2M4VA

Mycobacterium tuberculosis rna polymerase binding protein a (rbpa) and its interactions with sigma factors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
b'SMADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis RNA polymerase-binding protein A (RbpA) and its interactions with sigma factors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.270 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2m4vA00
2M6OA 2M4VA 2M6PA
chains in the Genus database with same CATH superfamily
4POGA 4C3HL 2JA6L 2WAQP 3S17L 1RB9A 4X6AL 3GTPL 3J7Y1 1IW7D 2EY4E 3KYWA 4BY7L 3S14L 1R0IA 2PPTA 3K7AL 1FHHA 1RDVA 2O5JD 2C6AA 3RZTA 5RXNA 2NVYL 3PO3L 1LKPA 2AQCA 2NYDA 3KYXA 2H12A 4LHLA 1QCVA 1IROA 3PIO1 3J7Z1 3S16L 4ZN1B 3S1RL 3RZDL 1FHMA 3GTLL 3HOYL 1BRFA 2DSXA 5EIOC 2R93L 3GTML 1YUXA 4C3IL 3MQKB 3P8BA 1R9TL 2HVYC 4AI2A 3LWRB 2AYJA 5FJ8L 2JA5L 1F4LA 4A93L 3PZAA 4E6YA 1K83L 1PFWA 3MPSA 1RYTA 5DM71 5MFPA 1VZIA 4QIWP 4TVMA 1DVBA 4YWMA 4WFN1 5IY0A 2CKAA 1B71A 1TWGL 1IU5A 2XJRA 1PZXA 3PIP1 3B08B 3H99A 1IRNA 4AI1A 3GTKL 3KYUA 2B63L 1YK5A 1BE7A 5C3EL 2R7ZL 3B0AB 2C6BA 5M3FL 3HJWB 2XJSA 2M4VA 4A3FL 2KKDA 2JI1A 3RYGA 4ZN3B 4AR6A 4A3EL 3GTJL 5IP7L 4JAEA 5AI2A 3LPEB 2M4YA 2NVQL 2Y0SP 2XJQA 3K35A 1IU6A 5IYBL 2ERJA 2R92L 1P7PA 5K2ME 4K9FA 4C2M1 3A44A 3S1QL 3IU3I 4BBSL 4JAFA 2VUML 2YU9L 4Y52L 2KN9A 2JI2A 5MFZA 1TWHL 3RZ6A 3RZOL 1VZHA 2JI3A 3SS2A 3I4ML 5C4JL 1PFYA 3GTOL 4RXNA 4AR3A 3PO2L 1R0JA 3HOUL 3HOXL 5GAHc 2MS3A 2RFKB 5IYCL 2LCQA 2J9UB 1Z92B 2JA8L 2ERSA 4AHWA 2PVEA 1SMMA 4Y7NL 2V0EA 1OWCA 2Z3RB 3JR7A 2JA7L 1YUZA 2RDVA 1B2OA 3ZG6A 2XJTA 1H7VA 4C3JL 2L0ZA 3PKJA 2V0FA 3H9CA 5M5YL 4AHYA 1R0FA 3H97A 4G6BA 1T9QA 2A6HD 5MGNA 1TWAL 5GAEc 3S2DL 1LTLA 3LNLA 4BY1L 8RXNA 1B13A 3VPBE 4XXBB 2B5ID 1BQ9A 1T9PA 3KYYA 4A3BL 3WWLA 1PFVA 3GTGL 4LHNA 1Y1VL 4AI3A 4A3LL 2ZIXA 5JVH1 3P2AA 1WCML 3S15L 2NVTL 4U671 1ZRPA 3H0GL 5IP9L 2HR5A 1YK4A 3NFPI 4A3DL 1WJVA 1Y1WL 4GS7D 7RXNA 1NNQA 1BFYA 1TWCL 3PKIA 1I3QL 1VCXA 3HJYB 3QQCE 1RWDA 6RXNA 5GAGc 4A3GL 1S24A 4BXXL 4UY81 2PMZP 2PSMC 4TPUA 5IYDL 1S30A 5JVG1 1NXEA 1BQ8A 3M4OL 3WWNB 2A6ED 2E2IL 3LWPB 1DX8A 1QQTA 5MF6A 2XJPA 4A3ML 1JYBA 2VL6A 2AUSB 4AR5A 3H9BA 2NVXL 2APOB 2M6PA 4POFA 2WB1P 4AR4A 3LWOB 2XJVA 5C4XL 5GADc 5H1Sc 2K2DA 3FKIL 5MLC3 1I50L 1SFOL 2Z3QB 4A3IL 2A68D 3PL5A 2E2HL 5AI3A 4B8CD 1C09A 1LKMA 3PWFA 5DM61 1I6HL 1S2ZA 4YWLA 3KYVA 4A3JL 1TWFL 4AYBP 1R0HA 2PYAA 1B2JA 3H3VM 1RDGA 2QL0A 3LWVB 1CAAA 5M5WL 1ODHA 1CADA 5M3ML 3S1NL 1PFUA 2GMGA 3S2HL 4AI0A 2E2JL 3MSUA 1VZGA 3LWQB 4JADA 2A69D 3HOWL 1RYQA 1SMWA 4AHZA 1LKOA 2CR8A 4XGHA 3QVDA 3HKZP 5C44L 4A3CL 3HAXC 4AHXA 1R0GA 3HOZL 3CQZL 4ME3A 1YV1A 5EINC 2CKCA 1E8JA 5AN9H 1QYBA 5M5XL 4V196 2PVXA 3I4NL 2M6OA 4JAGA 1SMUA 1NXGA 3M3YL 2XJUA 3GTQL 1T9OA 5FLML 3S1ML 3HOVL 2V3BB 4BBRL 3FDJA 2BE5D 1OWBA 4A3KL
chains in the Genus database with same CATH topology
3B0AB 4POGA 2C6BA 5AI3A 4B8CD 1C09A 1LKMA 5GAEc 2XJSA 1LTLA 1RB9A 3LNLA 3PWFA 8RXNA 2M4VA 1B13A 3VPBE 4XXBB 2B5ID 5DM61 2KKDA 3J7Y1 1BQ9A 1T9PA 3KYYA 1IW7D 1S2ZA 4YWLA 3KYVA 3KYWA 3WWLA 1R0IA 2PPTA 2JI1A 3RYGA 4ZN3B 4LHNA 4AR6A 1FHHA 4JAEA 5AI2A 2PYAA 1R0HA 4AI3A 4G6BA 1RDVA 1B2JA 2O5JD 3LPEB 1RDGA 2QL0A 2M4YA 1CAAA 1ODHA 2ZIXA 2C6AA 1CADA 3RZTA 5JVH1 2XJQA 3K35A 5RXNA 3P2AA 2GMGA 1IU6A 1LKPA 4U671 4AI0A 2ERJA 2NYDA 3KYXA 2H12A 1ZRPA 5K2ME 3MSUA 4K9FA 1VZGA 3A44A 4LHLA 4JADA 2HR5A 2A69D 1QCVA 1IROA 1YK4A 3NFPI 3J7Z1 3IU3I 3PIO1 1WJVA 4ZN1B 1RYQA 4GS7D 4JAFA 7RXNA 1SMWA 1FHMA 1NNQA 1BFYA 4AHZA 2KN9A 2JI2A 5MFZA 3PKIA 1VCXA 3RZ6A 1BRFA 2DSXA 3QQCE 1RWDA 5EIOC 6RXNA 1VZHA 1LKOA 5GAGc 2CR8A 1S24A 2JI3A 3SS2A 1YUXA 4UY81 2PSMC 4TPUA 1S30A 4RXNA 5JVG1 4XGHA 1NXEA 3P8BA 3QVDA 4AI2A 4AR3A 1BQ8A 2AYJA 1R0JA 3WWNB 2A6ED 4AHXA 1DX8A 1R0GA 3PZAA 5GAHc 2MS3A 4E6YA 2LCQA 2J9UB 2XJPA 1JYBA 5MF6A 2VL6A 4ME3A 3MPSA 1RYTA 1Z92B 2ERSA 1YV1A 4AHWA 2CKCA 4AR5A 5EINC 5DM71 1E8JA 2PVEA 5MFPA 5AN9H 1VZIA 1QYBA 1SMMA 4V196 2V0EA 1OWCA 1OWBA 2PVXA 2M6PA 2Z3RB 4POFA 2M6OA 4TVMA 1DVBA 4AR4A 4JAGA 4YWMA 1YUZA 1SMUA 4WFN1 2XJVA 1NXGA 2RDVA 2CKAA 5IY0A 1B2OA 5GADc 2XJUA 2XJTA 1B71A 3ZG6A 5H1Sc 2K2DA 1H7VA 1T9OA 2L0ZA 1IU5A 2XJRA 5MLC3 3PIP1 3PKJA 3B08B 1IRNA 4AI1A 2V0FA 2V3BB 3KYUA 4AHYA 1YK5A 1R0FA 1BE7A 2BE5D 1T9QA 2Z3QB 2A68D 2A6HD 5MGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6O A;  2M4V A;  2M6P A; 
#chains in the Genus database with same CATH topology
 4POG A;  4C3H L;  2JA6 L;  2WAQ P;  3S17 L;  1RB9 A;  4X6A L;  3GTP L;  3J7Y 1;  1IW7 D;  2EY4 E;  3KYW A;  4BY7 L;  3S14 L;  1R0I A;  2PPT A;  3K7A L;  1FHH A;  1RDV A;  2O5J D;  2C6A A;  3RZT A;  5RXN A;  2NVY L;  3PO3 L;  1LKP A;  2AQC A;  2NYD A;  3KYX A;  2H12 A;  4LHL A;  1QCV A;  1IRO A;  3PIO 1;  3J7Z 1;  3S16 L;  4ZN1 B;  3S1R L;  3RZD L;  1FHM A;  3GTL L;  3HOY L;  1BRF A;  2DSX A;  5EIO C;  2R93 L;  3GTM L;  1YUX A;  4C3I L;  3MQK B;  3P8B A;  1R9T L;  2HVY C;  4AI2 A;  3LWR B;  2AYJ A;  5FJ8 L;  2JA5 L;  1F4L A;  4A93 L;  3PZA A;  4E6Y A;  1K83 L;  1PFW A;  3MPS A;  1RYT A;  5DM7 1;  5MFP A;  1VZI A;  4QIW P;  4TVM A;  1DVB A;  4YWM A;  4WFN 1;  5IY0 A;  2CKA A;  1B71 A;  1TWG L;  1IU5 A;  2XJR A;  1PZX A;  3PIP 1;  3B08 B;  3H99 A;  1IRN A;  4AI1 A;  3GTK L;  3KYU A;  2B63 L;  1YK5 A;  1BE7 A;  5C3E L;  2R7Z L;  3B0A B;  2C6B A;  5M3F L;  3HJW B;  2XJS A;  2M4V A;  4A3F L;  2KKD A;  2JI1 A;  3RYG A;  4ZN3 B;  4AR6 A;  4A3E L;  3GTJ L;  5IP7 L;  4JAE A;  5AI2 A;  3LPE B;  2M4Y A;  2NVQ L;  2Y0S P;  2XJQ A;  3K35 A;  1IU6 A;  5IYB L;  2ERJ A;  2R92 L;  1P7P A;  5K2M E;  4K9F A;  4C2M 1;  3A44 A;  3S1Q L;  3IU3 I;  4BBS L;  4JAF A;  2VUM L;  2YU9 L;  4Y52 L;  2KN9 A;  2JI2 A;  5MFZ A;  1TWH L;  3RZ6 A;  3RZO L;  1VZH A;  2JI3 A;  3SS2 A;  3I4M L;  5C4J L;  1PFY A;  3GTO L;  4RXN A;  4AR3 A;  3PO2 L;  1R0J A;  3HOU L;  3HOX L;  5GAH c;  2MS3 A;  2RFK B;  5IYC L;  2LCQ A;  2J9U B;  1Z92 B;  2JA8 L;  2ERS A;  4AHW A;  2PVE A;  1SMM A;  4Y7N L;  2V0E A;  1OWC A;  2Z3R B;  3JR7 A;  2JA7 L;  1YUZ A;  2RDV A;  1B2O A;  3ZG6 A;  2XJT A;  1H7V A;  4C3J L;  2L0Z A;  3PKJ A;  2V0F A;  3H9C A;  5M5Y L;  4AHY A;  1R0F A;  3H97 A;  4G6B A;  1T9Q A;  2A6H D;  5MGN A;  1TWA L;  5GAE c;  3S2D L;  1LTL A;  3LNL A;  4BY1 L;  8RXN A;  1B13 A;  3VPB E;  4XXB B;  2B5I D;  1BQ9 A;  1T9P A;  3KYY A;  4A3B L;  3WWL A;  1PFV A;  3GTG L;  4LHN A;  1Y1V L;  4AI3 A;  4A3L L;  2ZIX A;  5JVH 1;  3P2A A;  1WCM L;  3S15 L;  2NVT L;  4U67 1;  1ZRP A;  3H0G L;  5IP9 L;  2HR5 A;  1YK4 A;  3NFP I;  4A3D L;  1WJV A;  1Y1W L;  4GS7 D;  7RXN A;  1NNQ A;  1BFY A;  1TWC L;  3PKI A;  1I3Q L;  1VCX A;  3HJY B;  3QQC E;  1RWD A;  6RXN A;  5GAG c;  4A3G L;  1S24 A;  4BXX L;  4UY8 1;  2PMZ P;  2PSM C;  4TPU A;  5IYD L;  1S30 A;  5JVG 1;  1NXE A;  1BQ8 A;  3M4O L;  3WWN B;  2A6E D;  2E2I L;  3LWP B;  1DX8 A;  1QQT A;  5MF6 A;  2XJP A;  4A3M L;  1JYB A;  2VL6 A;  2AUS B;  4AR5 A;  3H9B A;  2NVX L;  2APO B;  2M6P A;  4POF A;  2WB1 P;  4AR4 A;  3LWO B;  2XJV A;  5C4X L;  5GAD c;  5H1S c;  2K2D A;  3FKI L;  5MLC 3;  1I50 L;  1SFO L;  2Z3Q B;  4A3I L;  2A68 D;  3PL5 A;  2E2H L;  5AI3 A;  4B8C D;  1C09 A;  1LKM A;  3PWF A;  5DM6 1;  1I6H L;  1S2Z A;  4YWL A;  3KYV A;  4A3J L;  1TWF L;  4AYB P;  1R0H A;  2PYA A;  1B2J A;  3H3V M;  1RDG A;  2QL0 A;  3LWV B;  1CAA A;  5M5W L;  1ODH A;  1CAD A;  5M3M L;  3S1N L;  1PFU A;  2GMG A;  3S2H L;  4AI0 A;  2E2J L;  3MSU A;  1VZG A;  3LWQ B;  4JAD A;  2A69 D;  3HOW L;  1RYQ A;  1SMW A;  4AHZ A;  1LKO A;  2CR8 A;  4XGH A;  3QVD A;  3HKZ P;  5C44 L;  4A3C L;  3HAX C;  4AHX A;  1R0G A;  3HOZ L;  3CQZ L;  4ME3 A;  1YV1 A;  5EIN C;  2CKC A;  1E8J A;  5AN9 H;  1QYB A;  5M5X L;  4V19 6;  2PVX A;  3I4N L;  2M6O A;  4JAG A;  1SMU A;  1NXG A;  3M3Y L;  2XJU A;  3GTQ L;  1T9O A;  5FLM L;  3S1M L;  3HOV L;  2V3B B;  4BBR L;  3FDJ A;  2BE5 D;  1OWB A;  4A3K L; 
#chains in the Genus database with same CATH homology
 3B0A B;  4POG A;  2C6B A;  5AI3 A;  4B8C D;  1C09 A;  1LKM A;  5GAE c;  2XJS A;  1LTL A;  1RB9 A;  3LNL A;  3PWF A;  8RXN A;  2M4V A;  1B13 A;  3VPB E;  4XXB B;  2B5I D;  5DM6 1;  2KKD A;  3J7Y 1;  1BQ9 A;  1T9P A;  3KYY A;  1IW7 D;  1S2Z A;  4YWL A;  3KYV A;  3KYW A;  3WWL A;  1R0I A;  2PPT A;  2JI1 A;  3RYG A;  4ZN3 B;  4LHN A;  4AR6 A;  1FHH A;  4JAE A;  5AI2 A;  2PYA A;  1R0H A;  4AI3 A;  4G6B A;  1RDV A;  1B2J A;  2O5J D;  3LPE B;  1RDG A;  2QL0 A;  2M4Y A;  1CAA A;  1ODH A;  2ZIX A;  2C6A A;  1CAD A;  3RZT A;  5JVH 1;  2XJQ A;  3K35 A;  5RXN A;  3P2A A;  2GMG A;  1IU6 A;  1LKP A;  4U67 1;  4AI0 A;  2ERJ A;  2NYD A;  3KYX A;  2H12 A;  1ZRP A;  5K2M E;  3MSU A;  4K9F A;  1VZG A;  3A44 A;  4LHL A;  4JAD A;  2HR5 A;  2A69 D;  1QCV A;  1IRO A;  1YK4 A;  3NFP I;  3J7Z 1;  3IU3 I;  3PIO 1;  1WJV A;  4ZN1 B;  1RYQ A;  4GS7 D;  4JAF A;  7RXN A;  1SMW A;  1FHM A;  1NNQ A;  1BFY A;  4AHZ A;  2KN9 A;  2JI2 A;  5MFZ A;  3PKI A;  1VCX A;  3RZ6 A;  1BRF A;  2DSX A;  3QQC E;  1RWD A;  5EIO C;  6RXN A;  1VZH A;  1LKO A;  5GAG c;  2CR8 A;  1S24 A;  2JI3 A;  3SS2 A;  1YUX A;  4UY8 1;  2PSM C;  4TPU A;  1S30 A;  4RXN A;  5JVG 1;  4XGH A;  1NXE A;  3P8B A;  3QVD A;  4AI2 A;  4AR3 A;  1BQ8 A;  2AYJ A;  1R0J A;  3WWN B;  2A6E D;  4AHX A;  1DX8 A;  1R0G A;  3PZA A;  5GAH c;  2MS3 A;  4E6Y A;  2LCQ A;  2J9U B;  2XJP A;  1JYB A;  5MF6 A;  2VL6 A;  4ME3 A;  3MPS A;  1RYT A;  1Z92 B;  2ERS A;  1YV1 A;  4AHW A;  2CKC A;  4AR5 A;  5EIN C;  5DM7 1;  1E8J A;  2PVE A;  5MFP A;  5AN9 H;  1VZI A;  1QYB A;  1SMM A;  4V19 6;  2V0E A;  1OWC A;  1OWB A;  2PVX A;  2M6P A;  2Z3R B;  4POF A;  2M6O A;  4TVM A;  1DVB A;  4AR4 A;  4JAG A;  4YWM A;  1YUZ A;  1SMU A;  4WFN 1;  2XJV A;  1NXG A;  2RDV A;  2CKA A;  5IY0 A;  1B2O A;  5GAD c;  2XJU A;  2XJT A;  1B71 A;  3ZG6 A;  5H1S c;  2K2D A;  1H7V A;  1T9O A;  2L0Z A;  1IU5 A;  2XJR A;  5MLC 3;  3PIP 1;  3PKJ A;  3B08 B;  1IRN A;  4AI1 A;  2V0F A;  2V3B B;  3KYU A;  4AHY A;  1YK5 A;  1R0F A;  1BE7 A;  2BE5 D;  1T9Q A;  2Z3Q B;  2A68 D;  2A6H D;  5MGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...