2M4VA

Mycobacterium tuberculosis rna polymerase binding protein a (rbpa) and its interactions with sigma factors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
SMADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis RNA polymerase-binding protein A (RbpA) and its interactions with sigma factors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.270 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2m4vA00
2M4VA 2M6OA 2M6PA
chains in the Genus database with same CATH superfamily
5GAGc 1IU5A 2NVXL 1I3QL 1JYBA 3HOUL 3NFPI 3S14L 5IY0A 4K9FA 3FDJA 2MS3A 2Y0SP 2XJQA 5EINC 1DX8A 3LWRB 3JR7A 4YWMA 1NXEA 3M4OL 2JA6L 3LWOB 3J7Y1 3FKIL 1B71A 3QQCE 4A3KL 1RYTA 5M5YL 3MSUA 3K7AL 4C2M1 4V196 1T9OA 1VZIA 2ZIXA 3HOVL 2M6PA 3CQZL 4AHZA 3LWQB 4E6YA 1R0HA 3RZ6A 1DVBA 3GTML 4A3BL 4YWLA 4JADA 5FJ8L 3ZG6A 3S1ML 2M4YA 3K35A 5IP9L 2CKAA 2M6OA 4AR3A 1B2JA 4AR5A 1YK4A 4ZN3B 3PL5A 1SMUA 4POFA 6RXNA 1RDVA 1TWHL 3GTGL 3VPBE 4AR4A 2V3BB 2V0EA 4A3IL 3HAXC 1F4LA 4AYBP 5EIOC 3S1QL 1LKMA 5M5WL 5IP7L 5JVG1 2E2JL 1QCVA 5C4JL 3GTOL 3MPSA 4BXXL 2RDVA 4POGA 4AHWA 4AHXA 1YK5A 2HVYC 5MFZA 2DSXA 3H9CA 2VL6A 1IU6A 2R7ZL 5C44L 1VZGA 1BQ8A 2LCQA 1WCML 1S24A 4A3CL 3PWFA 3P2AA 2JA5L 1NNQA 5GAHc 1NXGA 3MQKB 1CAAA 5MLC3 3KYUA 2AQCA 2XJPA 1RWDA 2KN9A 3LWPB 2PPTA 2H12A 2C6AA 3WWLA 3GTQL 1BFYA 4A3EL 2ERSA 5MGNA 4A3FL 1IW7D 2XJSA 1TWFL 4AI3A 3LNLA 3HOZL 1TWCL 3PO3L 2M4VA 1E8JA 5IYBL 2QL0A 4X6AL 2Z3RB 4BBSL 2PMZP 2PSMC 1LTLA 2BE5D 3H3VM 2V0FA 5FLML 1I6HL 4AI0A 3I4ML 1T9PA 5GADc 3S2HL 2R93L 3B0AB 1I50L 3GTPL 5JVH1 2APOB 4AR6A 4LHNA 2XJUA 2A6ED 2NVYL 1R9TL 5AI3A 3SS2A 3PIP1 2EY4E 1IROA 2C6BA 1CADA 1K83L 2O5JD 1RB9A 3H9BA 2A68D 3PO2L 5M5XL 3IU3I 2HR5A 3S1NL 2L0ZA 3RZOL 2J9UB 1C09A 1TWGL 1LKOA 2XJTA 1ZRPA 4TPUA 2JI1A 4G6BA 2A6HD 1PFWA 1SMMA 1YUXA 4C3JL 1OWBA 4BY1L 4QIWP 1T9QA 5IYDL 2A69D 2ERJA 4ZN1B 3PZAA 3S15L 4A3JL 3RYGA 4A3LL 3H0GL 3GTJL 2CR8A 1S30A 4ME3A 5K2ME 2JA7L 2PYAA 5RXNA 1Y1VL 3GTKL 2CKCA 2K2DA 4GS7D 1YV1A 8RXNA 3S2DL 1PFUA 1R0FA 3HKZP 4Y7NL 4JAGA 2NVQL 3S17L 1SMWA 1Y1WL 3PKJA 1H7VA 1OWCA 3RZTA 1IRNA 3H97A 1ODHA 5DM71 3I4NL 2PVXA 2WB1P 2E2HL 2JI2A 4C3HL 4JAFA 3KYVA 4BY7L 1RYQA 3B08B 1P7PA 2AYJA 2NYDA 1S2ZA 3PKIA 2B63L 3J7Z1 5IYCL 4XXBB 4B8CD 5M3ML 5H1Sc 4JAEA 4C3IL 3HJYB 5GAEc 1B2OA 3KYYA 2GMGA 4A93L 1FHMA 3RZDL 3GTLL 3S16L 3H99A 3KYXA 2KKDA 1QYBA 3LPEB 2YU9L 2R92L 1QQTA 4A3GL 4A3DL 1TWAL 5AN9H 2VUML 1RDGA 3P8BA 5MF6A 3S1RL 3HOYL 2WAQP 1BE7A 1VZHA 2AUSB 2JA8L 2Z3QB 1BRFA 1B13A 4AI1A 4RXNA 4AHYA 5DM61 2B5ID 5C3EL 7RXNA 3QVDA 3HOXL 3M3YL 1R0JA 1VCXA 4UY81 5M3FL 1WJVA 1PZXA 2XJVA 2E2IL 2NVTL 3LWVB 2RFKB 1LKPA 4LHLA 3A44A 5MFPA 2XJRA 1PFYA 4A3ML 3PIO1 1BQ9A 2JI3A 1Z92B 1FHHA 1YUZA 1PFVA 4XGHA 5AI2A 1R0IA 4WFN1 2PVEA 4U671 4AI2A 1SFOL 4TVMA 1R0GA 4BBRL 3HOWL 3HJWB 3KYWA 5C4XL 4Y52L 3WWNB
chains in the Genus database with same CATH topology
1IROA 2C6BA 1CADA 5GAGc 1IU5A 1JYBA 5JVG1 4XXBB 1QCVA 4B8CD 2O5JD 1RB9A 3MPSA 3NFPI 4JAEA 5H1Sc 2RDVA 4POGA 4AHWA 2A68D 4AHXA 1YK5A 5IY0A 3IU3I 4K9FA 1B2OA 3KYYA 2GMGA 5MFZA 5GAEc 2DSXA 2MS3A 2HR5A 1FHMA 2L0ZA 2VL6A 2J9UB 2XJQA 1IU6A 5EINC 1DX8A 1C09A 1VZGA 1LKOA 1BQ8A 3KYXA 2KKDA 2LCQA 4YWMA 1QYBA 3LPEB 1S24A 2XJTA 1NXEA 3PWFA 1ZRPA 3P2AA 1NNQA 5GAHc 1NXGA 1CAAA 5MLC3 1RDGA 5AN9H 3J7Y1 4TPUA 2JI1A 1B71A 4G6BA 2A6HD 3KYUA 3QQCE 3P8BA 1SMMA 2XJPA 1YUXA 5MF6A 1RWDA 1RYTA 2KN9A 4AR6A 1OWBA 3MSUA 1BE7A 1VZHA 1T9QA 4V196 2A69D 2ERJA 4ZN1B 1T9OA 1VZIA 2ZIXA 2PPTA 2Z3QB 2M6PA 3PZAA 2H12A 2C6AA 4AHZA 3RYGA 3WWLA 1BFYA 1BRFA 2ERSA 4E6YA 5MGNA 1B13A 1R0HA 1IW7D 4AI1A 2XJSA 4AI3A 3RZ6A 1DVBA 3LNLA 4RXNA 2CR8A 1S30A 4AHYA 5DM61 4ME3A 5K2ME 2B5ID 7RXNA 4YWLA 2M4VA 3QVDA 2PYAA 1E8JA 5RXNA 4JADA 2QL0A 1R0JA 3ZG6A 1VCXA 2M4YA 3K35A 2CKCA 2CKAA 2K2DA 2M6OA 1YV1A 4GS7D 4AR3A 8RXNA 1B2JA 4UY81 4AR5A 1R0FA 2Z3RB 1WJVA 1YK4A 4ZN3B 2PSMC 1LTLA 4JAGA 2BE5D 2XJVA 4POFA 1SMUA 2V0FA 6RXNA 1SMWA 1RDVA 3PKJA 1H7VA 1OWCA 4AI0A 3RZTA 1IRNA 1ODHA 3VPBE 4AR4A 1T9PA 5GADc 2V3BB 3B0AB 2V0EA 1LKPA 4LHLA 5DM71 3A44A 5MFPA 5JVH1 2XJRA 2PVXA 2JI2A 4JAFA 3PIO1 3KYVA 1BQ9A 2JI3A 1Z92B 1FHHA 1YUZA 4LHNA 2XJUA 4XGHA 5AI2A 1RYQA 1R0IA 1LKMA 5EIOC 2PVEA 4WFN1 4U671 2A6ED 4AI2A 4TVMA 1R0GA 3B08B 2AYJA 3KYWA 2NYDA 5AI3A 3SS2A 3PIP1 1S2ZA 3WWNB 3PKIA 3J7Z1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4V A;  2M6O A;  2M6P A; 
#chains in the Genus database with same CATH topology
 5GAG c;  1IU5 A;  2NVX L;  1I3Q L;  1JYB A;  3HOU L;  3NFP I;  3S14 L;  5IY0 A;  4K9F A;  3FDJ A;  2MS3 A;  2Y0S P;  2XJQ A;  5EIN C;  1DX8 A;  3LWR B;  3JR7 A;  4YWM A;  1NXE A;  3M4O L;  2JA6 L;  3LWO B;  3J7Y 1;  3FKI L;  1B71 A;  3QQC E;  4A3K L;  1RYT A;  5M5Y L;  3MSU A;  3K7A L;  4C2M 1;  4V19 6;  1T9O A;  1VZI A;  2ZIX A;  3HOV L;  2M6P A;  3CQZ L;  4AHZ A;  3LWQ B;  4E6Y A;  1R0H A;  3RZ6 A;  1DVB A;  3GTM L;  4A3B L;  4YWL A;  4JAD A;  5FJ8 L;  3ZG6 A;  3S1M L;  2M4Y A;  3K35 A;  5IP9 L;  2CKA A;  2M6O A;  4AR3 A;  1B2J A;  4AR5 A;  1YK4 A;  4ZN3 B;  3PL5 A;  1SMU A;  4POF A;  6RXN A;  1RDV A;  1TWH L;  3GTG L;  3VPB E;  4AR4 A;  2V3B B;  2V0E A;  4A3I L;  3HAX C;  1F4L A;  4AYB P;  5EIO C;  3S1Q L;  1LKM A;  5M5W L;  5IP7 L;  5JVG 1;  2E2J L;  1QCV A;  5C4J L;  3GTO L;  3MPS A;  4BXX L;  2RDV A;  4POG A;  4AHW A;  4AHX A;  1YK5 A;  2HVY C;  5MFZ A;  2DSX A;  3H9C A;  2VL6 A;  1IU6 A;  2R7Z L;  5C44 L;  1VZG A;  1BQ8 A;  2LCQ A;  1WCM L;  1S24 A;  4A3C L;  3PWF A;  3P2A A;  2JA5 L;  1NNQ A;  5GAH c;  1NXG A;  3MQK B;  1CAA A;  5MLC 3;  3KYU A;  2AQC A;  2XJP A;  1RWD A;  2KN9 A;  3LWP B;  2PPT A;  2H12 A;  2C6A A;  3WWL A;  3GTQ L;  1BFY A;  4A3E L;  2ERS A;  5MGN A;  4A3F L;  1IW7 D;  2XJS A;  1TWF L;  4AI3 A;  3LNL A;  3HOZ L;  1TWC L;  3PO3 L;  2M4V A;  1E8J A;  5IYB L;  2QL0 A;  4X6A L;  2Z3R B;  4BBS L;  2PMZ P;  2PSM C;  1LTL A;  2BE5 D;  3H3V M;  2V0F A;  5FLM L;  1I6H L;  4AI0 A;  3I4M L;  1T9P A;  5GAD c;  3S2H L;  2R93 L;  3B0A B;  1I50 L;  3GTP L;  5JVH 1;  2APO B;  4AR6 A;  4LHN A;  2XJU A;  2A6E D;  2NVY L;  1R9T L;  5AI3 A;  3SS2 A;  3PIP 1;  2EY4 E;  1IRO A;  2C6B A;  1CAD A;  1K83 L;  2O5J D;  1RB9 A;  3H9B A;  2A68 D;  3PO2 L;  5M5X L;  3IU3 I;  2HR5 A;  3S1N L;  2L0Z A;  3RZO L;  2J9U B;  1C09 A;  1TWG L;  1LKO A;  2XJT A;  1ZRP A;  4TPU A;  2JI1 A;  4G6B A;  2A6H D;  1PFW A;  1SMM A;  1YUX A;  4C3J L;  1OWB A;  4BY1 L;  4QIW P;  1T9Q A;  5IYD L;  2A69 D;  2ERJ A;  4ZN1 B;  3PZA A;  3S15 L;  4A3J L;  3RYG A;  4A3L L;  3H0G L;  3GTJ L;  2CR8 A;  1S30 A;  4ME3 A;  5K2M E;  2JA7 L;  2PYA A;  5RXN A;  1Y1V L;  3GTK L;  2CKC A;  2K2D A;  4GS7 D;  1YV1 A;  8RXN A;  3S2D L;  1PFU A;  1R0F A;  3HKZ P;  4Y7N L;  4JAG A;  2NVQ L;  3S17 L;  1SMW A;  1Y1W L;  3PKJ A;  1H7V A;  1OWC A;  3RZT A;  1IRN A;  3H97 A;  1ODH A;  5DM7 1;  3I4N L;  2PVX A;  2WB1 P;  2E2H L;  2JI2 A;  4C3H L;  4JAF A;  3KYV A;  4BY7 L;  1RYQ A;  3B08 B;  1P7P A;  2AYJ A;  2NYD A;  1S2Z A;  3PKI A;  2B63 L;  3J7Z 1;  5IYC L;  4XXB B;  4B8C D;  5M3M L;  5H1S c;  4JAE A;  4C3I L;  3HJY B;  5GAE c;  1B2O A;  3KYY A;  2GMG A;  4A93 L;  1FHM A;  3RZD L;  3GTL L;  3S16 L;  3H99 A;  3KYX A;  2KKD A;  1QYB A;  3LPE B;  2YU9 L;  2R92 L;  1QQT A;  4A3G L;  4A3D L;  1TWA L;  5AN9 H;  2VUM L;  1RDG A;  3P8B A;  5MF6 A;  3S1R L;  3HOY L;  2WAQ P;  1BE7 A;  1VZH A;  2AUS B;  2JA8 L;  2Z3Q B;  1BRF A;  1B13 A;  4AI1 A;  4RXN A;  4AHY A;  5DM6 1;  2B5I D;  5C3E L;  7RXN A;  3QVD A;  3HOX L;  3M3Y L;  1R0J A;  1VCX A;  4UY8 1;  5M3F L;  1WJV A;  1PZX A;  2XJV A;  2E2I L;  2NVT L;  3LWV B;  2RFK B;  1LKP A;  4LHL A;  3A44 A;  5MFP A;  2XJR A;  1PFY A;  4A3M L;  3PIO 1;  1BQ9 A;  2JI3 A;  1Z92 B;  1FHH A;  1YUZ A;  1PFV A;  4XGH A;  5AI2 A;  1R0I A;  4WFN 1;  2PVE A;  4U67 1;  4AI2 A;  1SFO L;  4TVM A;  1R0G A;  4BBR L;  3HOW L;  3HJW B;  3KYW A;  5C4X L;  4Y52 L;  3WWN B; 
#chains in the Genus database with same CATH homology
 1IRO A;  2C6B A;  1CAD A;  5GAG c;  1IU5 A;  1JYB A;  5JVG 1;  4XXB B;  1QCV A;  4B8C D;  2O5J D;  1RB9 A;  3MPS A;  3NFP I;  4JAE A;  5H1S c;  2RDV A;  4POG A;  4AHW A;  2A68 D;  4AHX A;  1YK5 A;  5IY0 A;  3IU3 I;  4K9F A;  1B2O A;  3KYY A;  2GMG A;  5MFZ A;  5GAE c;  2DSX A;  2MS3 A;  2HR5 A;  1FHM A;  2L0Z A;  2VL6 A;  2J9U B;  2XJQ A;  1IU6 A;  5EIN C;  1DX8 A;  1C09 A;  1VZG A;  1LKO A;  1BQ8 A;  3KYX A;  2KKD A;  2LCQ A;  4YWM A;  1QYB A;  3LPE B;  1S24 A;  2XJT A;  1NXE A;  3PWF A;  1ZRP A;  3P2A A;  1NNQ A;  5GAH c;  1NXG A;  1CAA A;  5MLC 3;  1RDG A;  5AN9 H;  3J7Y 1;  4TPU A;  2JI1 A;  1B71 A;  4G6B A;  2A6H D;  3KYU A;  3QQC E;  3P8B A;  1SMM A;  2XJP A;  1YUX A;  5MF6 A;  1RWD A;  1RYT A;  2KN9 A;  4AR6 A;  1OWB A;  3MSU A;  1BE7 A;  1VZH A;  1T9Q A;  4V19 6;  2A69 D;  2ERJ A;  4ZN1 B;  1T9O A;  1VZI A;  2ZIX A;  2PPT A;  2Z3Q B;  2M6P A;  3PZA A;  2H12 A;  2C6A A;  4AHZ A;  3RYG A;  3WWL A;  1BFY A;  1BRF A;  2ERS A;  4E6Y A;  5MGN A;  1B13 A;  1R0H A;  1IW7 D;  4AI1 A;  2XJS A;  4AI3 A;  3RZ6 A;  1DVB A;  3LNL A;  4RXN A;  2CR8 A;  1S30 A;  4AHY A;  5DM6 1;  4ME3 A;  5K2M E;  2B5I D;  7RXN A;  4YWL A;  2M4V A;  3QVD A;  2PYA A;  1E8J A;  5RXN A;  4JAD A;  2QL0 A;  1R0J A;  3ZG6 A;  1VCX A;  2M4Y A;  3K35 A;  2CKC A;  2CKA A;  2K2D A;  2M6O A;  1YV1 A;  4GS7 D;  4AR3 A;  8RXN A;  1B2J A;  4UY8 1;  4AR5 A;  1R0F A;  2Z3R B;  1WJV A;  1YK4 A;  4ZN3 B;  2PSM C;  1LTL A;  4JAG A;  2BE5 D;  2XJV A;  4POF A;  1SMU A;  2V0F A;  6RXN A;  1SMW A;  1RDV A;  3PKJ A;  1H7V A;  1OWC A;  4AI0 A;  3RZT A;  1IRN A;  1ODH A;  3VPB E;  4AR4 A;  1T9P A;  5GAD c;  2V3B B;  3B0A B;  2V0E A;  1LKP A;  4LHL A;  5DM7 1;  3A44 A;  5MFP A;  5JVH 1;  2XJR A;  2PVX A;  2JI2 A;  4JAF A;  3PIO 1;  3KYV A;  1BQ9 A;  2JI3 A;  1Z92 B;  1FHH A;  1YUZ A;  4LHN A;  2XJU A;  4XGH A;  5AI2 A;  1RYQ A;  1R0I A;  1LKM A;  5EIO C;  2PVE A;  4WFN 1;  4U67 1;  2A6E D;  4AI2 A;  4TVM A;  1R0G A;  3B08 B;  2AYJ A;  3KYW A;  2NYD A;  5AI3 A;  3SS2 A;  3PIP 1;  1S2Z A;  3WWN B;  3PKI A;  3J7Z 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...