5MFZA

Human sirt6 in complex with small molecule ubcs40
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mfzA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mfzA01
2IHTA 1YTLA 1ICIA 2OORC 4JT8A 5K6TA 4V1CB 4F56A 4JUCA 2H2DA 4J1TC 4Y6QA 1U28C 1U2GC 2VBGA 2H59A 4MPRA 4TWJA 4I5IA 3RIYA 4JUAA 4HD8A 1PTJC 5EJMA 2Q5QA 5MFPA 2X7JA 3IAFA 3ZGOA 4BVBA 3EA4A 2EZUA 1HZZC 4FEGA 4COKA 1PI3A 5EJ4A 3CLRD 4BV3A 2JLCA 4UTRA 2A1UA 2VJYA 5EJ8A 4V1CA 4BVGA 5AHKA 1EFPA 4HDAA 1V5FA 4UTNA 2IHVA 4V1CI 2W93A 4JUDX 1Q14A 3GLTA 4BN4A 2VK8A 2FRDC 2Q5LA 4JU9A 1T9DA 3CLUD 3D4BA 1O96B 4JU8A 5MGNA 5EJ9A 3U3DA 1NM5C 1N0HA 4BVEA 1UPBA 3PDHA 4JUFA 4UU7A 4GM0A 1V5GA 1YHZA 5MF6A 2PANA 1YHYA 5MFZA 4K9NA 4UTZA 2OD2A 4GP9A 1EFVA 2DJIA 4GM4A 4K9PA 3E9YA 4GM1A 3PKJA 1Q1AA 2JI7A 4KPUA 4K9KA 2EZTA 1PO7A 5BWLA 4FEEA 2NYRA 4IG9A 3CLSD 2FR8C 3K35A 5BWOA 2H4FA 4BN5A 3OE1A 2H4JA 5DGDA 4FZ3A 4JT9A 4KGDA 2BRUC 5DEIA 2OD7A 4K9LA 4UTVA 2OO5C 1U31A 5EJ6A 2VK1A 2HJHA 1XLTC 4JD5A 3CF4G 4QELA 4QPZA 1Z8NA 1YNOA 3F6EX 1M2KA 5FYQA 5D7NA 1PNOA 4RMIA 1S7GA 3GLRA 3FZNA 2H2HA 1OZGA 4ZP1A 4BUZA 1UPCA 2H4HA 3IAEA 2JI8A 3GLUA 4KXQA 4C78A 4Y6OA 3PKIA 4K9OA 1YBHA 1DJLA 1BFDA 4O8ZA 2WVHA 1T9AA 2VBFA 4GG1A 3HWWA 2JI6A 1O97D 2VK4A 3D81A 1PYDA 2EZ8A 5EJAA 1Y9DA 1PNQA 2A1TR 2WVAA 4RJIA 3ZGVA 4D5GA 4L2IA 2V3WA 4RMGA 4IAOA 4RJJA 2Q5OA 3D7KA 4GPEA 1SZCA 2JI9A 4MPJA 2OD9A 4ZZIA 3JR3A 1T9BA 4Q9DA 4Y6LA 3JWPA 2UZ1B 4JSRA 3U31A 3RIGA 1S5PA 2Q28A 5EJ5A 4J16C 5DGTA 1M2NA 4G1CA 2FSVC 5FEMA 1SZDA 3F6BX 4D5EA 4TWIA 4UUAA 2PGOA 2QQFA 1J8FA 1E3TA 5K6RA 1YI1A 2WVGA 1Q6ZA 1T9CA 2H2FA 4RMHA 2H2GA 4L3OA 1M2JA 2AG1A 4X3PA 4IF6A 4MQ5A 1POWA 1M2HA 3GLSA 2FWNA 2EZ4A 2UZ1A 1JSCA 1POXA 2PGNA 1UPAA 2FN3A 3LQ1A 2Q27A 4C7BA 5IMSA 1YC5A 1ZPDA 2NXWA 4BVFA 1YC2A 4BVHA 4UU8A 1Q17A 1OZHA 4MPPA 4X3OA 2AG0A 1D4OA 1PT9A 3ZG6A 4FVTA 5BWNA 3HWX1 3EYAA 4MZXA 2Q5JA 2B4YA 2H2IA 3CLTD 4QQ8A 3FLMA 5K2OA 1MCZA 4JUBA 4UTXA 4F4UA 1OVMA 4RMJA 4K9QA 4R8MA 3EY9A 4BV2A 2IHUA 2VBIA 1QPBA 1MA3A 1OZFA 1PVDA 3FSJX 2JIBA 4RJKA 2JLAA 4K9MA 1V5EA 5EJ7A 4UUBA 5K3SA 1YI0A 2C31A 2Q29A 1U2DC 1M2GA 2QQGA 2EZ9A
chains in the Genus database with same CATH superfamily
2NSDA 2XTJA 2HM7A 2HXSA 4KPFC 5J4HA 1QX3A 3QMMA 4EY8A 5KTSA 4PG4A 5TNXA 3I9LA 4XTCS 5J4KA 1PKEA 1ZSNA 2CXHA 3MMNA 4IXWA 3VBEA 2OORC 4YTEA 2WF9A 5KZMB 1YQDA 1LPOA 4BO1A 5E3JA 3FOCA 5BMOA 1LDMA 4PG7A 1EVYA 1EFPB 4PCLA 1U28A 3HKEA 4NLLA 5KVCA 3K70D 4O4LB 3FYCA 2RJNA 4QFCA 1U98A 3TSYA 1HNNA 2ZWAA 4EI9A 2XT9A 5HOQA 1R9GA 3QPBA 5K0BA 4FFBB 4BLQA 2GCOB 2M2IA 4OXNA 1KZHA 5IF9A 1C50A 3B1KA 2C5BA 1R18A 3F5DA 4HJXA 4TWZA 5AI9A 4RY0A 3GTPL 2FMTA 1JA1A 4Z3KA 3GJXC 5B12A 4PN3A 1YOBA 1EWQA 3GJRA 1RPNA 2VBGA 3D2BA 3AO0B 2JF0A 3FCEA 4OOEA 3IUPA 1BYUA 1KK0A 2NXCA 1GPH1 3MD9A 3E8SA 4B6SA 5CBPB 2WTXA 4AL4A 1R5BA 4TWJA 3K1AB 3DWGA 1DEXA 3FCOA 3EMKA 4L9AA 3H0GL 1L7OA 4C43A 5JWOA 3IT2A 3VMFA 4AYXA 1GFZA 1KZ6A 4AI2A 1ZUNB 3E53A 4MVCA 4DYVA 1V11B 2RGDA 1L1QA 2W2PA 5B5SA 4ZN6A 4P54A 4ZQHA 2B4KA 2BKLA 3FTPA 3H2SA 4DWVA 2GHQA 1SKBA 2H7VA 1BW9B 1OXUA 4TTQA 2DUJA 2A5JA 2ANCA 4TSFD 3S2SA 4DCVA 3WAGA 2EZUA 5AJYA 1L4NA 3MM4A 2ONKA 2X40A 3VYVA 4LX8A 4OI2A 1NJ5A 5F7ZA 2EJUA 4HEA1 2CYBA 3GUHA 3OAAA 2P6MA 2FK7A 4XASA 1NRJB 1LLDA 3TTVA 4ENUA 3CNBA 4PZ0A 2HA0A 3LUKA 5AVOA 4C21A 1NZJA 5DBFA 2A1UA 1SBZA 3OZCA 3C24A 5HIMA 2I8CA 4DBVO 1EFVB 1VLMA 4M7RA 2O3TA 1O94A 3CJTA 3R23A 3I61A 1PT6A 1YDWA 4IH1A 2JGEA 5HK8A 5HNKA 4WE3A 3LQRA 3KL4A 4W5QA 5F1PA 5IJ9B 3PHGA 2Y2UA 3WLJA 4E08A 4ZOAA 1LNQA 2A8YA 2H9AA 4ZMBA 2OTCA 3CO0S 3CZQA 4DC0A 3SZGA 3NEJA 1E9AA 1GCGA 3BXPA 1K3FA 2WD8A 3QLUA 4M1TA 5F78A 5TT1A 1P3Y1 1W36C 3MK31 1Y82A 3OUTA 1J09A 1GV0A 2E2JL 2BDEA 2C5EA 1JMYA 1AURA 1NBWB 3MMPA 4WFN1 1M33A 3PNKA 4X1KA 4YY3B 1OAOC 4L5JA 4RZSA 2PXHA 3NHUA 4JP1A 1W8DA 1FLAA 2W0MA 4LSZA 4F7WA 4CG3A 1JJBA 1NM5A 3PDWA 4R7GA 2C2WA 2F9MA 2ATIA 1N2CE 2PKEA 5TX7A 3SSAA 4HEQA 2B21A 2E0IA 4PZ9A 3U4HA 3VR6D 1MR3F 1WMFA 1WUKS 5LKAA 2Y0SP 3LBAA 2WMNB 3K5HA 4J0DA 4K9SA 4OKNA 2FW6A 1KE1A 3ADKA 4D4HA 1FSGA 4QXAA 5KSWB 2P2DA 4G5HA 3KKNA 1XP5A 4MDEA 4W8HA 1R16A 4OO3A 4BLPA 2C7PA 5FPHA 4KQJA 3K8QA 1REQB 2WIAA 1DIHA 1OX6A 1VCMA 1Y98A 1Z13A 4RFSB 2ASEA 4X1YA 4EENA 1H2HA 4CKCB 4N48A 3G8CA 3WLQA 2O1EA 1W76A 4QUGA 4LDZA 4RCVA 1KERA 4ZT7A 1X1RA 3FTQA 3VKFA 3JQ8A 2H1VA 2NPIA 2R4TA 2XUFA 3NI2A 4KIJA 5CM2Z 1WDTA 1P44A 3RD5A 3RUHA 3VPHA 4QT0A 4D9MA 2XDAA 4NWIA 5CGZA 2YJ6A 1QOQB 3NTLA 1FPMA 4ND7A 3TZEA 5ALOA 2J9XB 4GM4A 3PYLA 5A62A 2HC9A 3AYXB 3DUFB 4X6LA 3VKGA 1O2DA 1A97A 3ODGA 2P0EA 4DR1B 2J4DA 4WA7A 1IY9A 4XQ9A 4C6HA 1I2DA 5FUXA 5I48A 1L7RA 2WYWA 3IQDB 4ZQEA 1HLPA 5KWIA 2WOOA 3W9BA 2VQ6A 1J06A 4FEEA 3R8XA 1Z5ZA 4S24A 2O2YA 2P78A 5I47A 1UBKS 2R97A 2Y66A 1PWZA 3A7EA 3NHKA 4G5QA 5AICA 3VC7A 4UNRA 2PK3A 3V2UA 4FEAA 2B5VA 5LM3A 3A4TA 4ZAYA 3RODA 1A2OA 3VKHA 1QIKA 2DR0A 2DJ5A 1GGFA 2FN9A 2QUKA 4OYRA 5JO0A 4FCVA 4PYKA 1NZFA 4KODA 3TFQA 1CJKC 1TA4A 2XSZD 4JT9A 3UM9A 3UY4A 4DUGD 2HMVA 3CT6A 1R0YA 1H0KA 1XCOA 2RK3A 4C0AC 4GZLA 4O4HF 3G0OA 5DEIA 4YXFA 3WGJA 1QFMA 2Y1GA 1R8SA 1TPYA 1EDBA 4C3OB 3NP7A 2A9OA 5T8KA 4CTKA 4F2DA 2B6HA 4ESHA 3HXKA 4Q39A 4DA9A 1UBNA 3GZNA 1QJ4A 3F47A 3SZ3A 2GEVA 3L7DA 1JFRA 1WULS 3LWBA 2H7YA 3G9UA 3PNLA 4R8KA 1I32A 2QMHA 4IHJF 4UHDA 4YRDA 1ZW1A 1FRZA 3ZZTA 2PWPA 3HEMA 2HJHA 2Q3BA 2IH2A 2XGMA 4D57A 3HXMA 3DE3X 1EUYA 4NESA 1QFJA 1BE6A 3IKMB 1ADJA 3CNEA 3ZGLA 1K5HA 2VJMA 4LC9A 1Q21A 4M76B 4UATA 2G7ZA 3UV3A 5JNVA 1OR8A 5EYPA 3DYVA 3E27A 5IKXA 3CVXA 5C9ZA 6PFKA 1U8AA 1QMPA 3C39A 4C0HA 1DBPA 1VE7A 4DLUA 3NEAA 4OLAA 3KKQA 4L78A 5C5CA 4TKZA 2WJ3A 2EFCB 1E0KA 3R0ZA 2Q7XA 1K7XB 2RG1A 2RJOA 3HB7A 4L72A 5CHEA 1JTEA 5D3MB 5KYYB 1IMJA 4Q18A 2Q2QA 4BUCA 3Q7IA 2E2WA 1KNXA 4NCAA 4YRPA 3A8TA 5TB5A 2C3YA 2GTPA 4X90A 4JQYA 2GA8A 3JYLA 2NU9A 1KZ1A 3T52A 4D74A 1R8QA 4IDNA 3V8EA 5GINE 3UBTA 1UFVA 3K5WA 5EAIA 1GZVA 1VLQA 5DTQA 3HB4X 4DILA 1F0PA 3CKYA 3KB6A 3S2IA 1HFEL 3WIDA 2WIKA 2NO5A 3WTCA 3OZXA 3I05A 4BWGA 4TKVA 2E4YA 3ANYB 3VH3A 3FW1A 1MX9A 3I2HA 5AVQA 1EB8A 3LP8A 4AI6A 1IPFA 1DQZA 4BMZA 1LSJA 2LDXA 4ARAA 4RVDA 1NLUA 3AHCA 3G7NA 3TQOA 4J90A 1H94A 1PUIA 1WU8A 2FWMX 2RGWA 3QEMA 4EOGA 2PX0A 4IUCS 4TX1A 8ADHA 2CXNA 2ZYDA 2DB3A 2RDMA 1T3GA 2NSJA 2BMWA 1VKJA 1BFDA 1MB9A 2BWJA 2VUSA 4DLWA 5HILA 1N6PA 1Z22A 2I4LA 3GDHA 3N87A 2B5OA 3O9MA 4X61A 3TJRA 3SDZA 3UB4A 4YDHB 3TLJA 3FHTA 2EBUA 4NENA 3ND7A 3MTGA 3KSAC 3U80A 4ZT2A 1DCFA 2TMDA 3CUUA 5BSRA 1RVV1 2JAXA 4B09A 2GK6A 2V54A 1QH0A 2V7BA 3BN3A 2P3OA 3RIEA 2VHWA 3FPLA 3PWTA 2GBLA 1LU9A 3F67A 2GDZA 3DMPA 4Q9KA 4D98A 3ULKA 3N58A 1T8RA 3SLGA 2VUML 4DA4A 1EDOA 2VIIA 5AH0A 4LBZA 2G76A 1JU9A 3ZD9A 5K0ZA 1UBLS 1R0LA 4JBGA 1R4ZA 2NWQA 3AQIA 4JLWA 1NRIA 3DC2A 4JLUA 5BQ5A 2XF8A 1L8XA 1Q6YA 2VRNA 4KQXA 1TJ5A 1WD5A 2BP7A 4M46A 3I04A 1XHLA 3T95A 2OCYC 4F5EA 5J23A 1ABEA 1ENOA 1SB8A 1XWIA 4C6TA 5AW9A 3O03A 1FBTA 4H7IA 4YV7A 1OH6A 1SXJB 5JYEA 3AR5A 5EMHA 1EH5A 1KVRA 3ESYA 5JEEA 4JC5A 2GX6A 2ZCUA 3FM9A 3KEOA 4IVPA 1NJ1A 5EQTA 2WUGA 2P0YA 4EEKA 3HZHA 2I8AA 2ORVA 4R01A 4YJHB 2JEOA 3CB2A 4JAVC 4ER0A 2F1RA 1SZCA 4QBTA 4FFSA 4EUHA 1Q20A 2AEMA 4ZMRA 1LC3A 1UWKA 3EVCA 1JALA 5A0TA 4BATA 4RPKA 5FQOA 3SFVA 3GLFB 5IK2A 2GYWA 2QYTA 5IPFA 2IZZA 3C3MA 4ZZIA 2W8BB 4RTMA 5HQ3B 1J07A 1HWYA 4BBPA 1T13A 1XWWA 2RIPA 3SIRA 3HFGA 4FZ5A 2NPOA 1QHYA 2WLTA 1EK6A 4G0ZA 1GNPA 1XQVA 2I76A 2J67A 2R6R1 3DMDA 3L7MA 3N7UA 4GMXA 3LE8A 4QWWA 3L4JA 2WTMA 4IZ6A 4RJLA 2PHZA 1YA6A 1PJAA 5AK4A 5AXAA 1MC4A 2OPBA 1PQPA 4FFOA 4NZOA 4UVIA 3REQA 3C5EA 4G9BA 5ICFA 4U9UA 5LLSA 4JQOA 2H1OA 4FILA 5DN6D 4C2AA 3MWKA 3E5HA 1GCOA 2A5LA 4K28A 2MR6A 1ZO8A 4OAPA 1KI3A 4XOUA 4RV4A 3IE0A 5D1HA 3LJKA 1D03A 5BP7A 2JIMA 1E1LA 1P91A 2QK4A 3MWEA 2QTBA 4CTOA 4E2FA 5JJIA 1L7QA 1A50B 3FAKA 5DHQA 5FEMA 1C9KA 2E9SA 2QRNA 3P94A 4UE6A 5C3UA 3IQGX 3T94A 1ISMA 2JZCA 4CG2A 1XZIA 1TCBA 3USZA 4EPXA 5BVGB 2WWGA 3HFJA 3BCUA 1PZMA 4WNYA 4X94A 3W1WA 1R0ZA 4F2GA 1MP0A 4GU5A 5KDLA 2X6QA 5EGSA 2HSWA 1GZ5A 5EOVA 4A16A 4PLPA 1P1IA 3EDOA 4UUOA 2JFVA 1R4NA 2DHRA 2R87A 2REBA 3MTEA 1P9OA 2HBRA 3PU6A 1C3OB 2RCNA 4KGDA 2F3SA 1TT7A 1Q6ZA 4B0PA 4CMEC 3VYRB 3K7AL 1UK8A 3BD8A 3UW3A 4EP1A 4DLSA 3QBEA 4D42A 4AHWA 3JWGA 1WCIA 2H3EA 3T4EA 2PPTA 2FPWA 4X1OA 1GYQA 3LK6A 1T9OA 4KBFA 1BC5A 1GN9A 5HJ7A 5AM1A 1M83A 3R5HA 2QI9C 3W5SA 3S2FA 3CU5A 4KYVA 3T3GA 121PA 3ZNQA 4EY6A 4W7SA 4C7MA 1QGDA 4BAUA 2IGTA 1EGQA 3M6XA 3P9XA 3ZQKA 1IJFA 1W44A 3H87A 4TWRA 4C4AA 1SVNA 2NUPB 1P4SA 4YDQA 2FCRA 3B1YA 4LJ6A 3ACDA 3KT3A 3T54A 2W6JD 3T7EA 4WLUA 1YRYE 1NF2A 2R7ZL 3EQZA 3A2NA 3UANA 4CF5A 1E7SA 1UPAA 3RUPA 5CCEA 3T5AA 5E2AA 2IH5A 4PO1A 5IT0A 1AS0A 1NYQA 5JS7A 2KYRA 3CJRA 5K0FA 2XVAA 2SECE 4H6PA 4ER5A 2P9HA 3VX4A 2I3DA 4BVFA 1J0AA 1FVXA 1ZAYA 5HCNA 2PBZA 1F2TA 1E1MA 1E66A 3ISVA 4HO1X 4R0VA 2HWXA 2I7TA 1NIPA 3OX1A 5BQ3A 3OLZA 3SZMA 1I3NA 1W34A 3DE4X 1FQKA 4H7EA 3EA0A 3DE6X 4HR7A 5IZCC 1WCWA 3RF6A 3EPPA 3OKAA 3QE2A 3LRXA 3RGGA 4JR0A 2FXVA 4L3VA 4N5NA 3H0KA 3ZDEA 5I4KA 5EZYF 5JZVA 3KOUA 1D1PA 2DP4E 1GPDG 3CLHA 2BFFA 2K2DA 1SUDA 1XGKA 3N1UA 3RTGA 3W90A 1V4BA 1YVPA 2VDMB 3HRKA 2EFEB 2C7VA 2PJUA 4I9NA 3QFRA 3PC7A 3ZHSA 1P29A 3CNOA 2JASA 3UH0A 5K9ZA 1KZYC 4QOHA 1U3TA 3OM9A 5FJJA 3N8GA 4JYCA 4QQ8A 2PLWA 2RGNC 2Q0QA 4KXNA 3WWNB 1LPPA 2FSGA 4Z2AA 4M1OA 3R74A 4P3KA 1VLLA 4U0KA 1CDZA 5AW7A 1I8TA 4OQLA 3B6IA 3JALA 3WQHA 2LDBA 1FRVA 1WZ2A 3GTQL 3PG5A 2IXDA 5C8YF 3F78A 1D6NA 4QGAA 4KVAA 1UJBA 1EXMA 2BEKA 3GJ5A 3OEYA 2GK4A 1XF1A 2D2VA 1D8AA 1MLDA 4U63A 1X87A 2FF7A 5FFMA 2GAIA 2HDNB 2QZPA 3WFZA 4MWTA 2FMFA 1YJ5A 2HQSA 3HNPA 4HN2A 4O1HA 3IR7A 3TGWA 4AC9A 3LQKA 1D7AA 4QKQA 5HOEA 3ZTYA 2J9RA 4CF3A 4NV1A 2GM3A 4H7PA 1TCCA 3X3HA 1G8GA 4PG5A 1UXHA 2NNWB 2X4DA 3L5KA 3THWB 1Z4JA 3KEFA 4A6PA 4A6EA 1HTBA 1IVNA 4G1UC 3HHPA 3IO5A 3K1JA 2JLAA 1WUHS 3ESDA 3INGA 2ZUCA 4OIMA 1I6HL 1CUXA 1I2AA 4ZWNA 2VJLA 1KOLA 2OHIA 3TMYA 1RWNA 3UXYA 3ZY4A 2OGSA 2W2XA 4N9WA 4C3ZA 1X13A 2I4IA 1II0A 3R7NA 3I34X 3IKJA 3PNQA 5HKOA 1NP6A 5K3SA 1NASA 4YJGB 1BVRA 2CJWB 4YWLA 4IQGA 5EGNA 5FOWA 5DNWA 5JC8A 3QSYA 2Q29A 4F8YA 1U2DC 3T5GA 4CCYA 4C08A 5DYYA 5IM4F 2FPPA 1S2OA 2MINA 5ALMA 5KVAA 3AY7A 3GN1A 5EE9A 2PT9A 5LMZA 2IRWA 1YZQA 4Z3OA 1KPHA 1CUBA 4EMBA 1E98A 3GPIA 5E95A 5A3RA 3UA3A 2Z3VA 2IF0A 1EGVB 1DBQA 1H5QA 1R0JA 3BM5A 4QOGA 1FP1D 1RXIA 4WZBA 4J1TA 4FB4A 3K9FC 4KR7A 3BCSA 2I6UA 2BC9A 4HRYA 3LQFA 3OD1A 2QX4A 4F56A 5FFNA 5KTRA 2G4VA 2IE8A 2A3RA 4DN6A 1G6OA 1P81A 3DTVB 4I1VA 3DE2X 1FP6A 2ALJA 4JYBA 3FOBA 1XXLA 5E8RA 3TIFA 4D0GA 4CM1A 4D3YA 3R3SA 1JPUA 5JNLA 5DO9A 5JZMA 1FYXA 4GSLA 2JH3A 5KNDA 5SYAA 5CVCA 4LPSA 1ISGA 1XVTA 1U94A 1UZMA 1NRWA 1T24A 1P4GA 2P11A 2ZBQA 3KPUA 3QM1A 4PWZA 4S35A 4B74A 1YF3A 2C9YA 3HVUA 4IWXA 2ZJ4A 3QXGA 4KLRA 2WJVA 1YHNA 4MYCA 3KEGA 3PVSA 2R8ZA 4JUAA 3UFBA 3WL3A 4JX8A 2JAHA 2PMDA 2V59A 5HFJA 1NXQA 4RZ3A 1ZM2A 3UIEA 5JG7A 1XVAA 1W52X 1V4NA 3E0XA 4PZCA 3VDMA 1ZQ1A 3JQBC 1RI3A 3TAXA 4P81A 2GM5A 2XRYA 5I4IA 2XBMA 1KRHA 1F0KA 4TTIA 4BY9E 4N8DA 3RTCA 2PZFA 4AIIA 3ZWYA 3COVA 3D2AA 4WWHA 2V6JA 2BEVB 2J4CA 3WWYA 2FEOA 1SWWA 2P79A 5KNLA 5CLQA 5C1BA 2IYSA 2VI5A 1U0LA 3JATA 1P2BA 1MGPA 2HDHA 2Y1DA 3EUEA 3U1TA 4CODB 2XUOA 3BERA 4YQZA 3CLRD 4Q1AA 1P2TA 3NFYA 1FOEB 2O07A 3UH1A 2VJYA 2EU8A 3SQWA 1KL7A 2JBAA 2FHSA 1J0EA 1FJ2A 1UM9A 2GF9A 3I04M 4A3GL 1UAGA 1SIUA 3AOGA 3H2YA 3KQOA 4RHCA 2E6UX 4REQA 5AHKA 5HE9A 3RAGA 3T3MB 2OYCA 2VOEA 1T9QA 1QIFA 4C76A 3H3JA 4YRSA 4FHCA 4Q9HA 5LQCA 5AN9H 4QXPA 1LVHA 3A6PC 4YEDA 2V65A 3C43A 4NPAA 2Y6UA 2ZIUB 3WYFA 4W99A 4X60A 4MQFA 4OHXA 4PPFA 3RC1A 1E92A 1NUTA 2W83A 5CTJA 1RM4A 1MOSA 1T6BY 1UP6A 2J7PD 4H17A 5DE3A 2Q5LA 2AFIE 3ZZ0A 1JDTA 2B7LA 2IYUA 4J1SA 3ETHA 4UUNA 3O8QB 2BMFA 3RS4A 2OO7A 2EBFX 1ZK3A 1FSFA 2A35A 3M3HA 4CTNA 5JAIA 3I4NL 2N1MA 4CQJA 3TQFA 1VKNA 1QGED 2XWSA 1IWPB 4W1RA 2FPLA 3RU9A 4CKYA 4PEVA 1YJQA 4E2YA 1OVGA 3PHCA 2G1UA 1P77A 3L79A 4FFLA 3QFSA 1YQWA 1DG9A 4FHDA 1Z2AA 1PZHA 4M6WA 5GVSA 3O26A 2OQ2A 2J8ZA 4KH1A 3Q7SA 1CU1A 4LQDA 2Q62A 3T3PB 4K46A 4LYGA 2YTZA 4J07A 1XHEA 2O54A 5F9FA 5I51A 2HHAA 3AIKA 2FFBA 4QQFA 1HFWA 3AUSA 3LUPA 4IM7A 4BO5A 3A36A 4IO0A 3FVTA 4FFPA 4DYHA 4PLVA 5IUJC 1TM3E 4I5DA 1D4ZA 2CVZA 2XJRA 1C7ZA 1G5IA 2QTZA 3B53X 3AMVA 4R41A 4YT5A 3WDSA 3U9SA 3UK6A 5DM61 1EAYA 4QHTA 3IP7A 1RD4A 2YIVX 4LOAA 2R1UA 1SVIA 4Q3BA 3AR3A 3QI2A 4X41A 3R5KA 4KMRA 3B6JA 4K9KA 5K8VA 5FUMA 1WU7A 3V46A 1YNSA 2GTHA 3A6DA 1ZHOA 1MJGM 2J3IA 1H4SA 3FRHA 1NFQA 7REQB 3O7WA 4F06A 2O3UA 3A1SA 4R1QA 4GL2A 3RAEC 4DHWA 2FW7A 3CLRC 2HI0A 4YLGA 2Q4DA 4HH1A 1Y5IA 4AYTA 3ES9A 5EIWA 2PS1A 2RHHA 5COBA 5TQJA 2JPDA 3DGEC 3CYFA 1H3EA 4XLZA 1QO7A 3UAOA 1T9PA 5DLQC 1DJQA 1N5RA 4MGKR 2PSEA 1DPFA 1JQJC 3GFSA 4WXPA 2COEA 2F7SA 1PGNA 3QE4A 2Y0CA 2ZRFA 1WPRA 3I53A 1UWCA 2HXGA 5K2MA 5KOIA 2O3QA 3BZWA 5E0KB 3IU3I 4GRIA 4CL0A 2D1TA 2EQBA 2L2QA 2HRZA 3H6HA 3OU6A 4PNPA 3SJUA 1LV8A 4UZEA 3NC1C 3NFPI 2G9ZA 5I7UA 1XMOB 2YRFA 9ABPA 4U7HA 1J42A 4BFUA 2HA2A 4EA7A 4CLEA 1GAJA 4Y98A 3P9YA 4YREA 3TAHA 4LF7B 1KI4A 1W4LA 1OFUX 5FCDA 2C7OA 2B6NA 1PLKA 3W9UA 4HB3A 5EPOA 3WAKA 3U3JA 5JD3A 3ICOA 3OJLA 4WFQA 2XOEA 4ZRNA 2FFHA 3S4YA 3VNBA 1BDBA 2ZBUA 1FTSA 5BPHA 3U60B 4LHNA 3K0AA 2BAGA 2CF6A 4QELA 1YS1X 3RLFA 4MW7A 1DMSA 2PLRA 2JFOA 3AW9A 4LW8A 2Z5FA 2V9ZA 3THYB 4C88A 3H6KA 1WF3A 2W2KA 1NLFA 2F3QA 5SYMA 1O03A 1BA2A 3CR3C 2IW3A 4FXOA 3AEKB 3N2GA 1NR1A 4HDRA 4RVOA 2QAGB 4YCDA 2IFTA 1D2CA 1PJTA 2PU7A 4DA0A 5EIEA 1Q12A 2I4OA 3G2JA 2PRSA 1UMDA 5DIFA 1JQ3A 5AKHA 5GMOA 2JJ8A 4YK7A 3JD4A 5I9BA 2GO1A 1IXKA 1YVEI 1UXOA 1JSXA 3G6KA 3JRWA 2IQIA 2EBHX 5ILGA 2CMDA 1N92A 1RLOA 2WWWA 3U4GA 2AOTA 4QU0A 4Y67A 4DVGA 1QH8A 4KJZA 1JIUA 4E33A 4UTPA 1MFPA 3OF3A 3ZXXA 4HVCA 3Q8KA 2ZJ2A 3IEXA 3DL0A 3FNIA 5CDYA 4GW3A 2KPOA 3NKVA 4XSHA 3RQSA 1LF0A 1Y7PA 1JT2A 2GPNA 3GARA 2QLFA 3D4OA 1HE4A 1DJPA 5EP4A 1CAAA 3STXA 5IKMA 1KP3A 3JRNA 1JLMA 2VDWB 4MTCA 4NU0A 3U3MA 3S17L 2WA2A 3B3FA 4E4YA 3Q6IA 2O8FA 2EP7A 5DI3A 1MXFA 1OIWA 3O8CA 1BZYA 3O4GA 2QE6A 4WCVA 4AWAA 3IPLA 5FI1B 2ZAMA 2G88A 3UWMA 1RJ9A 4P2BA 4V24A 5IDXA 2X2FA 1MB4A 5EFZA 1ZGBA 4XCXA 5CNIA 5CU7A 4DR3B 2D3TA 4UZSA 4J0FA 2OA0A 2ZJ6A 3RR2A 1DKOA 3TE7A 3ZY5A 4XWAA 4FOPA 1DZIA 1H5UA 3O0TA 3V2IA 2A33A 2GHTA 3V4OA 1CS0A 5IC4A 1JECA 1VP3A 3DW1X 1GNRA 3GXBA 5JJLA 1GPMA 3BMQA 1RHQA 3EC7A 3L7OA 1GDDA 3RG2A 2FRVA 2PSSA 3T1QA 1N6HA 1A9ZA 1M7HA 1LBEA 4Q21A 1KDTA 4JK3A 4A3EL 4ZTUB 3DDWA 4WIAA 1C1DA 3FPBA 1DC3A 4PQEA 2RG7A 1NAHA 1NU6A 3SLKA 5LA6B 4AJ1A 1EUDB 3FPGA 2OV1A 1E9DA 5CEFA 1RKXA 4PAOA 1RZUA 2HEGA 3ZYCA 3BWEA 3KTOA 4FN5A 1WXIA 2WYHA 2YFKA 3LDAA 4RMGA 4X84A 5EVJA 2NVUB 3TQQA 8LDHA 3VHRA 2PVSA 1ZLXA 1U5AA 3PPIA 4I55B 2M6PA 4ZAXA 4AZTA 1E6MA 5KMGA 1GWNA 4URYR 1HE8B 5K51A 2PX4A 1AK1A 2E48A 4X7PA 3R3VA 2GXQA 1QQTA 4DTCA 1AA6A 1Y8CA 4ZOLF 3UAVA 2IP2A 1VCXA 3W06A 1IRIA 4MRPA 1XEXB 2HMUA 1QVRA 3AVXA 2G08A 3PWFA 4CKBA 4L6AA 5AOCA 3W2EA 2QR2A 4UQOA 5DBEX 1ORDA 3L06A 5BMVF 2YJ5A 4K40A 4MLPA 3QVGB 4PGAA 3QQPA 1DBRA 3SJ7A 1K5GA 1TB4A 5G0TA 2WD7B 4XEUA 6CHYA 5MGBA 4CBVA 4A36A 1U3FA 1SG9A 2YWHA 1BTOA 1H05A 4IJQA 1SUPA 3VR6H 1IEQA 2FZ4A 2OR3A 2UZ1B 2XKKA 2ZI3A 2C00A 4N8EA 3WAJA 4AZSA 2ZRMA 2IXAA 4IBOA 2ZB7A 1TVKB 4YFVA 3NWBA 3SQDA 2AS0A 3Q6MA 1ZVVA 4DR2B 1RKUA 3WADA 3PO3L 3HLTA 3NV7A 1UZLA 3TR0A 4CM9A 3O9VA 3G0BA 3MJVA 3L46A 3O8BA 3PT5A 1F8GA 2BTEA 4HEJA 3VR2D 4C4TA 3K2EA 1C30B 1R6AA 2IA5A 1YRQA 3WA6A 3QVMA 4K87A 2KS6A 2JLUA 4RMNA 2C2GA 5FBZA 1SZDA 4MW6A 1NMSA 1P74A 4R3UC 2MT9A 3ORFA 5JNUA 3ADPA 5CCBA 3BE6A 1XNRB 3IELA 1H9CA 4KKXB 3WO1A 4FD2A 2LD4A 2A84A 2H1IA 1N2JA 1LX6A 2W0SA 1J90A 1Y7TA 2ZIWB 3LPCA 2ZPUA 4WOKA 2P7HA 3T99A 4DS3A 5TJ9A 2Q2NA 4OHWA 2OAGA 4QPNA 4F71A 2J6HA 5E9AA 5B2ZA 4ZHQB 1U2RA 1F0NA 1G2IA 4D9KA 4OATA 3O4IA 1Q2XA 1G20A 1QR2A 4OFWA 4UE3S 3D8BA 1XYYA 2R48A 2X42A 3K1TA 3NHYA 1GL6A 3PZBA 3QU9A 4BMNA 1ZJJA 5HUHA 1M2JA 2XA2A 3KXIA 2HBYA 1BS2A 3FJOA 2IEIA 2E37A 4IF6A 3ZWVA 5BSWA 2LCFA 2R44A 5H3CA 4W9MC 3LRTA 3I6IA 4QG7A 4C03A 1ZY2A 1VJTA 1Q0HA 2OKCA 1KAGA 4J3JA 4KX5A 3ZIDA 3IOEA 1KWKA 3MAAC 2Y2VA 1HZZA 2M32A 2V45A 2XT6A 2V97A 3BB3A 2DEUA 2AJBA 3BCRA 1WW2A 4JITA 3L6DA 1YD7A 1ARZA 4NNJA 2XWQA 3QIVA 1N8SA 4PONA 3DULA 4GECA 1I51A 4N5MA 2KWIA 3EF3A 4JH0A 3WWDA 1U0FA 3OHMA 4PQRA 1JL3A 1B8NA 3Q41A 1RJWA 4KFTA 4KZPA 1AQYA 1Z5OA 2JGIA 2RHLA 4GICA 3P7MA 4ARSA 5CCDA 2P90A 5CA0A 1NDHA 2L42A 1P7PA 1PZNA 3JQFC 3T8YA 3NH9A 3WLMA 1GU0A 3CF2A 1GPLA 3FIUA 3HDJA 3U5TA 1OI7A 2DQYA 2ADOA 3F5QA 1J1UA 3I12A 3HJYB 2XW6A 1PJ3A 2OOSA 3BRCA 5EZQA 2HOQA 2R60A 4QBGB 3DBHA 4CZ2A 3KDSE 2DE0X 2PRZA 2IPLA 1A76A 1SQ5A 3ETCA 2JCVA 4MZXA 4Q4DA 3ZN2A 2G72A 4AN4A 3WV4A 3EVTA 2HSDA 2QLMA 3H9EO 3HRHA 2I3ZA 4YFYA 5KREA 3VPSA 3GLIB 5B4VA 4XSGA 3K16A 5CNKA 1GKYA 1I7PA 5CA0B 1Y4UA 2ZAYA 3ACCA 5EWLA 4QUHA 4YAJA 2H8GA 3C8HA 3JWEA 2J3DA 3S1AB 1E8DA 4L5YA 3BMOB 4D9FA 1HL7A 2EARA 1D1QA 4WQMA 3NP9A 2AE2A 4K9DA 5DHUA 2WDZA 5A7FA 3NEYA 1JQAA 1NXSA 4OK5A 1JHOA 1IY2A 2GXSA 2ZE8A 4LE0A 4AG3A 2F43A 4DG8A 1OUMA 4L4RA 1PFWA 3LC0A 2Z3WA 4K9QA 1BJRE 1CZUA 3IDQA 5GQSA 3SHFA 3U62A 2NO0A 2O1XA 2XWJI 3HNOA 5AW0A 3V8PA 4NY1A 1ZM9A 3TDKA 5CVDA 3EEIA 2A0UA 3EY9A 2D5AA 1FDSA 3FVVA 4X54A 4WL0A 2XUJA 1T4GA 1ZINA 2NT4A 1CD5A 1BHQ1 5L3QA 2JDID 3KB1A 3AL2A 3LC7O 3LLMA 4LJAA 1PGOA 4NK5A 4TN5A 2BI8A 2IKSA 4ZAFA 4ZVRA 4PC2A 2XHEA 3LT2A 1CNFA 1EQAA 5B7PA 4LN1A 1TU0A 5ALUA 3NXKA 1T9GS 1XFAA 4P3YA 4RJKA 1M3SA 5CDTA 5L3SA 1XAHA 1J9ZA 1PT8A 4BXOA 1UJ6A 2OCAA 5G1OA 3ZI0A 3B38A 4U5XA 3ER9A 2AUMA 2I66A 4RACA 1COWA 3U3RA 2I65A 2P5SA 4IJ6A 3SDBA 3WDLA 3EFEA 3N8NA 3L4EA 1H0SA 5L3ZA 4KU4A 4E22A 4N0PA 1FJGB 1JFFB 1A2BA 3UT5A 2M1ZA 3NYRA 4D43A 3ZZMA 3K1ZA 4XB6B 4IRMA 4DJFC 1MZPA 4E03A 2WTUA 4INAA 5LSAA 1X7XB 1XD2A 2JFUA 1DX6A 3G1WA 3LHFA 3NC4A 1JLLA 4U4AA 1HDOA 3EC1A 5D5QA 3WXMA 3CC8A 4PPNA 1D5CA 4MVXA 2QUHA 4PSVA 1A9QA 3HVKA 1K6XA 1A7JA 2C8JA 5FUVA 3KQHA 2GMWA 5IZ4A 2YHBA 2WWYA 2EYUA 1MO4A 1EP1B 4HUQB 5ICEA 4CM8A 1BA3A 3IAS6 4W5WA 4NNPA 4EO9A 4KMOA 1NXOA 3W04A 4ESVA 1KMNA 4FB5A 2LXNA 2O52A 1YVRA 2PY6A 3WZ2A 3FCCA 3VPBA 5KB3A 2TMKA 4PRYA 3A2KA 2L0ZA 4J9UE 2H59A 1A5ZA 3I9OA 1FYWA 2FG6C 3F97A 4YECA 4NBLA 3PNYA 2HFJA 2O2JA 2I1LA 1E4VA 2TS1A 2VF5X 5KHAA 3GNTA 2QSYA 4A6DA 1XDWA 1XELA 1CEEA 1E64A 3GA5A 4CWAA 1EE9A 4IIXA 2DTXA 1SWVA 2Y1XA 2F2TA 1DKNA 2C0QA 2GR9A 2HFKA 2B83A 3I73A 4YAWA 3IDAA 4G0YA 2Q5QA 1I5RA 2JVJA 1RBZA 3ND9A 3ONNA 1TWHL 3PXBA 3NTXA 1UT6A 2JA6L 3NW9A 5ESXA 4JMPA 4BNVA 4EUFA 3GOHA 4IJWA 1EQ2A 3BXOA 4OMFG 1RM5A 3ZDDA 1P4RA 3R9XB 3CWZA 4GPAA 1AUPA 5K3BA 2Y71A 3WQBA 4UBJA 3GTLL 5TS2A 2H52A 4G65A 1FTWA 4JEIA 3BGDA 3ITDA 2IHYA 1WEHA 4FQ5A 5TGZA 4UM9B 5IVHA 4PBRA 3TOZA 1U8CB 4COKA 5IBPA 2C5GA 2CMGA 2ZP1A 3KSMA 4Q3DA 2I7VA 3R3YA 5KOHB 1KK1A 2NLOA 1YK4A 3CE6A 4LDNA 2AFRA 2ZYSA 5AT1A 3T7JA 3E9NA 4K1LA 3H84A 4IX1A 5EJ8A 2G4CA 2IS2A 3CF0A 5E1OA 3D6JA 1PU2A 3REOA 1YI8A 2NSLA 1PG5A 3JWJA 1IJEA 4YCCA 2PVPA 1GVNB 5ITSA 3BK1A 3H19A 4HDAA 1RE1A 1XQ9A 3GX1A 4GSYA 1ZGJA 1L7AA 5HKAA 3VVLA 1EFCA 4J3NA 2VSNA 4XR9A 1ONSA 1SIBE 2VHVA 4H3SA 4QJ5A 4Y2YA 3ZWDA 1EK2A 3L1JA 2NVTL 3ZHRA 5KNCD 5KTKA 2YW9A 3GZJA 3S7ZA 5KJFA 1VTKA 2C2YA 2O0KA 2YHAA 1GXSB 3MJDA 2A0KA 2O7QA 5EJ2A 3H42B 2ZS7A 1B74A 1H2XA 1KO1A 1SQSA 4N49A 4A10A 5D01A 2VK8A 1Q0ZA 5M3BA 4CMCA 4I4TA 4DQLA 4FWIB 3AR9A 4K2AA 5INTA 1CC1S 3PFCA 4RPLA 1LF5A 3DE1X 1TJ4A 4A0FA 1ZWLA 4MA0A 4OK3A 4RTJA 1OF1A 5TE9A 4ETIA 1SXGA 3IP3A 2D00A 2RH5A 4IG4A 1T1IA 3AP2A 3ZNNA 2ST1A 4QC2A 5JBQA 1FF9A 1L5WA 4Z6KA 1U0EA 3BL8A 2XTMA 1ENPA 4GM0A 4M1QA 1MO3A 5ANRB 2AG5A 4DIDA 3HN7A 5H1YA 2AMFA 3OJFA 3ZCUA 4J4HA 2QUZA 4FYMA 3NHWA 4A26A 5HRCA 2J46A 3ZU2A 5I4BA 4RVFA 4AZ3A 2X76A 3FSEA 1VMKA 4E11A 1T8TA 1PV2A 1G3UA 2C9OA 2PMZP 5CFOA 4FC7A 3LNCA 4O63O 4I2NA 2OD2A 1FSPA 4JBIA 1E5LA 2D8AA 3DUWA 4NJMA 1L3BA 4G63A 2VT6A 1NUPA 2P75A 5EEHA 1YU6A 1IIRA 1DCKA 1K4MA 4RXUA 3WGNA 4ENQA 2P9QA 1C9JA 5DXJA 3DZIA 3E9YA 4MKRA 1KK2A 3T41A 1J7JA 2WFMA 2GI4A 4LNUB 1XRJA 3HAXC 3A9SA 4YJ3A 5J5AA 1PO7A 2JD1A 2I03A 1T5SA 3EEBA 3T0GA 1UBSB 5BQPA 3T7AA 1QRUA 3E05A 1VHTA 2JG3A 1A9SA 2ERYA 3IBFA 3TI7A 3NKLA 3EZLA 1FJHA 3HP1A 2NACA 4QYIB 3KP1A 4PX9A 3DZJA 1J20A 2A1UB 1JIQA 4BFSA 5KJEA 5BQFA 1K6EA 3WIOA 3UXEA 5HUJA 4W8GA 2PMBA 3V8BA 3RE1A 1IOWA 4M98A 2YYZA 3ACBA 4F9EA 1ZDMA 1OPRA 3DM9B 3ANLA 5GY7A 1W35A 2A14A 3OIWA 4JA2A 1O96A 2RGYA 3LBYA 4KDEA 3TM4A 3VU8A 4E88A 4F0JA 4YGXB 4UMFA 2B8EA 3FYUA 4OBXA 4RORA 3U4CA 2G9UA 2EJCA 3BB1A 1FDWA 4BC0A 5EY5B 3O8NA 1NW4A 4M1ZA 3DVAA 4IEFB 3KLOA 4JOSA 5REQB 1OC4A 2BBSA 1FBNA 2JI4A 3EXHA 2WSBA 3U3KA 4CMJA 2M4VA 3PB3A 3ILVA 2A4MA 4CDGA 1SU4A 1WIWA 1XZEA 1G0OA 3G5TA 4EX7A 2NAFA 4UHCA 4D4JA 1E1CA 2GPAA 1P61B 2ACVA 3MB8A 3Q7PA 3C4QA 4H7JA 3G79A 3MWLA 2OGTA 4XW2A 3RYCA 1NE7A 4NMHA 2WSSD 4YO7A 3STHA 2J9ZB 3KO8A 1IVSA 1AA9A 3MTIA 4C06A 2PGLA 2BGIA 3AVPA 3KOWA 3CHYA 3ANNA 1N2OA 1CUEA 3BRWA 5CPFA 2ZRDA 1H2BA 2OFXA 1ZGGA 1ZRPA 4F3KA 1OD6A 3G02A 4FMDB 2ZAGA 4EZBA 1IBLB 3PNSA 2O0MA 1J2EA 4I2VA 5HBGA 3C6BA 4O29A 1DAMA 1VZGA 4X1YB 3TINA 5ELXA 4BFZA 4ZANA 5DI9A 4A0GA 3PV0A 4P38A 4EVIA 5BURA 1XPJA 1DL5A 4CR6A 5AKYA 3RSOA 3VVMA 4ZGWA 1WB9A 2O57A 3TTWA 4D45A 1CR4A 3LQ4A 3R4CA 3KZXA 3AHJA 1NPTO 3S70A 3WGOA 4M0EA 3OPXA 3FFWA 5T7BA 5H0IA 4N18A 3ILSA 1F6BA 1F60A 3CQZL 3FZNA 5IXSA 1KARA 4MWBA 2YMQA 3PL5A 5IP7L 4QBKA 4IOLA 4DY4A 1OZGA 1W75A 4UVHA 3VTKA 1H8HD 4FCCA 4OHUA 3HJWB 3I5AA 2OV2A 1XX6A 2HCRA 3G82C 2YYYA 4CM3A 3PJDA 1DOZA 4FIDA 1EJ0A 3U9LA 4DB2A 4O3MA 4Y6OA 1UPFA 1V3VA 4J0KA 3A4YA 4ZAWA 3RRFA 3RSZA 4BKRA 4BB5A 2FPXA 1V2GA 4C1NA 1XL1A 3BS4A 4YGYA 4AX8A 2AI2A 3EYWA 4O8ZA 4TTAA 4Q9IA 4FPXA 1KYTA 5TC4A 1CUFA 3WYDA 2AKAB 2AYYA 3FZQA 3AETA 3H5LA 2G0TA 4JJAA 2P6OA 3AOEC 4LV5B 3G5MA 2Q3JA 4DCTA 3SEAA 4RVCA 5LOVA 1B0ZA 2L69A 1Z39A 1A1VA 1Q1ZA 2AF3C 2B69A 2JIDA 3NR2A 3RVRA 3ZCXA 4BKMA 3KRTA 4FDVA 4M9UA 2XVMA 4BVJA 5EXXA 1DG3A 4DMHA 1EAMA 5LQRA 4IDHA 4B3IA 1ADYA 4MVJD 1SXJD 3TZLA 1QQ7A 2V0FA 1VE9A 1ATIA 2DBYA 2O4CA 4KAFA 4X6UA 1WHTB 1GQQA 1JWLA 1PAUA 3WS7A 1G5HA 2ZE7A 3GCXA 1Z35A 3A9VA 4QATA 1T8WA 4P08A 3P0FA 2X4GA 2NVQL 1OI4A 1W1WA 4O6VA 2AQHA 3RYHB 1CQIA 1LUAA 2C2HA 4RAQA 5FWNA 1SD2A 2QGFA 4U39A 2VJMB 2QRVB 1JHPA 3GT0A 1RYNA 4JB2A 3D6TB 3DKIA 4PRKA 3SHWA 1JR4A 2D7CA 3TB4A 4G8BA 1CVLA 4QQKA 5ALGA 3WYBA 5U4XA 1G3MA 1RACA 2CNWA 3MUEA 1ZZEA 2BCEA 2FMXA 4GXTA 4KXUA 3OUZA 1Z0ZA 1HG1A 5CG1A 2Z2IA 3QX9A 1LPSA 4DADA 4AECA 3HLYA 1QV7A 3DF9A 1UBEA 4TLBA 2ECKA 5AVJA 3EHEA 2IYRA 5L3VA 1UWLA 1M8FA 4U7WA 3ZKAA 3NTUA 4BWFB 2BE9A 2JC3A 5DHTA 5IT4A 4PINA 2GZ3A 4HUTA 4JC0A 5H83A 4A3KL 4GEKA 2FEMA 2NU9B 2DFTA 4BLSA 1UJCA 1DVRA 4BPBA 1ZVJA 3ZWXA 3RRJA 5LBTA 4DRXA 1PR0A 2EGHA 3O94A 2M6KA 4GLOA 1LS6A 4KN9S 4JOCA 1N25A 2PL3A 3PFKA 1IZYA 1MN6A 1USUA 3RIGA 4EO4A 4AZWA 3ZE9A 5KEIA 1NVGA 4RKFA 1XXHA 2RIRA 4MEAA 4LY0A 1NA5A 3UHAA 1AHPA 4W5TA 1UKYA 4P1ZA 2BGNA 2CYCA 1YDGA 2IUTA 2PRKA 2YWGA 4AWBA 4LSMA 4TOIA 3O8OA 4URWR 3ZV6A 2GJKA 1EP2B 3ILHA 1B4DA 2QMYA 1N3IA 1PP4A 2ENWA 4W63A 2NSYA 4HVTA 4W5JA 3CH5A 1EVKA 2W37A 4FHZA 4BNDA 5CDFA 1ML3A 1AG9A 4Q16A 3KNZA 4MEJA 3U4IA 1HL3A 1X7WA 3MRSA 1GTSA 3GFVA 3W1EA 4JJGA 4DJEC 1MPXA 1TVEA 2CWDA 4OQEA 3CKMA 3L5OA 4DMKA 3NCTA 2I4RA 2QIOA 2CCJA 4M0PA 3ZDFA 5KC9A 5BPFA 1SXJC 2JGLA 1NY5A 1C0LA 2Q3FA 1YI1A 1VIYA 3HR4A 3WL4A 1A88A 4KOAA 4TS4A 5ENZA 5B55A 3BFVA 2H2GA 3EDQA 3RI3A 2BP7B 1BSVA 2PT7A 2ZT8A 4MJ3A 3ECSA 5CM9C 1NQWA 3K72B 4OQMA 1PEKE 4LI0A 5HKKA 4QBHA 2ATEA 5DVZA 4K6CA 4MRSA 1XD9A 2WHXA 3LPDA 3GUUA 3DMRA 3M49A 4FBGA 4DDVA 5B1YA 5CFZA 1Z45A 3HCEA 3WQRA 4OOFA 4S0ZA 5HZGA 3B3AA 1V1RA 2BZSA 2CHVA 3GW8A 3L93A 3F9IA 4L50A 3CCFA 1V9SA 1RLMA 1OJLA 1J8MF 1GLNA 1XJCA 3O2QB 2O8CA 5IMBA 1XP8A 4NJEB 4G01B 5EVCA 4H1UA 4EB8A 1E2IA 2EERA 2RB5A 2VNAA 1FNCA 4FNAA 4INPA 1TOAA 4PQYA 2X0NA 4C0JA 2INGX 4ZEWA 1D6SA 3A28A 4KC0A 3WK4A 3AI1A 4BLWA 1D2MA 3KPJA 4LS3A 4RVHA 2NXWA 1KVQA 1BE7A 1HOTA 3CQ9A 1HEIA 3LKZA 3IB6A 4CUKA 3ILYA 1CJCA 1I13A 4O3FA 1X0XA 3GEIA 5JJCA 2FEXA 4CGZA 2WQ6A 1G64A 1DUVG 3INTA 4JLPA 2PWAA 1YUZA 5FRDA 1HEUA 4OEHA 1E9CA 3RJTA 1EKXA 1KORA 1UBOS 2A1TS 4F72A 1K7EB 1SMWA 5LZ7A 3SXJA 3QKRB 4D8YA 3ADCA 3PC6A 1BCRA 4LZWA 1ECCA 2YS6A 3A6ZA 4LZAA 1YK1A 2FZVA 2V7QA 5EIAA 3OZGA 3WP0A 3WLIA 4M0DA 3KZVA 4ZQBA 2C2XA 2KQUA 2WBLC 3RWBA 3BL6A 1R6UA 2EL7A 4WBNA 4ZJPA 3IBSA 4FZVA 1DX8A 2XUIA 5TEVA 3RZ6A 4CIYA 2YXEA 1FX0A 1XTRA 1M74A 3SYTA 3HJGA 2BHRA 4B4KA 2UXDB 1TLTA 4BVLA 4QJ4A 3ZCSA 1IU9A 2XNSA 1H3NA 4W1SA 5DB4A 5FUWA 4C7JA 2X0DA 5IJ0B 4KGVA 1N2ZA 1N6LA 5IG2A 3JTEA 4OYHA 3IO3A 4CDMA 3RRBA 4PHTA 4ZI7A 1GZHB 3C5VA 3LXXA 2V3BB 3RZOL 2PZJA 3ZHCA 3BOSA 4Z9YA 5ENDA 1ZESA 5C18A 2ISCA 3EGEA 4A27A 4KK3A 1I36A 3N53A 4RIFA 3C3YA 1E4EB 4HAZA 2I7XA 4V196 5ERXA 3WTBA 4EUSA 2EIHA 5AVRA 2GZMA 1NQAO 3PUVA 2DH5A 1AZTA 2VUIB 3OCJA 4JQZA 4KXFB 4RYLA 3A0RB 5JH7B 4JI7B 4X20B 3QX3A 2DULA 3GUYA 1YB2A 1V1MA 2I1QA 2QIPA 5HMLA 4L02A 5EJGA 4QJIA 3HL4A 4O4LF 2ZBDA 4ZIRA 1XVLA 1LKZA 2ONCA 3ZCTA 3WGGA 5DNCA 3EXEA 3FYDA 2G6TA 3ROEA 5EJ7A 2XCIA 3H3FA 4PFQA 2IDJA 3NALA 5FP0A 2ZUDA 1C5KA 2PZLA 4PO8A 3VGJA 2O2ZA 2J0VA 4HDOB 3BIFA 2VPZA 3MINA 4HN4B 1CR2A 2QQGA 3LM8A 1SRRA 2GCNA 2HQ1A 1Y6GA 1V45E 3U0BA 3EW7A 4LWQA 1VBFA 1CUYA 3DTVD 1UAAA 1G9SA 5FEUA 4W6ZA 4B5LA 3W2FA 3EPLA 1ICIA 1NW7A 1ONNA 4MX8A 1FXUA 3PPVA 4IDDA 1IOLA 1QZUA 2G82A 4GGPA 3TPZA 2Q1XA 3I4FA 2EFGA 1UFRA 4CTJA 1XTSA 4RA9B 5EHQA 1X7YB 4QYTA 1L4BA 1MUUA 3GTKL 1GTMA 2C94A 3TLXA 3V8QA 5JYBA 2O8BB 3HYNA 3E8MA 4J0JA 2FRXA 3HJBA 3S15L 1GNQA 4BFWA 4BLVA 4EGJA 2G3YA 1G21B 4FK8A 2MHCA 3VH1A 1QB8A 1AQ6A 4NNOA 3AB3A 3K9LA 4R1SA 5G0WA 5ARBA 2I4MA 3HDYA 4Y2UA 4JVSB 1QORA 1ENYA 3VVBA 4Z1OA 3BH6A 5C1OA 5TQ0A 5DMHA 2BFFB 1DQRA 2FW0A 3PEUA 4JSTA 4E14A 4M83A 1PTJA 2VXBA 1O5OA 4V0MA 3VV3A 1YVDA 2CNKA 4F45A 3TH5A 2XLBA 2ZSUA 3RIYA 1AN0A 1KRXA 1A98A 5HR5A 2Y67A 3FVWA 1RYHA 3O1JC 3ORRA 3EZ2A 4KNWA 5EIBD 3RLIA 5M3FL 4K0RA 1OWOA 3SCZA 4GF5A 5FD8A 1ZS9A 3DWIA 3SU8A 1SCKA 4DLKA 1RRCA 3ESAA 1L9KA 1SUCA 1TAHA 3KVVA 1J5XA 4EA6A 2H2WA 5KPDA 5JQGB 5FPQA 1VA5A 4OJQA 4XRGA 3B13B 2V8BA 1GEGA 2Z98A 3OZTA 4LTNA 3SR0A 4MYHA 5KPJA 2YHUA 1ZH6A 2VEDA 4YP6A 3UC9A 1OLXA 4ZVSA 4AY5A 1EVLA 4DGSA 4C01A 3L8CA 3CMCO 5E9JA 1RAHA 3N0WA 5AI3A 4IY1A 1CUWA 4F21A 2XJUA 1Z2OX 1WXFA 2VPWA 3TSOA 1EINA 3I5UA 3ZJTA 1LTKA 1MB3A 3DEFA 3L8MA 1AB6A 3SFTA 4FYKA 2ZIFA 3DYBA 3VAZA 4B2LA 1U9JA 4BBAA 1E3DA 4ID9A 1GL7A 3AGQA 3EZXA 1OLUA 1QH1B 2V6BA 3HR8A 4Y2RA 4QARA 1T5HX 5CVUA 4D3XA 1OTYA 9ATCA 3JD2A 2A4KA 3CCBA 2RHWA 1U3WA 4RSRA 3NMUF 2AX4A 2WB1P 1Z4NA 3QUTA 4KQWA 2BPOA 3BEDA 3RBAA 3N2KA 4EY4A 5IF3A 4LPKA 2EKZA 2IU6A 1VE3A 4CCYB 5JFOA 3QA9A 2RSLA 5ENVA 3CUEF 2FPPB 3UG7A 1L5ZA 1H69A 3FCYA 5GADc 1ZVMA 4CQNA 3FGZA 2FPRA 2X8JA 3GG9A 3IUQA 4B8ZA 5WRFA 3JQGA 3AYZB 3OZBA 3EXG1 2O8DB 4A0RA 2OZPA 4HLDA 3ZJ4A 1LJ8A 4Z49A 1JKFA 2XJQA 5C3EL 2R8OA 4HY3A 2CK3D 4WBSA 5DU2A 4MW5A 5AQ1A 1NHWA 3JPWA 4Q1VA 1KAEA 4U7DA 3DW3X 5F21A 4UE2A 3ZVRA 4UFOA 4YMGA 1QP4A 3CRNA 1JAXA 1JI3A 3JZAA 3ETNA 5ED0A 2JFFA 2APJA 2PS9A 3D7LA 2YX1A 4ZV4A 1QYVA 1DC8A 4QRDA 4OYLA 1SURA 1MRZA 2R2AA 3IMCA 1BG6A 1Q74A 3HQ4O 3OPYI 5A6SB 5L95A 4XD2A 3ELUA 4NCXA 1I2CA 1TC2A 2YIJA 3KHKA 4GBJA 4R9RA 1OWCA 3SBXA 2QTVB 3TLAA 2IIPA 2NNLD 2PANA 1DIAA 3M6IA 2YN4A 4O59O 4A8PA 4CCAA 1CY4A 2FN7A 2Z2ZA 1HTTA 3KYXA 2PNFA 1YHYA 4ZZ2A 1M2OA 1Z2DA 2BR3A 1LVUA 2ZJFA 3NAQA 4PXYA 1AV6A 1C0IA 4MUKA 1B8OA 5BN4B 5EIBC 2CD9A 1ZXXA 1ECJA 2ZUBA 4O08A 2CXUA 2LW7A 4ZVQA 5DASA 4OA5A 2RI1A 3WKCA 1XZQA 2C9DA 1N7GA 2B4TO 3FPKA 2YNMD 3GCZA 4LRUA 1M75A 1MAUA 2GN4A 3RAPR 2YQ5A 4F9FA 4KUGA 2BCGY 2F00A 1J2TA 4RABA 1U0OC 4N5LA 5K3DA 1QB7A 2BFWA 3HUUA 4IINA 1XR3A 5IJAA 4TVKA 2P8JA 4V0LA 2JARA 3IPCA 3TLGB 4DNPA 5KCZA 3FH0A 3PA8A 1FNBA 2IHBA 1YXMA 3SYNA 1M5TA 1E7RA 1Z4PX 1WOYA 4RDHA 2N75A 3PITA 4OD0A 2VJQA 2OBBA 3JATB 3PF9A 5A3JA 1VC2A 1SVOA 2RBKA 3W8NA 1FE8A 5JSHA 4FNGA 5EKTA 2UUCB 2WP0A 5BWOA 1M1ZA 3ZVMA 2A7QA 5KWJA 3W8FA 4D25A 2GAOA 3H11A 1L5GB 4BQEA 4H6WA 3Q2IA 2H4JA 3Q5GA 2IHKA 1IZ8A 3TSAA 2PCJA 5KYNA 4GEGA 5FB3A 3TUIC 4J7CA 2Q4BA 1O6BA 3GRAA 1UBGA 4Q7MB 1A27A 3OQPA 2HQRA 1P1FA 3RARA 3RUIA 2IGBA 2JGJA 3LWPB 1WXDA 2IY9A 4HAOA 4F9TA 4Z9FA 2EC5A 5JAHA 4HNAB 4MB0A 1NVEA 4MQFB 1HLFA 3D8TA 3OKPA 4ZTBA 4A3FL 1QTIA 1Y37A 3FE2A 2AW5A 4NCJA 1KYZA 3UGTA 1VJCA 3L01A 5EP3A 4NYMQ 5D00A 3VNRA 4F46A 3HBJA 4YV0A 4U2FA 3NBFA 1P1BA 4QODA 1Z36A 4IHQA 1JG3A 2HLDA 4RLSA 3U0VA 4B3RB 4Q4JB 2HMAA 3IIEA 4HWKA 4WJLA 3ETGA 3H9JA 3WBBA 3KKZA 5C37A 1M6WA 1KP9A 3F7MA 3RBXA 4F4DA 1LRJA 4LYEA 1HGXA 2NTYC 2JAUA 4WESB 1ZW6A 3THXA 4Q4HB 3RYIA 2J33A 1NX6A 2DPHA 3DQQA 1WMDA 2RGXA 3K73O 4Z8XA 4URUR 5FYQA 1T8UA 1ZN8A 1BQ9A 2B36A 3RV4A 5DTJA 1WUYA 4LVNA 1FUKA 5G0UA 4DCCA 3G59A 4AZ0A 1W5AA 2FXIA 3H9QA 1APBA 3A1EA 1TJPB 2BKAA 3P71T 3PT9A 1J0XO 3E22B 5A4JA 3PNMA 2QSUA 4M86A 5DNVA 1BWRA 1OAAA 3DOEA 1WCYA 3H2BA 1YGYA 3EWNA 3PXGA 3IKTA 2VJOA 4MQUA 4G5GA 4NK4A 1N3LA 2W22A 3N0TA 3X1MA 2H92A 2YNMC 5MN4A 1AKQA 3RUEA 5HF5A 1X8LA 4C5CA 4GGMX 4X95A 3KZNA 3OEHD 4MWDA 5AVTA 3CLKA 4CEIB 2CWWA 2PFGA 3NXSA 1NT4A 1FP4B 3D8NA 3ZE2B 3HKZP 1AUOA 1EWVA 1JR3A 1N8KA 2DQKA 2JAWA 4RKRA 5GPBA 3WLEA 4MV4A 4MWSA 4F5ZA 1I7DA 4ZP1A 4CEJA 1JDZA 1LZLA 1XA4A 2MSKA 2ZRBA 3SC2A 3U39A 5AQEA 2G8LA 1MJNA 3PHHA 5TPZD 4TZ0A 2AFVA 3V4ZA 1G42A 2L18A 2HQOA 3KZOA 2W70A 1E6CA 3BE4A 3ICWA 2AKEA 1TT5B 3PFFA 1Z92B 1PRYA 1B1CA 4MW9A 4RLQA 4ZOCA 1NVWQ 1ZUD1 4POAA 1JQBA 4XA8A 4XDZA 4EO7A 1RW4A 1U2QA 2PU5A 3TBKA 4HC4A 3TRDA 3M6FA 2HRCA 4QECA 2ILTA 5BN3A 2WFZA 3QFFA 3ANMA 4IS3A 4C4RA 1V43A 4U9IS 4OJKA 3ZV5A 3DZBA 1FHMA 1MGOA 2IYZA 1V35A 4WRRA 1YFKA 4G9EA 2WJZB 3PLAE 1OFUA 2WJGA 4YT2A 2FUG6 5J4VA 2J3KA 1CIPA 4I4NA 2ZR0A 4EEZA 2LNDA 1GSHA 1IH8A 4YT8A 1Y1RA 2WHEA 3O3OB 4AN0A 2Y4NA 1XALA 1U1IA 2M98A 3BGSA 1DKMA 3A6JA 3M7IA 3VOAA 3E4DA 1U1GA 3EZ7A 3HMQA 3LQ2A 2VPIA 3H97A 3P4XA 4IIVA 4AHYA 2EWWA 3EXIA 3H9CA 4L2IA 2NTEA 3VZRA 3AONB 4DV1B 1RAAA 1WNTA 2C99A 2C2OA 1G8AA 1G8SA 2QAGC 2P3QA 2LV8A 3EIUA 3JASB 5B3JA 3K0AB 4I3FA 4NYIQ 4BLRA 5AW3A 3RFVA 1AD2A 5JD6A 1WZNA 3LNLA 2DTEA 1L5RA 1KSHA 2D1YA 3PQ4A 4ZRDA 3AFMA 2B78A 3HCDA 1HDRA 2H3HA 3DL7A 5AK6A 5KNCH 1JI0A 3T1HB 4MHSA 5T4HA 3RS9A 3UXHA 1VKHA 3EARA 2C7BA 1CY2A 2IXGA 5FYDA 4E2ZA 1RM3A 1PJ8A 1Z29A 3D59A 1U99A 5CA1B 3K53A 1V3UA 4RM3A 5LWHA 4H16A 5K09A 3F74A 1KMCA 3JRXA 4BBSL 1UC4B 1P0IA 4KR2A 3QE0A 5F2EA 4IWYA 4EJSB 4AR4A 5ELMA 1EK1A 1BIFA 3P9SA 1QH8B 5IVPA 2HCBA 3MJSA 1E9FA 2ZRKA 1X1QA 5AM4A 4CKXA 4Y6LA 2ADMA 1MNAA 4NH4A 2WB2A 2HK7A 3JQCA 4N7BA 3A1VA 2EEZA 3RFUA 3NDRA 3GHYA 1Z6AA 3HZOA 3QG1A 3HA3A 3A44A 1GU7A 4BNIA 4P9NA 2GBIA 2RARA 1N7IA 2YFHA 3CO5A 3K15A 1U3DA 3MA0A 4PW0A 4H6XA 2QTMA 2Z3ZA 1ELOA 2SKCA 2FSFA 4ESEA 2AC4A 3KJFA 3AERA 5AJXA 2RH4A 2R66A 1B6TA 3CZAA 3D7NA 3H8WA 4OQ4A 4UVDA 4P5DA 4RJTA 3HN2A 1VDZA 4D8TA 3D8UA 2XXBA 2WFLB 4L8FA 5FUYA 1SKYB 4H7KA 3O1LA 2H1FA 3OT5A 2RONA 5LNK1 3FLBA 1NLYA 2GUGA 9LDTA 2HA4A 3KX2A 2PPLA 1OFIA 2DKOA 3MZ0A 3ML1A 3HA7A 3LWVB 3CW9A 1I3QL 2PG3A 1FUYB 2RAFA 2Z95A 1TUEA 4GT1A 4GOMD 1M8KA 4FGZA 1U0NA 3WWZA 1NBEA 3EQ6A 4WZBE 1DAFA 3E7DA 2YH2A 3ZU4A 3AV3A 4QSMA 4M0LA 4WEOA 3OFSA 3BWMA 4JX9A 2YWDA 4WJZA 4UQPA 4CR7A 2FKNA 1DU4A 4DQUA 1G5TA 3O3CA 2YJ4A 3NTRA 3UPUA 2FTKE 4NCIA 2YBEA 3VPDA 4JLOA 1NOKA 4KO4S 4CM6A 1VOTA 4Q1CA 5TY0A 2IY7A 1JKIA 1K06A 2E87A 2QORA 3KC2A 4Y3UA 5F76A 4AS2A 4RPIA 3HY6A 2BONA 1L1FA 1VIDA 3K09C 2XQGA 2IT1A 2ZKIA 4LXQA 4JJ7A 2DSXA 1M1XB 4UQLA 1IG3A 3BJZA 4MCHA 3AF2A 3LY5A 4TSKA 1XVIA 3SKYA 1UJ4A 4EH1A 4CL2A 1ZOIA 2CXTA 1M1YE 2MYNA 4IVNA 4MVJG 4A2QA 1Z5NA 4V0KA 2RHRA 2CKMA 4O4JB 4X7RA 5AYVA 4MUIA 3V6MA 4BGDA 3GLFE 3G5AA 3W5AA 1DO0A 4QO8A 4UMDA 3TCXB 4B2IA 1EJ6A 4MR8A 1TZBA 3F1LA 4YUZA 4QPCA 3EVBA 5FLYA 3RTEA 3WLKX 4YMHA 1AKWA 1ZR4A 3DTNA 3ND8A 3RQIA 4WPGA 4HLCA 4D6PA 2GNAA 2HRDA 2PNJA 1Q17A 2GEKA 4TYQA 2OESA 3PENA 3ND5A 4C0LA 5DXFA 1VHWA 1M6VA 2PS3A 3A3PA 5LYJB 1UFOA 5KKNB 2GLTA 2D0OB 2XDYA 2EBWA 3GGOA 3IB3A 3QELA 4G1BA 5EHIA 2YWXA 4C05A 4Z9BA 5J1TB 1N2GA 3LUBA 2QN1A 4FVTA 4GMGA 4OG2A 2PKQO 2YVQA 4XSVA 4YP1A 1WJGA 2I6GA 4G8CA 4LGCA 2EJBA 3EBOA 1CCWA 1GAQA 2NZYA 3GO4A 3PUIA 1KDZA 1JE0A 1HQYE 3GH1A 3HEAA 1MQ8B 5KSYA 3OZVA 3FMIA 5IRCD 1X70A 2ETVA 3LWQB 1DAHA 1E1DA 1T3HA 3VHLB 5C34B 4W5NA 1A82A 1WMBA 1LLQA 5K45A 4I50B 1DVBA 3F5MA 4RGYA 4ER6A 5A9RA 4ZOQI 1SXQA 3IBYA 1F7VA 1UXKA 4OHRA 1MRSA 3O47A 1WPQA 2X3YA 2KKDA 4MHOA 1AB5A 5GAGc 1U2TA 3EGWA 4MICA 2BMJA 2GCGA 1T1EA 4IGIA 4XQGA 1H22A 1YASA 1XMJA 2V7WA 2P40A 1ZOOA 3I92A 4N3GA 4U6SA 5L6LB 3F6YA 5FF9A 2WJJA 4MA4A 1RKQA 4OL0A 1ZI9A 4DPMA 5CB4B 1XYVA 3K92A 3U13A 5EXTA 1DV1A 3VBCA 1TZJA 3VHQA 1T0IA 2PXAA 2ZBPA 5CIWA 5DBIA 3AI2A 4N5HX 1V95A 1YWGO 1D4AA 3PUJA 3FSJX 1RHUA 4OJMX 4K7JA 3B0AB 1NC1A 4RF4A 5AJWA 1Q57A 5F4BA 2N1BA 4TTJA 4BKUA 4C3UA 1A9XA 1RI5A 2JIBA 2PBFA 2DPLA 3UJ6A 4CKWA 2GZ1A 2QR3A 1E0JA 3OC0A 1JB9A 4RLFA 1J5EB 1Q7CA 4DMFA 2QM7A 4JS0A 3QRWA 4UUBA 5IASA 5CX4A 5I5GA 3UAYA 2IHJA 4C3VA 1ZIOA 3G7UA 3CUWA 4MNTA 4JLNA 1MQAA 4KVZA 1QCYA 1EFRD 1H2EA 4BQOA 3RADC 1PN3A 1VIAA 4UPEA 1OC2A 1QVWA 4O2LA 3FCSB 4UAVA 3A9WA 4LXYA 1TQ2A 4ZJYA 4MVJH 2GFQA 2W6ID 2LKCA 4R5MA 1O7JA 4Q24A 3Q7QA 2X77A 4P4LA 4XJTA 4YHBA 1OLOA 3N59A 4ME3A 1PL0A 3W1VA 1N9GA 1V6AA 1Z0SA 3GIWA 3AFOA 2ZJ8A 4DEVA 2ID4A 1II8A 3RC3A 5DISB 5C4MA 3IE2A 1X1DA 3SIPA 3IDOA 4JUCA 2QJTA 4CMAA 3HCPA 2CLEB 4J1QA 1QYXA 2PQ2A 3WK6A 1PL8A 3EGIA 5EKUA 2YOFA 3A6KA 1QHFA 1E8NA 4BY7L 3PHIA 2ZUEA 3F8TA 3VU9A 5CFQA 4HVAA 1G5QA 3MS7A 3V3KA 4OH7A 2W71A 5AW4A 2GPJA 1R0GA 3D02A 3E3OA 2GH1A 3HO1A 2OECA 3HABA 1GAXA 3NYQA 3IVRA 4LE1A 4KITB 5ABPA 1HNWB 2H1LA 5F3RA 5KQMA 1CRWG 4LJKA 1JEYB 1V5IA 3NORA 3T3OA 1Z7BA 2EP8A 4B1FA 4F2HA 5AD1A 2GEBA 3BIJA 1EK0A 2QYOA 4MPRA 5D7BA 5ALKA 5IH3A 1O3YA 4LZPA 4MA5A 5FBRB 1IVYA 1J99A 1J1ZA 3A70A 4I5IA 4HK4A 4GKVA 1JJFA 1KYWA 4C0BA 5B57C 1SBTA 3MMXA 4RTOA 1DADA 1IBMB 2X23A 3BIWA 1DFHA 1D04A 3H86A 1E32A 3TRJA 2IZ6A 2BH9A 4UM9D 5HCIA 4JODA 3TD9A 4LY6A 4NFYA 1WZUA 2BGRA 3PXDA 2C29D 1IFXA 4CF4A 1WVIA 5CD9A 5JNTA 3SZOA 1WM1A 2QN8A 3LBHA 2OZVA 3JV7A 3BWCA 4KE9A 4JIMA 3RCBA 1B71A 5BYAA 1CR1A 1VL1A 2XE8A 3NHBA 3HBAA 3P27A 3ZHZA 4EHBA 1TQDA 1HEYA 2IS1A 4V3BA 5L3QB 1G2OA 3LG2A 4OLBA 1K86A 1KIAA 4A92A 2VT2A 3KZ1E 5FI3A 2YQZA 5TMEA 4CKEA 3HVJA 2JLCA 1CUAA 1MAHA 2KW5A 3C3AA 1F20A 3QLJA 5L3SB 2ZTUA 2YWFA 4EW6A 3JQAA 5HTOA 4JJKA 1YU9A 3ZD8A 4URZR 1EUCB 1GGEA 1FFHA 1GG8A 3E81A 2VYQA 1VCIA 1XI2A 4YCJA 4BNYA 1N2CA 2OXCA 2ZI9A 2DERA 4Z0HO 3D1LA 1UBHS 2A0WA 3HDHA 3BFKA 3LW8A 2KX7A 2DU8A 2FZKA 3PICA 4JDUA 2Q45A 4JUDX 5U4QA 2DXIA 3G2QA 2R7NA 3OFNA 1NVKA 5K01A 5A02A 3JZMA 5BN5A 4BB0A 4ND8A 1FEZA 4UMVA 3FWHA 1GQFA 1YZUA 3L0DA 4LDAA 4A0HA 1NVMB 2WR8A 2H57A 4AU1A 5DT9A 1QTRA 2QF7A 2WJPA 2FRDC 2XTNA 2Y1EA 3R6WA 5LUAA 3G88A 3GB9A 3KOYA 2QPTA 1E3SA 2G83A 3T5CA 2FA9A 3WLRA 5TSDA 1ZSYA 2PH1A 3EJWA 3MT0A 4LXGA 4Q1BA 1F8YA 3MBKA 1C41A 2Q0XA 3TL6A 3ZE8A 5J2UA 1WDWB 3BK2A 3GPCA 3WLTA 3O8RA 3AM3A 1BH2A 3S27A 1FNMA 3ROKA 2VZLA 2GCEA 4G2NA 4U2CA 4CT5A 3QBDA 4KRGA 3TOSA 4Q02A 1W8IA 1I80A 2BZGA 2YY7A 2H08A 4FR5A 1KEEB 4ONEA 1WMEA 1VHQA 1SFRA 2V6IA 4Q3LA 4PNEA 2HNBA 3PVCA 2P68A 3U9TA 5BN1A 4NCKA 5MFZA 1LSSA 3BTSA 4O8CA 2IX9A 1T6XA 1S24A 1THTA 3H05A 1MO5A 4IIEA 1I7NA 1GTRA 3BXFA 2IP4A 3HOYL 2R84A 4FD3A 2YU9L 1VRCA 4JC8A 2PIDA 3NB0A 3WI7A 4ZI3A 3PXUA 1WXHA 2JLQA 2DJIA 1XG5A 1NMYA 2IUSA 4JZYA 4KQKA 5GWXA 3TOVA 2PVCA 4PWYA 1KXZA 3RIMA 5DKFA 3WICA 5HIJA 1XRLA 3HVIA 5FWYB 3FJ1A 4KPEC 4PVDA 1YZHA 2JI7A 3KT8A 4XTRA 4EGQA 1NQVA 1UBUS 1BMFD 4FE3A 4XE5A 3B6MA 1ZI6A 4NYMR 2EJTA 4YUYA 3QOYA 3EF0A 4L0CA 1ZLYA 5F3DA 3WY9A 4ZVNA 2VJAA 3N8IA 5IAEA 1DT5A 2V7GA 1I2ZA 4MQBA 1HURA 1G1AA 2EFHB 4X66B 4HZGA 1F17A 4L76A 3IMEA 1CB7A 1HSOA 2B37A 2MU1A 3Q85A 1B8UA 2BFMA 1VPEA 3FHLA 4Z54A 1P2SA 3NIWA 3BJRA 2ZDHA 5FBWB 3OQBA 1RMTA 5LN1A 2IPAB 3RFTA 3P0EA 1PHRA 4FUQA 4G1MB 4HCJA 4YPVA 2BRUC 3MILA 1W36D 2FSIA 2L17A 5IN4A 3C3XA 1S8AA 4PFJA 1CY0A 4OJNA 3KR1A 4L08A 1QXSA 3OCYA 2H51A 3PWKA 1U7HA 2JZOA 4XYMA 2CLMB 4TLCA 3RT1A 3CCCA 1FQWA 3T5DA 1P5RA 3FNFA 3GQBB 1O08A 3ZK9A 4YBRA 5KVSA 1CDEA 5EG5A 4LCEA 5AR1A 4E2WA 4OK6A 4P84A 5DNYB 1FLNA 3WL8A 4A6XA 1YCDA 2QEQA 3I1YA 3P0JA 3ZW8A 4BNKA 3SHVA 2YV3A 4CIAA 3B1XA 5DLYA 4CQMA 3K5IA 1IUOA 1L4MA 1Y8QA 4RK7A 5IEJA 1KYXA 4F2PA 5AOBA 3U44B 2O59A 2TMYA 2VRWA 5DN9A 1Z6PA 1LDNA 1SOMA 1LBHA 2QNBA 3E9QA 2IV7A 4RL4A 3WMFA 1R0CA 2AN9A 2IEGA 2Y1LA 3JQRA 1P8JA 3D0RA 2CNOA 4WZAB 2Z1MA 3SP1A 5CP8A 2Q6OA 4HX9A 5FWXA 3LIPA 2B4RO 3FUVA 4MI6A 4AR3A 1AS3A 1ISIA 1Y3BE 2Q9AA 2XYHA 4QVKA 3WLOA 1TK9A 3LTNC 4HYTA 2R1VB 4TLDA 4TV9B 5GJVC 4AZ3B 3ND6A 2FQQA 3LPNA 2CJFA 4LV6A 1W88A 5FNVB 1NUHA 4BNJA 4KXMA 3NWPA 3CINA 3AH8A 4NIMA 5SZIA 4NJMB 3VJKA 2WIDA 3DMFA 2XCTB 2ZBVA 1TLFA 2PFSA 4M7PA 2JRCA 3AILA 4OGLA 3KG2A 1W73A 3RYFB 4WCFB 3MCWA 1XEWX 3K30A 3SD7A 1OA0A 2MJLA 2C6AA 1WDMA 4C07A 1YMUA 1QUEA 2HZBA 3ENWA 1UEXC 2CB0A 3VSAA 3RANA 1M2FA 4UXHA 5LQMA 4L9RA 3VC2A 1I2MA 5SYNA 1SVSA 2FQXA 3CT4A 1GSIA 4QDJA 1SEPA 1XTVA 2FZGA 4ZCQA 4CQLA 4NDZA 4HLUA 1DXYA 1AX9A 2JK1A 1AUXA 4IL5A 4DABA 5LA6F 4BYGA 4O25A 4S1PA 4AF8A 4B3TB 4KR9A 5FL7D 3KT0A 4NYIR 5A71A 3NGMA 5H70A 3U4DA 3TG2A 4AR6A 2LGJA 1IM2A 2WUDA 3QOXA 2X8LA 4GX1A 1F14A 2BBTA 5GVRA 3R5XA 3VDXA 1P2UA 3FYUB 4I55F 3UQYS 4EB3A 4O2BB 3AWIA 1U5BA 1R9JA 3MUFA 1ODLA 1U8ZA 1G7TA 4BIMA 4EG6A 3D81A 1BKDR 3NHRA 5AOAA 3GJ6A 4O4HA 4OGFA 4LXUA 2JFPA 1U8FO 1M7GA 5THKA 4F4HA 1YCGA 1YAJA 1YBAA 2FDRA 5L9AA 3DOUA 4OHYA 2WEKA 1JZTA 1P0PA 4CIWA 4AB1A 1OHHD 1K6IA 3N6VA 3EAQA 3VU0A 2OHVA 1Z4LA 3QWAA 1E1CB 3IR6A 4I1OA 1FXWF 4MK4A 4BGIA 4IHJA 3NM6B 1BRFA 3ZDAA 4XQ0A 1UBMS 1SU7A 1NDQA 1I6KA 1NBHA 1QONA 2ZSAA 3TQSA 1VPVA 4CV2A 3RYCB 2WU3A 3V33A 3K9NA 3KUCA 3JQDA 4HPJB 2RMKA 1C3XA 2P8SA 3VYWA 3UHPA 1QYIA 4N7JA 3MJFA 4E15A 5C8XA 2PH3A 3EIWA 5B1HA 4PO9A 4U0JA 4G07A 2P41A 3UFXA 9GPBA 2OQRA 1OXMA 1GL9B 4B7ZA 4F38A 2B94A 3T7TA 1QG0A 4R6WA 4JFRA 4K6KA 2ARKA 1JG7A 4M0KA 4F84A 1H5NA 5GV8A 2FUNB 1B0UA 2HA5A 4KFSA 4ZK2A 3Q8MA 1JAHA 3U4QA 5GONB 2IWHA 2IODA 3NU1A 2LCIA 4QPDA 1XSEA 1JDUA 5ALYA 5DV9A 4Q9DA 4UBIA 1P72A 3RVMA 4E0BA 5AVUA 4AAYA 4GOOD 1IAVA 1VHLA 2HDOA 4V0RA 4URXR 1QK3A 3VR5D 2XEDA 1LW6E 1U7OA 3KU1A 4H0FA 3WLSA 2PUJA 2VRCD 4LV8B 1VBNA 1KO7A 1KEWA 2W2NA 1OXVA 4LZZA 2J3HA 3IBCA 3ONFA 4YPOA 1VG1A 1RSZA 5A5EA 3ADBA 2Z2KA 3DZ8A 3ESRA 4RGVA 1NOJA 4LGVA 1HK7A 1NSTA 4J16C 3CY6A 2I71A 4XXBB 1T26A 1N8TA 4WLOA 4DA7A 1HMYA 4XEHA 1DCTA 5F98A 3ZWQA 1T2DA 1Z25A 2MDTA 3OCVA 1XVUA 3I09A 1UQUA 3ED5A 2O05A 3C4JA 4NYJQ 3GP3A 5NLLA 3LVFO 2P35A 1H4TA 3S8EA 1GCAA 1PE0A 1M8GA 4M89A 3HJFA 5AM0A 3GN2A 2YMLA 5LOVB 2ZU0C 4B79A 2D4AA 1L8QA 1Y89A 2RFLA 3T3NA 1D9XA 4TLMB 3SE0A 1D5WA 1QG4A 1CJMA 3B7GA 4YWHA 1H0HA 4HMOA 4P31A 3S1SA 2DPXA 4ZO9A 3PPYA 1KEZA 3S2HL 1ZJ5A 2EWMA 2C2BA 1EX9A 1G16A 4PZDA 4E5KA 5EP1A 2A30A 4YH1A 1BQEA 3GTJL 2C3UA 3JQ6A 3H5WA 4LHXA 1NVXQ 3Q5EA 3O4RA 1AKTA 1SVMA 4LHEA 1F4PA 1SHJA 2ZAIA 2GAAA 2BM9A 3R7WA 4DC9A 4A3IL 1NBMD 5KSZA 2BFEA 1GFWA 3H1EA 5ADUS 3MS4A 1CJUC 3GLSA 4DMRA 1VM6A 2P5UA 2C04A 721PA 1Z5GA 3OIVA 5I3ZA 3MLAA 4EKGA 5KBYA 3W5CA 3UMSA 5KHLB 1KSFX 2R8XA 3D2LA 2BL4A 1KK3A 4YJ3F 1KFCB 1ORTA 4ASUD 1RAIA 5ECWA 5JTUA 1C4XA 1DUSA 1USKA 1GZ4A 1N2BA 1S1MA 2ZI5A 4YWMA 3N8DA 5L4LA 4NPHA 2FPGA 5FLML 4XGNA 1Q7TA 4EHKA 1T4MA 2QUJA 5FADA 1X7DA 3FKJA 3ZWAA 3W4KA 4NC9A 1HFKA 4EFMA 5ILOA 1E9VA 1QLJA 3JZDA 4XVHA 5K8UA 4EGSA 1Z16A 2Q27A 1QX4A 3COZA 5CDSA 3PGA1 4EMSA 2DBZA 1TU3A 3QUCA 5CVJA 1TMOA 3PXEA 3V8RA 2ZXFA 4KUHA 5IN5A 4ZXFA 4B6FA 4Z1MA 3A4LA 2NYAA 4P4TA 1C1HA 5D6OA 3U17A 4UM8B 3KHUA 4DNQA 2CLHB 4C30A 1B42A 1OZHA 2NYDA 1AVTA 1SY7A 3E5RA 1C2TA 4F92B 4B9AA 3ZE1B 4D97A 4J29A 2EXXA 4EUKA 1UC8A 4ZDIA 3K3PA 2ECQA 3UPDA 2HMYB 2W4QA 1P39A 3HKCA 4LSGA 5T4EA 4ZODA 1XXHB 2X5KO 4FLFA 4Y0AA 5KTOA 5FX2A 1GTJ1 3EYAA 4F8JA 2JFBA 2EX4A 3KAPA 3QU7A 2IELA 4XFKA 3QY0A 4DFDA 1ECFA 3O8OB 3SSNA 4H7HA 3D3JA 4IZOA 1LD3A 2PBLA 2C1EA 4LA4A 3SKVA 4Y9RA 3VR3A 4TRNA 4QM7A 1W1IA 1OBFO 4G4SO 1R1DA 3AR8A 4M8LA 3WK8A 5K2OA 5MHTA 4I6EA 2GPBA 3ADDA 2Y93A 1OVMA 2ATXA 4P4NA 2P2CA 4H77A 5E4YA 1X7WB 3BSYA 4YACA 4YI5A 3ZTWA 1CUUA 2FZ5A 2DFDA 2RGAA 3HCNA 4I14A 5CURA 4RTKA 4MWEA 2VC2B 1FB5A 2WVJA 4DQVA 2FV8A 2HU5A 3C14C 4FINA 4MKXA 1OW3B 5B7NA 2CHFA 2VDQB 4FNOA 4LAFA 2G28A 3OKFA 1A7AA 4U7TB 4KFUA 2Q5CA 5KNBD 1KBOA 1M67A 1BHO1 2FK8A 4FYPA 4BEVA 1N33B 2KN9A 4KAXA 1CIJA 3DFKA 2AVDA 4XR4A 5TR9A 2LPMA 1C9EA 4N3BA 5BOSA 4JCOA 4YMUA 2PV0A 5C8DA 4WXHA 4A1OA 1HNXB 2A9RA 2CXQA 4KKVA 1CRPA 3C7AA 1ATZA 5DNEA 5HHTA 1RCFA 1JR2A 5ALNA 3HJHA 1V1RB 3FBGA 1E5VA 4B9EA 1E3EA 4DCNA 4ETNA 1M0EA 1DJOA 4L57A 1PJZA 3KVOA 1PDOA 1L3IA 1R6DA 4E6PA 4HDQB 2WG2A 2VHJA 3UCFA