVA 3UJBA 1EIWA 3FB4A 1DNPA 4QYWA 3ZE0B 5CHEA 3OZAA 2O07A 4M0LA 5D6OA 2MR6A 2UZ0A 2IHTA 2A1TS 1ZN2A 4QD3A 4YREA 5ADUS 3PR1A 5BRJA 1X9HA 4U63A 1CZNA 1KZ7B 3JQGA 3VO2A 2BGJA 4DYDA 2D54A 3E5NA 4KR0A 4UM5A 1LQUA 3NHLA 3ZDDA 5IXSA 3D6UA 6RXNA 3AKCA 2IZ7A 4NX2A 5CLQA 3MTEA 3RF7A 1E9CA 1AIPA 2CKMA 2O0HA 3MT9A 3MQFA 1CYEA 1CQJA 1TUEA 2QG6A 3OCXA 3U4CA 3M5PA 4G5SA 1XEXA 3BB1A 4G36A 4IDFA 4K9OA 3EIFA 1ZUD1 5CLIA 4ZMRA 4G0MA 2QV7A 2CKAA 2JHAA 3GRCA 1EFHA 3P32A 3PVZA 3L6BA 5F21A 4RELA 4CEHB 2G5CA 1GSIA 3NKLA 4G5OA 3OHPA 1D9XA 2H1WA 4IHAA 2Y67A 3QXHA 2JFGA 5EZYB 1VYHA 3ZCVA 1T2EA 4DJEC 3RU7A 4YRIA 3AFMA 2FCAA 4YP1A 5ILGA 1A0OA 4RETA 3TSOA 3KZMA 1HM5A 3ROPA 4JN6B 3T38A 5EZ5A 3IQFA 5JEEA 3C5CA 1GPJA 3OEHA 5BWNA 4R9RA 1M74A 1OBFO 2RARA 3CX4A 1K7YA 3HP1A 3PBKA 4HDKA 3BIFA 3MLAA 1NMZA 1W4AA 3G9ZA 3HACA 1MABA 1T3SA 2PD3A 1TT5B 2V55B 2ZDGA 1E5DA 4W1RA 4DA4A 2XJTA 4Q9DA 5BYKA 2ZANA 5LU8A 2AUNA 3B1JA 1ZGCA 3EJWA 2XB9A 3C6KA 4QHYA 3WYNA 1L5HB 4DWVA 3GEGA 3NI2A 5DGDA 3GFFA 2BMVA 3R0VA 3V2UA 4CTOA 3JQAA 2OAP1 3MSUA 4GPD1 3KDAA 3LAWA 3MIZA 2B83A 2Y27A 4PGMA 5DX0A 1FZTA 1J1IA 5JXWA 3LDHA 2PDAA 3QUQA 3QK7A 3RAGA 4G0PA 1ZVQA 2R97A 1SBIA 4MWCA 3EGCA 2XCLA 1TGYA 3KOUA 1EBBA 1ILWA 2PGIA 3ETEA 3G5UA 4QUBA 3WGNA 3K31A 1O6BA 2YNMA 3M1YA 2QRVB 4JMLA 2AOXA 3T5AA 4BKPA 4R31A 1YDGA 4ZVTA 3CV3A 2A30A 5K8UA 2FPPA 4GMGA 3GGSA 1XF1A 2C9DA 3VSEA 3ROEA 1TTPB 3EPRA 1BE6A 3ADKA 4G0OA 4RJJA 5BN3B 2NU8A 5BWCA 1UBHS 4GKVA 4DLTA 1YJAA 1GGVA 2CXQA 2HWKA 2P1RA 3DW1X 1JEAA 1PD0A 3DDNA 4IOLA 1K8XB 3VU9A 2IGBA 2AL7A 3MTJA 3GMSA 3WADA 1DBWA 2FWPA 1DJMA 4H1VA 1QCCA 1LBIA 3COZA 3FNHA 4FK8A 3FDZA 4H9GA 4HFRA 4L16A 4L9WA 3SE0A 4BO4A 1G66A 5ALHA 2OP1A 1MDBA 2PZLA 2QRKA 3CX7A 3GNLA 5CU7A 1OXSC 5LP1A 2PX3A 1LGYA 3C39A 1HMYA 1GPAA 1K5DA 3PKIA 1V37A 1V3VA 3DD5A 3HU5A 3DMYA 2ZCVA 2R2GA 4LHSA 3DV0B 4EGAA 3R6LA 1ZUWA 1NJ2A 3H2SA 2OM6A 4FWIB 1D03A 3L7KA 4ZOAA 5EZQA 5KTPA 3QLEA 2XCSB 4OI0A 4E88A 4DUZB 3U31A 1PFWA 1RRFA 1H8ED 2VNHA 3OTIA 3LBIA 4Q7MB 1H6CA 1R4ZA 2FN3A 5JSFA 3RQIA 1NP7A 1X8LA 3BICA 4R05A 2C5HA 1ZXBA 1UXKA 3PNPA 4R0NA 4B8YA 8ATCA 1RCFA 3MS2A 3TEMA 2INGX 2H29A 1FUUA 4BBSL 1NZJA 3OQBA 2R8XA 4H7PA 5GVRA 1BZYA 1YAHA 3BXFA 4LJ6A 4DIFA 6NULA 1OAOC 4LVCA 5FT9A 5ELMA 2ZB2A 3EDQA 3QX9A 1X8JA 4W99A 3C3WA 3EZ7A 1Z0SA 1B7GO 4FHGA 1R4NB 1IEQA 3E27A 4EJSC 1RQ2A 1OXUA 5E3JA 4BJHB 5DHQA 3AEYA 1GM5A 4NXMB 5JQGF 1HYGA 4JR0A 7RXNA 3MZ0A 2RKOA 4Y2RA 5AVZA 3U4IA 1M2HA 1VA4A 3VVLA 3KLNA 4AI1A 1UQTA 2ENUA 2OCDA 3AJ9A 4A1FA 1YS6A 1YT5A 3Q6NA 2C5LA 3EXG2 3K96A 5LA6B 2SCUA 1T2NA 2X42A 4NZNA 1ZPDA 2YJGA 3K2QA 1N1GA 4KXNA 2VJCA 3RFXA 5BWMA 5FOVA 1DIHA 5HEKA 1WCIB 2PPVA 3EFOB 3CRRA 2RGDA 1MB2A 5FUXA 5LB4A 3K9HA 4ALKA 3W2IA 5IC4A 3GZNB 1C81A 1KI6B 4P35A 3UUEA 4B8ZA 4EGJA 2Z6VA 4AI2A 4LYFA 1A4UA 2Q4RA 2QNRA 1L4FA 4Q4AB 4MUKA 3OG9A 5IMBA 5F98A 1R0WA 4OJKA 5TMBA 2HU7A 3OFKA 4UM8B 1DEKA 3U16A 1DTWA 5KTSA 1E2GA 1YNOA 4G1BA 2ODBA 3NBXX 1PU2A 2L18A 4PGFA 2P4QA 2X0FA 4DDKA 3KYYA 4MRMB 3OP1A 5DNAA 5IX8A 4CUZA 5IWAB 4TMYA 3DO6A 1NFRA 1OZ0A 2H06A 1DRUA 2W2KA 1MO5A 4JJZA 4YI5A 5ENZA 3GNTA 2WUGA 2BEWB 3ND8A 4KO1S 4WLOA 4MI9A 3WWDA 4B09A 1E8MA 2WKPA 2AWNA 1FYXA 1ELOA 4HTAA 3WRYA 1IONA 3RRMA 1IK6A 3BZBA 5LP6F 3ZHVA 2VDJA 4DPKA 3DH0A 3EOBI 3QX7A 3ZYCA 2XLBA 1EX6A 1HL7A 5AJYA 1P7WA 2ILTA 3TOSA 1SQ5A 2NUTA 3ZQKA 2VVTA 2CE2X 3WDKA 1OWOA 1VYTA 3DAOA 3AEQA 1EDOA 2P11A 4QUAA 5AM0A 2O59A 3VAAA 2EJCA 4G84A 3NVDA 1U65A 2ZUUA 3EOAI 4AIRA 2FX3A 3EGXA 1J9ZA 5BNIA 1BVYF 1ODJA 2ZWVA 2IH2A 1TKBA 2FN7A 3EA4A 4AL4A 4QG3A 1YCDA 4LRUA 4QUJA 2X5XA 2LGJA 2F59A 3GJ7A 1JAZA 4HI0E 3ELBA 4KIFA 1GDDA 2II6A 3M6LA 5AMXA 1CT9A 4FX2A 5C4IA 4JYZA 1D7OA 1HXHA 2TS1A 3O8DA 4GU5A 5KTTA 3QG5A 1VE5A 5EGNA 3W79A 2JA5L 3EWIA 4C6SA 2HQ1A 3GLRA 3L18A 3BSYA 2M98A 3WIBA 1JFSA 1HF3A 1M8KA 1M1YB 2G07A 2VSOA 1OJLA 1V8ZA 1Z9BA 3DZCA 3MB8A 1VGRA 1DQNA 1WU8A 5LDDC 2QM0A 3WB2A 1GZ5A 1YS1X 1HV8A 3HWWA 4ENUA 2OCBA 3I04A 4MRNA 2HV9A 3FPHA 1ULUA 1KYYA 2BDUA 2HYDA 3L1JA 5K0NA 4QDTA 2V0GA 3ZD6A 1NW9B 5IP5A 1IM8A 4WCFB 4S12A 5DBOA 4A4DA 1KFCB 2A3NA 2VHCA 4XR4A 3RFCA 2B4KA 5TPZD 3ZTYA 1AHPA 1WCML 4BX8A 5KDLA 4RMGA 2BC9A 4S0XA 4Y6QA 1NMYA 1ZD5A 1P3DA 3BREA 5BW5A 4N18A 2FSUA 5BR7A 5DXAA 3AF1A 3BHIA 1KZHA 4WBNB 2PKYX 3KQLA 2HLDD 4A7PA 1QCZA 3GRVA 1K86A 3L82B 4AKIA 2R68A 2O50A 3PHCA 5AIBA 3WBBA 3CVYA 1CRLA 5CH5A 3EXEB 4HB0A 1YK1A 4IEFB 4HXFB 1JILA 4ZU6X 3K0AA 4B47A 3ZQJA 4JXXA 2UUAB 1GL7A 3LXXA 4PXYA 5GP1A 3U9LA 3WWYA 2GFIA 1HQKA 4M37A 2EZ9A 4C30A 3T5PA 1X7YB 5JBNA 4L8LA 1VSUA 2XYVA 4G89A 4Q1VA 2WZQA 1JEQA 4KNVA 1E9FA 3P0JA 2Y0PA 3DDHA 3VH1A 2PS3A 3ZXUB 3BGDA 4B71A 4JELA 2HBYA 4CI0B 2GMGA 1J9GA 3D5EA 4OYHA 3RO7A 3HM2A 1R6DA 4DFDA 1TOAA 2X2FA 3FIUA 3GBPA 3QBTA 4QODA 2J3IA 4QXQA 1G7CA 1WF6A 4XKJA 4RV5A 1N78A 4HH4A 1T5OA 3C48A 3A14A 1PV4A 2P2NA 1A50B 1SVIA 1K0UA 1VJCA 1J99A 1Z6YA 1Y4ZA 3B9BA 3QEOA 2AJTA 2NSJA 3NKVA 2FWMX 3KTDA 4M9RA 4EQZA 4F5WA 5TEWA 4JWTA 2JIQA 1GZ7A 3HKDA 3A6EA 2M6KA 4RE5A 1UJ5A 2C03A 1J2UA 5EEHA 1AKQA 5E3HA 4FNAA 1XTUA 3K6SA 4KCGA 4OIMA 3RS5A 4EECA 1JMYA 5BNZA 4DEXA 3SIWA 1R88A 3DBRB 4R98A 3EVAA 3D43A 5BYBA 3UCFA 3GVIA 1E69A 2ADMA 4LBZA 4A03A 3OZUA 1EFCA 1A8HA 3ECSA 5FTNA 4HNVA 4DV4B 4C5AA 2XDQB 2AOUB 4LK2A 4LYDA 3ZCUA 2GUGA 2IU0A 4XUCA 2QN9A 3LNLA 4XJXA 2G0AA 1ZOPA 2H2DA 2QN8A 5JG7A 4CDMA 7AT1A 2PD6A 1AS3A 1T0HB 1W1IA 1G5TA 1EX9A 2JIPA 1X70A 4WL0A 3JVDA 1TZ2A 1G18A 4PRYA 2PX6A 2WY2D 5E7IA 1UF9A 1G2QA 2VNIA 4PONA 3A6FA 4R1NA 3UY4A 1SXHA 1BWSA 2ACVA 3C8ZA 2QMYA 2C2YA 3GCGA 4AJPA 4DEYA 3UEOA 1RVDA 2NYAA 1CR6A 4V0ME 2VFAA 1SUEA 4MKXA 1XDWA 1Y9DA 2JEZA 5HBGA 4YT2A 4YY3B 4IJ6A 4LVOA 1JFLA 1I1NA 3IYLW 3U9SA 1BDIA 4YAKA 4UUPA 3IHWA 4WCFC 2XTZA 4O33A 4BJ1A 3GFOA 4Z2YA 4UM9D 2R1ZA 4BNZA 2N1MA 3T12A 2HV8A 3B1ZA 4GOLD 4Y1GA 4Y52L 2Z98A 4L5IA 4X6YA 3IP3A 3DQZA 2LV8A 4CM4A 1TEZA 1VE1A 1S8NA 4JLDA 5CM9C 4YCCA 2PEZA 3NASA 5JS7A 5IAJA 2HU8A 3S7TA 3EHDA 3AFOA 3IVAA 4YYEA 1PVOA 1LCIA 2IHBA 3WIEA 2JFNA 3LIPA 4ERNA 4OHWA 1UBOS 5DX8A 1D2HA 2GNOA 3CVXA 1T1JA 1T1GA 3B82A 1QS0A 1NKTA 3DOFA 1F5NA 3JQ8B 4M1EA 4BNMA 2O3TA 2ODPA 2YFQA 3OZTA 1SEVA 3AM3A 1AJEA 2WNSA 1YE5A 2B82A 4FOLA 3IOMA 1H4TA 1KFEB 3B2EA 3KWLA 3OZSA 1Z2EA 5DBHX 1DAGA 4Q02A 1IXZA 3T9BA 3Q8KA 4PSCA 3B3FA 1AXGA 1NV8A 1GG9A 4UBLA 3EMBA 1RWPA 2JGRA 4BEVA 3RS4A 4QU0A 4EW6A 2IBSA 2FZLA 4QYMA 3CXUA 1WSDA 4GPAA 1MN6A 3KJXA 4B76A 2VBFA 3DKPA 2GPTA 3VYUB 3IP7A 1SOWA 1H8EA 2UZ3A 3ZBPA 3IVRA 1BSVA 3NUQA 1I7DA 4GL2A 3MT7A 5CXQA 1ZCFA 1BXRB 1UJ6A 3BGVA 3EULA 1J5EB 2O52A 2B0JA 3I9NA 3GTQL 1BFYA 1LVGA 5EMJA 3C3BA 1XXLA 1DKNA 2CV0A 1A9SA 3AWDA 3IELA 4AMZA 1WHSB 1Z8FA 4FC7A 2Q2QA 1FX0B 3H3VM 3VR3D 1QRUA 1QP0A 2OGTA 2VAVA 2W2QA 1OLUA 4CE6A 1LNZA 1LRJA 5TPWB 3X3HA 4DE5A 4URHA 3E35A 1CUXA 3DLPX 4MW1A 1ZQ9A 5COAA 3C43A 4HGYA 3GI1A 2O3JA 2CXRA 4BXOA 1MA3A 3GO4A 5DF1A 3M49A 4HQFA 1YZ3A 4IX9A 1N33B 1T1RA 1UMDA 1QVAA 2FQQA 4JL6A 2W2LD 1PG2A 1GGHA 3OX1A 2WIFA 5DGCA 4K03A 5DV9A 1DINA 3PFBA 1GWNA 1YBVA 2XT6A 3SSAA 4EUSA 3WGOA 2GKSA 5IP9L 1CEEA 4S35A 4BB6A 3KLBA 5TQ0B 1QANA 1A9TA 1X1BA 3EZNA 1G5PA 2VRCD 1JDSA 1PT5A 1HZJA 3MMPA 5HFJA 5JC1A 2X8JB 1JFRA 4KMRA 4YRKA 1MA0A 5JDCA 5JD5A 3ECCA 4M38A 3DLBA 3LLVA 3I53A 1T6XA 3Q88A 4E70A 4XTCS 1BMDA 2WJ6A 3EF1A 4WACA 5JADA 1QQ6A 1AQNA 3INGA 3JXEA 3LXUX 3L9XA 2R79A 1AURA 2EOAA 2HBZA 1W94A 3EE6A 2A8YA 2IPLA 2ZSIA 4C01A 4J6EA 2VAMA 4KYIB 1OH7A 2IBMA 4Q3KA 2HMYB 4MKRA 4Q16A 4DRXB 1UK8A 4X95A 3W8EA 2JHGA 2EFEB 3E23A 4I6JA 1QRTA 3R44A 1XQ9A 4G4GA 1I4EB 3GCZA 1JHRA 2RK4A 3UJAA 5J47A 1Z88A 3RTDA 4NTZA 4G0YA 1QQAA 3H0CA 4RY0A 2J8ZA 5E2BA 1I1OA 2F9FA 5HTOA 1N5KA 5DWVA 4UHDA 4CG3A 4EVRA 1NF9A 121PA 2CMHA 1KH2A 1AQYA 1SBNE 2PCLA 4FFLA 3ZGZA 4OQEA 1U98A 4UUQA 2EX0A 3PGKA 3VR1A 5AVTA 2CLKB 3R3VA 2IZOA 1SKYE 2FP3A 3GNQA 1DAIA 5ALWA 1Y4DE 4NH0A 1F5SA 1KAQA 1Y81A 2OZLA 4M0DA 4YB8A 5TJHA 4B83A 4D9EA 3TLXA 1TM2A 1L6IA 2J0UA 3FBWA 2JLYA 2AFIB 4C4OA 5BNWA 4MKGA 1ZD1A 2Q5EA 4LVUA 4MB0A 5CJPA 5HWSA 1E9DA 1NR5A 2VP4A 3LY7A 3N8NA 5ALIA 3NXKA 1HA3A 2GDZA 2QN3A 4HMPA 4ALJA 4CF6A 4F97A 2AG0A 5JR3A 1AK1A 3LZCA 1IQ0A 1E1LA 1K27A 1PKEA 2O3QA 3GT0A 3L7BA 1WXHA 3X0DA 4CBVA 4LXTA 2IDZA 2B1JA 2IEYA 3MTDA 2DPGA 3EIUA 4ZN6A 3F73A 5DHTA 3H3FA 4EYGA 5KTYA 3UK7A 3SC4A 2BF4A 1C30B 2R44A 4W5QA 5CA0A 4MDFA 4DQKA 1NBMD 1SPXA 3H2JA 4N65A 1P7PA 5EE1A 1JJAA 2NVBA 2IWRA 4DADA 3STWA 4EPXA 1J07A 1Z5OA 2JARA 1X1DA 2V4UA 1GU7A 1PJLA 4UDXX 4R83A 5D6NA 3WNVA 3X44A 4CVNA 1NG1A 1GKLA 4D25A 4RXNA 4XTRA 3DUFA 3VO1A 4GDFA 1QRAA 1ZK2A 1NOKA 1VIVA 2O0LA 2AKEA 4WY8A 4CQLB 4UDYX 4CGZA 2JH8A 3TRDA 1WZNA 2QZJA 1P9NA 1PJCA 2XYGA 2Z4RA 4V196 1XQXA 3MHPA 3GFVA 1E61A 3MILA 3TKYA 4O4HA 4F7DA 4MWGA 4IKEA 4BLTA 1N7GA 4XWKA 2JLRA 4WMLA 4B8CD 1WHTA 3VNUA 1HYEA 1G291 1OFUX 1EFKA 4DCSA 1KSGA 5HE9A 2NVXL 3U7FB 3KYXA 1LB1B 4NZOA 2CCKA 2HLDA 1N36B 1MB0A 4QX6A 5SV2A 5AD1A 3EPKA 2HO4A 1URPA 4RSHA 4KODA 5TRTA 1YL6A 1MOSA 5KNLA 4DM4A 4H31A 3TSCA 5IMSA 5DRYA 2WM3A 3UVEA 4QU9A 3R5FA 1TMOA 5CK5A 1QH1B 4DXAA 4HXGA 5DHRA 1DTEA 2ODNA 4QICA 3FOCA 5FV7A 5HQTA 3FPEA 1PR3A 3A1FA 1FFDA 2O1EA 2DQSA 5EC8A 2R8ZA 5B2ZA 5E6UA 4R3NA 2J7PA 3U3ZA 2GZMA 3FRHA 3NRJA 3GGPA 5HSGA 5ILOA 1WE2A 2E5LB 2JA8L 2HF8A 2I7DA 5KNBD 2EQAA 3OOYA 2XTAA 4IYJA 3L04A 3IIKA 4D3XA 4EFKA 3QLTA 3IE2A 1NA5A 2J0EA 2MSCB 3ETJA 3KYIB 1FNDA 3AHIA 3IBSA 4B44A 3B20A 4AN0A 2JBAB 4W5OA 4OHUA 3NNDA 1FMFA 1NTRA 1CS0B 3CUTA 3NGMA 2WKSA 3P4UA 3K4PA 4IMJB 2CVFA 3JWJA 4MQEB 3SYLA 3QSGA 4AMUA 4IF6A 1WCXA 1Z62A 3AB3A 1MOPA 1NAIA 4GBMA 4XQ0A 4B4WA 3QY0A 2IELA 4HQNA 4ZD6A 1N4DA 3PU6A 4RJIA 4IUYA 5CH8A 4A16A 3TGPA 3HEBA 2EG5A 4PO1A 3BWVA 1YD7A 3D02A 4RTQA 3ELYA 3C6XA 2I6FA 5FXMA 3RAEC 1ZSVA 4AQ7A 3H75A 1TVKA 2C3YA 1BFKA 3CA8A 4D46A 3T6KA 1Z2NX 3OLWA 3D59A 4GO1A 4RKRA 2PSFA 2QE7A 4NDNE 5AI5A 2I80A 2BGGA 1CUIA 2YVAA 1XU4A 3HOWL 2O2SA 2EWMA 3TLGA 4NCJA 5H83A 4MI1A 3MJRA 3B53X 3IGFA 4KE8A 5KOHA 1VDMA 4PBRA 2KKDA 2ZROA 1BHSA 1B3RA 4Y6GB 5IDQA 5K8TA 5KNCD 2WZDA 1N32B 4EARA 1EFUA 4F9EA 3CISA 3BYZA 2SCUB 1EXVA 2PFSA 1RYTA 2ZZKA 3LCCA 3GFTA 4IJKA 3EIWA 1YDMA 3LLUA 4P81A 5JAQA 1S4QA 4EG4A 2C2MA 1E18A 2CJWB 2NVOA 3KPYA 5JXGA 2HMAA 3HBFA 3VTAA 4E94A 1XV5A 3IP8A 2YC2C 3WLJA 4CLRA 3FVVA 1W75A 5HCNA 4TUYF 4XM2A 1P33A 2VDOB 1ZLYA 3R24A 4GYYA 4U8GA 5EXEA 3ZXYA 3AVYA 3IXLA 5LVAA 3AYXB 1KYVA 4G86A 2K87A 3VPGA 3C8HA 1MCZA 4BO8A 4LF4B 5K0BA 2W6ID 2NT4A 5T6MA 4EK9A 2C9OA 4DYVA 3IVMA 2DWCA 2A92A 1EA7A 3DTVB 4GRDA 4HPWA 4J1SA 4P36A 2QZ9A 1DWOA 4WK0B 4BNLA 3TN7A 2PRKA 3L8MA 2OV6A 3QBJA 4C0SA 1N3BA 4GYWA 2VPZA 5IAGA 4CKBB 2BW0A 4MR8B 4DNQA 5AESA 1QTNA 3CCBA 5J40A 4BO0A 4YJDA 4EUKA 1B8NA 3U7HB 3KTAA 3OC6A 1UC5B 3TAXA 1AZLA 3KJNA 1YR9A 1DCKA 1C0LA 1LLDA 2WG0A 4Q9KA 4Z3DA 5C5EA 1BKYA 2DCMA 3OPYB 3S1AA 3ABRB 2ZJ7A 3QOXA 2XUZA 2WJGA 3FFXA 5G1OA 2FEXA 3TSAA 1EHYA 4UNRA 4MUNA 5LNK6 2AXQA 2IYLD 8ADHA 3UJDA 1I3LA 2Q5OA 4WZAA 1QSGA 2JAOA 2O54A 2PQMA 5ADHA 3CE6A 3UOGA 1AGRA 1PT7A 4AS2A 1V2HE 2JZOA 2EWVA 5HF8A 1Y8AA 2V6JA 1R0RE 2OQ2A 4PHFA 1CUJA 3OSZA 2C57A 3HSYA 4BQOA 3GTOL 2JGKA 5JFTA 1PJ8A 2OD9A 1G3IA 1LQTA 1UMBB 2FSSA 2VQSA 3A1CA 3HY6A 3SVZA 3FSGD 3QOFA 5IXYA 1S96A 3R9KA 2WK1A 4O0LA 2ZWPA 3DLCA 2P6NA 1E1CA 3F8WA 1IN7A 1YKSA 2YMLA 3QLVA 4NK4A 4U671 1U80A 2WVAA 3RLIA 4TKVB 2WJJA 3Q11A 4BP3A 3G2QA 4Z3KA 4FEYA 2G5PA 4B8WA 3ILHA 1AU9A 2GJKA 2XT0A 5TT1A 2C99A 3PQFA 3CLHA 5C80A 2DKNA 3EFEA 3LWZA 1LRLA 4KKXB 4F3CA 3CPJB 3O2SB 2XWSA 3RU9A 1MXFA 2BFEA 3JU3A 3PEYA 3R20A 10MHA 3BZWA 4MTCA 3QE3A 2J4FA 3V42A 4K87A 2VRCA 4PLFA 3H5RA 4OQNA 1L4LA 2IY8A 4F1WA 4M9UA 2ZG6A 4MYDA 3INNA 1NI4B 2EW1A 2RK6A 1UWVA 1WB5A 2ZJ2A 3KZVA 4HH3C 3TQCA 1SQGA 3A31A 4DCCA 4EOGA 5FLEX 1S9HA 3D64A 5FUYA 5HBRA 8LDHA 3CRVA 2W2NA 1Y3DE 2G9ZA 4OLFA 1K63A 2PZ8A 1Q50A 4JOBA 4YT8A 3U19A 2AIRA 1IZZA 2CXPA 1E6UA 1LPMA 5ALTA 3RRXA 3OVMA 2RHJA 3FAZA 4NNOA 4UNSA 1NVEA 4BKQA 5E4JA 2Q4OA 4WK2B 5E4YA 3MWFA 3WDMA 4EABA 3CRZA 1UCFA 4PANA 3A1SA 5IT4A 5L4LA 4LZAA 1SG9A 3ORHA 4PAMA 4Z0TA 1T26A 3UJ9A 2P9TA 5CM2Z 1US8B 2NU7A 3AF3A 2PMKA 1KBOA 2XNCA 1PHRA 1SBHA 4HLNA 3GNSA 1Z35A 1ZI9A 3CNHA 1GQYA 5EIEA 3C3JA 1CDZA 1XNHA 4TKMA 5B4UA 1K2WA 3RODA 3VKUA 1PQPA 4G0VA 3HXPA 1R66A 1K08A 2J3LA 3GCXA 3ZW8A 3IODA 1NG9A 3UF0A 2VDNB 1ADBA 3IT0A 5LSAA 3AVUA 3FI0A 1ZYUA 4WZBA 1D2MA 5JXHA 2GA9A 1IN5A 1VE7A 3KC2A 3F71A 4LQ4A 4YC7A 2E37A 4IHQA 1KRWA 1EVJA 1GXSA 2GA8A 3MFQA 4JBYA 1QFJA 4DIMA 4GZ6A 1XLUA 4P32A 4WNIA 1ISJA 1XTZA 3L7IA 3VO8A 1L5MA 3QEMB 4ZN1B 3K0FA 2PJRA 4HVCA 3R7DA 2UZ1A 2IHUA 1SIUA 5CJ2A 5G4LA 3NOVA 4UBNA 5KNDH 3C1AA 3G2MA 3M5CA 4BMNA 5K20A 4EP1A 3RK1A 3NOOA 1Z4IA 3SP1A 2IUUA 1ZU4A 1N9ZA 3LF2A 3Q7QA 1UJCA 2YQ4A 5CYOA 1G20B 2CJYA 5ARBA 3SKXA 1YFJA 3OOHA 1P0CA 3VHXA 5IBRA 2I8AA 2YY7A 1E62A 1R6BX 2HRRA 1GTL1 3ZXSA 3O74A 3ZWVA 4BZQA 2XMQA 2VF2A 1L8OA 1FUIA 3U40A 4FFRA 2JCBA 4IDGA 3K6JA 9ABPA 2HC9A 1LI5A 4TV9F 2D8MA 4U7JA 3NDRA 4ZQCB 4UUBA 4ARVA 2PS9A 2UUCB 3D6NB 3L7NA 4ZRMA 1E0JA 2YMQA 4F46A 3IPCA 1YU9A 4IGFA 1WOYA 4C06A 4CUKA 4J1TA 4OB6A 4EPTA 2HF9A 4ZI2A 4MRVA 1IROA 3WLSA 3TNJA 1CVLA 1TKAA 5I47A 4A5SA 3JTEA 3W2FA 4IUDS 4PEVA 3LTNC 1Q95A 2PWAA 1MEEA 4D3SA 4TKUA 1PUJA 1MXHA 4FI3F 1SIWA 4LWZA 4PE5B 2C7GA 3ZU5A 5BSHA 2LP4Y 5LN1A 1X2BA 3GCWA 4KYVA 4YEDA 3JAWA 2VR1A 3IAHA 4E5DA 4FMDF 4I14A 5H4GA 1CUGA 4CT0A 1F9EA 5IEJA 4QM7A 4WDRA 4GMXA 4P34A 2QNBA 1M72A 2I29A 3GDWA 2ZTVA 2JRLA 2Z83A 4INZA 4JQCA 2W93A 3GDFA 1XCPA 3ZZ1A 3R5SA 4ZTZB 3R9WA 1FFEA 1I2DA 1OD6A 1U7XA 3JQ7B 2D1SA 4ESOA 1ZSNA 4AF8A 2X8WA 3VC2A 4LMPA 5DSTA 1XZKA 4L5AA 5BRNA 3VV3A 2XJVA 1C1HA 1JDJA 1YJ8A 2NNWB 3P9NA 4MVJE 1P9RA 2ZRLA 1Z6GA 4NATA 4S1PA 4AF6A 4ZI3A 1U99A 3ZWPA 2APJA 2D13A 2ZWIA 4P7GA 4LXIA 1H1DA 5E6SB 5F77A 4JYMA 3GTKL 3KPUA 1IN4A 3H42B 4M7OA 1SUDA 5DSZA 3SR3A 1SPBS 2P9CA 2R8YA 3UICA 3CQZL 4DV5B 4QUDA 5EWJB 1EVIA 4OJQA 5M34A 1F8XA 1XDSA 5E6RB 3R5JA 5F5NA 3BT7A 2PG3A 1I4DD 5TF0A 5IFLA 2H4JA 4MVYA 4X61A 4UCWA 3DWIA 3GUZA 2GVZC 4RKYA 1K3FA 2NPFA 5GIOE 3WAJA 4JJ4A 4KJZA 2H3HA 3R3XA 5FEMA 4FFOA 4NYMR 4L74A 2OCPA 1SC1A 3NM5A 1A95A 1P72A 5AK4A 1RPNA 3FBGA 3U39A