5MFZA

Human sirt6 in complex with small molecule ubcs40
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
282
Chain Sequence
PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mfzA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mfzA01
2H59A 5MGNA 1YHYA 2OORC 1Q17A 2H2HA 4GG1A 2IHTA 4K9OA 5FEMA 2HJHA 4GP9A 1YI1A 4IG9A 1Z8NA 4V1CA 2PGOA 4C78A 4G1CA 1U2DC 5EJ7A 4GM4A 4C7BA 2JI7A 4FEEA 1ZPDA 2H2GA 2VBIA 3GLRA 5EJ6A 1SZCA 3GLUA 4ZP1A 4I5IA 4UU7A 2Q5QA 1YC5A 2EZTA 3CLUD 1NM5C 2OD7A 4MPJA 4BN4A 1PYDA 2Q5LA 4IF6A 5BWOA 3HWX1 2PGNA 2EZ4A 3GLTA 1POXA 1MCZA 2FSVC 1YNOA 1SZDA 4UUAA 1J8FA 1YBHA 2OD9A 4ZZIA 1BFDA 4F56A 1OZGA 1S5PA 1PTJC 2JI8A 2EZ9A 2A1UA 5EJ8A 1S7GA 4K9QA 4UTRA 3F6EX 2VJYA 5MF6A 1YTLA 4JUAA 4J16C 5IMSA 4MPPA 1O96B 5DGTA 1DJLA 2QQGA 5EJMA 2B4YA 3HWWA 5FYQA 2Q5OA 1D4OA 4FEGA 4QELA 4Y6QA 3ZGOA 4BN5A 1T9BA 3U3DA 1V5GA 5AHKA 4UTZA 4D5EA 2H4HA 1OZHA 1HZZC 4QPZA 2A1TR 2Q28A 3CLSD 4GPEA 5K3SA 4BVGA 2VBFA 5EJAA 4L2IA 1U28C 3JWPA 4K9MA 1JSCA 4RMHA 1EFPA 5MFPA 4KPUA 3PDHA 2BRUC 3D7KA 5EJ5A 4V1CB 4Y6OA 4BVHA 4BVEA 2QQFA 2NXWA 2PANA 1Q14A 4BUZA 2VBGA 3FZNA 4RMGA 4TWIA 1N0HA 2UZ1B 2VK8A 1E3TA 4QQ8A 5BWLA 1Q1AA 1PNQA 5K2OA 2IHUA 4RJKA 2OD2A 1M2NA 4COKA 3CLTD 3D4BA 2VK4A 4RMIA 2DJIA 2EZ8A 1OZFA 5K6TA 3EA4A 4JUBA 4JSRA 3LQ1A 2OO5C 4UUBA 4JT9A 5K6RA 4Y6LA 5EJ4A 1V5EA 3U31A 4HDAA 5DEIA 2WVHA 1M2JA 4UTXA 3JR3A 3F6BX 4JUFA 2H2DA 3FLMA 5BWNA 3CF4G 3OE1A 4JD5A 1UPCA 1Y9DA 4F4UA 1OVMA 1T9DA 2FRDC 4JT8A 2X7JA 1POWA 2W93A 4IAOA 3IAFA 4RJJA 2H4FA 1M2HA 3CLRD 4K9PA 2FR8C 2C31A 4K9LA 4D5GA 1PVDA 4UTNA 4BVBA 2FN3A 2V3WA 1T9AA 1MA3A 2H2FA 3EYAA 1UPBA 5EJ9A 1UPAA 1ICIA 4RJIA 4MZXA 1YC2A 3IAEA 1QPBA 4JU8A 3ZG6A 3D81A 2JIBA 4FVTA 1M2GA 1XLTC 2AG1A 4J1TC 3EY9A 4K9NA 2Q29A 2JI6A 2VK1A 1PNOA 2EZUA 2UZ1A 4BV2A 4X3PA 3ZGVA 5DGDA 1O97D 1YHZA 4TWJA 1Q6ZA 1YI0A 2AG0A 2H4JA 4R8MA 2H2IA 2WVGA 4L3OA 2JLCA 2JLAA 4MPRA 3K35A 4GM1A 4BV3A 2Q5JA 4GM0A 1M2KA 4UTVA 1U2GC 5D7NA 1U31A 4V1CI 3PKIA 2NYRA 1T9CA 3GLSA 4JU9A 4O8ZA 3E9YA 4BVFA 2WVAA 4HD8A 4JUDX 4K9KA 2FWNA 3RIYA 1PT9A 2IHVA 4KXQA 4MQ5A 1V5FA 4JUCA 3RIGA 4UU8A 4KGDA 4Q9DA 4RMJA 3FSJX 3PKJA 1EFVA 2Q27A 1PO7A 5MFZA 4FZ3A 4X3OA 1PI3A 2JI9A
chains in the Genus database with same CATH superfamily
3LSTA 3MPOA 1XMQB 2VF8A 3A2LA 3KD2A 5KIAA 2ONKA 5EWLA 3BKXA 4LWQA 4BNWA 4K9OA 3FHJA 1SZPA 4C4YA 1OWBA 2WQ7A 4ONEA 4DA8A 1YJ5A 3R7WB 3GVIA 1H6CA 3EIHA 4BLPA 2D1SA 2ODAA 4I50B 4MWTA 4KQ1A 4LCBA 4ZODA 2ZITA 3V8EA 1LDBA 2CHFA 1N5DA 2RGEA 2XA2A 2XCQA 4LDJA 1KK3A 1ZD5A 4X84A 2WJ6A 3BQNB 4E12A 3IA2A 4DJDC 4QDTA 5G40A 4YWHA 2XCRB 4C7BA 1UC4B 3CVWA 2I6QA 1WUKS 2ZRBA 3QKWA 4GXQA 2O0LA 2WUGA 1IBSA 4EEKA 3BCRA 5M5YL 3OUUA 3SHVA 4ZDKA 4ZYLA 1WL8A 1UBLS 3PJRA 4FDVA 5TLSA 1UMBA 4ZV9A 2W6QA 3EVBA 4OSPA 3PU6A 1BDIA 1UJMA 3R3HA 1CR1A 1AQYA 2ZIUB 2RC5A 3I5YA 1KARA 4W82A 4B43A 3PR1A 3LSYA 2QY9A 3EAQA 4PCUA 1EGAA 3LLMA 3KYDA 3ONEA 4M6WA 5E6RA 4CCYB 3WWLA 1OX5A 4LHLA 3CW8X 2CFSA 1UJNA 2XIJA 3P9XA 4NK5A 1X7ZA 4OXKA 4P4SB 1E2IA 4N7JA 4NYMQ 2NU6A 4RDXA 4NMHA 4MRRA 1MB2A 3ZDXB 1H4VB 1KH3A 2A0YA 2ADFA 2P9CA 2BEUA 2YNMD 5DX8A 2EY4E 4ZT4A 1KZ9A 1J09A 4R2XA 3VHXA 2ZRMA 1HYQA 2XCUA 1OPXA 2MSEB 1MCZA 4NENA 3NDJA 4Q4AA 3JWHA 4MV5A 3MWYW 3SZOA 3AHHA 3G2MA 3NEPX 4MGIR 1N2EA 4MICA 2IPOA 5FYDA 2XR1A 2QQ5A 1F9AA 3WL3A 2B9VA 1U2DA 3B5JA 4K05A 1S0UA 1VFNA 1YCHA 2GZHA 3O6VA 1J25A 3VV3A 5BMOA 5J4LA 4BYGA 4F56A 1PGOA 1P9OA 2J3DA 4RK7A 3ASYA 4B4KA 2LNDA 1QF7A 121PA 3N70A 2DHRA 1Z2AA 1S1CA 2JI8A 5HEKA 2YHIB 1OC2A 2C59A 2H1RA 1F6BA 3GNTA 4NZZA 1HV8A 3DHWC 4QXOA 5EXSA 3UJBA 1AXRA 2ZB3A 3ZQ6A 3E53A 1Y8RA 4BKRA 4C6HA 4DV2B 1URPA 1XF9A 3I5MA 5IXYA 1YTLA 4HWGA 3C8DA 1QGYA 4QLAA 4E3WA 2WMDA 3C6QA 3EQ7A 5CH3A 5B1SA 3M0EA 1I1NA 3JW8A 2GM3A 1G98A 4JYBA 4YIHA 2I6UA 2ZRPA 4BFVA 3DEZA 1DJLA 1RHUA 5CD1A 5BQPA 4E2ZA 5IFLA 1XZHA 4NATA 4QT4A 5CA0F 5EJEA 4HR7A 5GJCA 3AF2A 2FW0A 1W44A 3WIUA 1RYBA 4V39A 2V0EA 1Y9JA 3SIPA 4A93L 4URWR 2HY7A 1MV8A 5HW0A 3AEUB 4LX8A 1TIKA 1NGSA 2PSSA 3SDBA 2OAGA 4XIJA 5HF8A 1X1DA 3V8MA 2Z2JA 1RWPA 3BGWA 4I3GA 4AI3A 2QVCA 3EHEA 2G04A 1MT3A 4UCQA 1YJ8A 3FXAA 1Z5PA 1JAYA 3E7WA 3G5UA 5JECA 3GH1A 4ERNA 1UBHS 3G79A 4ITVA 1DBSA 1UKAA 4K9SA 2CLEB 2IODA 3DDWA 4GPD1 4KN9S 3JYPA 4MW2A 1PU2A 4F3CA 3V4OA 3U9LA 4F2GA 1SQFA 2C04A 5JNWA 2H9YA 3W6PA 1BGXT 1E2BA 4KXLA 4OP2A 4UQOA 3E0QA 3F3MA 1J07A 4ND7A 3CKMA 3TJZA 2NVYL 2VSYA 1GA4A 1W0CA 4CF6A 4OMUA 4AICA 1KI2A 4KQ9A 1QH0A 2QTAA 4MV6A 1O8CA 2QVLA 2VJCA 4X6YA 1B16A 2AC2A 3AJEA 1R0RE 5EJAA 4BNDB 4DC1A 5J2TB 4C08A 2JG3A 5BN5A 4FGLA 2E21A 4NDAA 5JZMA 4YP9A 3L4SO 2K5UA 1FP4A 2HSJA 3NRJA 4TZTA 3WYDA 3GMSA 1P5FA 3Q2KA 3HG7A 4L73A 3JQ9C 3ZWBA 4LXXA 5H1Sc 1K7CA 3NX4A 1SM4A 4PG5A 4XGNA 1G2OA 4DR1B 1Z6TA 2PQ6A 5FCDA 1P6UA 1NZFA 2AD5A 3BE6A 2EQBA 5EXDA 4RIEA 4RVUA 1JFTA 3A11A 1CR4A 2AI1A 3ZCXA 4IIJB 2BCGY 3PPIA 5G2OA 1LBIA 1QQAA 2BGNA 2PR2A 4Y0NA 4ZEOA 1WULS 3GTJL 2NZVG 4J7XA 4V0ME 1KFBB 3VTZA 3UB3A 3ROFA 3H3XA 5EE9A 3F3SA 1BQ9A 1RPTA 2P91A 3A4TA 1E6KA 3BRWA 1XCJA 4IRMA 2HA2A 3UICA 1XVAA 2FW7A 1I7PA 3B9RA 4C4SA 4CL0A 5A4FS 2X41A 3QXXA 1Q50A 5EIBC 4Q9AA 1WHSA 1Q7EA 2G72A 3F0TA 4CM5A 4HB0A 4N7MA 5H02A 4MV8A 2GM4A 2VDVE 5FTLA 5L4LA 4QPPA 1EP3B 2FF7A 4EO7A 5ARBA 1MJGA 4XE5A 2A3RA 3G2KA 4NQZA 4KW7A 3FTDA 2D2VA 2ZAIA 1YK0A 4GVLA 2PUWA 2ZBRA 1N4AA 5C81A 1GTSA 1ZWLA 2HF9A 2GPYA 1OQAA 2OV8A 3L8HA 4D9NA 3BFPA 4GLFA 2PKCA 4MQFA 3EC7A 1C7JA 3GBPA 4EHIA 4HAWA 1XC7A 1OV6A 1WDWB 3BL8A 5JS7A 2BE9A 2VG8A 1UDXA 3H1EA 1ECCA 2QYTA 4I9NA 1ZM3A 3U3KA 4E31A 4IP0A 4ALLA 4YONB 2BEWB 1HETA 4MVJD 3F47A 1X1TA 3S2UA 2XZLA 3ZGZA 3IRVA 1VMKA 2XJTA 4YJHB 1K8XB 2CC2A 5DB4A 3I6MA 1WZIA 1R6DA 1VKRA 3H6HA 2AQ8A 1QLJA 1Q15A 5L3RA 4LHNA 3H5OA 1YIAA 2CBXA 3ZOKA 1JN0A 1F4LA 4X5OA 5K5EA 1W6UA 1B8UA 4MR7B 3QHPA 1TWCL 1VXRA 3EBLA 1F0NA 4D97A 3AVOA 3Q6MA 1M2EA 2O54A 3PQ8A 2BBSA 2DJIA 4KQFA 4WJZA 2OCPA 4L27A 2C88A 1XCGB 2LVBA 2RK6A 3U3OA 4XM0A 4R9VA 3B1WA 4YRRA 3OMLA 3BG5A 3V2GA 2XQIA 5JH7A 3DM5A 3JYQA 1BHJA 4MVJE 4YVFA 4PNEA 2ACWA 3CNEA 2G1UA 3SQWA 2VT3A 1LFAA 5F9HA 5DI9A 3AK4A 3RS3A 5C1BA 3FNRA 1QH8B 2R2GA 1L6IA 1HEUA 4MW0A 2BZSA 2WFZA 5K9ZA 4XGHA 3WB0A 3SYNA 1TVEA 1PG5A 1W4RA 5JWHA 2AOTA 1RVDA 3IB6A 5ALNA 1Y1VL 2WYUA 2A57A 1W5BA 2EC5A 2DCUA 3DXFA 3UBMA 5DHUA 4CMAA 3FUWA 3OJLA 1NVBA 1ENYA 2G9VA 2ZP1A 1IU9A 2ZB7A 5ICGA 4UVGA 4OH1A 1N9KA 4X6AL 4X3CA 2WWYA 2P67A 3DKPA 4LRWA 3TM4A 4BKPA 4ZMBA 1BA2A 2R5WA 5ALWA 1J8VA 1GNRA 2VTEA 1P18A 4L9SA 4MW4A 1CJTC 1ND6A 2GILA 2IDZA 2SKDA 2GAFA 3IJ5A 4XWAA 3NR2A 1SQGA 1RLMA 2ZOSA 2EERA 3BT7A 4DYHA 1U6IA 2ZTSA 2DRIA 3R24A 4CRWB 3IGFA 4XDZA 5JTUA 2GCPA 4FGZA 3P5BA 1M6VB 4DZZA 4QD3A 4OQQA 2M1XA 3AP3A 3QOYA 1QAQA 4AJEA 2ZUFA 4JT8A 2JGKA 1N8SA 1USVA 2OGUA 2X22A 4LE1A 4PX5A 1USWA 1INLA 5LBUA 3TNFA 3VTAA 4D4IA 1B0PA 3LG2A 4HH0A 1BKDR 2AZMA 3UANA 1R37A 3PFIA 4HJRA 1AUOA 2ZRHA 4E5KA 2ONJA 3H11B 3BBLA 1YDMA 2QLJA 2AC4A 3V8BA 1O87A 1PV2A 5AI9A 4RA9A 3MHTA 4POGA 1X8KA 2ZJ0A 2YWHA 4CEJA 3IJEB 4FT2A 1Z83A 2ZYIA 2NAFA 1U4SA 1CQXA 2YYYA 3KT6A 5FOSA 4YRLA 5FNZA 5LDGA 3UJHA 2SCUB 1YQXA 1G4UR 2PS9A 3BGVA 4FONA 1YFLA 1T0JB 2DBYA 1ODIA 4AR4A 4BQRA 4RXNA 2VNHA 3I01A 1U5BB 3ZNNA 4OYLA 2AFHE 4OQZA 4ZOEA 1EDEA 1HKHA 1XDWA 2X6TA 4AKTA 4BCDA 2V0GA 2P4QA 3RYTC 9LDBA 1Q0HA 1GU1A 1QTRA 3KDAA 5FV7A 3RUHA 3IUEA 5CW2A 2G40A 2VAPA 1OASA 1REQA 4BVBA 1GO2A 2DPMA 1IOWA 3QE3A 1VP9A 3QKTA 5FB3A 2GD0A 3WFZA 1ZR2A 1E9DA 1U0OC 2QRHA 4QNMA 3IOMA 3RE1A 1MB9A 3ZD7A 2QSJA 3AB7A 3NGMA 4YGXB 3SIWA 3U1TA 4Y9DA 1NRXA 4B4WA 4EG1A 1HMYA 1TOAA 4Q0MA 1SVMA 3BFJA 4EOGA 1DTSA 2PGIA 3K7AL 3EFHA 4K6CA 2OHIA 2LCIA 1U0BB 4MW5A 4EYKA 3QXHA 2DHQA 3O7MA 4Y2QA 4EFNA 2HMAA 1M3SA 3KZNA 2V6JA 4P3YA 4CF5A 1ID8A 4OGGA 1XX6A 2XGMA 4NXMB 1H3NA 3GK3A 3IT2A 3QLEA 4I99A 1L8AA 1XRRA 5BNWA 1E6WA 1AN9A 2W00A 3EGXA 4R2HA 2P2LA 1JB9A 3MSUA 2JZNA 4INPA 4XJSA 5FA5A 1X7HA 2SKEA 3O8QA 3WLLA 5ETJA 1FRNA 2P5YA 4O4LB 2C97A 2EKZA 4LRTB 2IBSA 1ZHFA 3VKWA 4LYYA 1NUQA 4HDCA 4JAFA 3C8ZA 4G86A 1O5OA 3GLFA 1WLSA 2HPHA 2IEBA 5LB4A 4B3XA 1LBSA 2BP7A 3C5CA 3NO4A 4DM4A 1QQTA 5C5EA 2W2QA 2E7ZA 3O4RA 3R5HA 3VFDA 3RS4A 4QBFA 4PR3A 4V3BA 4BO3A 1PJLA 1KJ9A 4DLXA 3TNDA 4WZBB 3PSHA 2ZU6A 5KKNB 3PWSA 1RLOA 1KKMA 4EENA 4GWGA 2GVZC 4K8RB 4QPNA 3S2ZA 5JALA 1Y6GA 4JHXA 5ITWA 2Q29A 4JBYA 4JAVC 4EZIA 2JI6A 2YN4A 4G4SP 2Z56A 5E1OA 4HQLA 1KO7A 1QG0A 1ZM4A 2EU8A 2W2TA 1SUAA 3WLEA 1DC5A 5AW1A 1FMCA 2VS1A 3WDKA 2P3QA 1C3OB 4CGYA 4O2BB 4LY9A 4ZALA 3AZPA 3OCWA 4AM8A 2FZ4A 4JJKA 4S04A 3CCCA 1QV9A 3IUMA 1IZ8A 4IMRA 1WUYA 4FLMA 3BS4A 2RC6A 3O4GA 4CDNA 3VYVA 4UPDA 1ZHOA 3UV7A 4LDRA 2H0RA 1M8GA 3CBGA 3H0CA 4YCBA 5JFGA 4N6NA 1H1DA 2XDAA 5I9NA 4ZCQA 3ILXA 1YI0A 1Z12A 5JV5A 2FFAA 4NAVA 1OWNA 2PRKA 2PT9A 1Y3AA 3K05A 5DASA 3RTCA 4YT4A 3SYKA 1GZHB 4XVUA 1K1EA 4L3OA 1WB4A 3AF3A 4G3XA 5JVDB 4BKOA 4CKWB 3D6AA 2ILTA 1KSFX 3B8HA 5CJJA 5I7WA 4C6TB 1OB2A 1QJCA 4LQDA 3FBTA 4RKWA 4QDKA 3DCIA 1NX6A 2QVZX 5D3ZA 5L3ZA 1X3LA 4CM4B 3HKBB 2BM1A 3N1UA 1BW9B 3O7WA 4JIGA 1QC5A 3QIAA 4EKEA 4YWJA 3ZC3A 3OOSA 2FJUA 5L9AA 5DM1A 3KQUA 3OWXA 4XPIA 3N0RA 2B3DA 1NNI1 1VA4A 2MSNA 4TXNA 1CF9A 3AERB 3CA8A 4XUCA 5EJ2A 2B1JA 1BD4A 5FBLB 1BHSA 4RE6A 1ZH8A 4LI0A 4ZN3B 2BCEA 4G8CA 1VL0A 1SVSA 2HQSA 4X1IA 4ZT7A 4LVCA 4DA9A 3KB1A 4DSTA 2RDVA 5AVRA 4BVFA 4YCLA 1GAXA 1ZAKA 2PFGA 1QVRA 4P7GA 3PT9A 1KC1A 5DBOA 4PN3A 1RCFA 2KPOA 4EPWA 3QW2A 1GTJ1 3H9EO 5EE1A 4FDAA 1P1BA 3SGLA 2R4UA 1W47A 2JEZA 1MN6A 3WHPA 4G0NA 3P0JA 1YIDA 1V5FA 1ZY2A 5ELXA 2NACA 2RFLA 2VP6A 3ICWA 3SS7X 1C3EA 4M36A 4MTCA 5HE9A 1C0KA 2EBHX 3G59A 3RKUA 3WS7A 1HSOA 1JHMA 1KF0A 3HCBA 2EEPA 1E2NA 1EM8A 1PL6A 1S2DA 4L6IA 3R9WA 4BGEA 5JNRA 3QTBA 2W90A 3OFJA 2Q3DA 4YMSA 5H82A 3VPSA 4NVRA 3L3BA 3IMFA 3UHPA 2NU8A 3BGDA 1V7CA 1A9SA 2C9MA 3H17A 3G0HA 3NOVA 2FFQA 5LP1A 2YXDA 3OIUA 5LMNB 1MOSA 1EFVA 1KIFA 4IUBS 3U48A 1Y4ZA 1ULTA 2HI0A 1PD0A 2CXUA 3IIKA 1N6RA 4DDTA 1NUTA 1ILEA 4ZEVA 4JBIA 1N6OA 4XQGA 3SLRA 4TLAA 3CQ9A 3BE5A 4ITUA 1JU3A 3T5DA 5M29A 3FGNA 5TVGA 4AHWA 2XT9A 3KYBA 1THMA 5IYCL 5TGZA 3QVUA 4HLUA 4CCSA 1IPEA 1TUEA 2O05A 1EFCA 4LA4A 3BDAA 2GOYA 2H2HA 1CYEA 1R10A 4LYGA 4IVNA 2XWSA 4DDHA 2QKYA 3FLAA 4HQFA 4Q3NA 1HBJA 3O8DA 4G0UA 1TC2A 1UOOA 4Q9NA 4OHKA 1OAKA 2YW9A 2A1TS 1MF7A 2J8ZA 1A9OA 3E1GA 3L77A 4CM3A 2A6HD 4PZ9A 2QE7D 2YZKA 1VMAA 3SHFA 1PR2A 3UJ7A 5C2JB 1IXZA 2ZJ5A 4HAVA 2CVQA 4KNYA 3L2OB 3NRBA 3U44A 2XQJA 5EJ7A 4RD2A 3R0VA 4V0KA 3TZBA 5L7YA 3HDVA 1JUDA 4KMRA 4DREA 2PMZP 3VQTA 4CWAA 3DLIA 4ZI5A 1RHQA 3DDOA 2R8PA 5AIAA 3JRXA 3K32A 1B26A 1H0RA 3R6DA 4X60A 4RZIA 3I6YA 1KXJA 1NXOA 4GBGA 5C8YB 4AF8A 4MVJP 1Y48E 2CJXA 4MVJF 1UJ5A 5AJXA 3UN1A 2QLMA 2OLJA 1F4PA 1F5SA 4K6KA 3R75A 1F1JA 3B1JA 3EC2A 4OB8A 5EIOC 5M3FL 2Q5QA 2YUTA 3M4ZA 3OBIA 3ODGA 5CX1A 4AKSA 3S5UA 4LXQA 4REQB 2ZJ2A 3JQ8B 1PJQA 1VBFA 2WJWA 5TDHA 1KTVA 1VCMA 5IANA 2OXCA 4WK4B 3MCVA 1AY0A 4GOND 3TEFA 5F12A 5IJWA 4D45A 3HP1A 4A2WA 2JEYA 3EUEA 1EK2A 1G3QA 2WWGA 4X54A 1DIOB 3AY0A 3IEUA 3KYIB 1KI8A 2BM0A 4PGFA 4WESB 3WNZA 2PGNA 1IQUA 1GTVA 3OKAA 1CERA 1E1QD 5ALGA 5JCJA 5B1EA 4ZXPA 5IT5A 2XVXA 1PGNA 3EAGA 3IA7A 1ZM9A 1DAKA 3MLEA 4C1NA 3TSCA 4DNPA 1M1YE 2FTKE 4EUEA 5TEVA 4MVXA 2R1TB 3VR6D 5IVDA 4F91B 1EUYA 2EFYA 4RF5A 1U7TA 4BZQA 2IYEA 4ZZIA 3CUYA 5CCBA 3QNUA 1T34A 3OF2A 3U3XA 5SZHB 5H3HA 5K6AC 1YULA 4HDMB 2DBQA 4HNQA 5IAKA 5AVWA 2H29A 2INGX 3JALA 2QW1A 4YFYA 1QOZA 3R8FA 5DRYA 3ZU4A 3RG8A 3MFYA 2BFDA 5EJ8A 4GVPA 4HOYA 2VDWB 5IX8A 4D25A 2A0KA 2W2LD 3F6RA 3H4TA 3A36A 1NRWA 3CXRA 4JUAA 2V3CC 3EXEA 4DPMA 3QZUA 2FUG6 2ZUUA 2DERA 1U7DA 2Q3EA 3O47A 1CR2A 3I30X 2ZLBA 1YRLA 1DCTA 4XZ3A 5L4NA 3L7CA 1MTOA 4PAOA 1SIBE 5EJMA 5FRDA 4BMXA 2Q0HA 1XVTA 4YAWA 5HQJA 5T4HA 3CH5A 1WF3A 1P0CA 1Q1ZA 2DTDA 3ITKA 1HG1A 2IU4A 3G8DA 2PX4A 2HU8A 3NJ8A 3O4VA 3EG9A 5T57A 4B2PA 1CY0A 1YOVA 4UEJA 3N3AC 3UAXA 7MHTA 2CBZA 1MLDA 3IUJA 1USUA 2C5BA 4EZBA 3OIWA 2PFSA 4V02A 3I61A 4WY2A 1IBMB 3ZY6A 2Q3JA 2HF7A 1P33A 2GJ9A 1OAAA 3EDOA 3VHQA 2YIJA 4O4HA 1O57A 3LHKA 1WNTA 4UTZA 2XNHA 4BLWA 1CUIA 4BO6A 4A0SA 1BMFA 2OHVA 3E9QA 2GGSA 4GYKA 4Q6WA 1HZZC 2EFHB 3UC5A 3QVKA 3ZTWA 4D9BA 3GZ4A 3M4JA 5DOVA 4IIGA 5IXSA 4R6XA 5F98A 8ATCA 1ZSVA 1BC5A 1K3TA 4PLHA 1GRQA 4BVGA 1KI9A 2FFHA 2ZTLA 3CUKA 4IVQA 2NGRA 1SQSA 1P2GA 5CK5A 1U28C 4ZHQF 3WGJA 1YB6A 5IVHA 4L5CA 1T3LA 4KXFB 4NEGA 1TK3A 1N34B 3S1RL 4OHBA 4WN3A 4EJMA 2Z04A 2FSHA 2QRNA 5BUCA 2HKIA 4RPIA 4UE2A 5T4FA 2XLBA 2WD7A 2QAGB 1QKIA 4QXAA 3RASA 1WSWA 5JXGA 2HJ9A 4PYJA 4DEVA 3W3AA 3VRHA 2Q6KA 4DA6A 6CHYA 1K6MA 4EJ0A 1VC2A 4G0XA 1I9GA 3CUEF 4FMDF 4Z3OA 1RDFA 4C2TA 1TUBA 1RKUA 4A36A 4KBYA 1DRJA 4O1HA 5HYVA 4W1RA 2ATEA 4EWLA 1T43A 1Y8AA 3FWYA 4F7WA 1W5AA 3ZZTA 4JA2A 3ZY3A 5CA0A 3WQRA 4KAJA 1TJNA 2MSDB 4RF3A 4NMWA 2G4LA 2G88A 3EZXA 4CIVA 2C5FA 1JG7A 3JQBA 1T4BA 4HWPA 3SFVA 2ZPUA 3BSYA 3ROXA 1HX7A 4J2OA 3ENZA 3ILYA 3MAGA 1XJ0A 2OBFA 1B3BA 2I6XA 4H0FA 4HCJA 4EB3A 5CD9A 3PUHA 5TVKA 5GADc 3RYFA 2F8SA 4E5VA 5C5IA 3STWA 2I54A 4RFSA 2QLNA 5DMXA 3NT4A 2I4TA 2Z95A 1Z6AA 4FLFA 4UM5A 2NO6A 4KLCA 1PFKA 1PTKA 4JOSA 2WI8A 4QVGA 3L4BC 2XQGA 2FWAA 3AG5A 3JASB 2MR6A 2QUKA 4KEAA 1WS6A 3CVVA 1N7GA 1R9NA 1P91A 3C14C 5B7NA 2BDTA 3QWAA 3FKSA 4ZCSA 5TSDA 1EFLA 4ZFNA 3KSBC 3HRIA 3GEGA 3QVVA 2Q5IA 5U9CA 5JJIA 1QP8A 2H16A 1WY7A 2VAWA 1WU8A 2X0NA 4MS1B 5CGQB 1WMEA 3T7CA 4AJJA 4P5PA 4DMKA 1FBTA 3OLQA 1Y5LA 3C7TA 3N0XA 3NXKA 4QBHA 1VGQA 4QQ8A 2XVZA 3W9SA 4DMUB 1JIIA 1CEQA 1D07A 1W36D 1PQWA 4P53A 2CXXA 8ADHA 3MUEA 5D84A 4ZQIA 3GDWA 1RI5A 3R3JA 1I3CA 3PHCA 1ULZA 1Z6ZA 3B9QA 3R1IA 3GJRA 5K8JB 2SHKA 3KTAB 3SBEA 4C2M1 1H2FA 2ZIAA 3PFFA 2IXTA 1L4KA 3DH0A 4BMCA 4YRCA 1QHNA 1ZVMA 4LISA 2UUBB 1XEWX 2XUPA 2Z4RA 1PAUA 3X44A 4AL4A 3LQ4A 3U7QB 3GPIA 3PI6A 1U2RA 4QEDA 5FLYA 4EJFA 4Q24A 3R23A 4U7HA 1KVQA 5D1NA 3TMAA 4RTPA 2A78A 3DUFA 3NHFA 3PRJA 4FSHA 1ITZA 4OKNA 3RNOA 3ZIAA 4D56A 3HAXC 2WHXA 3UG6A 3ZUGA 3NAGA 5EIXA 4S2EA 2N9UA 2ZIWB 3DPSA 2RB5A 4FUQA 1HF3A 1QCYA 3KEMA 3B7WA 4BVJA 4K03A 1VSUA 4OHUA 4TXLA 1L5MA 4B9EA 2V55B 4LDZA 1DWPA 1KR2A 3H65A 1RJ9B 3S1AA 1FFAA 4HNUA 3LVQE 1VRWA 2JAPA 5K8TA 3A2NA 1BOOA 1OD6A 3C87A 4JLWA 5FWXA 3TS1A 1GEGA 4BNXA 4KSYA 3RC3A 3HYSA 4WKCA 2P40A 4HX5A 4IHKA 3UPDA 1R16A 2ERCA 3F6BX 4DR6B 1J4AA 1X13A 4PYLA 1ESCA 5B4UA 3DJFA 1RYZA 3IVAA 4MINA 3TMYA 1I32A 4YUVA 2EOAA 1JH9A 2R86A 1FSGA 1IM2A 4P3NA 4KQHA 1C7FA 1B3RA 1ZQ9A 4OYYA 4AZSA 2WZDA 4D3ZA 1Q0QA 2XCOA 4QATA 4OGKA 3LXXA 3M82A 3MRTA 2AI2A 3B70A 4BQEA 4EB6A 4QOIA 4Q3AA 3LBIA 1GUBA 2G83A 2ZGVA 1COWA 4QXMA 4W7IA 1GUYA 3EFOB 4JC4A 4M89A 3BCUA 3KQMA 3L05A 1TVKB 2BF7A 2C9ZA 3M5DA 3DS8A 3N8IA 1XTRA 3W06A 9ABPA 1WUTA 2YTZA 3O0DA 1AN0A 5CDFA 1IU5A 3QMVA 1CQZA 2C2BA 2W6PA 2Y1GA 1KY3A 1M75A 4JVMA 2QTHA 3TE6A 3RYCA 1ZGCA 3BTUA 3BC1A 5D87A 5ALSA 3NC1C 3PQ7A 1B93A 3RS2A 3ESBA 3LXMA 1QBKC 2YU9L 3EUAA 1N3IA 3ZD8A 1IIBA 1XZIA 4R1OA 1IAQA 2Y3IA 3G8BA 3F2IA 4G4IA 5JDCC 3V8NA 4E6PA 3ZHBA 5EQFA 4TT3A 5FUWA 3QF4B 2GERA 3TSYA 5JBIA 8LDHA 1MNQA 1FU8A 1CJKC 1IUPA 4FS3A 3HB1A 3R2JA 1M1UA 1WXEA 3JARB 1UEXC 2BFFB 1PL7A 5PNTA 2RAUA 1QHHA 4E09A 3A6PC 4S1TA 4J0HA 4P7BA 3ERCA 2B1QA 1ZRMA 4O02B 1EAMA 1AH2A 2ZEJA 2VF2A 4QODA 4B31A 1OGIA 4JI2B 4L16A 1LVUA 2RGYA 4ZC8A 2W6ZA 1FU4A 1X9HA 1RBQA 2MR5A 2WJYA 1T9AA 2CXSA 3JQ7B 3NUQA 3DEIA 3AH8A 2FW8A 1PR6A 2I8CA 3HSYA 4RKQA 1HH4A 5IJXA 2O8EB 1QP0A 2DM6A 4ZD6A 4DIFA 2M4YA 4NG5A 4LVNA 1HUQA 4NY1A 4CLDA 1R12A 5KYXA 3SF8A 3D4PA 2VNSA 5EWMB 3NIBA 3IULA 1AMUA 1YKGA 1L5NA 3B2EA 1G64A 3KVRA 4K9RA 1JHUA 1G4AE 5C34B 1T0HB 2JLRA 5A3SA 5SYNA 1XN1A 4CLOA 3OMWA 5M5XL 2XBMA 4LQCA 5JAIA 1W8IA 5IP7L 1RMTA 1EP9A 2F8LA 3NBUA 3BFVA 1IN6A 1KDOA 1C3LA 5EMLA 3C3BA 1JQ3A 3ZHYA 2HC9A 1T4GA 1E3WA 2D5CA 5IN5A 2B99A 1R6UA 2MSKA 1P4RA 1SCQA 3S2YA 2DUUA 4J1TC 1GGMA 3LDAA 2BSXA 2OGWA 3AWDA 1M1NA 1PJBA 2JATA 2OV3A 4J0KA 4D82A 1EWRA 4INZA 4XDYA 4BO4A 2G67A 2PU5A 4JLDA 2HR1A 5JUWA 4CV1A 2JZCA 1IN5A 2YINC 3PGA1 2V7XA 5TRTA 3BHMA 3FKJA 2ZYDA 4IFBA 3B0AB 2HN9A 2MSWA 4AR3A 3GOQA 1LS1A 4KBFA 4BV2A 2R7ZL 3OPQA 5K3BA 3QVWA 3LCVB 2JBWA 2JCXA 2JK0A 1ULHA 1T0BA 1LUAA 3KZXA 3PDWA 2AF3C 2P1DA 2AC7A 3W78A 1O97D 3U61B 3PG5A 3LKBA 3SSAA 1F14A 4IDQA 2ZROA 3EPHA 1TM3E 2VOEA 2Q9AA 1QCVA 4NYIR 3GFPA 1AV6A 4D4KA 1VGVA 4DKXA 4U7FA 3CJQA 4E88A 1BCSB 1R0YA 1UJCA 1XZAA 2NYUA 3QOWA 4P36A 3WAGA 2YIMA 4DM7A 1NI4B 3DTVB 4HXGA 3E6AA 3T95A 1MH1A 3BRCA 2QTGA 1NUPA 3FHCB 2AD1A 3KVYA 4TMKA 4OO3A 2CHUA 1N5MA 4Z0NA 1J1IA 2CE2X 3IXMA 1BA3A 2B8JA 2CWWA 2R1VA 2V9PA 3T41A 2PUDA 2Z4SA 4X1KA 3EEQA 3EDYA 4I14A 3N07A 3R5KA 3TL3A 4B3SB 5FQNA 1CZUA 3LO5A 4M1TA 2H7XA 1WJVA 1JJVA 1L3BA 1Z28A 1X74A 2HZ7A 2AXQA 3WB9A 1DADA 1DWUA 2RH9B 4I36A 2BMEA 4OCZA 5ITZB 1ML3A 3HHPA 1G18A 3LZDA 5E4TA 3RVMA 1ZMRA 4H18A 1SXJC 3WNVA 5IJ0B 3C3KA 1GILA 3HUFA 5FFFA 4URVR 3RUDA 3SS2A 1L5ZA 3T0GA 1IHUA 3JY6A 2CLKB 1FNBA 4LYEA 3TFQA 2CNKA 1CJSA 2R44A 2J46A 3GPDG 1Z75A 3L1KA 1XXLA 2OFOA 3MWDB 3P9QA 4P9NA 4Y2PA 1OH6A 3F78A 4PRLA 4GKVA 1UOPA 5KDLA 5C51B 2A5DA 5ARDA 4CMEA 2JJ8A 5TE9A 1A69A 3NOOA 3IDQA 4JJAA 4JSTA 5CT6A 5GAJA 5E7JA 1Z63A 2NP6A 2QX4A 3MF4A 4JP8A 2XF8A 1DMRA 2B61A 4KRXA 4Y1EA 3GFOA 4Y3UA 3WL6A 4ZKDA 1M2FA 1G5TA 2GN2A 2NYDA 2B37A 1GNSA 3QEKA 1XTVA 2E2IL 1GDHA 2OKCA 2I2CA 2CFIA 4XDHA 1H0SA 4Q15A 4CMIA 1T9GS 2GN8A 4F1KA 4LYJA 3JATA 5KJEA 3PFGA 1IB0A 1GUAA 4R51A 4KN8A 4DF3A 4N18A 4RMJA 1TMKA 4PRKA 2ISSD 2BEVB 3I4CA 2WIBA 4RZHA 3TB4A 1U2GA 3RS9A 2ZQYA 2IYAA 3K0EA 2ZE5A 4CXMA 2GJ4A 3H2YA 4ZO9A 1SY7A 3UENA 3VPHA 1PSZA 3GFGA 1PO7A 2VOJA 4RVOA 3R7SA 4CTJA 1VRVA 4U2KA 4XJTA 1OH7A 5DYIA 3RK1A 1NU6A 1UXJA 1LSJA 1ZD3A 4UBOA 4RKYA 3HLTA 5MGNA 1KYIA 1E4YA 1KORA 3NYRA 2YZGA 2JCVA 1R64A 4IQ8A 1K7SN 1KR5A 3IR6A 3TLJA 2OK8A 1RDGA 5E9WA 2Y1CA 3WBKA 1JHXA 1V8BA 3QV2A 2FG6C 4H3VA 1LSSA 1BYUA 1V9CA 5HBGA 1DEHA 3VOSA 1TA4A 2VHXA 3MGBA 4JXJA 2FSPA 4F8JA 2JASA 3UUEA 1P1KA 3NJ4A 4LBYA 1IK4A 2H52A 2M6RA 3C4VA 4FCCA 2CB9A 1P7VA 2PQ0A 4RWEA 2AIRA 4CIBA 4C06A 4NXNB 1U2DC 3M5WA 2P2NA 4U7GA 2CXRA 2PYAA 4ALNA 1Q0TA 1FVXA 2ONCA 2QUBA 3R3UA 1YK1A 2A9JA 2CYCA 4XVQA 3VC7A 1WAMA 3N7AA 1V5IA 3ANYB 3BXGA 3HZRA 4ZI7B 1ZPDA 5C52B 2VWHA 1MXFA 3IOYA 4H59A 3V3TA 3BQMB 4YUXA 5WRFA 2JFFA 2IY8A 1JT9A 2J07A 2RIRA 4RVHA 3SG0A 4DSZA 5IK2A 5CYGA 1HNZB 1YB5A 4QBTA 1YQ9A 1KJQA 2DLDA 5AKIA 4E11A 3ZBPA 3WLKX 1Z5ZA 5SY4A 4M1KA 5FFNA 2ZYAA 1E20A 3HKZP 1SAYA 2IYUA 2QM3A 3QLVA 2WYOA 1ZRNA 2RH5A 4NBUA 4LGYA 2NO5A 3LUAA 2VJMB 2FI1A 2ZT7A 1K9SA 4Q7LA 3SHQA 5C8ZA 2J09A 1TWHL 1I2ZA 1Q57A 2P2GA 1RJGA 1ZQ1A 5A4MS 3TLCA 1V39A 1J0AA 3CPJB 2FW1A 4RK1A 1ZA1A 3T5BA 1YNOA 4ZMRA 1KI6A 2PXXA 4UUAA 3R6GA 1N1EA 4IJMA 4R1TA 2ZSKA 4BFZA 2QZZA 3N8KA 2JFBA 4FFBB 3IEMA 2QNIA 3L0DA 3H3JA 4HEA6 1JBKA 5CYPA 4ARBA 4KYIB 2OA0A 5KBYA 4HUQA 4DLTA 4AI6A 2UUOA 3Q3JB 1VJGA 1EIWA 1K3FA 1KJYA 3FCUB 1SPXA 3FDFA 4OHRA 4AG3A 4K40A 2BMFA 1XQXA 4YLEA 1GV0A 1SG0A 2H6EA 3WDLA 3THOA 1LK7A 2X42A 1JR6A 2CNLA 3AKCA 4XSHA 2WKPA 4B2IA 4ZJPA 1KZYC 3LOUA 4MO9A 4IY1A 3C7AA 4TS1A 1VYTA 3GGPA 3QVLA 3I1YA 2W4IA 1EZZA 3ZWWA 4C88A 4MGZR 2JGDB 4EMBA 1BEZA 1XCLA 3Q41A 5BUSA 1FFXA 1ECLA 4RVCA 3PD7A 3QKRB 3LMKA 3H6GA 3L7BA 2PSEA 5CW1A 2N42A 5IEBA 2DKNA 4EGSA 4X64B 5I8PA 5KNBH 1PW5A 1M0SA 1RXEA 3FMIA 3L41A 1UWLA 2I3ZA 4EJSB 5A5FA 3KR1A 1I33A 1WOYA 4BBJA 1KVUA 3QYAA 2IOHA 3FWKA 1I3KA 1QBGA 4N0EA 1H2RS 2REQA 3JWEA 2ZJOA 3L1HA 5T41A 1K92A 3ESCA 4II7A 4OMFG 1CDZA 1T4CA 1OU0A 1DAHA 5D5HA 4CFZA 4HI0E 5C3MA 1KPHA 4NV0A 3IVRA 4BFUA 3LECA 4WNAB 4WQMA 5AVSA 1RW4A 1KSJA 1NFFA 1VHQA 3F5DA 5TQ0B 1E9SA 3UT0A 3Q98A 5A06A 4DR3B 1QOPB 1EJ2A 3IQFA 3BDVA 2RK3A 4RSHA 2K6GA 1AK9A 2XMCA 1I6MA 2Q6VA 1HDOA 2B4RO 3CLSD 1GG2A 3GUVA 4HSGA 4GPEA 4LVUA 3WGZA 2DETA 1PE0A 3A1EA 4HMOA 2QX6A 2VDJA 1L6RA 1D2RA 1NC3A 3DUWA 1AQ6A 3O74A 4L2IA 4M49A 4RQUA 2JEOA 2G1JA 3TOXA 4B1FA 5C46F 2PH5A 1JDBC 3H84A 1E3QA 5AM0A 1U6KA 2NTVA 3CR8A 3GGGA 5H5JA 4AUNA 2OWDA 2Z5FA 1JFRA 3WGNA 4ES6A 4DOMA 4G37A 2C03A 1US8A 2VBCA 4IW3B 4FX5A 1B0UA 1K5DA 2ORED 4C22A 3T7JA 5LCXA 2IYXA 3L7MA 1QRRA 2VKQA 4DMLA 5JTTA 3PDHA 1Z8FA 1L1FA 5AVKA 3RV3A 3GBSA 3L18A 5CCEA 1YTUA 3BMOB 2M98A 4D6PA 4AUKA 3NFYA 3IXLA 3AR5A 3L1IA 1TU0A 5EZ5A 2P5UA 5JD6A 3S55A 3E3NA 3TLGA 2B25A 4CE6A 4YR9A 2VHCA 1UADA 5DLYA 2BGJA 1OVGA 1FP6A 1DO8A 2ZE6A 1M8FA 3A6GA 1L4GA 3ESZA 2OWEA 2D0IA 3KKZA 1JDSA 5HDQA 2Z3QB 1T3TA 3K7EA 4GMHA 1VQ1A 2QRVA 4UBLA 3TRFA 3ZQ4A 3NB0A 2ZRIA 4UBNA 3W2GA 1BVRA 5CB4A 1NJ8A 3PFCA 2AK2A 3PRKE 2Y1XA 1O9BA 2ALJA 2FQXA 3HJBA 4DZRA 2CVOA 4JC5A 2Y1WA 4COOA 1P72A 5BQOA 1JI3A 2R6ZA 4YCAA 2VBGA 4IICA 5B4TA 3ZQJA 2X23A 3GO4A 3FPBA 5F2EA 5KQSA 1XJ5A 5B4VA 3N0VA 5KSYA 4I4TF 4E21A 1NN5A 2J9UB 2Q1UA 3IQXA 3O94A 1PN3A 5ALZA 5G4LA 2GN4A 4KRGA 3L6DA 4RLQA 3TINA 4WZAB 3D4OA 2HSZA 1E2UA 4EA8A 1T5LA 2JCSA 5ICCA 2YXNA 1E1KA 3KJHA 2BRUA 2HPVA 2PD6A 3PCRB 1HI9A 2GJKA 3VC3A 5IJ9B 5EZQA 5JNUA 2NPOA 5KYYA 3AIOA 1EK5A 1TQ2A 2WAXA 1AB6A 1K6EA 1JQBA 3WYNA 1NNQA 3SE0A 3HXKA 2NUTA 3WMRA 4ZHQA 3A9UA 4KFRA 2IHUA 4E6YA 1NXXA 2AMFA 2Y0BA 3I9JA 4XTCS 5KX5F 4X41A 3S40A 3CZPA 1DI0A 3BMNA 4WK6A 4MUXA 3O82A 5CTAA 5LUBA 1MRNA 5DH9A 3L5OA 2AOVA 1LS6A 4OSOA 5EHIA 2POQX 4C5BA 2AUMA 3HDTA 4L5YA 4A0QA 3RT7A 2BELA 5JSZA 3ETGA 2A59A 3HB5X 2VK4A 2LBPA 3SEFA 4DZTA 2D0OB 1ZONA 3OOHA 2FMKA 1TX4B 4OMDA 1KQPA 1UBKS 1Y8CA 1Y80A 4XSGA 5SYMA 3QBJA 1HPLA 2Q4BA 2WYIA 3KLOA 3GLHB 7REQB 4FSDA 4POOA 4ZOBA 3PDJA 1BXZA 1EX9A 1QCZA 3KWFA 4G1MB 3E15A 3ANMA 5D1HA 1AS2A 2GBIA 3I8XA 2CK3D 4R84A 3WJ1A 3LKVA 1BGVA 2VDLB 5EJ4A 4UM9B 4HDAA 1KZ6A 2RHCA 2XRFA 4ND8B 4FK8A 3WMEA 3QE0A 3UPTA 4ZZ1A 1ZISA 4KXNA 3RUAA 1PGJA 2AOXA 5ECWA 3EGDB 1NW4A 4G2NA 5ICSA 1QKKA 1RZRD 1K7FB 3KJGA 2QIPA 4YWLA 3GRPA 1Q6YA 3GRUA 3LLSA 2DQZA 1GRVA 2RBKA 1OLSA 5A1TA 5JNSA 3U1BA 2AJ8A 4YQEA 3K0AA 2Y1EA 4MCIA 1VHWA 1V8ZA 4QO8A 3RU9A 3PQ4A 2OHJA 5ALTA 3TE7A 1RJWA 2DOKA 2I0FA 2J7PD 3IMKA 3GUZA 1SKBA 1RHMA 3DP7A 1Z4LA 4MX8A 4XUDA 3K5HA 1WZUA 3WZLA 3HYCA 3VVCA 3ZKWB 3KJEA 4Z86A 3L06A 1C1XB 1L2TA 3A6JA 2PMWB 5JDIA 4I50F 5E9QA 2R97A 4LHVA 4GYYA 4UVHA 1BE1A 1NG1A 5DX0A 2KLHA 4H60A 1QFMA 3HCCA 1ZHHA 1RWDA 3CUSA 1QYWA 3GHYA 1E2JA 3NWEA 3QFRA 4MEAA 3WGYA 4BLSA 2XJUA 3U3MA 3AJ9A 2J0UB 2FH5B 4XEHA 1NUHA 3K09A 2OMEA 3QOXA 1H2ZA 1GGNA 4F6LA 4ENUA 2I6GA 3DDZX 1IXRC 1YU6A 2LW7A 3N8GA 3ZVKA 1S8FA 3BAFA 1U7UA 3SS8A 1ZUNA 3WL8A 4DBLE 3DAGA 3HBAA 4A3GL 2BFWA 3WSWA 4E4TA 1V0JA 4OPMA 1LI7A 2PKEA 2Z9CA 1A98A 3P71T 4HLCA 4B7XA 2F1IA 3FOFC 3RDPA 3CNLA 4PYNA 5LBTA 5IT9A 3EWAA 1OX6A 3W6ZA 4UMDA 4ZT5A 4OHXA 3T52A 1NKTA 4M7OA 4JKYA 1F7VA 4GI3A 3LPEB 3JPWA 3EPJA 3W1VA 3OX2A 3FOEC 4YMHA 2PG3A 1AZLA 3A1CA 3KKNA 3W4JA 1EK6A 4YRSA 4LX0A 5B12A 4Q34A 1HG0A 1XTTA 1U9IA 5FWNA 2YJTD 1YOBA 3OE5A 2ACVA 3D3WB 5EXXA 3T61A 3OWHA 4FT4A 4XI9A 1G8JA 2JARA 3OQIB 1A8UA 5JBNA 3URMA 1F2TB 1C29B 4RDIA 1B73A 4CKBB 4ETNA 2HYDA 3G1TA 2CCKA 3R7AA 4D3SA 4DS3A 4KXYA 4ZYXA 4J0IA 2ZBUA 5A9RA 5LN1A 4P86A 2VP5A 3PRHA 4RMNA 4YJHA 3VR4A 2GCOA 3IQIX 3QU7A 3TXAA 1F8YA 1SULA 4F04A 4QUGA 5TPZD 2HRBA 4IGIA 1V11A 3UZUA 3HOVL 1ADYA 1HYHA 1QJ4A 2QVBA 3O91A 1I3LA 2GWRA 4EGJA 5LMZA 2C2GA 3E3OA 4YO8A 5J5CA 4AT1A 1SUIA 1IK6A 2YJ3A 5I7AA 2CVZA 3SSMA 1YAJA 1BE7A 5C53B 4MRMB 3MT9A 3NP9A 1JI0A 2Q6OA 3WGQA 3GA7A 3JYNA 5CNKA 5BO5A 5I6DA 3HJFA 1QH1B 3K6SB 1N2JA 3LT2A 4G1VA 4KMSA 4V0RA 4IEIA 4EVIA 1H4QA 2PBRA 1NRJB 2F00A 1Z17A 5JPIA 2XUOA 3QEAZ 4OYRA 3HCEA 4MW9A 1P0MA 1FRFS 1IVNA 4PC1A 4FWBA 2C2MA 3ZV7A 4PX9A 1Z0KA 4JLSA 5HDBB 3LXRA 3MQKB 1OXTA 3D02A 4DMGA 2I4MA 3PXCX 2X6RA 1O9GA 2E89A 3PHBE 1QIHA 5EVJA 3KLPX 2IZZA 3RAPR 2VK1A 4CMGA 1GGFA 3AOEA 3LF1A 5CBPA 5K0CA 2CL6X 1EWVA 4NS4A 1Y3FE 3ELWA 3P0HA 3MINB 4GGPA 3ZI7A 1JX6A 2FN8A 2X13A 3KHKA 3ZQKA 5B7GA 3JD3A 2QN3A 3GEHA 1R15A 1CRZA 5BV7A 1HQKA 5IABA 3F4KA 4JI8B 3AFNA 4CGZA 3BE4A 4UD2A 2J5RA 3HJYB 3WA7A 5JXWA 4XQ9A 2FG5A 3EH1A 3V8RA 3WRWA 3O8OA 3WGMA 1YDEA 4TXMA 5LKAA 3DHNA 1NXEA 2PLRA 4MKRA 4NJMB 3V7UA 2QE7A 1CY8A 4FMBB 4IDFA 4JC0A 4JHLA 5J2TF 1KRWA 3WXMA 4DABA 1GZSA 4OGWA 3WOVA 4D96A 4C4TA 4EAAA 2PKYX 4JN6B 2D5BA 5E9AA 1CJMA 3THYA 5KWVA 1JEQB 1TB4A 1HXHA 2H4XA 2A7QA 4QFCA 4GM1A 4R7ZA 1BXRA 1P2FA 5EE0A 4RM3A 3AWIA 4TPUA 4TV8B 2NN3C 1X19A 4PGAA 3UOAB 2GMGA 1VG1A 1ISIA 3ZZ1A 1QPGA 2IZOA 3RV4A 4DAOA 4IIJF 2A9PA 4BMYA 4YT8A 1GPH1 5DWQA 2YZNA 2HUPA 4MGKR 3VZQA 3H13A 3JZDA 4QREA 4QYMA 1E2DA 3LQ2A 1GZ7A 2Y76A 3G2QA 1Y7HA 4JS0A 5K0TA 2EF0A 3QVGB 5LOVB 3CONA 4HLUC 1UPTA 1XNQB 3IRUA 2J9YB 1E5LA 4A4DA 4X66B 3AM5A 1JYSA 3IAS6 1E1DA 5TGTA 3EGVA 1E2MA 2DQ4A 3EOZA 1JHYA 3IQWA 4EFDA 1PT9A 3F73A 1E6MA 2GBPA 2X0EA 2GBCA 4ZVLA 1XZDA 1PEYA 4Q3BA 5GAEc 3IE2A 3H9JA 1PZXA 4TUYA 4OLHA 1NTOA 2XNCA 3NM6B 1TM7E 2JNWA 5HGJA 3TZEA 1XV5A 2VDUE 4JUCA 2X3UA 4QRIA 4MA4A 3IPCA 4YMGA 3VDQA 4J1SA 4AJ4A 1LFDB 3GRFA 5TF0A 3AEZA 1RCUA 2YY6A 5HGXA 1FYVA 3DYBA 3HFGA 4ZIRB 3LA8A 3L01A 4PSUA 3UGTA 4KUEA 4YYZA 3K70B 1IRXA 2Z3ZA 4FNOA 1PWHA 3PGVA 4G25A 1JLMA 2JBAA 2FGJA 3BXXA 3KXIA 4YCJA 4XOUA 4BYMA 2VP4A 3SC3A 1EXVA 4RPCA 2J3HA 4BQSA 1HFWA 2QW0X 3RJTA 3GJ4A 4G07A 3ZXUB 3P19A 4A82A 3NZEA 4NCJA 3EVEA 3FPKA 3FJOA 1W2HA 1Z5NA 3R9KA 3AP2A 1DDIA 1O94A 1X7XB 1DC4A 1E9CA 2ZFUA 3HVJA 4MARA 3VO1A 1JIVA 3NBAA 3L0BA 1X77A 5HXAA 2HA7A 2DP4E 2IP1A 3ORFA 5F4BA 3W9UA 2H59A 4M0KA 2D4AA 3UATA 1JKJB 4DNXA 2X7HA 3L6CA 3NC0C 2AW5A 1QE5A 2L42A 2OBBA 2X0RA 1LBTA 1OYVA 1SVIA 4B79A 4OQ4A 4IGEA 5BNZA 1MRZA 3IBSA 1IOVA 2IYLD 3AJRA 4HAYA 5GIOE 1OBFO 1O77A 4IG9A 4D4GA 4V1CA 3W5AA 1DV2A 4FHZA 3U4DA 3BCHA 3VDRA 3E5NA 1TGYA 3BB4A 3CN9A 4PG4A 3HN7A 4IH4A 4U8GA 1LPOA 3KOUA 5KNDH 3HY6A 3JQGA 4Q3EA 3FMFA 3HYNA 5FTKA 3BWVA 3KWMA 2G1AA 3HCFA 3LYHA 1I2BA 2G80A 2YJZA 3P8BA 4LWOA 5TT1A 3H83A 3RFCA 3H5IA 4ED9A 4UXIA 3OEHA 3PUJA 3WRYA 4RE5A 5ALFA 3WZ2A 1WA5A 3ZQUA 2GNPA 1D1SA 1SZCA 3NANA 5HE8A 3T7AA 3W5SA 3I9KA 2WC1A 1CQJB 2YWFA 3CM0A 4JSYA 5E7MA 3PCXA 4AR6A 3D6FA 2ZSFA 1N7IA 3HEAA 2VXYA 3AL2A 1MC1A 1WBDA 3NHWA 4G5RA 4AD8A 3W1EA 2W2MA 5CHYA 3IQDB 3EXHB 5BSRA 2P6MA 4TTVA 3N2NA 1AURA 3DOHA 3M6IA 3EQ8A 5ARCA 5MN6A 5IF9A 1YB4A 1T1GA 3LU1A 4F1WA 4KR2A 2RD2A 5BVHA 4NP6A 1S9HA 1VPTA 1EVEA 2B1IA 2L2QA 1UFKA 1F3LA 2R66A 2ZJZA 1CB0A 3HWX1 5T6MA 4ENTA 2J7KA 2ZG6A 2IWRA 3UUGA 1ZK4A 3GLTA 3V6MA 1DO0A 5DGHA 5IKOA 5FAKA 3N28A 1NY6A 4ZQGA 2B36A 3RS0A 1XTQA 4H7IA 4R8SA 3BHJA 1JKIA 3I12A 4JP5A 2GEUA 3V42A 2AE1A 1Y81A 1WR8A 3EXAA 3COPA 5ERYA 3AKZA 2VFAA 1J21A 3AW9A 3EVCA 3GWGA 1A27A 3K1JA 1S5PA 3NEJA 5U1PA 1L4EA 4ZOQI 1FW6A 2V58A 2ZWMA 4CKEA 1BMTA 1UKZA 2R7NA 4RL4A 3HOWL 4TQUS 3QUQA 2BTEA 3HEMA 3RC9A 3EZ7A 4HYYA 4NLLA 3OHSX 4AY3A 1TK2A 1JZSA 1AMOA 4MYUA 1AUVA 2EGHA 3D1VA 1IN7A 1N0IA 5FL7A 1DARA 4B6PA 2OUKA 3CPSA 3PVCA 1NNLA 4O63O 1OKKA 3FY4A 3HJNA 1BD3A 1TLFA 3KEOA 4DN6A 4DWWA 5L3SA 1HDEA 3MUOA 5CGZA 2EATA 5AUNB 5LIRA 4DSAA 4FFMA 1SQ0A 1C7IA 4M7WA 4CEHB 1TQ4A 4XWTA 5DEOA 3W79A 1PJCA 3Q9LA 1T4DA 3VNUA 2Z1NA 2NTJA 2QD4A 3DMYA 4WIAA 1SNYA 3ABRB 3H18A 2ZR7A 3HJAA 4LTMA 4IQ4A 3R8XA 1A5ZA 5J9FA 5L6MB 3B36A 2NQTA 4EFKA 1ZSNA 4B3BA 5EUMA 2LWIA 1CCWA 5AM4A 4C29A 4EW6A 2UXDB 1KFJB 1THGA 5KTSA 1HRKA 3OCCA 4R68A 2RGUA 3GYGA 1DTWB 1LGYA 5JZSA 2C4UA 2FXIA 2ATCA 4LCJA 2VA9A 4OQPA 5EHGA 2ZJ6A 3RUFA 3D6TB 4DQLA 2J08A 2CXHA 2DULA 3JQBC 3TD6A 3DXZA 4Q02A 1QDEA 1PTJA 1YR7A 2RJOA 3E8XA 1KVRA 1RE1A 3K73O 3MBIA 1CTQA 3QYJA 4O4LF 1G7RA 4PHFA 2YV1A 3CEJA 4RGQA 4RLHA 4G1UC 3VU1A 4C7KA 1YZLA 1R8YA 4JBWA 2GT1A 3WKDA 1W46A 3UW1A 3FE2A 1P5RA 1ZL0A 4ZYZA 3BGOS 3BK1A 2AR9A 3V1LA 3HJWB 3NWOA 4TWAA 2XDWA 2OXTA 4I1IA 1UKEA 4ALMA 2JFVA 4G0PA 4G9BA 4MMYB 1TYZA 4K7JA 5JC8A 4KR7A 1U1GA 3G7SA 1EGHA 3M9XA 5BT8A 1OI7A 3SP1A 1JHVA 3V4VB 1V47A 3ZIAD 1BWSA 3DYVA 2PRIA 3OZVA 2XUJA 3B89A 3BH7A 1B8NA 1FTSA 3E22A 5EP3A 3GJSA 2X86A 2XYVA 5HZKA 3DE2X 4NF2A 4ZWNA 5KU7A 3N3BC 1J70A 4MZDA 4O2BF 5ELMA 4EGCB 1YZQA 1QLHA 3GRRA 4HFJA 2C57A 5KC9A 3IUQA 3DNMA 2ZSUA 5EIEA 1L5KA 2EP5A 3M6WA 5CK4A 4MLPA 4G5HA 3IR5A 1JILA 1LI4A 3OQBA 2C4KA 4WXRA 1RNLA 1DO2A 1SIUA 2B78A 3E48A 4LHEA 1EK0A 3TEMA 4B32A 4KTTE 5IKPA 4HTAA 5KEIA 1SCUA 1IROA 3CR3C 4MW1A 4FOSA 1U3CA 5AVZA 1E8NA 2X9GA 4R98A 3COSA 4EKIA 1Z92B 4YGYA 1V8FA 5AI5A 5KUTA 3PHLA 4D4JA 4BVHA 2W2KA 4C7VA 3A32A 3RFFA 2QQFA 1JDUA 3L49A 2XIQA 3VSDA 5JVDF 1DC3A 4Q7JB 3K9QO 5A3QA 1WPQA 1ZIPA 4UHJA 5F2OA 3D0RA 4MPDA 5CITA 1GPWB 1EHYA 1LC0A 1A88A 4B85A 5GOZA 3I2JA 1XD8A 1H9AA 1N0HA 4PFSA 2IX9A 2I6SA 4POFA 2R6FA 2V5UA 2X0IA 5FPKA 2JFYA 4XB2A 4MKIA 3UHOA 4NTZA 4BMVA 1EM6A 2YL2A 2RHMA 3WK8A 4HDRA 5ALMA 1VMDA 5LDHA 1UJ2A 4TVKA 3DW1X 3RD5A 3EE6A 1NKSA 2H1FA 3DO6A 3Q88A 5KVSA 1UFRA 3USCS 3PIO1 1PZNA 4JQZA 1W48A 4UNQA 4URXR 1YZGA 3TKAA 3ZDZB 2QMYA 3F71A 3C74A 2G77B 5AI3A 1N2HA 2E1RA 3QBTA 5E6SA 4MMXB 1DG1G 3VDXA 2H5LA 1OXXK 2H63A 2VQSA 5IF3A 2AX4A 3E05A 1HEIA 3GMIA 3EZNA 4F6CA 1S3FA 1J9ZA 2HMYB 2XVMA 4Y0VA 4OVKA 5DM0A 1R4ZA 1FTQA 5CVJA 2EZ8A 2UZ4A 1D4ZA 4Y9UA 1C0EA 1YE5A 2NO9A 4JUBA 1L7VC 4K46A 1R0JA 1B74A 4MKZA 3VPGA 2CUTA 3NWPA 5E4YA 1JQDA 3MGAA 2LPMA 4C14A 4B2YA 3TIVA 4FFPA 4J1NA 3FYUB 5K8IA 1Z07A 2WOOA 4TYQA 4FB4A 2BMVA 4C3HL 4UY81 2X2FA 3E84A 4RKFA 5DCWA 3QXCA 1VLLA 5K6RA 2GK3A 3ZS8A 3DMFA 2XWQA 3GJ6A 3MC1A 4NJOA 5GM1A 2MU1A 4U2FA 4F6RB 2XHEA 1VCNA 1G8SA 2RKOA 4URHA 3F9RA 1HNNA 1G6Q1 1YVUA 1KHTA 1XEWY 1JHPA 4A9AA 5BY2A 1Q0LA 1ZDMA 2WG0A 5EUBA 3T1HB 5AUOB 2ZI9A 3OX3A 5IDXA 1CY2A 5TC4A 4AHXA 2AKYA 3FVTA 5ENZA 5F1KA 4FMPA 2XTNA 2AH5A 4HQ6A 1KMIY 2PZJA 4I5DA 3UUWA 4BLVA 1WP4A 2H5IA 2LE0A 5BWNA 4YP0A 4I4TA 4IKOA 4FD3A 5JPCA 2X0JA 2ZYRA 3ZU6A 4RADA 3IXQA 2EFEB 5IARA 2YY5A 3BXOA 4N65A 2PWPA 1MORA 4TWZA 5DISB 3JQCA 1E60A 1BXGB 1CHNA 1TA0A 2ODNA 2PD4A 4DJTA 1M34A 4P84A 2BAGA 3LRPA 3WB1A 5J1SB 3LF2A 1DKUA 2IP2A 2WYHA 1J00A 3ND9A 4ML3A 1JYFA 1UXKA 2RHGB 5NLLA 5SZIA 4B71A 1N0UA 4PO1A 4D57A 4X20B 1A71A 4XX0A 2GZMA 3MLAA 4CMBA 3QPDA 3HOYL 2QTFA 1J97A 1JE0A 1N9ZA 1YBVA 3R5JA 5KX5A 1EB8A 3PEEA 3TBFA 4BNYA 1V48A 5BYKA 2XUHA 3AYZB 5C8YF 3U5ZB 4K6HA 1A76A 4P98A 3NOQA 4N0DA 1DKPA 2XNDD 4R8LA 4JI5B 4EUNA 4F8YA 1U7XA 3U3RA 4G0OA 2IYQA 3KJNA 5G0VA 5TY0A 1Z26A 2ETVA 2OAQ1 6ABPA 2CUZA 1YV9A 2ZIEA 1GHTA 4Q1EA 1K75A 1LWNA 1JE1A 1JLLB 1A3CA 1IM5A 1QIMA 3ZH2A 3BEDA 3U3JA 4RHEA 1DG3A 3Q10A 4UXJA 5J5AA 4KZPA 3ZV3A 4OI2A 3AXSA 3J7Z1 2ORIA 3KDPA 2M6OA 2P4EA 2GK7A 4X85A 2VTBB 3SYMA 3J80A 3ZE2B 2B0JA 4HRYA 1QF9A 4BATA 4C4ZA 4EFLA 3LCJA 3CGWA 3K53A 4ZV4A 5GINE 2HWKA 2ZIXB 3EZGA 1N32B 1J56A 2GPJA 3GARA 3QFHA 1JJBA 2YWRA 1R0IA 3EISA 3HY3A 4GX0A 5F33A 1WSBA 2AUTA 2IYWA 4U2EA 5BWMA 4CKCA 3F96A 4N40A 4YQYA 5DV9A 5FO0A 3R6TA 3CG0A 2EYUA 4FP9A 4BRWA 4RNCA 2GLUA 1WVMA 5GMOA 4GKJB 3EZFA 5FOWA 1EHIA 3PUKA 3IHTA 1RWOA 5AK4A 2YWDA 3FNEA 4DLBA 5C4MA 4G4SO 2OB1A 2GVDC 1KL7A 2HRDA 1MC4A 4PV7A 5C80A 1SHLA 1AKRA 4B45A 4EM6A 4WOKA 5DF1A 1UMDB 3VC1A 1SVWA 4YXWD 5AW2A 1RYNA 2WMYA 1PEKE 1CZNA 2WHPB 4EH1A 4ZEMA 1PLLA 1Z34A 2VO1A 3K8OE 2H1IA 1GZDA 3DTVD 3T5TA 3WLIA 2B30A 4JU8A 3M2TA 4A1OA 3E81A 3STUA 5BSKA 3RQSA 1K5HA 1NPDA 2B4AA 3LBAA 1GEEA 3GW8A 5BSUA 1SJ9A 4X7MA 2VUHB 4O0LA 4IV0A 1LBHA 2D2EA 3M1LA 1YQWA 1KA9H 3L92A 2Y9PB 4MDFA 1VSQA 2GN6A 2EX0A 3FVVA 4GU5A 1RKBA 3P94A 3QVOA 4E5UA 3WGUA 2VJPA 2YVAA 2Y99A 2SECE 4Z3KA 5A02A 5DNUA 4HVLA 1ZRSA 4IDDA 4F06A 4RJLA 3KPUA 4TZ6A 4CCYA 3TTSA 1JKFA 5F3WB 2UZ1A 5GQSA 4QUEA 4WEQA 4MUAA 5B6JA 4P4SA 3I64A 4QRHA 1GARA 1PZEA 1ACJA 1XTJA 3MWGA 3O0TA 1HE8B 5AJYA 3SDSA 5I4IA 5IHPA 4OJNA 4CIWA 5EFZA 4BLQA 1SG6A 1SHUX 1UP4A 3DWGA 4DCGA 4M9RA 2BGKA 2CVFA 2MYTA 2R6DA 3PFBA 4TWJA 3PX7A 4CMEC 2ON6A 4QOFA 3SK0A 1C80A 1D7AA 2NZ2A 5JE8A 3WK5A 1S8OA 1LA2A 2CL5A 1SCNE 2LKCA 2XUGA 1WWKA 2Z1DA 3OY2A 4NABA 3RWMB 2J3MA 2H2IA 1VE5A 1H5NA 1WV1A 3NHBA 3FYDA 4CG0A 4WOCA 3QLUA 4ZO7A 2FPGB 2V6IA 2YHIA 4KQKA 4KFTA 1V8DA 4LK3A 1YRHA 2G0AA 1D2CA 1RIIA 1RLIA 2KW5A 4TV9A 3W2EA 2K7FA 2YRWA 3M4YA 3PPYA 2Q4TA 1U2GC 3KOZA 3MJHA 5FHQA 4BBPA 1UZUA 4W1SA 4W1PA 4BQOA 5KDOA 3LLUA 1JTFA 3IV6A 3RRXA 4R7TA 2QORA 3RU7A 4LZPA 1AKYA 5JJKA 2EJCA 2P0YA 4PG6A 1IJEA 2H2AA 5AKYA 5E3HA 4YRDA 2WVAA 4IJUA 3AEUA 2E48A 2OVBA 1YKFA 5CVVA 1FFYA 1ETUA 3A58B 3T12A 3GAZA 5BNTA 1L5OA 4TTTS 4DIEA 4ZDIA 4C87A 4ASUD 5L3QB 2OCYC 3I9V1 5JCZA 1JDVA 1DAIA 1G7CA 1DG9A 4TQ9A 4TM8A 2GCGA 4KXQA 4Z7NB 3BF7A 4GBED 1Z35A 1TJ3A 2AXNA 3ZOZA 5JARA 1SHKA 3S8YA 3HXMA 3IAM1 2RCYA 4BE4A 2O8BA 2CDBA 4Y9RA 1JQLB 4RVFA 5FAXA 3VVLA 4I66A 2A94A 2YRFA 2PX5A 4DJEC 4NBVA 3LUPA 5FUVA 1Y9ZA 4NL4H 4HGPA 4BUJA 1KNQA 4LY6A 3OKCA 5K7SA 4AKIA 3S5JA 4QYIA 1JHZA 4RVGA 3BQ9A 3DQQA 1RI1A 1E3DA 4N6GA 3ENKA 3ICEA 1DIHA 3CKKA 4HGOA 3FSJX 1V2GA 1AKTA 2WUVA 4L4RA 1X7WB 4RANA 1IHXA 5J2TA 1H1LB 1EXNA 4HH1A 4GPIB 3UWSA 3NTOA 3HDQA 5AW9A 4ZRNA 3H0KA 1I51A 5KQLA 1ZI9A 3GI1A 4I8IA 1OY1A 4B3DA 1WY5A 1F2DA 2XKBA 3QLVC 4PZCA 4QBKA 5K51A 1GTL1 1MVLA 1NZJA 2PSJA 2BDEA 2WK1A 1AUXA 3NC4A 4JASB 1SCDA 4PC6A 3W3AH 4GQAA 4BU1A 3RAEC 5CDUA 2F55A 3IODA 1IZ0A 4OX9B 1LRKA 3K9CA 2WJPA 5DTJA 4JI0B 4R01A 2H8GA 5JCOA 3U09A 4C0JA 1ST2A 4HYEA 4BMSA 2FDRA 4IIJA 1OXSC 2Q07A 3A9RA 4R1PA 4PSDA 1KDPA 5SZJA 4ZGGA 3M8KA 1I7NA 2A4KA 1QU3A 4K9FA 3RJZA 5KCZA 1E0DA 5CYOA 3W1WA 4DDKA 5KC8A 4C78A 3MW8A 3ZLUA 5FPTA 2HAEA 3SLGA 4NU8X 5JNTA 3WV5A 4S2UA 1XRMA 2A88A 4OQYA 2ZU0C 3Q11A 2Z6UA 3OOWA 4MVYA 2ZM6B 2VDOB 5FWDA 1VJRA 1WZEA 3IV7A 1D1TA 2JI7A 1XA3A 2B7BA 2JGFA 2H2GA 1NFQA 2I3DA 2WJVA 1UZNA 3PC4A 3Q40A 4P3OA 4AF6A 2X9LA 3EQZA 4R3UC 4DC9A 2A5LA 2NM0A 2DR3A 1VJCA 1ZX1A 3BZUA 3MTEA 2GASA 4JEMA 2OPBA 4JVNA 1QWOA 3D7LA 4I5IA 4R2LA 1GSOA 3P96A 4DNOA 2ECKA 1ZYUA 2HJWA 3ESYA 4IX9A 3PHHA 5H7XA 3HN2A 1DEOA 3FDIA 1GAEO 1AKMA 4RTQA 4ME6A 4MWEA 3ZJVA 4HPXB 1XIVA 1DVBA 2OD7A 4DG5A 1PR5A 5J4KA 3TSOA 1V25A 3ECCA 5JRDS 3OIDA 2I5PO 2BEWA 3KFXA 1F8XA 1PJSA 4D81A 1TKCA 4IHJB 3DO8A 2GM5A 3AVPA 4UAVA 2WB1P 1JF8A 2WNSA 2XZDA 3OT1A 3QKIA 2CUNA 4KZKA 4MWOA 4XCXA 1NQAO 3OTIA 3UC9A 3EVDA 2OO3A 1S2OA 2Y4OA 2JW5A 1Z5WA 4G09A 4JJ8A 3WMGA 1P0PA 4H3KB 4LSWA 2KM1A 2BC9A 5F5LA 3UWPA 3W5IA 2GEBA 3THWB 1SZDA 2O8VA 1NNSA 1V2HE 3AVXA 4G97A 2J33A 4QUAA 5FOQA 4OLAA 2PXHA 5FTWA 2XAUA 1Z6QA 5GJBA 4WXHA 3PWFA 3TRJA 1N8TA 3B53X 3IESA 2R6AA 3W5HA 4E3ZA 4Q00A 1UM8A 1VLVA 3T1TA 1I5EA 3DNPA 1KYQA 4A5OA 2RAPA 4F4JA 1TM2A 1DX4A 1UH5A 1PP4A 4HGZA 3EIWA 2RK4A 4MCAA 1LTQA 2ORVA 3VPCA 2X9QA 4ZO4A 3F6EX 5D6OA 2ZSJA 4D0SA 4XGIA 5KKCA 3WLSA 2AF4C 2Q4OA 2VDMB 2X8JB 1BGWA 4CT5A 1QVWA 1QFJA 5IMSA 2WU0A 3TTWA 4DVGA 2PBZA 4ZCIA 3H86A 3S1LA 1P61B 3B82A 4N49A 4UJ5A 1SMUA 2EXXA 3HA2A 3LWDA 4PICA 3K0CA 2CV0A 1TKAA 2P3SA 3BDIA 3MQFA 5DBGA 3R41A 2P68A 2WUDA 1ZD4A 4MWZA 3FNGA 4QYXA 4CKXA 1VZIA 1XVVA 3O3NB 1OBCA 1PW7A 2EL7A 2Q50A 3PUZA 4QG7A 3ZZ0A 1HRDA 3KTOA 1DFGA 3OQPA 3KYCB 5CAEB 5ESWA 5FYQA 2OQVA 4BWVA 5CB8A 1NN3A 4PINA 4NBNA 2C5GA 3OF5A 1C0LA 4YJ3B 3ZTTA 3LWOB 4E94A 2QIOA 2OSVA 1H6BA 1ZU4A 3PF8A 2P41A 3NT2A 1RJDA 3TNLA 3OSUA 3HPQA 4TQAA 1P1HA 1GLGA 1JG1A 2PGJA 1T9BA 3U3DA 2UU9B 1V5GA 1IEVA 4JYPA 4PZAA 4Z1OA 2CJPA 2JVIA 3GJQA 2H4HA 3CX3A 5CVEA 7YASA 2JFNA 2I9PA 2C96A 1GUFA 2Q8QA 3MSXA 4Q4JB 4W5JA 3HA3A 3IHWA 2ISCA 2TMDA 1DDGA 1XNHA 4AWBA 5BMVF 1DZ3A 1G9XA 2ZIFA 3KFLA 2YQ4A 1GZ3A 4IRUB 1GWNA 4RABA 2EJUA 2OR3A 3GQBB 1D6SA 3BIFA 1JJ7A 3WBBA 1J39A 2GAOA 3ORSA 1TVCA 3JQAB 3NV7A 1VLZA 3HDHA 2GTIA 4H6WA 4RD1A 3NONA 4L6CA 4YRPA 5J47A 4JAEA 5BW6B 5EHXA 1RXWA 4DG9A 1IQ0A 2M1ZA 2Y71A 3GTKL 1GSAA 3V33A 5BSMA 1U4NA 1XO1A 2JI3A 2PMCA 1HNXB 3LWZA 2X8WA 4UMVA 5DXJA 2BSAA 4ZVNA 3UAVA 1ADFA 1IIRA 3JPYA 4F9EA 1ZOIA 1VJ1A 3KAKA 4RUKA 2H0QA 5DCLA 3TTXA 4A0FA 3RIHA 4JVSB 1JFSA 3IKVA 3FUVA 5B3KA 3CVYA 5DGXA 3N53A 1RZRA 4PO3X 5FOTA 2BRUC 3WGIA 4AJLA 2ZYTX 2OC4A 4BP9A 1U2EA 3B52X 4PX2A 1NP6A 1LRJA 1U5BA 1S89A 1E3LA 3QU4A 1KJWA 3U17A 2RHTA 4UM7A 1L5SA 2IPNA 4EPXA 2I67A 1Y4AE 4BXOA 4HY3A 4UHEA 5CEFA 2P65A 2R68A 3GG2A 1Z62A 2EEZA 3PXEA 3NIWA 5BYBA 2J7PA 4XR4A 2I2XB 4ABTA 2ZWOA 4ECEA 2ZYGA 4Y0AA 1LVGA 3KQPA 4JJEA 4B6OA 3LHIA 4L5JA 1IMOA 4WFIA 4WZAE 4M38A 2ZIVB 3G2IA 1BNCA 1MRSA 2FAXA 3CSDA 1P2BA 4D2IA 2G6BA 2AUNA 1KYXA 2V96A 4YI5A 3TM5A 2XTMA 4F84A 1XQYA 1RAFA 1ZXLA 1HFEL 1W29A 1E98A 2FA9A 3CS3A 2QLBA 1F2UA 4KVAA 1EWYA 1CUAA 1QRAA 4UM9D 4RMGA 4IX1A 2J0SA 1H93A 4HFMA 1N36B 4JLUA 1IBKB 4IWYA 1HE5A 3Q7QA 1FJ2A 3A9CA 4Q1FA 3NDRA 4O4LA 1TW3A 4IINA 4YMIA 5CG2A 3DMRA 3GRKA 4RYDA 4C6SA 3QFSA 2C0CA 3LDHA 3T3PB 2RGGA 2QY6A 2HPZA 1XCPA 3N8HA 2XJQA 1GG9A 1HL7A 3DVRX 3EULA 4PBTA 3ZIUA 4AO8A 2WM8A 2YH2A 3GLHE 4D6XA 5EY5B 3HWSA 4UCFA 5K4HA 1AGNA 1NVVR 2R1UA 1EUZA 1QGAA 4EEXA 1USIA 3MAAC 4UUNA 4WZBA 2Q4EA 4H3SA 4HUTA 1YVPA 1T2UA 3KYJB 4R7GA 1OIWA 1VE9A 4COKA 1DJPA 1M7HA 4GQIA 4LZLA 3WYFA 5CFPA 1CUFA 4BFXA 3ZHRA 5JDIC 1DELA 1CP3A 2XUDA 1ODLA 3UHAA 1WCIA 2VDPB 1G8FA 4AG5A 5RXNA 3DOCA 3ZKAA 3FCEA 4XLZA 4O2BA 4ZVOA 3IVMA 1HTWA 2CLIB 1TZCA 4PTZA 3TZHA 5KWIA 3BMCB 3LQ1A 4NFLA 2WNHA 3B6ZA 3OJEA 2B6NA 2YICA 3K09C 5TPZA 5LNK1 3RS8A 2N46A 5M7EA 4OX9Y 6RXNA 1A9YA 1C09A 1QYDA 5HSGA 5DEIA 4GR9A 5GV7A 2HIHA 2BTQA 3S2DL 5FX2A 2J6HA 3MBOA 4TTPA 2H0AA 4V24A 4O1MA 5C4JL 5JATA 3RRFA 1CUUA 4X92A 2YFYA 3QEBZ 1OMOA 1AQNA 3RLIA 2GTPA 5AXBA 5JVDA 4W5TA 4NR0A 4CKWA 4C6TA 4DQKA 3DE4X 4ZZ0A 1JPUA 3G5MA 4V0OA 4L4ZA 3AR8A 4WTOA 2OUIA 2F67A 1H0HA 4ADSG 3FVQA 4H08A 4LAFA 4CM4A 4KRFA 4KU4A 1LD3A 1SWWA 1GYPA 1DJNA 1SWVA 2H4YA 2R96A 4KLZA 2YV2A 5H3LA 4ZHSA 1BKSB 2XB6A 2WAMA 4Q7EA 1D5CA 2X40A 3D0OA 4OATA 1BE0A 1U9IC 1S3IA 2P9EA 4U9IS 1IVYA 4C7OB 5B30A 2DPGA 5ER6A 4Z1MD 3ZGXA 2PVCA 4TX1A 2W2PA 1NPYA 1NT4A 4IJ5A 3FAKA 4OB7A 3CB4A 4L78A 1YACA 2EWWA 2UVPB 2ASEA 4JB0A 4II3A 5H0IA 2F6RA 1NYTA 3AIMA 5KB3A 2J6BA 2ZWIA 4N12A 4U0KA 2HXSA 4WLNA 3V4RA 2Q0QA 1NQTA 4ZDJA 2H4FA 4US1R 4ZI7F 2R0QC 4WK2B 5TS3A 2K7ZA 2OV6A 1SMKA 2A6PA 4F38A 1JIKA 2PT6A 4ZVPA 2JIMA 4XVHA 3FPLA 4N7RA 1W5TA 1OLXA 1VL6A 1RWBA 4ZOLA 3UMVA 4A26A 3AEXA 1ZOLA 3O8CA 3RT9A 1DP4A 4K1XA 4EPRA 3JVVA 2NSDA 4ZAFA 4Y2XA 3EF1A 1ARZA 1R1DA 2DQYA 4TS4A 3CMCO 3ROEA 1M5TA 4B6EA 5KQRA 2WP8J 3CTMA 2O59A 2D7CA 2ZCVA 4KNVA 1J24A 3RFXA 5KTRA 1BH6A 4IG4A 1C5KA 1NXWA 4DYDA 1YBAA 4CUZA 2QRUA 2HMTA 1JLSA 3GWZA 2BW0A 3Q7PA 4G23A 1T5IA 4RY8A 2IYTA 2QD3A 3WI7A 4REMA 3UMRA 1FTNA 2JGEA 5G0UA 1UODA 4Y9SA 1ZINA 5EP2A 3RFTA 1NLMA 1K0FA 1XKQA 1N33B 3D5TA 3F7TA 1SFRA 4FE3A 3H2JA 3STHA 1XDZA 2HMSA 4CNBA 3AOEC 2PNFA 4QIWP 4X8OA 1ZA2A 2PKQP 2PPTA 1SUDA 1W88A 3THSA 4BO1A 5AHXA 4US0R 3OQOA 5L3VA 2NVTL 3KELA 1TYDE 4JXZA 3HHEA 4B8CD 1UPBA 2C5HA 2GM9A 5DKFA 1VJDA 1SOVA 2EP8A 4NE2A 1FQKA 2FPRA 4ESOA 3DEJA 2CF6A 4C2BA 1OWCA 2OP0A 4IIFA 3MJRA 4EPTA 4KDFA 3U4QB 1E5VA 3BTOA 3DL0A 2X4LA 3FTPA 3TW8B 1JJFA 1SVOA 2PQMA 5LBIA 3VH1A 4DMFA 2Q0XA 1JYEA 4GI1A 4Q7MB 1F06A 1RCTE 4HN9A 4UEOA 5DTRA 3RYIA 4CDRA 4D80A 4YCMA 4J9VA 2D3WA 3SVTA 1PG0A 5K3OA 2ZR0A 4TYNA 1DKLA 2CFRA 2R7AA 3HM9A 2IH5A 1TM5E 4EO9A 4OOEA 1YCFA 5F77A 1VOTA 4B0PA 5IEJA 1CNFA 1JWAB 2MINB 4QDXA 3IIMA 3QP9A 4DJFC 5KYUB 2YJ4A 2HHHB 3GGCA 3MHPA 3BD6A 4XOIA 1R74A 2FSFA 4CM6A 3PIRA 3LT5A 2AG1A 1O95D 1ODJA 2BHTA 2O2SA 3MNFA 4HNHA 3UJNA 2JAXA 2GTHA 4GXRA 1XVLA 1ZN7A 1EXMA 2BN4A 2F3SA 3HU1A 1QYIA 4P7KA 4Q03A 4TXJA 2AFIE 1DQYA 1SC4A 3IE1A 3H0EA 3B08B 1U98A 3PUXA 1YIOA 2HV8A 5JOQA 2F1OA 3J7Y1 1TGVA 1Y6RA 2A9QA 4V0LA 3QKSB 2CXTA 3A6DA 1RKVA 2VP2A 3JQ8A 1JP7A 4WEOA 1FDOA 3D4LA 3KSZO 3NM4A 4H16A 4ACAA 1FQOA 2OOSA 4PSKA 3T8YA 4D26A 2OESA 4Q18A 3SICE 2OFPA 3LVBA 3FTQA 2EDCA 3RG2A 3PPWA 1IONA 3CY6A 3TYXA 4HXFB 3U26A 5C7LO 3KUKA 4I2VA 3EF3A 4AO6A 1IJBA 1A7KA 2Z58A 4WESA 3KWLA 5SY9A 1ZJZA 4EP1A 4YRJA 2BIFA 3UEOA 1MV5A 4CTKA 3Q3VA 4ZT2A 3WBFA 1R8QA 1AGRA 3WBJA 3E3LA 4TL7A 1Q22A 2G07A 3DR3A 3FKQA 4RH1A 4BE9A 1MUUA 4RD6A 3DAFA 1GRRA 2R1TA 3I6QA 4HQ0A 3V48A 1NQOA 3HXPA 2G06A 2ID7A 1XEFA 3BD9A 3PDIA 2DSTA 5TV2A 4HGQA 1QFXA 1GP2A 4MWBA 1QFZA 4MNTA 2JBHA 5KTTA 3KB8A 4M8IA 1HT0A 2CHGA 3CBQA 2C7VA 4GP7A 4ALKA 1UC8A 2GAJA 2YMMA 4BV3A 1KO4A 2Q5JA 1VMEA 1HLFA 1FE8A 4U1RA 1RAGA 1M2KA 4C76A 1ATZA 2VRBA 2IZ0A 1E64A 4G5FA 1KEZA 3T7RA 5BMVB 4O2AB 2G36A 2MWMA 4RSRA 2FP4B 2MIIA 5ADVA 2XTAA 4MDEA 2CD7A 3Q8LA 4YUYA 1JG3A 1U31A 2VPWA 5LWHA 1TEVA 1O94C 5ELLA 3NTLA 5BT9A 1T13A 4M1EA 4M3NA 3U7GA 2QTMA 5ALXA 1AKVA 4ND2A 3OFSA 5D85A 5FUYA 4ARAA 1R66A 3MB8A 4JAGA 2NNLD 4JDPA 4KO8A 1N2CB 1MQ9A 1OV4A 1D7OA 3BMQB 4G01B 4YAIA 3FD8A 1F8GA 5CA1A 4A8TA 1LTHR 3H2KA 5IP5A 3MCZA 2I22A 4I1OA 4G26A 1MAVA 3KOMA 1KH2A 3QMMA 4LWPA 3VR3D 1E1MA 5JU6A 3TIIA 1E7MA 1Q2UA 2C20A 3GEMA 3TPFA 1JTEA 4Y98A 1PX0A 3D8BA 4H17A 4HLDA 1SUPA 1FCJA 5HKLA 3GH3A 4Q19A 1L7RA 4GI2A 2NVWA 1GL3A 2JFGA 4PIVA 3Q3CA 4L8LA 1ZIXA 2PS3A 2GZ2A 4Q9DA 4HHEA 3WRYC 4IIHA 3LWQB 1KZHA 3ZWKA 2AWOA 2PX6A 3MPUA 2A9VA 3N0TA 4W5HA 3ZY4A 5LU8A 1VYHA 3CEHA 4BZPA 5CFOA 5KWEA 3JQFA 3G0IA 3BBPA 4WXPA 2ZIGA 1SC6A 4XVRA 3IEPA 3SE7A 3WSVA 3H2BA 3WISA 1E4VA 1V7QA 2IHKA 1YL6A 1WETA 1QUEA 2CDNA 5KNBD 2CMFA 3MJVA 4KXUA 3UGQA 1OTYA 2QZPA 3JWJA 1BU5A 3OC6A 1U2TA 2AJLI 3OIVA 3OIYA 5G02A 3ZWYA 3LUBA 3LP6A