5MFZA

Human sirt6 in complex with small molecule ubcs40
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mfzA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mfzA01
2OORC 4G1CA 3F6EX 3D81A 3PKIA 5K6TA 4Y6QA 1Y9DA 4JT8A 4JUBA 3IAEA 4BVBA 1U28C 3JWPA 4GM0A 3PKJA 4RMJA 1V5GA 2IHTA 1QPBA 2FN3A 5FEMA 3EY9A 2FR8C 4QQ8A 5AHKA 2VK8A 4RMGA 3OE1A 4KPUA 2OD2A 1M2KA 5K3SA 4MPPA 2EZ8A 2Q5QA 1T9AA 4BN5A 4D5GA 2OO5C 1XLTC 2Q5LA 2Q27A 2JI8A 2Q28A 1S7GA 1T9DA 5BWLA 2WVAA 4K9MA 2H2IA 5MGNA 3FSJX 1YHYA 4K9PA 1SZCA 4IF6A 3U31A 1YC2A 1ICIA 1UPBA 3GLRA 4V1CB 4JD5A 4HD8A 2H2FA 4JT9A 3ZGVA 4UUBA 1M2HA 4JUCA 1OZHA 2VJYA 3GLUA 5EJ5A 1S5PA 5IMSA 2H4JA 3RIGA 5K2OA 2WVHA 2WVGA 2A1UA 2JLAA 2A1TR 5EJ7A 4RMHA 3PDHA 2UZ1A 4F4UA 1MCZA 2OD9A 3RIYA 2QQFA 5EJ4A 4GM4A 3HWWA 3ZGOA 3CLRD 2PANA 5MFZA 5DGDA 4GPEA 4GM1A 1T9BA 4Y6LA 3U3DA 4IG9A 1Q17A 4FEGA 1YTLA 4FZ3A 4COKA 1JSCA 2QQGA 4BVHA 4RJKA 4V1CI 1M2JA 5BWOA 2DJIA 2H59A 4UU8A 4K9LA 1Q6ZA 2FWNA 3JR3A 2JI7A 1M2NA 1YNOA 1OZFA 1NM5C 4UTRA 4ZZIA 1POXA 4K9NA 1PI3A 4BVGA 5EJ9A 4Y6OA 4UTXA 3E9YA 4J16C 4QPZA 1YBHA 1ZPDA 2PGOA 1Z8NA 3ZG6A 2VK1A 3FLMA 4BV2A 1DJLA 4BN4A 4RJJA 4KXQA 2Q5JA 4JU8A 1T9CA 4GP9A 4MQ5A 2H4FA 3D7KA 1N0HA 2X7JA 1OZGA 3GLTA 5DGTA 2NXWA 1U31A 2UZ1B 2JI9A 5D7NA 4K9QA 3HWX1 5DEIA 4D5EA 3LQ1A 2HJHA 1UPAA 1EFVA 2FRDC 4UTVA 4TWIA 4QELA 3CLSD 1PTJC 4K9KA 4I5IA 1M2GA 2AG0A 3F6BX 1U2DC 3CLTD 4JUFA 2V3WA 2EZ9A 3GLSA 4X3PA 4C7BA 1SZDA 2H2GA 3CLUD 4MPRA 1YC5A 5MF6A 4BV3A 4O8ZA 2W93A 4GG1A 1V5EA 4RJIA 2B4YA 4MPJA 1POWA 2VBIA 4BVEA 1YHZA 5BWNA 1Q14A 2EZTA 2JLCA 4FVTA 3FZNA 4L3OA 2JI6A 2C31A 2BRUC 1PO7A 5K6RA 4C78A 3K35A 2H2DA 2IHVA 5MFPA 1BFDA 2VBFA 1MA3A 2Q5OA 4JUDX 2JIBA 1E3TA 4F56A 1OVMA 1V5FA 2EZUA 3EA4A 1J8FA 4ZP1A 4X3OA 5FYQA 1PT9A 5EJ6A 5EJMA 5EJ8A 2Q29A 1PVDA 1O97D 1EFPA 1PYDA 4HDAA 4KGDA 4TWJA 2PGNA 2H4HA 4L2IA 4BVFA 1Q1AA 1D4OA 2AG1A 3D4BA 3EYAA 4UTZA 3CF4G 2H2HA 2FSVC 1PNOA 1O96B 4MZXA 4FEEA 4UU7A 2VBGA 4K9OA 1U2GC 4BUZA 2IHUA 1HZZC 1UPCA 2NYRA 1YI1A 4R8MA 1YI0A 4UUAA 2VK4A 2OD7A 3IAFA 4RMIA 2EZ4A 4V1CA 4JU9A 4UTNA 4JSRA 4JUAA 4Q9DA 4J1TC 5EJAA 1PNQA 4IAOA
chains in the Genus database with same CATH superfamily
2BGLA 5JVDA 1ZMXA 2Z3ZA 4GHWA 4KXLA 1X3SA 4DSOA 4GWGA 1PT7A 1WPQA 1Y1VL 1F1BA 1L7AA 3K6RA 3LUPA 3LXRA 4DJAA 4EG8A 4A10A 1OT3A 4FZ5A 2NSHA 2EXXA 1DKQA 4J4HA 3SI7A 2VK2A 4IPTA 3BD6A 1ST3A 4HBGA 4JSTA 3OAAD 4KTTE 4R9NA 4Z9BA 1XL0A 4B6PA 3HFJA 5CBPB 1GQQA 3WISA 2C2XA 4X7MA 2I6FA 2Q1XA 4QJ3A 1XWFA 2NLOA 3E58A 3I2IA 2O07A 4OHPA 2DFNA 4PX2A 4E2XA 1XMOB 4JLNA 3I2FA 3PYMA 4KR3A 2DY0A 3L4JA 1JAXA 4QWMA 1AGYA 1AGXA 5ALSA 2OAEA 3LI2A 4NBVA 2JLBA 4QQNA 1JDJA 1PR6A 1B41A 1UC4B 4FE7A 4JODA 4M8NE 4BHTA 1Z63A 4NCNA 4ZYTA 1N2OA 2UZ4A 2B7LA 4Q3EA 1QIIA 5AKIA 1LGYA 1FIUA 3Q98A 3KB2A 4POOA 3B3JA 5CVTA 3BWVA 1LTLA 1TWGL 3QUQA 1CR6A 4B81A 1OWCA 4P92A 3FMVA 3HWSA 1C8BA 4ICIA 2PUGA 3ZWAA 4BNWA 5CITA 1VFPA 3KYDA 5CB4B 3CLTC 2NYVA 1A9RA 1J99A 4ACAA 1MFPA 3NU1A 4ZGWA 1MW9X 1T25A 1U8ZA 2W2VA 5JSUA 4HR7A 5KWJA 2ZG6A 2PYIA 4P4SA 3LUJA 1EG2A 1MJNA 3BBPA 3RQSA 3GLFE 3KOZA 4ZC1A 1ZWKA 3CH7A 3EAGA 4E51A 4AFNA 6AT1A 1CRQA 1GNLA 1UBSB 4JOSA 4B2PA 4DDKA 2QF7A 4NRDA 3BK1A 1F4PA 3F67A 4MRAA 2WWTA 2ZVPX 4G1VA 4MB6A 3TD9A 3TSCA 2BL4A 4Z0TA 4DLRA 1KDZA 5BWLA 3M3HA 3FOCA 3OFKA 5KNLA 3KTAA 4L76A 3IC5A 1CPYA 3KVYA 4OXXA 4CKBA 1N9GA 1P0CA 4GSLA 2DEUA 3CRMA 2IEIA 1CUXA 1NQAO 1SCUB 3COVA 1F6BA 2X3UA 2O59A 1R4AA 3IUPA 4LZOA 4UY81 3QMWA 1CQJB 3I05A 4YTEA 1VLZA 5KQPA 2C7PA 2ZKLA 5HMMA 4D9IA 3H1BA 4UFOA 3WICA 3QYPA 1UPBA 2IZOA 1CUDA 3I37X 3JARB 1ILEA 5HFAA 2ZI4A 5BVGA 1TFRA 1HYEA 1O57A 4G8DA 1GPKA 1NOIA 2NW6A 3JQ8A 5EIEA 1NBOA 1YJ5A 1XAGA 4B5LA 1S2DA 1DTSA 5K0BA 2FF5A 3GUHA 4O2BA 3UXYA 2GPTA 1CUCA 4LG1A 3V8VA 1RAAA 4KNVA 5M34A 1OBOA 2DFDA 1HDOA 4LWQA 2Z43A 1XJQA 2XIQA 1Z0IA 4BNIA 3MTDA 4FBLA 1T4DA 3DBIA 2JDIA 2FEAA 3UAYA 3HVUA 4ZCRA 2OCBA 4MR7B 1E2BA 1FE8A 1WO8A 4DY4A 3GVCA 3HACA 1YVEI 3PPYA 2GRUA 4XVHA 4DIEA 1ULAA 1Y8CA 4BRUA 3GGOA 1CQZA 1X0VA 3DHWC 4MGZR 4A8TA 4AAYA 5F35A 1KO1A 1JFSA 2YHIA 3V1MA 2FAXA 1NJ5A 1AKMA 1HYGA 5DPMA 4FTWA 1YUBA 2QSUA 3K1YA 3REFA 1YQUA 3BMNB 5DRYA 5EGSA 3OQIA 2HADA 3ESYA 2D2VA 2PFSA 2X1HA 1L7VC 1ZESA 3IUJA 1WRBA 3K2IA 1T0HB 3KJNA 3MBKA 5IBRA 4XSGA 1O9GA 5FIUA 5JAIA 3UGQA 5BUQA 3ZXSA 3G5MA 4EGSA 3A58B 3GEIA 1KC3A 4OJYA 2BT4A 2DKOA 2ZIGA 4L16A 4WOJA 4R8SA 2IH2A 2WJYA 2PMBA 2BLLA 2VYQA 5CXXA 3V4RA 1N6NA 1KZ4A 4ZTBA 1N2JA 4NATA 4NJEB 1FJXA 4RXNA 3VYTB 4BLWA 3E8SA 3T3EA 2WU8A 1T0IA 2DM6A 5EN4A 5F21A 2QNRA 3U4QA 3ICWA 1H4SA 1DIAA 1NPDA 1JG4A 3GBSA 3ULKA 1ODHA 4RV4A 4X1IB 3BSYA 3S8MA 1E6UA 2PANA 2OLJA 4IV8A 2OC4A 5DFAA 3GL9A 1P7YA 2Z2ZA 3C8UA 3RVQA 2Y1EA 2O3RA 2A68D 1VPLA 3GEGA 5EKXA 4EVIA 2H54A 4PAWA 3GH1A 1BX3A 3RGWS 1V6AA 3P0FA 4NEQA 3OY7A 1FYXA 1T3TA 3H5LA 3GLQA 4M4SA 2IBSA 1BEZA 4IFTA 1GFZA 1T5TA 3DEYX 3FCUB 1C3OA 1VIMA 4FFVA 1UXIA 4PLZA 3OM0A 4J0JA 3HJCA 5CUQA 3ZU5A 4L15A 4DR7B 3PB3A 2I2WA 3A1WA 2WKRA 2G9ZA 3KV1A 3X3HA 3OZRA 1HZZA 1NN0A 2JD0A 3E5NA 3IJ5A 4HLUA 1K4YA 3FZEA 3JR3A 3KKPA 1CU1A 3AHJA 4YBRA 4BBPA 2MSNA 1PR9A 2B6HA 3BGVA 5BV0A 3LW8A 1QVRA 2AI1A 3AXTA 4LTDA 3WWLA 3MHPA 3K1AA 3FX2A 1E2NA 1KZ1A 3DOOA 2ZROA 3A4VA 2RAVA 3COZA 1WOYA 4R16A 3TL6A 5AQ1A 2A92A 4A8JC 4M83A 1QTIA 5A7FA 4OHVA 4YAEA 5HP4A 2Q07A 4M7RA 3TW8B 5EWJB 1DRUA 1POXA 4X97A 1YFKA 4ZYZA 3LKDA 6NULA 2GETA 1X8JA 3EPPA 5F4BA 3MOGA 1M6EX 3U26A 2X4IA 4EJSA 5DGCA 1KYTA 3KZOA 1U8EA 5HK9A 1EE9A 1LJUA 4I7EA 4HDCA 3RTGA 2G9VA 3ZCRA 2H29A 2O1WA 2VTEA 1E4OA 3LSTA 3ND5A 5CK4A 3FM9A 5G3ZA 2DKFA 3BA6A 2PUHA 4ISBA 3R8CA 2G1UA 4R1NA 4M9UA 2B5VA 3KQKA 1ZEMA 1SBIA 4N1AA 1TWAL 2UAGA 1IJKA 2QNIA 3KZMA 1U8AA 3ZCUA 5LCXA 3ELUA 3OE5A 2I55A 2XJVA 3C43A 1OH7A 4BV2A 2FUG1 4BKPA 1WOMA 1ZBDA 4HDRB 1NJSA 5H4HA 4DMKA 4YLEA 4YJHB 2AMLA 3G0CA 3E9QA 2YWFA 4Q34A 4NBRA 3OM1A 2ERCA 3KR1A 4LVOA 1RJ9A 2AG8A 4Z86A 4XTRA 1KKLA 4LYHA 2R7NA 3LVQE 4HGRA 4N3GA 2HPAA 4R1SA 4BWVA 1QGDA 4AP6A 4ENQA 3GJTA 4H17A 5AUNB 4MQ5A 2MSWA 5I8WA 5C32A 4UUOA 3FCSB 1C1XB 2CMKA 5IANA 1LZKA 2AXNA 3TLGA 1ECLA 1Q3TA 4GZMA 1SB8A 2DPHA 4QJ5A 1GN8A 2V6MA 4O2AF 3TM5A 2B4KA 1H2BA 1BS9A 2IUEA 1EB9A 3CQ9A 3KHSA 4CV0A 4QG3A 4LBYA 1C3XA 3JATB 3HXLA 1O94A 3INTA 2FWMX 2OO3A 4KBGA 3VNRA 1GTRA 4GEGA 1WD7A 4I50F 2EWVA 2P1DA 2IEBA 4RY2A 4JZKA 4U2BA 4UHEA 3TSAA 5IT5A 2HT1A 2CLKB 1NXXA 1SXHA 4GMFA 2SBTA 2Y1LA 3BDIA 3WOVA 3F71A 1TCVA 2IYEA 4DR4B 2C2GA 3LQ1A 4L9AA 5JDIC 2ZYRA 9ATCA 1WVMA 4K9SA 2ZJOA 3UJ9A 2YFHA 1MEJA 5HQ3A 1RHRA 1XZEA 3CUWA 4PSUA 4WK0B 3SOPA 4J94A 1G5FA 4RZUA 1E7WA 3NXSA 3W6OA 2CLMB 2QX7A 3H1EA 5JI3E 4PYJA 5T5QA 1DINA 2RAPA 3TB6A 4Q37A 1L8LA 5JCZA 3W5HA 4F12A 4AWBA 3RBXA 5C4XL 1YQTA 1B0PA 2R6HA 4Q02A 1FC0A 5T41A 4BFTA 4F9FA 1LU9A 4Z2YA 3HJRA 4BKMA 4IFEA 2PG3A 3Q7TA 4X8HA 2X77A 1OWPA 3OFNA 5FL3A 3SDSA 3ZE2B 5A0TA 1G20A 1LLFA 1N2GA 1FK8A 2DY1A 2VJAA 4L0DA 4XB1A 2JH3A 2W8BA 1P9RA 1NF3A 1WQ3A 1HE8B 3GBVA 1Y6QA 4ZJYA 9GPBA 4QUKA 4HZGA 4P83A 1SBZA 1XCMA 5G2OA 1HDZA 2C84A 2ZBQA 1TMYA 4PSDA 4NMXB 3VQTA 3FWKA 2UYHA 4NU5A 4IV0A 5IN5A 4IILA 3RPEA 1GGMA 4BQEA 2H31A 1NXSA 5BSGA 3UV6A 4ECEA 3RC2A 1J8QA 4E2ZA 4RK5A 1OD6A 1Q5PA 2C3UA 2CLCX 5LDGA 4AURA 3ZIAD 1Q19A 2I2DA 3QEJA 1CUFA 3RB8A 1BD4A 3FGOA 5FDFA 1IBCA 1NMEA 3U9SA 2VHCA 1PZNA 4CQJA 1L4HA 5FO0A 2QL6A 3WNVA 1YTUA 2O8EA 2P77A 4CM5A 3W6NA 4B3JA 4H6XA 4P4SB 4XR4A 4B7ZA 1LS1A 4KYIB 1KOJA 2N1BA 3D4OA 4PQYA 4CQNA 2ACVA 1GEEA 4U02A 2G09A 1C0PA 2JI6A 4RUKA 5JS6A 1V3QE 5BR1A 1XTUA 3A32A 4Q82A 3ZCQA 2XE6A 4WUTA 3R7BA 2CXNA 4GOLD 1C50A 3LLVA 3UKDA 4ZCSA 2EFHB 2DPXA 2FP3A 3FZGA 2A7QA 4R2HA 3KXDA 3OCUA 1DRJA 1XDUA 3K2BA 5LU9A 5BSHA 4LDPA 4N0EA 4LWPA 4GPBA 4PNHA 1R0RE 4QYWA 1KI4A 3E18A 2I7VA 3ONVA 2ACWA 1KAOA 4TN5A 1ODIA 1DBRA 1AF7A 1GR0A 2QRMA 1SMWA 1T4MA 3IBTA 1K8QA 4DLPA 5I5EA 5JD6A 1SD2A 1E9BA 3HJUA 3DKVA 5MLC3 4L02A 1JHXA 4HX9A 4UQPA 4BMSA 3FNGA 3NONA 4HEHA 3BSFA 3GLFA 2B99A 2QPAA 1E3TA 1WZ2A 2V0CA 1WDTA 4PBSA 1N4AA 3ISVA 4YALA 2FDXA 1ODCA 4H77A 1J2YA 3W1WA 3RS9A 3B7PA 2NM0A 2UVDA 1VKRA 2QXUA 4R51A 3D8UA 2QGFA 1Q1BA 3GFSA 4MS1B 1BVRA 3OBIA 4RDHA 1HG0A 4LXQA 4F2PA 2ZSJA 2WQ7A 5DHQA 2A0UA 5FPYA 3S68A 1UAAA 1YR9A 1ILWA 2GN0A 2UZ3A 2WTXA 4BMDA 1I3MA 1MDFA 2ETVA 1Z8DA 2I1LA 2IOYA 2HL6A 3T4EA 3P94A 1JJVA 1Q7EA 1SBCA 2GJ9A 4O4HA 5FUBA 3PYLA 3KR9A 1Y9JA 4G4SP 4KV9A 4N39A 4PYLA 3R7WA 3HHPA 1AMUA 2BDEA 2PUBA 2DWPA 4F8JA 2QMUA 1T2NA 2GN2A 3MUNA 4MKRA 1IM5A 3W78A 1U1FA 2CKCA 2CBGA 2FSPA 2VP3A 2YC2C 1X9IA 4HDAA 4MXDA 4TV8F 5LB4A 1TD9A 3A4NA 4KLCA 3KQLA 5I4CA 3ZHZA 1MD9A 4O4IB 1F3LA 1Z35A 2WZDA 3M1YA 3GRYA 1USWA 2ZCUA 2XUKA 4DV7B 4R2KA 3HKEA 3K8ZA 4LFAB 4WZBB 4HDMA 4LY6A 1TECE 4Q1FA 4ZVKA 4CL3A 4E5PA 2CGEA 2YJZA 2HIMA 3DMHA 3EYAA 2VQ3A 4BBAA 1RJWA 4DB4A 3GA0A 3VM6A 1F9AA 2X14A 4OXYA 4QJ4A 4F6LA 2PZLA 2SCUB 3HZHA 3HI4A 1RPNA 4XB2A 3WLIA 2CHGA 3FSEA 4JVNA 4WY2A 1IZYA 3N0RA 4PGHA 4YMVA 1DLJA 2D0OB 1IHOA 1XAHA 3M2PA 1IVSA 1GUYA 3Q8LA 2FHPA 4YCMA 3THYB 2IHUA 2V9PA 3TRIA 2V0EA 1B8UA 1M6YA 1MQ9A 1HZZC 1FFXB 1XNGA 2NYRA 4UM7A 5HEKA 5F9FA 4NECA 1VCMA 2VF2A 3U0VA 5D85A 1GRRA 2OPBA 3VKHA 2XW6A 1GQOA 2XQGA 3IAM6 2PGXA 4RLFA 3OMXA 1DARA 2Y1KA 5M04A 1XLTA 3C98A 2VO1A 3GO4A 2PVPA 3RANA 5J2UA 3HVHA 1R9TL 4AO8A 5HTOA 1IY8A 2FFBA 2X9VA 2EKPA 3TM4A 1WCV1 4X90A 1T34A 5JE8A 3VR3D 3ZWBA 2A3NA 3Q41A 2WUEA 3ETCA 5AI5A 2YQ5A 4C3HL 3ESBA 2CLDX 5H02A 4DLUA 3ZV7A 3D1VA 3CM0A 4RA9A 4RTQA 4KWIA 3WBJA 2C97A 4OQMA 2XWQA 2LCFA 1AURA 4OQEA 3K1AB 2XB6A 3PL5A 3KSRA 3RVJA 4BVKA 1L6IA 4FT4A 3WA6A 4HLNA 2NMVA 4C5BA 1S2GA 2YV5A 5FBHA 2JFPA 3GRCA 1E2HA 2BHNA 4GLFA 1GN9A 1U0OC 2AWOA 4EZBA 1US8A 4FB5A 1XMVA 3T1HB 3RWOA 5IDWA 3KETA 3FOFC 1LKMA 3PK0A 5G02A 2Z95A 4BY9E 1DBPA 4E4TA 1Y7PA 4REMA 1MV5A 2NZJA 2G08A 5L3RA 2A0KA 4MR9B 1OLSA 3K1ZA 3T5DA 4DR6B 4XEUA 3M34A 4NARA 4L27A 4ESVA 5ICSA 3GCXA 3FXAA 2G6BA 3W3AH 5CA1A 3Q8KA 4KQEA 3KUUA 5IBPA 4IKPA 1VP9A 7REQB 3RLIA 1J09A 3A6LA 1TCBA 5B1HA 1QOZA 2BMJA 1L5GB 4NIMA 4I4TA 5KDLA 3S5UA 3I1IA 3NHRA 5AUOB 3D7RA 4MDYA 4YJ2B 1JAIA 4B82A 1FJ2A 3B9PA 4UCFA 2OQ2A 4UW9A 5IDVA 3V7WA 4ZALA 1EEHA 4H3VA 5A7HA 3BC1A 1C9JA 3NHUA 3C8ZA 2BEVB 4WEOA 1AM4D 2XEDA 3TXAA 4Z7NB 1RRVA 2EC5A 3CPHA 1L6RA 3Q85A 4X44A 2AD5A 3GJRA 3KSZO 4NOJA 1X86B 4QNMA 1O94C 3EY9A 4ZCLA 1NVAA 1MQAA 3WK8A 3O83A 5SY4A 1UP4A 2C00A 3C70A 2C9BA 2NV0A 5BW6B 1QDEA 1GGKA 1ZGCA 2ZBPA 4C7JA 3IALA 4P81A 4TKMA 3TLGB 1G4AE 4A36A 2R2GA 4OB7A 3FUWA 2A4KA 2PKXA 2O2JA 3OLZA 3CSUA 3IQEA 4M76B 1JIJA 1FMFA 3LYLA 3K05A 4WE3A 1AHPA 1ZM9A 2ZJBA 4R3NA 4PG7A 4HADA 1RYHA 1NJ6A 2NXEA 1WP9A 3ML1A 4L0QA 4NCXA 1JHYA 4JP2A 1DHTA 4KPUA 3H2IA 1VE5A 4KQGA 4ZRNA 1FNMA 1ZNXA 3GDHA 2ODNA 1THZA 3WWEA 5JRZA 2GFIA 1KRWA 3A2MA 3RUDA 4U8GA 1L4KA 4XLLA 2VPQA 3FTQA 1MABB 2BCJQ 3I1FA 4FX2A 2PD3A 3UH0A 1JMVA 4BP1A 1B43A 5TPZA 3RHTA 2JGDA 4CM8B 2I3DA 4LJ7A 2ZVJA 3CZQA 4MKIA 2CXPA 4N48A 5LQCA 621PA 3VOTA 5C7YA 1PJRA 1QZZA 2GN6A 1KXZA 2WV7A 4AT1A 2LXNA 1ABEA 3QLUC 3QLVC 5DGIA 4Z7OB 2Q28A 4Q3DA 4LV5B 3V4ZA 3NH6A 1A7AA 1GL6A 2V4MA 1U3TA 5GWXA 5A0FA 4F96A 3I42A 5JCJD 3MA0A 1Z2DA 5M7EA 1R50A 5C7LO 1O77A 2DECA 2JB9A 2I4RA 3ISTA 4LV8B 2DHDA 2QLJA 2X2EA 4DMMA 1AK9A 1VIDA 2CL6X 3LECA 3N0TA 3LP6A 4FYVA 4TZTA 4X1YB 3RJTA 1ZVJA 1QONA 2FEOA 4K8OA 1ZFNA 3MLAA 3VR1A 2NYUA 1T3SA 2G9QA 1KSHA 1UZAA 1N8NA 3C3KA 3O90A 1EQ2A 1JEAA 1JA9A 1QV9A 1Y3HA 2J4FA 4EY7A 1AHIA 1E1KA 3IV7A 2R79A 1CC1S 1TI7A 3DJFA 4C6SA 1N5LA 4PRYA 3CZ9A 4FDUA 5GJWC 4DM7A 3L04A 2W42A 1J07A 3P5BA 3U7HB 4AZWA 4Y6PA 4Z53A 1I3CA 4L9RA 4UDXX 3DCJA 3SZGA 3K0CA 4FS8A 2J3JA 2WHQA 1AS3A 4CIVA 2QTHA 3I73A 3LK6A 4RADA 1KYXA 4DQLA 4ZJUA 1T43A 3CJQA 3O7WA 1VBMA 2NUBA 4E22A 1EVKA 5KTKA 4GBED 4KO8A 2II6A 1ODTC 1KOLA 2V4UA 4BTEA 4X63A 1U98A 3INGA 1Y1QA 2VH5R 2ES4A 3LQQA 2B8EA 5BW4A 5KX5F 2XECA 3HJHA 4QDJA 2H7XA 2J3QA 1J1UA 3ZU4A 2O8EB 3WLTA 1IQUA 5DTIA 3MWEA 3QPCA 2YN0A 1JDVA 4Y9RA 5D6NA 3T3HA 3E0QA 3HVIA 2WVGA 3LIPA 4Q4JB 4GO1A 4H7DA 2AVNA 3G89A 4FR0A 4LPSA 3WV4A 1NLUA 4FR5A 3ZZUA 4B4KA 4XWOA 1MJFA 1SHLA 3AHEA 5IKXA 1QIJA 3STUA 2DQYA 1TUIA 3T0GA 2JIOA 3FIUA 1C8VB 1YBAA 2QVCA 3GXBA 3BMQA 3PDHA 4JY7A 4MWSA 2XJQA 1QYIA 4FSHA 1C8KA 1Q7TA 5JXHA 3NTXA 3KFVA 1Z74A 4MVJE 5DXAA 4BP9A 2W90A 2X2OA 3RFVA 3WADA 5TB5A 5IJWA 4GDMA 5K5EA 1USIA 2ZANA 3KP1A 1VI2A 3HU5A 2P11A 5AK5A 2XUHA 1FTYA 1II8B 3QVTA 3HY6A 4FJ2A 3J81k 2QR2A 4CTKA 4DPLA 1X42A 4CLXA 5E2BA 1P31A 1TTQB 2TMGA 1GPDG 2AHRA 3K9HA 3LY5A 5LJIA 2FDCA 4W9NC 4WX2B 1L4NA 2QDKA 5JEEA 4OHKA 3L7JA 1J5XA 1GSAA 1JIXA 1KYZA 3F6YA 4GM1A 4JC8A 4MVJI 4UPDA 3I58A 4DQDA 3NHSA 2XCIA 4KSBA 1UMKA 2H1SA 3AF1A 1YQWA 4U5QA 5C8YF 2XUJA 5JLAA 3C2QA 2IPNA 2VZ9A 1LV7A 1U3FA 3DL2A 3EGWA 4YAOA 4KQ1A 2Q2WA 3FBWA 2OHXA 3QSGA 4LX0A 4V38A 1H9BA 1GPLA 1YS6A 4LI3X 3QNMA 4IUCS 1DRKA 2PQ0A 2ZYIA 4KJZA 3N53A 4NAVA 1NVTA 2KQUA 3CT4A 1J7KA 1F7UA 3H5TA 4JYCA 3I9MA 5TT0A 2J85A 3DEKA 1FYVA 4BX0A 2HWUA 3CJRA 1A4XA 3QE3A 5G4KB 1KWGA 3HGTA 5FUVA 3N86A 1O0CA 3AJDA 5LKRA 1BMTA 1NJGA 4KRGA 3L02A 4Q6BA 1R6XA 3KQVA 4U7HA 3WLOA 2WF6A 3DAOA 3TJRA 2ZULA 1ZN7A 3C6KA 1FP2A 1YNOA 2IY7A 5AVSA 4D41A 3GBPA 2HWWA 4Q3CA 1W36D 4Z3OA 4L5IA 1B8VA 1XKXA 4KVGA 5JMWA 4EHNA 5I45A 1J90A 4ZOLF 4ADSG 4HXGA 2JGIA 4UTRA 5B57C 4Z0HO 2VTDA 1YBFA 1W0CA 4KE8A 4MULA 3O0TA 1GCIA 2E1PA 2EJVA 3NB0A 2GHTA 5F4ZA 2ZTLA 3LPDA 5TRTA 1TQDA 5G0VA 2H2AA 2P3QA 3CNHA 3FUVA 3R6WA 5ITVA 1Q44A 3P0RA 4ERXA 4C2TA 3KRTA 2KBFA 3OPYI 4IFIA 3OCZA 3HV2A 3BMOA 3I8XA 5DXJA 1QDUA 3DXFA 1YFJA 1U7ZA 2BBOA 4JSYA 5EPOA 1CX9B 4JVLA 1G8AA 1HFEL 2ZWPA 3KT6A 4MVJG 3ZHXA 1ZI6A 2JIZA 4F7WA 5JO0A 4N4AA 4AMBA 5KMGA 3TLXA 1GFWA 2I0FA 1XR3A 2YY6A 3V55A 4JEIA 1ATIA 1E2KA 1ORVA 1WX1A 1PR3A 2E5LB 2H12A 3B1YA 5IM5A 3WHLA 3CZAA 4QKQA 2CL5A 4AZ0B 1GM5A 1IHXA 1RAHA 3HC7A 4NZYA 4E31A 2VHUA 4WH0A 4Y2XA 4LPKA 1GAEO 5LMUB 4H35A 2R85A 2ACEA 3SQNA 2C9OA 1TWHL 5BQOA 1AQIA 4EFLA 1C09A 1G8PA 1GYQA 1LW6E 1S2OA 1ZSNA 2Q5JA 2QSYA 3N6XA 4LMBA 4XARA 4AZ0A 1O95A 1H66A 1KVQA 3FCEA 4GP9A 2XR1A 3IERA 2PQMA 3OG9A 3PGVA 3QYAA 4BVAA 2QM7A 2JGNA 1H5NA 1WMAA 3FSGA 3OETA 4NFLA 2VXYA 3VZDA 2DERA 1NBWB 3VZRA 2I9PA 4RZ2A 3ICPA 4FHGA 3BXXA 4RA9B 5DU2A 1QHIA 2Z8YA 1E2LA 4MJ3A 16PKA 3HADA 2CV1A 1U65A 5JCOC 2XAUA 1Z2OX 2ZI5A 4Q7QA 2OCPA 5HE8A 4EHBA 2JI9A 3C8MA 3KD2A 4C4YA 2WSSD 3ICVA 3G8BA 3HWX1 3O2NA 2UYYA 4LAFA 5IABA 3HXQA 4YRFA 3PWTA 5K4GA 3LAWA 4AXXA 5EQTA 1P17A 2IS4A 5IVIA 2IYUA 4BNNA 4HEA1 4G36A 3QENA 1IW7D 3N8HA 2RKOA 3SHWA 1ARZA 4K6GA 5A4AA 3QKSA 4A03A 2AWNA 4OGGA 4X6LA 1NASA 1J7JA 2FEMA 5BWMA 1XEWX 1BHQ1 1PFVA 3SEAA 1K9SA 4KHZA 4MUEA 5LYJF 1IMJA 2WPDA 1KWKA 1W2GA 4IIJF 4FFSA 2WBLC 4IM7A 2QENA 3S15L 4PY2A 5BNWA 4YCAA 2HTFA 3RS8A 1DV2A 4HI0E 3BB3A 2HUPA 1V7CA 4A8PA 1UJ6A 1IBRA 3LZCA 2JAWA 3IKVA 2QRKA 1JHPA 1S2ZA 2UYOA 1G19A 5H3LA 1K4KA 3QWHA 1QS0A 5LR6A 2IE8A 1JDUA 1ETHA 1WUJS 3QTTA 4MP8A 1ITZA 4TT3D 3GLSA 3WB2A 1TVKA 2HJVA 1E8MA 4PPGA 3VU8A 2ENWA 3TQCA 3NIWA 3DDSA 1IN7A 4HJRA 2VNHA 1HL7A 1K5DA 4PCLA 2X8AA 5A04A 5IW8A 1AA9A 2P69A 1QIDA 2PK3A 2VHZA 1DCKA 3SEZA 4DUGD 4NCBA 3NOOA 1ODKA 2GD0A 1L1FA 1S3SA 4OMFG 1D9ZA 5JJBA 1SZJG 3JYNA 1VP3A 3H8JA 1PFUA 1PQ4A 3I04A 1I7PA 1PJ2A 2CVOA 1Z0AA 3B1ZA 3UFXB 2HF9A 2R0QC 3PPWA 2HMYB 5DNWA 2GAFA 1H2WA 4MO2A 2D6FA 2GBPA 1OC2A 3LOQA 3MFYA 5FNVA 1Q0LA 3JSXA 5AI6A 3SMQA 1B7GO 2QKYA 4R4JA 1TM4E 3UJCA 3K0AA 2WPNA 3BFPA 2G82A 2ZB8A 2Q4EA 4DUZB 3VZQA 4WAUA 4ARUA 2HCTA 2LE0A 3H1TA 1B3BA 5FPQA 1K8ZB 2QVBA 3MILA 1W52X 5CB0A 5B5SA 5EKSA 1J2JA 3DH0A 4R8VA 2BN4A 3Q8WA 1YS2X 5C3EL 1RWQA 3R1IA 4YP0A 1JZTA 1KK0A 1EGHA 3CEAA 3I72A 5CVJA 3T1NA 1NMXA 3ROQA 4AKGA 4MUIA 3NFRA 2IPOA 1RMYA 2GPWA 3B1VA 3GGJA 3DBRA 1ORHA 3HGQA 1SMUA 2W4QA 3M5PA 2CVFA 1IU9A 3QYJA 3A7EA 1MO5A 3V80A 2BGWA 4I14A 3PGLA 4OHUA 3WJAA 1BFDA 3BILA 3HP4A 2RE8A 3BSSA 3ZWNA 3CVJA 2WSMA 4KE7A 1BRTA 5EQJB 4CHTA 2PNJA 3P0EA 5LLTA 3Q7IA 2IWHA 1ZX1A 1NI4A 5EZSA 1TJ5A 5JBIA 1FF9A 3BZWA 4YAGA 4S3MA 2CDCA 3PFWO 3SPXA 4DNPA 1NNLA 5K3BA 5JQGA 2XGJA 4FDVA 2CXXA 4Q66C 1V8PA 2A94A 3EA4A 4C4AA 1DWPA 1WXXA 4X3OA 4K9DA 1DCMA 1Y4ZA 4PN3A 2GF9A 1BXZA 5F23A 4WFN1 4OU5A 1MO6A 421PA 4C14A 1JYBA 3AHCA 3BXOA 3UGJA 2JH8A 3DXXA 5C8DA 3WIBA 4JAVC 1TO1E 1URPA 3V4OA 3DDZX 3A6KA 4MCAA 2J4DA 4E14A 5K8UA 2ZRNA 4BFZA 4LCEA 1RRKA 4GLBA 4Z4FA 5JANA 1WULS 3QXHA 3MWEB 2ZETA 5H3CA 4F9GA 1G5HA 2H9YA 4KWCA 2HRCA 3SQLA 1QPZA 3N70A 1O6BA 3TTXA 2NU9A 3B8HA 5KWSA 2E4YA 3VKVA 4WDRA 1YKGA 2FPGB 2K6GA 4RORA 1QYVA 5KKNB 4QL3A 2OZVA 1CZLA 4RPKA 3RVDA 4PHGA 4PAQA 3SVTA 4DUYB 3A3PA 2OZPA 1ZQ1A 1KP3A 1O3YA 4J90A 3ZNPA 2NYDA 1FXSA 2FR8A 3U3KA 3ZQJA 1X7WA 3G8DA 2HKIA 3P2JA 4X9XA 4L8LA 2GCOB 3AUJB 1B0UA 5BRAA 1W1UA 3HOZL 1Z47A 3M6XA 1CHNA 1LPSA 2FW9A 3C5EA 4RCZA 1MJGA 1A9PA 3CF4G 2CL0X 3CPJB 3LVRE 3WJ2A 1WCIB 4Y0NA 5K51A 2DBYA 3BMXA 4OHZA 1HT2E 4JJFA 1HOXA 2IK8A 3KR0A 1ISHA 2X0IA 4NXNB 2Q4TA 1X15A 1P5ZB 2D7DA 4HAXA 2R8RA 4M0FA 3V3KA 4ALIA 4M8IA 8AT1A 2C57A 1T9GR 1ZM2A 1W36C 2XDQA 1TYZA 3EDOA 2YWEA 1VXOA 3C3BA 3WXMA 5LMNB 3S40A 3E2IA 1YU9A 2HDHA 4POAA 2JJ2A 4W63A 4EYOA 4D9FA 2PUEA 2VRNA 3HB7A 4O33A 4MVJA 5LQNA 4GL4A 2BEWB 1G8YA 4BNDA 1P33A 2ERSA 1DZ3A 2C5HA 4UMFA 4CV2A 2GO7A 1V9CA 4Y3UA 5EIOA 4ZVRA 3WAKA 3CUKA 4EMUA 2J33A 4ARCA 3ZW7A 2QN1A 5F2KA 3OOWA 1C5KA 1N6KA 1XCJA 4OKSA 4YJGB 3HCRA 4FU0A 4EI8A 2VHEA 3GGPA 5IC6A 3ITEA 5EUBA 4ED9A 5B7GA 4RVNA 1K0UA 4AI0A 2WLTA 1VLLA 3IEXA 3MG9A 4J29A 2Q45A 2QN3A 5B6IA 4GYJA 1S8FA 2D1TA 1L5HA 3SDBA 1UBCA 2PWBA 1R0SA 4HFMA 4P3OA 3UNXA 3ZC3A 3VV3A 1NNEA 2NZYA 3QOWA 3L2OB 5IVHA 2ZRGA 4BZXA 4CKWB 1Q0HA 4I08A 4ASUD 2OPHA 3PC3A 5M5XL 2MSKA 4N12A 1NQTA 3HXKA 5LQDA 2EDAA 1U0EA 1KEZA 2CNNA 1ZIOA 4D8TA 3QY9A 3ECCA 3ENKA 4G1CA 1RU3A 3KK0A 5K0ZA 4RY0A 5F7OA 3HOVL 3W8NA 1W5BA 4NE2A 2X8JB 2CD9A 2ZSUA 3IE2A 4H15A 2HBZA 3P0IA 4XD2A 3BS4A 4BFYA 1W0JA 3JZMA 3ZGNA 1B13A 2P1ZA 2DPGA 4L8VA 5KOHB 4WRRA 3TG8A 2P67A 5IAOA 4JR2A 1KI6B 2GVDC 2J4CA 2REQA 4JT4A 2P2NA 1EUCB 3JWHA 2PY6A 2Y1WA 4IX1A 2J9FA 4BBJA 1KVSA 3ZDFA 4CI9A 3QZUA 3KL4A 4EWLA 1Z6AA 4YT2A 3UJ8A 5JYDA 2MOKA 3ZD6A 1D4FA 2ATIA 3PNSA 4JC4A 4CMGA 1S8OA 1ZRSA 2O5VA 4DREA 2QJFA 1KK2A 4NESA 4QSMA 4KO3S 3ILVA 5TMPA 1P0MA 4G0VA 4JKIA 1CJSA 4MUAA 1N6PA 5JW6A 1CY8A 1U7TA 2QA5A 4MLDA 3W9YA 4WA8A 4OJTA 1NTRA 1T5SA 1AUOA 1X13A 5IC5A 1YONA 1TMKA 2FWJA 3NGLA 4K6CA 1L5KA 5L6MB 2YYAA 5F3DA 1PFQA 4ZO7A 1BJKA 1WV0A 5F2OA 4TVBA 1OLUA 3E1SA 1IG0A 5EAIA 4AYTA 1WDKA 1HT0A 3B5IA 4FNAA 5L95A 5ETJA 2Y4OA 2WZBA 3AVXA 5JZSA 5KOYA 2GK3A 4N8SA 1KOFA 3ZH2A 2J5QA 3VDMA 3A2LA 4YXFA 1CR0A 4C7MA 4MUGA 5JNSA 2Z3RB 1DFIA 2H4YA 1TW2A 3E3OA 1EE2A 2B69A 1FJHA 2D5LA 2G76A 3DHNA 5BN3A 4M37A 4YROA 2HY7A 3ZE0B 5IAJA 3ZR4B 2VYVD 2P9EA 4IDGA 4P2BA 2CCJA 1DS6A 4RDIA 4J0IA 5DHTA 4C5AA 5A03A 2Q8NA 3H2YA 3OIUA 1B23P 13PKA 2VPXA 4LF5B 2NVUA 4MRRA 4BNXA 3NG1A 5B3JA 4HB0A 3UMCA 3OP4A 2WHEA 3CINA 3SQOA 3E8MA 3OVMA 2NACA 5E6UB 5ICCA 1QOQB 4N03A 1NURA 2QTMA 4IEIA 2KJQA 5CB6A 3UICA 4IXTA 2B21A 4JLAA 1X1BA 1KQGA 1XTVA 3RJZA 3RRJA 2D2XA 3ERCA 4NSNA 4EI7A 1SCAA 2BGNA 2VEOA 3ZI4A 1DGQA 3INRA 2CFOA 1DTEA 3RUHA 4WN9B 2F1KA 1ONNA 3IAXA 5FPTA 2GBFA 3VPGA 2VTBA 5KTPA 1PG2A 1VA5A 3IXMA 2A9VA 2R66A 3ZGVA 1U2EA 4B4VA 4OAPA 1PR1A 3FRJA 3FHTA 3MNFA 3WMEA 4C87A 2LD4A 5B55A 4NH0A 4LXUA 3JASB 1PWHA 2WMYA 4UFNA 1Y8ZA 2R2AA 2XVZA 3UMMA 4I99A 1C3VA 3P1JA 4QXOA 2PSJA 3IMFA 1ECCA 3M6MD 5AOVA 2V9CA 1P5JA 3KXKA 1SRQA 3VPHA 5ALEA 1NHWA 8MHTA 1E94E 4CL2A 1RIFA 5K99A 1ZVMA 2RGUA 1Z4MA 2WVHA 3F3SA 3DZIA 4FXPA 4N5HX 4GKBA 4JI8B 3TPFA 4AG6A 2VLIA 4QVKA 1ABBA 5DX1A 4EATA 3K31A 1GL3A 4C21A 4P3NA 5ALHA 4AZ3A 1XRJA 3IJPA 1C7RA 4F86A 1KTIA 3QFRA 1PEDA 4LV6A 1XD9A 4M6WA 3SFZA 1FRVA 1A69A 5KJ1A 4OJMX 4PLYA 3D59A 2IPLA 2VKTA 1C0LA 3CF6R 3WIOA 1MCZA 1T36A 3NM6B 3BQ9A 3HLYA 3T5GA 2OD9A 5LMCA 1MQSA 2QQFA 2QTVB 3TQTA 3RUIA 1KBZA 2W00A 1HPLA 2Y1FA 3KKEA 3KU1A 4RVFA 3CMCO 5FRDA 3ZKAA 5KSYA 5SV2A 5FTJA 1QCCA 3V7NA 1JW9B 4OU4A 1TT5B 1JA1A 1MC8A 2DT8A 2YICA 4Y2RA 1NXWA 3HL4A 4RH1A 3DCIA 1T1JA 4OHRA 4ZODA 4H4DA 4JROA 1PU2A 3FPBA 5E38A 1T8TA 3DAYA 1GZVA 4W1SA 5LZ8A 5EIFA 4QOIA 5BSTA 3U17A 2ZUDA 4IG9A 1TZKA 1U1EA 1AK1A 2OCAA 5TF0A 3CF4A 3W8RA 3JQFA 1YJAA 4WNYA 3RAFC 1J9EA 2HGSA 5DYGA 4DCOA 2B1GA 4F5YA 3CV3A 5CPBA 2WIKA 3EVCA 3DF9A 1VFNA 2C96A 1MG5A 4WFIA 3IMGA 2HHHB 1RFGE 4M9SA 2A9OA 2JCVA 5IFKA 3MWGA 1U1CA 2ZIFA 3IXQA 4BLQA 5FL7A 4DDWA 2JFUA 5K01A 4YJDA 1SBNE 4L8WB 4MUBA 4G5QA 3M33A 2OK8A 2NU9B 3TTUA 5BN4A 3QF4A 3DEZA 3FOZA 3U7RA 1SXGA 2A33A 4P3YA 2ZZNA 3WIVA 4NR0A 2HF7A 3N8GA 1IEVA 1KYYA 5AW5A 2VZEA 3RNLA 2PLWA 5I7FA 4D9BA 2CB9A 2F9LA 3LGSA 4U6SA 3IUSA 3WB9A 4BWFB 1NFRA 4L75A 2HA2A 4Z8XA 3QXJA 1SUFA 5EJ9A 4CTMA 1NI5A 1IULA 1KMHA 4RV9A 1IPHA 4QPZA 5K3OA 5I9NA 2E4XA 3K8OE 2BFDA 3CGGA 3D5EA 3DAFA 5AO9A 2NU6B 3FGNA 2QYTA 3K0FA 1MX5A 2WJPA 1WF6A 5M5BA 4RH0A 1R6DA 1JSXA 1HYHA 5DP2A 3BXEA 3DAGA 2J5KA 1UCFA 3GCDA 1WXHA 3LFHA 5DM60 3S1AA 2W98A 2IYQA 5IM4F 4TQ9A 1MA0A 3UKJA 3ZY2A 3D54D 5B2FA 4Q1EA 3UHOA 1E98A 2JEYA 1GTL1 1NUTA 3VPFA 3IS3A 4YCSA 1DOAA 3AZOA 4TLMB 2IQ5A 1FFEA 1C4WA 5FOVA 2BM1A 4D6XA 4HCJA 4D9MA 3WK9A 5SYAA 1AUQA 4UBMA 1NG1A 1KE2A 1A9SA 3KVRA 4QUDA 1RLUA 1E3QA 1ZITA 4R8KA 2NO5A 1LBEA 1XYGA 3AF2A 1A8UA 1JQBA 3G82C 4NMLA 3U4DA 3RR2A 4TXJA 3ANXA 1AU9A 4LJ6A 4Q3KA 5T7BA 5KSWB 3QKTA 4JS0A 3HOYL 2Y0DA 4TLAA 1RLTA 1LFAA 1IB6A 1J8YF 4G63A 2HJ9A 4NCKA 3RVOA 4GE0A 1ZD5A 4HFJA 1IFXA 3GLTA 4G4JA 3WYAA 1X7ZA 1GVNB 1U31A 2OXCA 3QELB 2X1LA 2COUA 3AL2A 5NULA 1XNHA 1V48A 3FKQA 1L5HB 4E21A 2ZZMA 3GFOA 3AR4A 1IY0A 2P3SA 1YO6A 4P93A 2G8LA 4DV5B 4Y1GA 3HBJA 3GJYA 1F2TB 1BH6A 5HZMA 3U5ZB 4MUKA 2EBWA 2R68A 3P2MA 2HO4A 2LDBA 4LYDA 4N18A 2IXEA 3VVMA 2XB2A 1YK4A 4LTMA 2FRDC 3SSOA 4CKEA 1SIUA 1UJ2A 2IW1A 3ZTYA 4GI5A 2P1RA 1H6BA 3KUCA 3GMSA 4DM3A 2FOIA 3J7Z1 3DL0A 5THXA 2PX3A 2G77B 3LCMA 1Z2CA 1IK4A 1G21E 1N2BA 3QLEA 5K3CA 4KOEC 4ZCMA 4YHHB 1BDJA 2C83A 4NG5A 1NRIA 4LC0A 1Y7HA 2I67A 3A1NA 3FE2A 4FYWA 3EWNA 1WAMA 10MHA 4MYTA 3SR4A 2VHQA 5DCWA 1VSUA 4JAFA 1G8JA 1V9SA 3EGOA 3NETA 4IOJA 4LBVA 1U1IA 4D8UA 1FX0B 4HTFA 3MUEA 4MV7A 4XDGA 1H9CA 4UAVA 2ERXA 2IXFA 2FPMA 3MSXA 4X24A 2GNPA 3RF7A 4NC9A 1JR3D 1BCSB 2ONZA 4CF3A 2FH5B 3SHOA 4WZZA 3PQ7A 1ENPA 4QBGB 1D9XA 4LF8B 5JI2E 2D00A 1KJ9A 2P9HA 2ZS9A 5GADc 3DQZA 1KYVA 4G4GA 4J3FA 2YNMA 2CK3A 3BXFA 4MMYB 3TQIA 4EG5A 2RHJA 4D9JA 1U0HC 4IHAA 5MF6A 1EGMB 4UUNA 4AXBA 4UDNA 1CNMA 1YZUA 2QLLA 4B6OA 2XKJE 1XDDA 1XZLA 2OXRA 2RSLA 1FDSA 1SULA 4WQMA 4EUSA 1XPUA 1JRLA 5A4KA 1XNJA 2G63A 2V3VA 4GG1A 3D8NA 3QFTA 1SU6A 1XSEA 2YIJA 5HDBB 3K71B 1TYAE 1NBME 4GWKA 3QA3E 4JCOA 4CLOA 3TFOA 3HVJA 2O4UX 1TQHA 3NEAA 4QQKA 1B6GA 4WLUA 3B08B 3A05A 1U2GA 3MK31 4MS3B 3PEFA 1RI1A 5B30A 1JPNA 3CZCA 3B3FA 1PZGA 2DYKA 1L7OA 2PL3A 4CWAA 2X0DA 4Y7DA 3GLIE 2PIAA 1YZ3A 3RADC 3PNLA 2W2MA 4OHWA 1TLTA 4JEMA 1LNZA 1COZA 3TLBA 2IXAA 3U7FB 1XTRA 4YJKA 3VHXA 5KWIA 4W8OA 5G41A 2EP7A 2VP5A 2C95A 3DBHA 1BWSA 1GUFA 2FN9A 5CVEA 4ALNA 3AKYA 1YZFA 3HCPA 3MTJA 3QVGA 1TM3E 3H1PA 3VOAA 2KN9A 1NU8A 2ZJ7A 1N7GA 3NKVA 5LBTA 3D6MA 1INLA 4EELA 1VC2A 4MVJP 3WGQA 5F2EA 3HYLA 5JISA 4Z99A 2KI5A 3N6VA 4MAAA 4PZZA 3VR0A 2G3YA 1UDWA 3DT8A 4O5OA 4H1WA 3BHJA 3HKDA 2F3SA 3QE9Y 4UAGA 1DI0A 4NY1A 1T6ZA 4UHFA 3QX9A 1SQ0A 3HXTA 5AW4A 4G2TA 4W9RA 2DQKA 3HBNA 2VTBB 1Z16A 4RSHA 3TKYA 4AROA 3ZKWB 2B8WA 2FOXA 3S2UA 4C3UA 4UOZA 5HYVA 3P96A 5AD1A 5HKBA 3KYWA 5K20A 4G0MA 4KVAA 1P9WA 3HZRA 2G04A 3HYTA 2AF3C 1AKQA 4BQFA 4HGYA 2QYSA 5J23A 3SC2A 1NA5A 4BKUA 3EEYA 1Q0TA 3I52A 3UW3A 1R2QA 3MLBA 4EDFA 2I1QA 2OCIA 4EGAA 3AR8A 2EJTA 4UBKA 1KO7A 2HO5A 2B9VA 4I6GA 2BKUA 1A97A 4PZ0A 4M54A 4W7HA 4QU0A 1ECJA 4J6EA 2QMHA 1SCJA 2VXOA 5GV8A 3OTGA 5BYBA 1U7DA 3DT9A 4EITA 2IUTA 2OFPA 1PV1A 1XDZA 4IHJA 1BMFD 1PTKA 5L40A 1RYBA 1G8HA 4XIGS 3U40A 1IZ7A 2CXTA 5DNDA 3ZIUA 2J09A 3GPBA 2X2PA 3N3AC 4Q6WA 3W2TA 5LA6B 3PTLA 4EPXA 2ODAA 2RHHA 4XVUA 1ZINA 4B79A 2GO1A 1OFHA 2C0QA 1QSGA 1UDRA 4HS4A 4EPVA 5IZCA 3Q3GE 1Z26A 1TQ8A 1K6JA 3CLKA 1E1RD 5DT2A 5AVXA 1AKUA 1FTNA 2XMPA 4Z1OA 3VU3A 1T36B 2X15A 3QU4A 1W30A 3ZDXB 5CR9A 1GNVA 3I3SR 2DSXA 2XA2A 4KQCA 5A5FA 4FN5A 1QIGA 4WZ6A 4N54A 1YRQA 2CKAA 1GV0A 2XRYA 3EVTA 1I80A 2FSFA 3HDYA 5TF4A 3AKDA 1M8JA 4ZIRA 2WU4A 1E63A 1DBWA 1X80A 3CE9A 4LOHA 2ZPUA 4Q18A 4G0PA 1ZL2A 1K66A 1VG1A 3UK0A 4LRTB 1PZMA 4U2KA 1P9NA 5HF8A 1F1JA 3M6FA 4XGQA 1VHDA 2ODEA 1EFLA 2O1SA 1H1DA 1Q0QA 3HKBA 5FBZA 4DM4A 4HY3A 2BHTA 2ZE5A 1GTJ1 3JQPA 1B2LA 1ES9A 3Q88A 3X1KA 5IKEA 5LP6F 4H31A 3CSDA 1EDZA 4YS6A 1QYBA 3REQA 3LHKA 4GXRA 3TDKA 4QRDA 2ISCA 4RVUA 5FA6A 1QG6A 4AS2A 3Q7SA 1SPBS 1YI8A 3TGLA 1JXQA 2BKAA 2QYOA 1KI8A 1RDFA 1M1NB 2CNKA 3G2HA 3K9BA 2AKYA 4LXXA 3PG5A 2AFIE 4M60A 2O05A 2VP6A 3CZMA 3UWDA 4AJOA 1H3FA 1YS1X 1RKVA 1GQRA 3ZHTA 2XMSA 2ZE6A 4PSKA 4DG5A 1K3UB 1HETA 1ODFA 2K5UA 1RQXA 2ZRMA 3FYSA 2PRSA 3GCZA 2AOUB 3EHDA 3LNLA 2BIFA 2CMDA 4I9GA 3PHCA 4WCFC 3TN7A 3D7MA 4DV0B 1L5VA 2GPSA 1NOKA 5DSTA 3ZHYA 5K0SA 3WSWA 1A7UA 2LTAA 3BZBA 1QB8A 4JVSB 1N5JA 1XE3A 1PN3A 3M49A 2ZXFA 1GXSA 1U6KA 3K9QO 2EGUA 3ADOA 5CCDA 2OXTA 4WCFB 2CNWD 1N9ZA 1MDBA 3TB4A 2IW3A 4L7QA 4RK7A 5SY6A 4EGFA 5BOSA 5IJ0A 1EDOA 1QZUA 1CF4A 3CN7A 1GEGA 1VKHA 2F3PA 5EL0A 2HSZA 5CT8A 2GX6A 2D1YA 4DNXA 4BN0A 4NF2A 1ZAKA 1IRNA 1CJMA 1XD8A 1ZXLA 3LY9A 3RBAA 3V2GA 2ECKA 1A88A 5HUQA 3TFQA 4CEJB 4H1TA 2ZPTX 1AKYA 1KBOA 4AO7A 3PKIA 3E23A 3MN1A 3PEYA 3EOAI 4MP3A 4IBOA 1OU4A 4AC9A 1XRMA 2GWRA 2HAEA 4FR2A 5ERGB 2X5XA 2G9RA 1HL3A 1UPTA 3FWZA 4I1YA 4JXKA 4ZO9A 2Y71A 3Q1KA 1ZJJA 2BKXA 4V24A 1ZOOA 3GHYA 1TC1A 1P39A 4NBSA 3EMBA 1W73A 1WUIS 4BY7L 3LUCA 4XVRA 1CBUA 4QXMA 3CEHA 5BWCA 1T0UA 4ZCPA 3DR3A 2TMDA 2C59A 1VPDA 3V1UA 4OKIA 1O8CA 2WOJA 3GLKA 3O3OB 4MB2A 4GD3Q 4ZN6A 2XNKA 3RK4A 3ZDDA 3HBMA 3WZMA 5TLSA 3OU2A 2VK8A 2D2EA 1Q0RA 1X14A 1YR8A 2A9QA 3TOXA 3RSLA 3GAAA 1E61A 1MBZA 3J81A 5E1OA 3C8DA 3K9GA 3U37A 3SBOA 2EJUA 1CEXA 3LQFA 3T54A 4HGOA 3EFOA 1XZAA 1XQ9A 2ORED 2QX4A 3FKIL 3HZZA 3DOEA 2QG9A 2VHYA 3TPCA 2ODTX 1J8VA 1Z18A 4QEKA 4EPTA 3GIWA 3KYIB 3TG2A 3SEQA 4MMXB 4EG4A 1HSOA 1VE9A 2HXGA 3BXZA 3LVBA 5ALQA 1TC2A 4HDOB 5ALKA 3L7BA 1QMPA 1BWPA 1ZUD1 2F4NA 4IDAA 4TQGA 1T5HX 5AM5A 3EN0A 3ZWOA 3TTWA 2WU0A 3UWPA 3LT1A 3FR7A 4PSVA 3IBFA 3SXJA 4G5RA 4PAGA 3FDFA 4WCDA 3SF8A 1WXEA 2XQJA 2Z2YA 2X3YA 1X9HA 1G41A 4YC7A 2GESA 3MZ0A 3UQYS 1LC3A 4I6EA 1B3RA 4NYIR 1LBTA 1VJCA 2R93L 2ATXA 2FFQA 5ENDA 2WT9A 1JI3A 4Z4EA 1AUPA 4ZT4A 1CETA 4W99A 5FYDA 2O8BA 3E9ZA 5L3ZA 4R1UA 2PS1A 3A25A 3IRUA 1OMOA 3NP7A 1EM8A 3MIZA 4KK3A 4KQXA 3MC1A 5E3IA 4JP3A 4EA9A 2HT6A 3QEMB 1UM8A 4TV9A 3GTQL 1EWKA 3EXEA 2Q1UA 1EJ6A 3HA7A 1ONPA 4E5NA 1V2HE 4QTZA 1K1EA 4C0QC 1XPOA 4LNUA 3G23A 1Q7GA 4Q1AA 1ZH6A 4KIJA 2ZBUA 4ER3A 5CFZA 3CX8A 1R9GA 1MNQA 4LE2A 1HORA 2PXXA 3C7TA 1R8SA 2FZGA 3LRPA 1RWWA 3SZUA 4QYXA 2VAMA 3EPHA 1Q21A 4KPYA 3V46A 1LDNA 3CPEA 1LSJA 3FDXA 5IYZB 5FUXA 4KPGA 3G8CA 3KHUA 3MJVA 3LG2A 5JYBA 1ACLA 1G21A 1AV7A 4AZSA 3D64A 3EZ9A 2HV8A 2VJYA 4OUDA 5A3SA 4KIUA 3RAJA 1N6OA 4U7FA 3VAYA 1J0DA 4MGKR 2HF2A 5DLEA 1JBQA 1FFWA 1VB3A 4F9EA 1G5PA 5DYIA 1G2QA 1C4OA 5JVH1 1RQLA 2VI5A 3B7WA 3MRTA 3K70D 3GD7A 3O21A 3OUUA 2UV8A 4LKRA 1NRWA 1GCAA 2G8NA 5AI3A 3GP5A 4MHOA 1IC6A 4XRGA 1C2TA 3Q0TA 4J2HA 1BYUA 1UZLA 2I2FA 1GZ3A 1XRRA 4NZMA 5JG7A 2YW9A 3ZX5A 4I1VA 2JGKA 4U63A 3OUZA 3S2IA 5A6SA 1T2CA 5C81A 3EPJA 3D5TA 1ND5A 4JUIA 2CCGA 3NAZA 4QT0A 3SYNA 4LF7B 5LXTA 5EXSA 2N42A 4RMHA 3VHXB 2ZIWB 3O6VA 3A9WA 3BWDD 3T5AA 3KBBA 5PNTA 1CG6A 2ZQ5A 3DFKA 4MJLA 5TQ2A 2QRPA 2UZ1A 4GX0A 4L4RA 3OZSA 3QPAA 3DVAA 4ND3A 1YAHA 2ZOSA 4UBJA 5FWXB 3NBYC 4OFZA 1OKKA 3BHNA 3HYRA 4JIGA 3VAAA 3NUQA 4X66B 3QUTA 5DN6D 1UANA 3L5KA 4EB8A 3PJGA 1MC1A 4X7PA 1NBMA 3ILYA 1BW9A 1JR6A 4A3DL 4KQHA 5KNCA 3OIYA 2IZ1A 3OQ1A 4XOUA 1RC1A 2J0VA 1BSVA 3BH7A 4UVIA 3ZGOA 2A4MA 3ZQKA 3ANSA 3IODA 3CNBA 4MIKA 2Y9PB 3PDWA 4MJXA 5LL6P 2NPFA 2IHKA 3WMGA 2ZP1A 1S2IA 2F8SA 1T9BA 3D8BA 4X20B 3GLIA 2VHTA 4Y6LA 4B73A 4XOIA 2IEZA 2H0AA 3EYWA 3P97A 2QD4A 3O4FA 4IQGA 3PIP1 2ADFA 4CNQA 2A0WA 1DIGA 3O1JC 4YUVA 1TK9A 3M5WA 5IF3A 4FI3F 3SC4A 5KAMA 4FZ3A 4QOSA 4DEXA 2YUIA 2CV0A 3N8KA 5JPCA 3Q87B 4XLZA 2GZ2A 1CYEA 4ZU6X 3ZXUB 2YHBA 3E03A 4YRPA 3L7CA 1ESZA 4OYLA 4KXWA 4CIXA 4O4LA 3QXSA 5IZCC 3NTLA 3QVLA 4O29A 4KP7A 4RKWA 1C30A 5GGYA 5H3HA 3F1LA 5KWVA 3WV5A 3UJAA 5KNCH 3G9ZA 1L5ZA 3X1WA 4IHJB 4DRYA 3AHIA 2QROA 2VJOA 3M6WA 4WKGA 1Y4AE 2ERJA 3WNZA 1E6EA 1UJBA 1WBDA 1QHSA 2F62A 1QH1A 4ZZ1A 4JI6B 1NM5C 2BTEA 3O1HB 4L4YA 2FGKA 2H1RA 2Q4DA 2WFLA 1B6TA 4IICA 4EJ2A 4BV3A 4I4IA 2ODBA 1RM5A 4I81A 4NV3A 1CULC 4W5NA 4MVWA 3WLJA 1CDZA 3OPQA 4JADA 4QUBA 1QC5B 4L8FA 2WHRA 5ALDA 5EMHA 3A6EA 1U3DA 3KJZA 2OBBA 1SBQA 4ZVPA 3UANA 2ZRIA 1ORTA 3FPHA 1BXRB 1XTJA 3ECAA 5EFOA 4D9KA 1AO0A 4OQPA 2JA2A 4PWZA 4KWEA 3V4PB 3C5CA 3AF4A 4US2R 1OF1A 1MC4A 4U3JB 2ZCVA 3RTEA 1K6IA 3RSOA 2G1PA 1S8AA 1EGVB 1HNZB 5KAPA 2BGTA 4H9GA 2MJLA 1QGUA 1TYDE 2BM8A 1Q0ZA 2ZS7A 3REQB 3E7XA 3I9JA 2QJRA 1WUTA 1VSTA 2HU8A 2QL5A 4N5IX 5IP5A 2Y76A 5C1IA 4A23A 4BGEA 1CFZA 4C01A 5HKOA 1W581 1ZM3A 3OJLA 3CVXA 2CF6A 2PRKA 3FVVA 2B34A 5KYTA 3SS8A 1GQSA 1M73E 2AUMA 2R5FA 4FYKA 4YRIA 1RAEA 3AJ9A 3H8WA 3KJGA 2E4ZA 3H05A 2C3YA 1LFDB 4HPWA 5CDHA 2PGJA 4FHEA 2IHZA 4HSEA 4IJ5A 4O1IA 1N0HA 4R54A 2H0RA 3C5WP 4O6VA 5JQWA 2X7JA 5C8XA 1SC1A 2HNKA 3FNHA 3GI1A 3MERA 4MWOA 3SGLA 3T9FA 1OZGA 4XRRA 5F1KA 1U9CA 1U94A 1RBYA 3KZVA 4HWRA 4UHBA 2JVIA 4DCGA 3JU3A 4DLLA 1DKOA 2DTXA 4NTZA 5D00A 2PCLA 1P3DA 5JR3A 1ML3A 2J59A 2QL9A 2WZCA 2WYWA 5JCPA 1OIWA 2GTPA 2J41A 2ZUCA 1V71A 2NSDA 1G42A 2Y99A 5IJ0B 2AFIA 5BMVB 4AG5A 2I6GA 5JXWA 1M8PA 2BEUA 5HRUA 4XD7A 2ECPA 4RENA 1SCQA 2GWHA 2ZRAA 1L9KA 3SYTA 4GI2A 1TLFA 4B5KA 1VYVA 3AR3A 4P38A 4MKZA 3VH1A 4AF7A 3E3AA 3QNWA 2IIVA 4BX8A 5LQKA 4DDUA 4QNRA 4EMBA 2NVQL 4Z4QA 2EW8A 3H9CA 2B8JA 1I4EB 4K9KA 3T4UA 3N2EA 1SUWA 2JVKA 3G1WA 2ZTHA 1FMTA 2XUZA 4UEWA 1NYQA 3U56A 5DOZA 2PWYA 2PPVA 4R7GA 5D3QA 1BJTA 1ISGA 3N2GB 2GPJA 2BH2A 4KVFA 1QHEA 3PX2A 1XJ0A 1ZH0A 4DT1A 5ER6A 2YCBA 4K86A 4II2A 1RWXA 3K9CA 3DE6X 3LLSA 4BNJA 2XAAA 3JQDA 3IR5A 1WY5A 1HYBA 4GE3A 2VQSA 3S5JA 4YJ3F 1TUGA 3AI7A 1QHNA 3QVKA 4B7UA 3R7NA 1L7BA 1OWNA 2FW7A 1RE0A 1I24A 2ANCA 4II7A 3AR6A 1I51A 4G89A 1WD5A 2CXRA 4MKFA 5EHIA 1CDDA 3JV7A 3V2IA 5M2QA 1U9IC 3T5MA 2H4ZA 2ZR8A 3KWJA 1M0SA 4G1MB 2X4GA 3C4JA 2VR1A 4O8ZA 3VVLA 4B7AA 1VI6A 2NZ8A 3F4LA 4LYFA 4QU5A 3VISA 5JNWA 4D57A 4O2BF 1U0TA 3HFRA 3Q7PA 5IY0A 2CT8A 2P8SA 3ZHUA 2RI1A 4PZDA 2XITA 2P40A 4RJIA 1QGAA 3V8QA 3HCCA 3DWIA 1HDGO 4BVEA 1B74A 2FE1A 5BR7A 3PPVA 1E3WA 1R0ZA 2RC6A 3O8NA 5JADA 4EQ6A 2J6HA 2VCEA 4D4GA 1P4GA 3W77A 3K5IA 3EXHC 4QUEA 3RFUA 3V6MA 3ECSA 3KAPA 2J8ZA 3L5OA 4FK8A 4NICA 1SMMA 4N65A 4PC3A 5LOVF 2Y66A 3LX6A 5A1TA 1THMA 3L7KA 1MVOA 4QVIA 3SR0A 3QOFA 4FJ1A 1JEOA 3GTJL 2L42A 1P0QA 1H65A 5CX1A 2JLUA 1EM8B 3R6DA 3U4AA 3DE2X 1HF3A 1JYEA 3EXHB 3LLMA 3K70C 1IXSB 2O2XA 1CLUA 4TV9B 4URWR 3IOBA 3MEQA 4WY8A 3RVLA 5EP3A 3L6UA 1BN6A 1O5OA 4BZQA 2H2DA 2Q3BA 1HEIA 3U39A 5B1YA 2D1RA 3HAXC 1BVUA 4ZPXA 3GFVA 3K94A 2ONYA 2HTEA 2VBFA 3BXHA 3I4FA 1NW5A 1YRHA 4O2AA 4ENPA 5JZBA 1OXSC 3H3VM 1A77A 1QFJA 1K97A 2WG1A 4ENTA 2HU5A 2P75A 2VLBA 4MKGA 3R5TA 1BQEA 4NZ9A 1E5TA 3K70B 2QTLA 4OX9Y 3MTBA 2J1LA 3D7LA 1IPEA 1QHXA 1O54A 1TJ3A 1YK1A 2QUZA 4NX2A 4PYMA 1T3HA 2VDJA 1KQNA 1JFLA 4OBBA 3R5HA 1BKSB 1UFOA 4ZI2A 1Y7LA 3BJEA 2WAYA 3R3YA 5CCBA 1TAGA 3AQ4A 4L5YA 1XMIA 3H6GA 3T3NA 2ZITA 5LVAA 1VZ2A 4ZZ3A 3VVBA 1DE0A 1E7YA 2JIQA 1IY1A 2HX1A 2JBAB 5TMEA 1JQDA 3G0HA 2ZJ3A 1E7RA 1VECA 2K4MA 5LQAA 1O97D 1VJRA 1MN6A 1GPBA 2WV9A 2CFCA 2HPZA 2Z8YM 4KXMA 4RFSA 1N2CB 5FUYA 4E70A 4F2DA 3CE6A 1D03A 2O3JA 4RS4A 1VYTA 5I9LA 2GJKA 1IHUA 3TBFA 1P29A 1RKUA 3KUKA 5JMOA 4MCHA 1CNFA 3DLTA 3T3DA 3PUJA 5ESXA 1XVUA 3A8TA 3G2KA 4MZDA 1P7CA 2EFDB 3GLGB 4RIHA 3DVAB 2Y3IA 2A9FA 2WNHA 5LU8A 1A7JA 2IYVA 4JJEA 4OLAA 2Q6KA 4ZEOA 2M98A 2WICA 3B1KA 1G5TA 3KNZA 4RZ3A 3PFGA 5K3AA 4DSNA 2XQKA 4XKJA 2NVWA 2H2HA 1XL1A 2WWRA 5COQA 5BN5A 2XYHA 2LIPA 1O96B 1W4AA 4XPZA 5CB8A 1BS1A 4GR4A 3FYUB 1WCYA 3IJEB 4KQ9A 3UK7A 3CGWA 1YVUA 4PC1A 4UNIA 4OSOA 3EW9A 4KN9S 2G9NA 1Z4PX 3ZLBA 4FWTA 2YBEA 3VPBE 2FI1A 3EXIB 2FLKA 1SVLA 3OOSA 3Q7RA 1DAOA 2AKAB 4JYPA 3MBOA 5T4EA 1TJNA 3GU3A 5E3HA 5IHXA 4BO2A 1ZCBA 2P2ZA 1R4NA 4WT7A 1VHTA 2D4HA 1RPJA 2KBEA 2OG1A 3AIOA 2GVZC 2QD2A 2C4TA 2HWXA 3KTFA 4L57A 3PUKA 4A6XA 3O2QB 1YL5A 4LRUA 4ZXPA 2WM2A 4R98A 3WSTA 1C30B 2PE5A 4DCTA 3CVOA 2WT4A 4RLHA 9LDTA 3H9BA 1EI9A 3FRHA 3ISJA 5K05A 3C7KA 1S1CA 5CH8A 3NPMA 3FI0A 4JZYA 3DOHA 4MYCA 3X1DA 2VQEB 3PP8A 1CZUA 1T9HA 2HHLA 2NX2A 4OHBA 3ZWPA 4IVRA 3KQWA 2ZEJA 1KSGA 3WYNA 3ICEA 3GJ8A 1O9HA 4FFRA 4Q1DA 1DC3A 1KMNA 2O20A 2Q3DA 3KXLA 1JHMA 1REQB 3I04M 3AHGA 3MJFA 4ISCA 4C03A 4YRSA 1ZOSA 2DBRA 3I8SA 221PA 3VTZA 3KQYA 3M83A 3N28A 1H93A 2Q21A 2CUZA 4OPMA 4C6TB 3RSZA 4P54A 2PFKA 5EYPB 1ZJZA 2GLUA 4OHFA 4TQAA 3T06B 2B9EA 4LHVA 3G5TA 3E7WA 3UT6A 4D4LA 2QL7A 1VSVA 1E7QA 5I8PA 5BNIA 1X1EA 3MIIA 5HSGA 1F4VA 2W22A 1M5RA 4R8LA 2AXQA 4G65A 1GZ5A 1TJPB 3QWAA 1SVKA 2PPTA 3HU1A 4JKOA 4Y6QA 1PT5A 3EDMA 3ZCTA 5CXQA 3O9MA 5U1PA 1ISIA 4JWTA 5ISMA 4KXNA 3CW2A 3SX0A 2P9YA 3CEMA 5KYNA 1XLVA 2H3EA 3QIAA 5C9ZA 1EGQA 1JU4A 4QC2A 4PV7A 4U7PB 5T3UA 5I9BA 2HRBA 2Q1YA 3BDVA 1W35A 2BR3A 3EPRA 4B9AA 3RFCA 4Q9AA 1KHHA 2CSUA 2J5RA 1WM1A 1XBTA 4MK4A 5FTKA 1FX1A 4U9UA 1UMDA 2FN3A 4KPFC 7RXNA 3HS3A 3HCWA 3T5BA 2HLNA 2DR0A 2XUPA 1KS9A 1VE7A 3GIDA 3N8DA 1YK0A 3EFHA 1IN1A 4HAYA 3A06A 5BV8A 4PG4A 5ES3A 2Z58A 1O8BA 5D3MA 2K7FA 1EFPB 4TV8A 3AU9A 3FFXA 4RD0A 1TL7C 3OHPA 5B2ZA 3QE2A 3EBLA 3VUEA 3H2BA 4MVCA 5AW1A 2PSDA 5TMDA 2HSDA 3A7DA 4IJKA 2HEGA 1PFKA 1KDVA 2QLBA 4LYAA 1LK7A 1M2EA 2QTBA 3OU7A 3QQ5A 4I0WB 3O8QA 4KTVE 2XF8A 4RIEA 4BJ3A 1LPAB 1U2DA 1KYQA 3EXG2 3SSNA 4BPRA 4LE0A 1GTSA 4BRSA 1GPUA 5GOTA 3VNQA 4EKNB 2GTIA 1DEKA 2O3TA 1DAGA 1JFVA 1F12A 4DIMA 2HA5A 3GCGA 3PF9A 1RIIA 3QFFA 2IXDA 1W93A 4GR9A 3AZPA 1IEWA 1V16B 1S96A 1TZ2A 3EQ2A 4Z7JA 4YAFA 3GQBB 5JNTA 3VNSA 1S4MA 2EATA 1F5SA 3L46A 4D5GA 4O1HA 1SD1A 4C7VA 5F51A 1CK4A 3KOXA 3OCVA 1OIXA 5E4FA 3G79A 3DLHA 3PNBA 2Q0QA 4RF2A 4YI3A 1XJ5A 2ZWIA 4JP1A 4BC0A 4C2BA 4DNOA 1W94A 1A1SA 4AM8A 4BCBA 2BP7A 3IE1A 2Z1MA 2Z04A 4Z9FA 4GMDA 1V3UA 5GV7A 4M0KA 4DZZA 3QJ5A 2FF7A 4IG4A 3KLPX 3GAZA 2QVLA 2Z2JA 2YN4A 3K3PA 3FSJX 4X64B 5KSZA 1MJGM 3L49A 4G8CA 3FTDA 3QBVA 1KQ3A 1SZCA 1C3LA 1MIOA 3EW7A 2Q50A 3TS1A 3ZPXA 3AJEA 4TGLA 3UXEA 2JHPA 4FHDA 4FXOA 2AA3A 3B78A 2P35A 1NN5A 4DMUB 4HAOA 2HDWA 3IB3A 3KHKA 3QPBA 3ZLUA 1E0KA 3N8IA 3PLNA 3PLRA 5CDFE 1BG6A 4R0NA 5K3EA 4JMPA 1E0SA 1LF5A 1IZ8A 2VYFA 3B6MA 5KJCA 1YR2A 2RJOA 2YZ7A 5CDSA 5K6TA 5A06A 3FMGA 5SZKB 4OUKX 1NVEA 1LXCA 1Y8RA 2I7CA 1A71A 1HE5A 1MPXA 4BWGA 1H3EA 3BTOA 1EK5A 1H3NA 4MVJM 5L4LA 3V8EA 2GXQA 1Q95A 2TS1A 3THXA 2EOAA 3EGDA 3ZJYA 3OT4A 2GNOA 2TMYA 4GPTA 4F6RB 2DPYA 4HDNA 3L6RA 3DZHA 4B3GA 1XYYA 2EIHA 3FDIA 2C92A 3ELWA 3KZ1E 1Z07A 4EQ6B 3RWMB 1MR3F 2XRMA 4RL6A 1N3YA 2A88A 3LVFO 3ZV4A 4GRIA 4UBIA 1F9EA 2FPKA 3D3KA 1VG0B 2VHWA 3R9XA 3R5SA 2MSEB 3PQ6A 1PF7E 1T1RA 3SS2A 2A1TR 3HA2A 5AVVA 3EDYA 5JPIA 5FAKA 4I3HA 2QT0A 1EM6A 3WKAA 4AMYA 2BONA 3BERA 1ZK2A 4LUCA 4XFKA 3H13A 3WOHA 4LDQA 4Q3AA 1EVLA 4IV5A 2XSZD 1FRFS 1XD2A 2XRFA 4L5CA 3TLAA 5HIJA 2C6BA 3AXSA 3FFWA 3HEAA 4U0JA 4P5DA 2CCKA 2W48A 2GEFA 1JLLA 3L8EA 1KO4A 4JLJA 4ARVA 2ZT8A 1GFIA 4UD2A 4K0RA 2IHJA 4BMYA 1G5IA 3EXAA 3GDWA 4O2AB 1ADBA 2JASA 4EKGA 2VSNA 4JMLA 2I2CA 3KKMA 3UWMA 4DBZA 1K5PA 3O1IC 5DGDA 1NXPA 4TTIA 4U7GA 3RCBA 3SHTA 1EG7A 3V4LA 1X1CA 4K28A 3E4CA 3DEHA 4FGJA 3T4PA 3OF3A 4I50B 1CY2A 2YWGA 3P32A 4I3FA 3HCDA 4ON9A 2O14A 2OFWA 4QTXA 3VKUA 3I2GA 3LWPB 1F8XA 3CURA 2ZUBA 1X94A 2DAPA 3TW4A 4DCMA 5INTA 1NVBA 3LJKA 2WSIA 3CRVA 2YUTA 3SC6A 2LBPA 2GRAA 1SKYE 1KFBB 2X23A 5H9WA 2JIRA 2OGWA 2OCLA 3KU4A 3RFXA 3VR5D 2GHRA 4NPAA 2W2LA 2X0NA 4FEYA 1M2WA 2WUWE 3NIBA 4ZU1X 3PA6A 3WSVA 1SVNA 1XJCA 2PJRA 1XWWA 2FCRA 4GVXA 4H16A 1QXSA 4YMSA 4DIUA 4K9LA 1SXJE 4YT8A 3MJSA 2PX6A 4AR6A 1YIAA 2A86A 2WIBA 4MDFA 4EO4A 1LDEA 1ADJA 2HXSA 4I3GA 5JXJA 2FUG6 3MGCA 3QG5A 4XWKA 2TSYB 4DN6A 3IE0A 3A1SA 2ASEA 1RCFA 4DILA 1J0CA 2Q3EA 3MQ2A 4H0CA 3C0KA 5JZVA 4N76A 1HLGA 2QN8A 2J5XA 1B76A 1FDRA 5DHPA 1UKVY 4I2VA 3P2OA 4ODIA 5L8VA 3T7JA 1OTYA 1QX4A 1B26A 2DH6A 4KQMA 2O4CA 3R0QA 5LFAA 4R1TA 2C2WA 1J2TA 1U99A 2SKEA 2YQ4A 2XKKA 4CT5A 1RQ2A 3D5QA 3KDAA 4YT4A 2P9BA 2W2QA 2Q2VA 2QX8A 3JQAD 3PJDA 1CVIA 2QRGA 2B5OA 4H60A 4XUCA 4ER5A 4ZHSA 1XZPA 3KJQA 4OSPA 1ZVQA 2IYNA 1TM1E 3F7MA 1P1HA 1DT3A 2I6QA 1NVVR 2JD2A 3FCCA 1RHQA 3JQQA 2PMCA 3RYHA 1VJTA 4LJAA 4PU0A 1LSSA 1Z8NA 1VJ5A 3GTPL 2CDBA 5CA1F 2AZ4A 4Q3LA 2ZCJA 4PYIA 2VYND 3HKCA 3RAEC 3EWSA 2W6PA 3C74A 5JU6A 3A37A 5FI3A 5K4HA 1QO0A 4KZKA 2BFAA 1VPVA 1QF9A 4FZVA 4B85A 4MQMA 1KAQA 2O50A 2G70A 3DD5A 2ODPA 2BMDA 3IUBA 4PCVA 5CNIA 1NATA 5DV9A 1FLAA 1U6JA 3BL6A 2C8JA 3H8VA 3QHQA 3QKRB 3V8BA 4YUYA 2IELA 3OFJA 2D1QA 2W7TA 3OZBA 4TTQA 1PUIA 1P1JA 1RAIA 1U7OA 4KXQA 4XA8A 2QLNA 4WZAB 3I1YA 1FU4A 1WEKA 5FOXA 3MGGA 4N6GA 3WLSA 3OZ7A 2G80A 3MGKA 4DYHA 2QZPA 1WHSA 1VHJA 3DE5X 3LC0A 3Q9NA 4IIBA 4DQ0A 2W6CX 2NQ2C 3JQGB 5AVQA 4DLZA 3AY7A 4GMKA 1CJVC 4QUGA 2R44A 4DG8A 3TKAA 3GQVA 3JWJA 3R5JA 4HUJA 7ABPA 2V6BA 3VPBA 1RYMA 2YMLA 2YYSA 4E5UA 5IEJA 3AR9A 3T9BA 3V1KA 3K9WA 2I8LA 3OZUA 3RABA 1GGHA 2V5VA 2WIAA 3O38A 4G9BA 3ZDZB 4REOA 3L93A 4TLDA 4LTNA 1OAOA 3GV0A 3DA8A 4ZDWA 4EMTA 4NXMB 3E70C 4AUMA 1I6LA 1RI5A 4I9UA 4XCQA 4DQXA 3T35A 5C7IO 3FOWA 5HRCA 2GFQA 4PIVA 3EULA 4MB0A 4TMXA 2VUTA 5AKYA 3M6VA 2H5LA 4D98A 1LBQA 1PLJA 3GTGL 1YRWA 1JJBA 4ZARA 5IULC 1EFVA 1OXMA 3MGAA 2DGDA 4BBZA 7YASA 2EQBA 4K9RA 3BQMB 4LE1A 1KVTA 5EWLB 3UJ6A 4B8WA 4OB6A 4IRXA 3RKUA 2ZU0C 5I4KA 3BULA 4C4RA 5ICFA 1A8HA 3H86A 3HDVA 3KEOA 4AYXA 4WTOA 5KVVA 3DZGA 3UJ3X 5B58C 3BRCA 2C3PA 2LCQA 1PEKE 3GJ0A 5DTJA 3WGGA 5L53A 1U2DC 4UNSA 4OI2A 2R4TA 5T4FA 4MV4A 3PUYA 2E6KA 1W5TA 3S14L 1Z68A 3SDZA 4D4HA 1UJ5A 2QJOA 1QH0A 1RM4A 2EGHA 3C4QA 3AYXB 3PCXA 4H27A 4HUQA 4TV8B 5GM1A 3EOZA 4WD3A 2CNOA 1Q57A 2RONA 4J6FA 4CG3A 4MA5A 4ZOLA 3FUCA 3MTAA 5ITZB 3PNVA 4TS3A 4DQKA 5JBNA 3LM8A 5AK4A 4IIHA 3ZXXA 4FCWA 2HBQA 2B3DA 2P79A 1NU6A 2DQZA 4FFBA 2JHGA 5DYNA 4ZAFA 1D0SA 4AN1A 4BMNA 3GJSA 1R8YA 4B48A 4YP6A 3SYRA 2WD8A 4Y2HA 1WTCA 3RS7A 2PWAA 3BJRA 3TVTA 3IIJA 3JAKA 2B4YA 1AY0A 3ICOA 3KZCA 4FC7A 1LSOA 4D6YA 2UUCB 1U7PA 3SS7X 2W71A 2OAQ1 3PV0A 4LHSA 4BRZA 3X0DA 4NJOA 5KI6A 5YASA 3I23A 2PTHA 3OPXA 5IT9A 5COAA 1NW9B 3FG9A 2CLLB 2ZYHA 1QBKC 1XTIA 1DKLA 1JI0A 4M9QA 2VRBA 3KCQA 3VPAA 4D9EA 1VHLA 2QVYX 3NANA 4XQGA 3ZBTA 3KQHA 4KNYA 4TRNA 4DQUA 4ZCTA 5DM70 3EVNA 2CWWA 4RJLA 3DB2A 1MTOA 4I8XA 3ZDRA 2Q9UA 2XUDA 4KQ6A 5J63A 4E2WA 1AMNA 2N47A 1O89A 3KZKA 2PIDA 3BAZA 4LSMA 3TCXB 1XNQB 1ZONA 5DKFA 1CUGA 3GROA 1QP0A 3M6UA 3DBLA 3MCUA 5JYEA 3EVFA 1YDMA 4NENA 3K09A 1KK1A 4DSTA 2CE2X 3P9YA 1BE1A 4BBRL 4J43A 2WT8A 1E1QA 3I4ML 3JWGA 4H1UA 3ZXYA 4LI0A 4UM8B 4JQSA 2VHXA 2FUCA 4FGZA 1Y4UA 2IHYA 4NE7A 5C5CA 1V6SA 1CJKC 4YRLA 3IVCA 1Y8RB 2W6OA 2IDMA 5FWYA 3KL2A 4KKXB 1O5IA 3P45A 4YACA 1FTGA 3WVNA 9MHTA 5B37A 1TU0A 4YO8A 2IODA 2GK7A 5G0TA 1TUEA 2JPDA 1L0BA 2C61A 3EGDB 3BIJA 1WMEA 2OBMA 4JITA 4II3A 5CA0A 3JVDA 1CR2A 4UPVA 3ZV6A 4B31A 3GA7A 3LBFA 5J4KA 3IA7A 3RNOA 3CYFA 3S81A 1TOAA 3SXPA 2P6UA 3VC3A 1C7FA 3KV3O 4XM1A 1UBGA 3R0IA 4OGLA 3G0BA 1SZPA 1I3LA 1X7XB 1JHUA 3BEOA 1ELOA 5CDFA 2VDPB 5EMNA 3NC0C 5FLYA 4A0GA 4R71A 2V6FA 4ZWNA 5BURA 1AN0A 2B1QA 3NTQA 4AKSA 2E5WA 1CWUA 1KK3A 4MI1A 3TJMA 3A04A 1B0ZA 3WIDA 2C5FA 3MMXA 4TLBA 2H4HA 4R01A 3TUIC 1SG9A 1BS2A 5JSQA 2VNAA 4K3VA 1D4OA 3CR7A 3IEPA 4M53A 3PLAE 2VSQA 4A4DA 1CQPA 3WKCA 2QL0A 1EDBA 3KR2A 1A9XB 3LUDA 1JPUA 1SUCA 3MS4A 4LSZA 3VSEA 1MRSA 1JLLB 1GUAA 2F1HA 3EASA 3A2NA 3G49A 3WZLA 4MZXA 1Y5IA 1FNCA 1NGSA 1OR8A 1XA3A 3DS8A 3LZ6A 5D8DA 5CEFA 3RSQA 5JH7B 2XBMA 1T5IA 2AJCA 4BGUA 2ZIXA 1BWQA 1JALA 1RBZA 3EGVA 2PVXA 2H5IA 2E48A 2MIIA 3IBCA 4HRVA 5DM4A 4EYGA 1Z5GA 4AVYA 1C0KA 1ZUNB 2XVXA 1OA1A 2F6RA 2VJCA 3C3CA 3NHZA 5DW0A 3LD9A 2VSFA 3GRPA 1GG9A 3J7AC 1ZRHA 1XK6A 5FOTA 3N2LA 2AKEA 4LY9A 1SRRA 1RWBA 4WOPA 2BI8A 2A5JA 2C8KA 5AR1A 2RBKA 5A02A 5K0GA 1N1GA 2OYRA 3AM1A 1NZFA 2C1EA 3H5WA 3LXXA 3DMDA 4R8MA 5DCLA 1PZEA 3DPUA 2O3SA 3R2JA 1C9KA 2Q2NA 3A36A 4FDAA 4OTZA 4S2UA 4WESA 5H80A 1XT6A 1RXUA 3EQ8A 3KKLA 3QM1A 1KRXA 2NSLA 5H59A 5IPFA 2FKNA 1GQYA 2JAUA 4AB1A 1PFYA 2W11A 4CYMA 3W2FA 4BLTA 3V3TA 2M6OA 4I55B 1CXZA 2BCGY 1HURA 3FHCB 1ONBA 4M49A 4JEUA 1J21A 1F7VA 3M3PA 4J7XA 2OMKA 2VOJA 1PJCA 1UC5B 1WTAA 2ORIA 3AGQA 2ZB4A 3JQAB 5TE9A 4EF5A 3RT9A 2ZE7A 2ZGVA 3AHFA 4UREA 4X61A 2YU9L 5AJUA 3QWFA 8ATCA 3U09A 3TLMA 3E3NA 3EZXA 4TLEA 5GIOE 2NXJA 2FMKA 2PZ8A 5JXIA 1JKJB 1YQEA 1LNQA 2IH4A 1UJNA 2NVOA 2X22A 4RGVA 5REQB 1DUVG 4PE5B