3ZG6A

The novel de-long chain fatty acid function of human sirt6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
MNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sirt6 Regulates Tnf-Alpha Secretion Through Hydrolysis of Long-Chain Fatty Acyl Lysine
pubmed doi rcsb
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-6
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 98
structure length 294
sequence length 294
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3zg6A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3zg6A01
1O97D 4K9LA 4JD5A 5D7NA 4C7BA 4JUDX 5K6TA 1V5EA 3F6EX 5DGDA 5MGNA 5MFPA 2OD7A 5BWOA 4TWJA 3FSJX 4BN4A 4UTNA 3F6BX 2Q5LA 4X3OA 2H2DA 4V1CB 1PI3A 4HDAA 1SZDA 4ZZIA 3U3DA 3PDHA 3CLTD 4KGDA 1EFVA 1PVDA 4QELA 4BUZA 1OZGA 1YTLA 4JUFA 2AG0A 3CLUD 1BFDA 3ZG6A 2FRDC 1D4OA 3GLRA 2IHVA 2Q5OA 2OD2A 1UPAA 2FR8C 4K9PA 4IF6A 4J1TC 2Q29A 1U31A 2UZ1A 1YHYA 1M2NA 2BRUC 1Q6ZA 4JT9A 4K9QA 4GM0A 4GG1A 3CLSD 1PO7A 1POWA 2IHUA 1YBHA 2IHTA 2OD9A 1Q14A 1V5GA 1M2JA 2FWNA 3EA4A 4UUAA 5EJ8A 4MPRA 4C78A 3IAEA 4BVEA 1DJLA 1EFPA 3D4BA 5EJAA 1XLTC 4RMGA 4IAOA 4UTZA 2QQFA 3GLSA 1SZCA 4UUBA 4MQ5A 1NM5C 2PGOA 3ZGOA 3K35A 1ICIA 2Q5JA 2UZ1B 1U2DC 1QPBA 1POXA 2JI7A 2H2HA 5IMSA 1HZZC 2AG1A 4KPUA 2EZUA 4TWIA 5BWNA 5MF6A 4D5EA 2H2IA 4BV2A 3E9YA 5MFZA 2VK8A 2H59A 2JLAA 2H4FA 5DEIA 2JLCA 4UTVA 4L2IA 4K9OA 3PKJA 3CLRD 2JI9A 1YI1A 2VJYA 2QQGA 1PTJC 2EZ4A 2HJHA 3EY9A 4Q9DA 4BVHA 5EJ6A 2Q28A 1T9DA 1U2GC 3LQ1A 4Y6LA 4G1CA 2VK1A 2FN3A 2NYRA 3EYAA 5AHKA 1T9CA 2VBIA 5EJ7A 1O96B 3PKIA 2WVGA 4R8MA 1YC2A 4FVTA 2OORC 3GLUA 1T9BA 3OE1A 1Z8NA 2VBGA 1PNQA 2FSVC 3ZGVA 2JI6A 3U31A 1J8FA 4GM4A 1YI0A 4JUAA 4K9MA 2JIBA 2WVHA 3FLMA 3HWX1 4L3OA 4RMHA 4RJIA 4UTRA 1UPBA 4JU9A 5FYQA 4F4UA 2PANA 1Q17A 2EZ8A 5EJ9A 3CF4G 3FZNA 4GPEA 5DGTA 1Y9DA 4MZXA 4GM1A 4BVFA 2H2FA 4O8ZA 4QQ8A 4JU8A 1JSCA 4UTXA 1MA3A 5K3SA 4JUCA 4UU7A 2EZTA 1MCZA 5EJ4A 3JWPA 2X7JA 3RIYA 2A1UA 1N0HA 1M2KA 2WVAA 4BVGA 2OO5C 2Q5QA 2H4JA 3D81A 4D5GA 2H2GA 4COKA 4RMIA 3JR3A 4FEGA 4RMJA 4Y6OA 4BVBA 5BWLA 1PNOA 4F56A 1YC5A 2EZ9A 1PT9A 1S7GA 2NXWA 4V1CI 2JI8A 2C31A 1YHZA 4IG9A 2V3WA 1Q1AA 4KXQA 1S5PA 2Q27A 4BN5A 2H4HA 1T9AA 4K9KA 2DJIA 4UU8A 2B4YA 3RIGA 4MPPA 1PYDA 4Y6QA 5FEMA 4HD8A 5EJMA 4FEEA 5EJ5A 4I5IA 1ZPDA 5K2OA 2W93A 2PGNA 2VBFA 1V5FA 1YNOA 4X3PA 4V1CA 4JT8A 4BV3A 4JSRA 1OVMA 4GP9A 4K9NA 5K6RA 3HWWA 4J16C 1M2GA 4QPZA 4RJJA 3GLTA 1M2HA 4MPJA 1U28C 1OZFA 1UPCA 3D7KA 2A1TR 1OZHA 4RJKA 4JUBA 4FZ3A 2VK4A 4ZP1A 3IAFA 1E3TA
chains in the Genus database with same CATH superfamily
1TX4B 1E2LA 5I7HA 4J1SA 1FX0A 4JD5A 5HBRA 1Z6GA 4O2AF 1FOEB 3IUJA 4B6EA 3O3NB 1TZKA 3OJXA 4AP5A 1UT5A 4H3HB 5FADA 4RORA 3MPSA 1FU4A 2ASVA 5BW4A 4IJUA 3W5IA 1GTRA 1NUAA 2G09A 3ZWQA 5A7FA 3I52A 4GIBA 3MCTA 5GP1A 3D64A 3SF8B 2ZI5A 3B78A 1EGHA 5BO5A 5L3RA 2DRIA 1FJGB 2VHVA 2PH7A 3VYWA 3M2PA 2O5JD 3MWLA 4H77A 5IS2A 3VOTA 2VAVA 3C43A 1FA9A 3X1YA 4DM3A 1NFQA 1Z2OX 3A1UA 3ABIA 4F9FA 2GX6A 1Y1PA 4NFSA 1BA2A 1MJFA 3IIJA 5GPBA 4WWHA 3SQMA 1J8DA 1N6RA 2FZKA 1I7PA 4NJMB 5IEBA 3S40A 5IM4F 3HCNA 1DV1A 4EPVA 3R7AA 4NX2A 5AXAA 1IHPA 4K7JA 2NO6A 4F4JA 4BUZA 1NXWA 1V5IA 2H1HA 2RHMA 3LCRA 1P6XA 4YBZA 3CTMA 1L5NA 2QTZA 5AH0A 1FS6A 1B6TA 3E9NA 1Y5LA 1A96A 3I9JA 3P2OA 3F6CA 3SK0A 3QBVA 2O3SA 5CVUA 3UGJA 1FJXA 1D3AA 3GLHE 3G13A 2ZI9A 1I3NA 3K5PA 1T9KA 4QGFA 4Q9HA 3VFDA 2VYND 3JALA 5EUQB 3LUCA 1I4LD 2H8KA 3OLXA 4J6EA 4CDMA 5B4VA 1I2DA 5KJ1A 1DZIA 2BGKA 2QAGA 2A59A 2JKYA 3C5VA 3HA3A 2Q5OA 4XDHA 5FCDA 1U63A 1VHLA 7AT1A 1X8KA 3PEVA 4B9AA 5I3ZA 3GTOL 3MQ4A 1JHVA 1Y8ZA 3MTDA 5FORA 2MSLA 4IIUA 3ELDA 1ZR2A 1P75A 2I1WA 5AVWA 1EBUA 1VA5A 3EXEA 4Q05A 1QIGA 4HGNA 4MVXA 2PFKA 5ECGC 2XLCA 4O4LB 1Z2EA 2YCLA 2ZSHA 1VECA 2AQCA 1Z39A 5BSHA 2W6JA 4PZEA 4OHZA 4EGAA 2NZ8A 1I24A 1Q6ZA 2HQ1A 3K1YA 1N2HA 1QFSA 1U4OA 1Y1SA 4R1LA 4BKPA 2RKOA 1QQ7A 2NXCA 1NVMB 3E7PA 4D45A 1Q6YA 4ID3A 1SEVA 3MERA 1FFBA 1MT3A 4MCAA 4I3HA 4ZTUB 5ELMA 2IOFA 4KFTA 3BQMB 5FJIA 1Z3CA 2QZ4A 5K1ZA 2M2IA 2QEQA 1B1AA 2XNJA 3Q85A 4Q1BA 4X6LA 4ZO6A 3RSLA 3OKAA 3C4VA 1XLTA 2H07A 2VAMA 1GTG1 4AUNA 4OAPA 3ABRB 5HJ2A 1U4NA 1GDDA 1UBMS 3J80A 3GGDA 2J8ZA 2Z8XA 4D2IA 2YZ7A 1CDOA 4ZC8A 1YZYA 2NV0A 3N3BC 1RMTA 2JGDB 2QD1A 2NVQL 3LVRE 4OFZA 3RYCB 4JB8A 3EIHA 1Q91A 3O84A 4B75A 3OOJA 5C1IA 1EWYA 2WUDA 4YMUA 3GHYA 1Y33E 3D4BA 1TEZA 1N2GA 3ANLA 3W8NA 1UXGA 5E7IA 2E4XA 4QVGA 3A1DA 3C41J 3CPEA 1WCWA 1NPTO 1RW4A 3IBGA 3C5CA 3IKMB 3GMSA 2HNAA 4KYTA 4AQYB 1PV1A 4KOAA 1I5RA 3GPDG 3QV1A 3F3KA 4NBWA 3V8QA 4CQJA 2H1OA 1Y4SA 4Z51A 5D1HA 4MR8A 4I55A 3AZPA 3IAS6 2CFRA 3NHWA 1D9ZA 4TT3A 3EY4A 4RHEA 1DC6A 2X0NA 2IHJA 1FFEA 2XI4A 1ZH8A 2CJYA 3TCXB 1R3UA 4FDLA 4YRSA 2JZNA 2XBUA 4MUNA 1FDTA 3NO4A 2PU7A 2RHBA 2Z3QB 1NKVA 1QUEA 3KTAA 2RHCA 3E3OA 4UBMA 4HAOA 4BL5A 2OQRA 5LQUA 3G0HA 1CUWA 4H6PA 2WJVA 4J0DA 1P0QA 2EEZA 5DCLA 1CXZA 4LDRA 4NESA 3O5AA 4CDGA 1L1RA 4FWTA 5EHNA 3VI4B 3L0ZA 4Y52L 3F6YA 4U7PB 1QPBA 1UT6A 4JJ7A 5D87A 4HDKB 3G0OA 3WV4A 2F8SA 3WDLA 3KPYA 3LGAA 3LI2A 1KR2A 1QH0A 1P8JA 1WY5A 2PLAA 2IGBA 4CKEA 3MIIA 1V47A 1YIAA 5HTOA 4IDAA 5J5CA 4K8RB 2GF0A 1MORA 3B2NA 1R16A 1PK8A 3LKVA 4QM7A 1HDEA 3L84A 4W5RA 1KQ3A 5E6RB 1B8VA 2ISCA 5IJ0B 1ZR4A 4JLJA 1NU8A 4QZVA 5I7WA 5JNUA 3UYLA 4H59A 4PV7A 3RYCA 4KQKA 1MO5A 2ISQA 3PXBA 4CDNA 1JGTA 1FRNA 4FFSA 1RHRA 3K4HA 2EW2A 4EFLA 2JLCA 3ZCSA 4BMSA 3B5IA 4ZYTA 3ESZA 1DGQA 3DLAA 1FP4B 2BKLA 1FTSA 2RBEA 5HNKA 1OH5A 3TGPA 3ZH2A 4K1LA 3UK6A 1UOEA 1JDBB 1EM6A 3CUWA 3VSDA 1ZP6A 3ESBA 1CUAA 1E1YA 2PTHA 3P5BA 4FT4A 3W8FA 4NH0A 1N6OA 3ND6A 4RHCA 2PT5A 2FLWA 1YI1A 1DKQA 3LX8A 2VRWA 2FE4A 2HMSA 1QP8A 5KJ6A 2A2ZA 1C8LA 3EY9A 1N6NA 2HAEA 3FUUA 3NHAA 4Q6WA 4BUCA 5IKPA 2WJWA 3IQIX 1KVRA 1A9TA 1Z9BA 3KT6A 221PA 3FOWA 3ILHA 4IFEA 1ST2A 2CFSA 2I6SA 2Z4SA 1QIMA 5EP1A 4JBWA 1PV2A 4UTPA 2R65A 2FLKA 3DO6A 1YUNA 3O3OB 4H7HA 1UC5B 1WQ4A 4PLTA 3OG9A 5JMOA 2J7PA 1QYCA 2WU0A 4NCJA 1ZVVA 1PNRA 3GH3A 4WOKA 2KMLA 4BO1A 4IMRA 3FVQA 1WCIA 3T7KA 2JJ1A 5C35A 4F06A 5JXIA 4HDKA 1GPJA 4OY3A 7YASA 1AZSC 2QN2A 4RJ2A 1X8JA 3WJ2A 5FV4A 4AMZA 3TG8A 4EL0A 4BASA 4QXPA 1EDZA 3L6DA 4GNKA 4LOAA 1QH1A 4U7GA 1QC5B 4WY8A 1JVBA 1QE3A 2DKNA 4HFJA 4QE3A 3HUTA 1E94E 2JCGA 4HRYA 3U3OA 2C3UA 3NYQA 2XDWA 1U8AA 5GM1A 2AJLI 4WFKA 4CQMD 1G5IA 4EG6A 3TW8A 3F6PA 2PVSA 3GLUA 4ALJA 4QUHA 3L4EA 4PVDA 5DLPA 1VMIA 3P5SA 1NDQA 4TV9F 8ADHA 4HWRA 2CFTA 3SIRA 4JVNA 2I6TA 2QW1A 2R5FA 4X00A 1RHUA 2ZJYA 1N33B 5FTKA 1WRBA 2WTXA 3LFTA 1IN1A 4PLGA 2WHPA 3E0QA 3QU4A 1I7SB 1QORA 3H5LA 3LXRA 4RKRA 4UVHA 5FFNA 2P9CA 3KWJA 4NF2A 2W37A 4B3BA 3DVSX 4OIFA 3TQCA 3INTA 5U4QA 4JWKA 2JIZA 4NXMB 5KQSA 1VIMA 4RX1A 2W2PA 3OO1A 5DV9A 2C1EA 4L2IB 2JAWA 4A82A 1WY7A 4RJIA 5HUHA 1CQXA 2QX6A 3RFFA 3OIYA 3UJ3X 2JCBA 4FCVA 1CS0A 1KI3A 5BV1A 4FD2A 5THKA 1KYWA 2GOYA 2PKWA 4O1HA 4QEDA 4AJIA 5A9TA 4A3ML 2VDPB 4OHOA 3ZZNA 1OX4B 3DV0A 5DJ5A 2OQVA 2PWPA 3IBCA 4UNNA 2PBLA 1LSUA 3K0EA 3A3OA 1RVDA 4ZZ2A 5ILGA 1GGKA 2X8LA 3TTXA 1ZKDA 2PANA 1U3DA 3BREA 1KYZA 1G2QA 3NBQA 2CE2X 4JP1A 5CPBA 2XYRA 1SU8A 2GESA 3I2JA 4FOLA 1HORA 2J3MA 3A05A 2QRLA 3KZNA 4RETA 5CH5A 5T41A 2VF2A 3RJ9A 1EB8A 1WZNA 2Q1UA 4LECA 4NBUA 1OD6A 4KFUA 3FMVA 3VYUB 4AC9A 2H2AA 3ABQB 4W1QA 4GPEA 5DGXA 1Z63A 2C2BA 2CMDA 4PQRA 4PCUA 3AL3A 5J4LA 3CS3A 3MS2A 5KHOC 2AEFA 1E66A 4QLOA 3FWHA 5CA1B 4DVGA 1P3DA 2CNNA 4FLFA 4QU0A 3WL6A 3ZK9A 4A6XA 5JD5A 1QTNA 4Y2YA 2HHAA 3GCWA 5I4CA 4QPPA 4LDJA 1AUOA 5B3JC 1FZTA 3L0OA 1LS1A 2GEDA 2OQIA 1G8MA 3F8TA 3SJCA 5KMGA 3Q1KA 1E32A 1QC5A 5IYZF 2FP4B 3JQ7A 3EMKA 3MZ0A 2ZUBA 2PZAA 4N6NA 1O95D 3OPVA 1OFVA 1ZMTA 4OCZA 5AM0A 4EJMA 1F4PA 3UAZA 3EFBA 3OZTA 2Z3VA 1QBGA 3KSUA 2DC1A 1ISJA 2X3FA 2FX3A 3E0XA 3QUQA 3X1XA 2HXSA 5JEDA 1JR4A 4M2LA 3V3KA 3GLIB 1GWNA 5CBPB 1WOMA 3ZDBA 2YRFA 5JALA 4Z99A 5BSKA 5KJFA 3T5AA 2ABWA 1M6VA 4P7FA 1J56A 1NXXA 4V38A 1NMYA 2OO5C 1I30A 2HR5A 5E1OA 2R87A 4LZJA 4C3UA 3U61B 4CVNA 2GKSA 1Y3HA 3B3QA 1LD3A 4M4SA 4R7ZA 4JB0A 3UJDA 4YMHA 4IIHA 3PBKA 5B7PA 3VR5A 4C4ZA 5BXYA 4QTYA 1CNMA 2CSUA 4TZ6A 4YRZA 1YR9A 2P0EA 1E2FA 3CURA 8RXNA 2AF3C 4L5YA 2HZ7A 1FFDA 4XGNA 1OX4A 2A5DA 3D4LA 2HBZA 3NQ41 4ZAZA 2OP1A 2DTXA 2BKEA 4KDEA 3QE9Y 3ZHYA 4FJ2A 1YRAA 1WF6A 3OZVA 4IUCS 4ND3A 4EO7A 3KZXA 4HLQB 1VYHA 2ZXFA 3L0PA 3GP3A 4PFQA 1STOA 1X1AA 2C42A 4IIJF 2ZDQA 2X1LA 1T3TA 2WJHA 4PHTA 3PGXA 4YAWA 3L2OB 1KHTA 4EG1A 2GZMA 4KDRA 2A78A 3OVMA 4LJAA 2SCUB 4HVAA 2ZI7A 4QXAA 1BVHA 3O8OB 4UXIA 1SCDA 3IMKA 1SQGA 5DDIP 4E15A 1V9CA 3U4HA 1YQEA 3F98A 3RBXA 3VTFA 4MMXB 3NKFA 1PS9A 1EVEA 1QWOA 1YSCA 1J49A 2MMGA 2YY5A 4QOJA 1DAOA 3ETHA 1LS6A 3WWCA 1MAHA 4MIEA 1C3OA 3I23A 4CKXA 3KQHA 4FILA 5JU6A 1QWSA 4YJ2F 1FFHA 1P60A 1QCYA 2FP4A 3FKJA 1TM7E 4JASB 4NEHB 4S1NA 4ZO4A 3RUIA 2I5PO 2C4WA 3CQ9A 3MUEA 5JDCA 2VJLA 1XZJA 5AHXA 3FHLA 3OETA 4D0SA 1P5RA 4JX8A 3VXKA 2I29A 1P2FA 1NQAO 3GLIA 3MMZA 5CBPA 3FDFA 1CY0A 2DBQA 4O2BB 4ME3A 1R4NB 3QWFA 4LMAA 2I67A 4W9NC 4JI0B 3FHCB 2JFGA 2C5BA 2YWFA 4ETWA 1P4SA 3KB1A 2NO9A 3HCPA 2RHLA 4Q82A 3ISTA 1J2JA 1IRIA 1RQXA 2XWQA 3C39A 3OZEA 5LC1A 1I6HL 3PO2L 3CH7A 5A71A 1XZMA 3ZJ5A 3D02A 1GO2A 3PUXA 4QWMA 5CXQA 2BDUA 2C1ZA 1JKMA 1GG2A 4CHGA 1NPDA 3HKEA 3EIQA 4M1MA 4Q01A 5IHXA 3N05A 2WWVD 3HNOA 3SBDA 4E5UA 4CI9A 3GVHA 4O4JA 1SIWA 4CKYA 4II3A 5T7BA 1W0KA 5ALVA 4KOEC 3N7TA 5K5EA 5CIQA 1VB5A 5C46F 1RJEA 4MKRA 2ZZNA 3ZIDA 3SHWA 1KAOA 2QZZA 3WYBA 4OLHA 2OP0A 3UWPA 5AYVA 1KJ9A 4L0QA 4DV5B 4DG9A 2W4MA 4Q3EA 5BR1A 2JFVA 3GJZA 1JKJA 2NO0A 2Z2KA 4RHXA 1N9ZA 8ATCA 4D25A 6LDHA 2SCUA 3HWWA 2YZKA 4HYQA 4N8SA 2FQXA 3KO8A 3TTYA 1MQSA 2NVUB 1EFTA 1A9PA 1FXWA 3O8OA 2EIXA 4WMLA 4EG0A 4UQLA 2V6GA 4EABA 2G9NA 1RE1A 5J4VA 5JJKA 5JE8A 5J2TB 1J24A 4QPZA 2WWWA 3I9V6 3GEEA 4FU0A 4Z5XA 4WL0A 4X84A 4ZXPA 3AHEA 3VR6D 3MTBA 4KV9A 3A2MA 1CYDA 3K9GA 2XMZA 3L04A 1NIPA 1Y4AE 3BTSA 1Z38A 2OBNA 3AIMA 1E1LA 5FULA 1T8YA 5ALIA 3AY7A 1KAMA 3RK0A 2WPDD 1K06A 4IEIA 4N0PA 5LJLA 4Q12A 2QSUA 4H1HA 1KMMA 1OXBB 4TLBA 3EIXA 4O2LA 4NPAA 4PQFA 1R4NA 3GJ3A 1VHDA 4UPEA 2I4OA 2D2IA 3FPLA 2FPLA 2EERA 3KQSA 2XF8A 4XE5A 1RKBA 4DXDA 1SQFA 3BA1A 4ZI2A 1Z5OA 2W8ZA 4NNOA 5H9VA 2O2IA 3D8RA 2QVZX 4DR6B 4K86A 2H1WA 4DSNA 3F6EX 1DUVG 3TL3A 4GL4A 1YJCA 1GP2A 2V6IA 5MGNA 1U2EA 4BMPB 5NLLA 5FPKA 1N77A 2Z9CA 1W36B 2AG8A 3W7VA 1LDMA 3QUSA 5BNIA 1BQEA 1QLJA 1ZS9A 1AXGA 3JARB 1SXJE 2ZT5A 3QP9A 3ZGLA 3LM8A 3F6BX 2ANCA 3AHIA 3QFFA 1Z6TA 2REQA 1QE5A 5CNMA 3GRVA 4PHGA 1QYDA 2RHOA 5EMKA 1PS8A 2KQUA 4ZZIA 4Y1EA 4TVBA 3ZU5A 3RC8A 2V4MA 3KG2A 1Z0IA 1RJFA 1XVIA 1QG0A 3QM1A 1KYQA 3LQQA 2AN3A 4PR3A 3RYFA 5C3EL 3HSKA 3IHKA 1P6UA 3DOUA 1ODHA 5FPYA 4G41A 1X8XA 1D6JA 4IGKA 1H0SA 2Z4TA 4J0FA 4C89A 3K6JA 5FWNA 1VHQA 4DSTA 2FR8A 3K05A 3KSAC 1Y9AA 1UBGA 2X9GA 3DZJA 2GPSA 3CLHA 3AF3A 5IBPA 1T25A 3T3HA 3JU3A 1GIAA 2Y92A 1TUEA 2PE5A 4C3HL 3IQHX 5I7VA 4ND8B 3GP5A 1NY5A 1GGHA 2FH5B 3MC1A 4GKKB 3OEED 2CFOA 1NR5A 4S0ZA 4HDMB 5CDTA 5JHGB 2K2QB 2IH5A 1CU1A 1Z16A 4GMGA 4MO2A 1HT2E 4OXQA 1WCXA 4IYRA 2OA0A 6NULA 1PUJA 1UAYA 3A0RB 4BFCA 4HNRA 3TQQA 2QE6A 4ZZ1A 4JXZA 2ODTX 4O29A 5TVGA 4ZC1A 2O2HA 4C0XA 1OH6A 3H1GA 1NMEA 3EVZA 4HQ0A 2Q29A 1H2RS 4KR3A 4KVZA 4MDEA 1IB0A 3IPXA 4MCIA 4JAFA 1ZEJA 3AILA 3CC8A 4JMPA 2AB0A 4PWZA 3RAGA 5KVCA 4EJFA 5LKAA 3T8YA 1LBQA 4TXHA 2YJGA 4ESHA 3IKLA 5B58C 4A23A 2BE9A 5DWVA 3ADCA 3AI3A 5IKMA 4OK6A 3AVWA 1FP2A 1GITA 2OHXA 3FJYA 2BD0A 3A4NA 4DARA 4JI1B 2H63A 4U7DA 1F8FA 1XO1A 2F3RA 3KDAA 3PG5A 4HMPA 4OLJA 2ERCA 3CNBA 2HK6A 3OX4A 4B40A 3SR0A 4MZDA 4YACA 2CLHB 3GTPL 1G2OA 3RC1A 1V4NA 4IOKA 2XVXA 4WRRA 2ZBUA 3QHAA 5ALRA 3D3KA 1DX8A 4FEAA 3UV6A 2FXVA 1CJCA 1Q14A 1WP9A 2BI8A 4GZ5A 5SYNA 3GLFB 4DDVA 4WOCA 4L8GA 1LXCA 2C7GA 2I03A 4RQTA 2IKQA 3G68A 1SQ5A 1Y42X 1ZWLA 4IV8A 4J29A 1X70A 1EXVA 1LDNA 4FE4A 5EIXA 1RLUA 2ZVJA 4MRAA 3UWKA 2AC2A 4YAOA 2QY6A 1NVVR 1X3LA 3HFGA 3WRYC 3PJDA 3WRWA 4C3JL 2BEUA 1H23A 3BEDA 2GDJA 4QBGB 5TEVA 3KQKA 1E1QA 2VNAA 2ZUDA 1QTIA 1GLNA 1WXIA 2RK3A 2YNMD 2ZJ4A 5TPZA 2IRWA 4QODA 4KGVA 4TWRA 4EI7A 2ZJ7A 1JVNA 3LDGA 5B36A 4JC0A 4CMEA 10MHA 4TYWA 5T4HA 1O58A 4Q9IA 1IJKA 3KAPA 1MP0A 1Y4ZA 4ND8A 5KVVA 1TK9A 5DH9A 1XTVA 3NWEA 1UFRA 1AKVA 1LLFA 1E2NA 2HDHA 1T8RA 4FFRA 4HDMA 4PHFA 5DWDA 5FBRB 3O3CA 2PMEA 3HA7A 4KACA 1HWYA 4ZEOA 4OKSA 3O4RA 1FMLA 5EPUA 3SCZA 2QQFA 4K28A 3KYCA 1U2ZA 4YP5A 4EG5A 1J1UA 2IPAB 1M7HA 3KSDO 4MEAA 1WP4A 3R3HA 3KVVA 1PBTA 3K1AA 1FSSA 5K2MA 3ZJYA 5BVGB 4CQNA 5F78A 1WS6A 3M6MD 2PGOA 3U0VA 4C4TA 1B00A 3JQCA 3TBHA 5LQJA 2X9LA 3PNKA 3KPJA 1TB4A 3IV7A 1TYCA 1V3VA 4ONEA 4HHEA 2XA2A 4DY6A 2VQ6A 1ILWA 3I6YA 2F1IA 3W3AH 2QT0A 4BCCA 1SMUA 1GZ3A 1MVLA 2DT8A 3IXMA 1YUXA 5LJIA 1VL1A 2VUTA 2WC1A 2BTEA 1M0EA 2J85A 5L4SA 3NYWA 4AHZA 1XEWX 2COKA 2YIVX 4FFBB 4H1TA 4C5BA 1HZZC 2XITA 3GDOA 2E5WA 5EN4A 1DU4A 1NWCA 3GTQL 1R6DA 3LUHA 4PZCA 5CTJA 5AI6A 3UK7A 3MQKB 2HFJA 5I7AA 1KZ1A 4AM8A 4WOPA 1S3GA 2FFQA 1ZGJA 4BQEA 3ZDAA 5MF6A 1CULC 1CIVA 2AEEA 1NN1A 2CGEA 2R8YA 3TLXA 1YOBA 1D2HA 4BZZA 3GLFA 1LJUA 4LOIA 5LNK1 4RQBA 1HNNA 4LHZA 1XEAA 4I4TB 5F1OA 5AUPB 1MB0A 3SYTA 2VSFA 2Z5GA 3MPUA 2QD5A 5HS6A 1MV5A 1U3VA 3DDNA 3KEOA 4I1RA 4JEHA 2P41A 3EZ9A 1E4EB 4A3DL 1K3TA 4Y2RA 3TTTA 5AM3A 4LRUA 4LDPA 4L72A 2YV1A 4Y3UA 4OP1A 1E2DA 1W87A 3T0GA 3EC1A 5EPEA 4MQFB 1N8KA 3KYUA 1ICEA 3G0BA 2FQQA 2YXNA 4NV0A 4AU1A 1WDKA 1WUIS 3DYIA 5JI2E 2GM9A 1NGSA 2V74B 2Z5LA 1H8ED 4S0XA 1CR2A 2GN8A 2V58A 4R3UC 3TN7A 1BGXT 1NNUA 2XRFA 1JIQA 1GNTA 4E13A 5U9CA 5TQ0A 1Q11A 2GBCA 3RW9A 4ETIA 1NN3A 1P4GA 3HWRA 4OUDA 1IU5A 4MRVA 1UDRA 2P75A 4LDNA 4LYGA 3WGZA 4E2WA 3OZAA 4YI3A 4O4HA 4G0PA 4MUGA 4EPXA 1KO1A 3CJTA 3ESCA 3VI3B 4CCWA 2B2CA 4JC8A 5LBTA 4MROA 5TPWB 3UAOA 3SFZA 2XB8A 1RAEA 2LZ0A 4DV3B 2YRXA 5B6IA 4XQEA 3S1QL 2E4ZA 4D41A 1NSYA 1RLIA 3H0EA 1DKNA 1YIOA 3IKTA 1EE9A 5DIZA 3S5UA 4R81A 1VM6A 2WAXA 4WBXC 2C9OA 1DBRA 5I9TA 2IUYA 1XXHA 1HYHA 3QKSA 1YACA 1EP1B 1YGYA 2AX3A 3I8OA 1P9OA 3NHFA 3QMMA 1L4HA 4MCHA 2W00A 3KKKA 4DZRA 1Z0JA 4MVYA 4WLNA 4EG8A 1P2SA 5G0UA 3BCRA 5ED0A 3Q15C 4Q7LA 2CHUA 3LPLA 4BV9A 5T67A 4YT4A 2QDXA 1O96B 3IJ5A 4HN9A 5C8VA 1G63A 2Q3LA 3KJEA 3MG9A 3CEMA 3QQCE 5EG5A 1V5WA 3EN0A 2M1XA 2PX3A 3I5XA 4UEJA 5AVOA 2KWIA 2BCJQ 3OPMA 1EU1A 1G3RA 3PWTA 2ZEJA 1J25A 1NVFA 2OUKA 2QS9A 4PZ9A 3UQYS 1AKEA 1MC5A 2H5EA 2PAFA 1XD8A 4J6FA 3UT5B 3FTFA 1IM5A 4GPZA 1W8IA 4CF5A 2PJZA 1YK0A 1XNJA 2XTAA 2A0FA 3OJLA 2IYQA 1X0VA 4W5JA 4YVFA 4BFZA 2K6GA 3GZNB 3ETLA 2QN7A 1YUZA 2OYSA 1NURA 4QXQA 1CRPA 4XQGA 4PTLA 4LF8B 4C7OB 1WXDA 4UE2A 1RQPA 2LGJA 3KL2A 5I9MA 2V0EA 2WOJA 3WWPA 4UM9B 4EFNA 2GPAA 4CODB 4DRZA 3WHPA 2RG1A 2E87A 4XOUA 1F0KA 1LB1B 1NOJA 1TJ3A 4CRWB 3S27A 5KKNB 3Q3VA 3QSGA 4F5DA 1RRKA 2PJUA 3BT7A 3BDVA 3PD0A 5HE8A 1TWCL 1KAQA 3U19A 1U7DA 2BFFB 2GN9A 2XNDD 4MUEA 2QGNA 1Z5UA 1E5XA 1W1IA 3TZBA 4M9QA 2V8BA 4HFRA 4BO5A 5DKFA 2POQX 3CXRA 5TPWA 2GAOA 2QRGA 4A36A 5IDQA 2K5UA 4QUBA 4UVGA 2QLJA 1HE4A 4XVHA 5FAXA 4NICA 3CSUA 1R9MA 3KKEA 1NVEA 3QUAA 2GZDA 3BJEA 1E2IA 5LXTA 2W6PA 5T57A 2EXXA 1AXRA 1Y9DA 4NAHA 4PYKA 2KB0A 4GM1A 3LV8A 3NAZA 1ESDA 4M98A 4OBEA 1PZGA 2QP9X 4PCAA 2QW0X 4ROTA 3T1NA 4LKRA 1PX2A 3M6VA 5ITZB 1FMFA 4OA8A 4MP8A 1FVXA 5DK6A 1RYBA 3EEBA 1A72A 3HFJA 4QQ8A 1QF9A 3SBOA 7ADHA 5FLKA 4DR5B 4DM7A 5C4GB 3VZQA 4JUCA 3JWHA 3VZCA 1E9AA 2QVXX 4BVLA 4YLEA 2QU7A 2DETA 2CMHA 1E58A 1HFWA 4RZXA 5LFAA 5JNSA 2WTUA 1FYWA 1V8OA 3CRRA 3O03A 3PR1A 4HAUA 3TLAA 1ESMA 2VSYA 4ZHSA 1B0PA 1M2VB 1R64A 4B33A 1LTHR 3QF4B 4WXRA 3ZW9A 4BWFB 3QGMA 1E3EA 1RQGA 2CZGA 4UDXX 4E6PA 1CV2A 2QRKA 1I5OA 1TQHA 5K0FA 1U0BB 4C7OA 1EK1A 1G21E 2QJWA 1YDWA 5DHUA 2AYZA 1N1MA 1E3DA 2OO3A 1A2OA 2PIAA 5AOCA 1PJRA 1JS1X 4FINA 4DJTA 3JR3A 1SELA 3VMMA 3OT1B 4F2DA 3EWIA 3VOBA 3P9ZA 3RSZA 1PQ4A 1U0FA 3ZQ6A 4XA8A 3OUUA 5LZ4A 2JI4A 3IU3I 4MVJD 1RWMA 1DIOB 1WNTA 1DRUA 3G1WA 4HRXA 5FLXA 2BBSA 5A3RA 2XJSA 4W8GA 3ESAA 3GRRA 1W5AA 1QCCA 3DB2A 5BY2A 2O57A 4QSHA 3KYDB 4ZKEA 2Z9BA 1NY6A 3UHAA 5JY1A 1ISFA 5GQSA 4LISA 3HLTA 1PLJA 1YR2A 4B8ZA 4EVSA 1HLDA 2I8LA 1NE2A 3JRNA 4OXIA 3KJGA 4ABTA 1D0VA 2QG4A 3IURA 3KIPA 1KAHA 4G67A 3WGLA 4BNVA 4D9MA 1BVYF 2EFDB 1XK7A 3UT0A 2Y1XA 3OJ0A 1S02A 2JCSA 4GT1A 5ITZA 3IP7A 2CCKA 2X41A 4WESB 2J0SA 1M10A 2VC2B 4X20B 4G97A 3VSCA 1HDOA 2EW8A 2QPLA 1JG2A 4ZQBA 4YQFA 4RH0A 3D6VA 3QBTA 2Q27A 1M3SA 4GEKA 1RBYA 4X7RA 4E5DA 4P33A 2GN0A 2ZE6A 3QOFA 4PFJA 4AX4A 2Y0BA 2GHTA 3WTBA 4BMXA 5B1EA 2Y1EA 4R8SA 1H1DA 3A26A 4XI9A 3BGVA 5HFJA 1ES9A 3A70A 2P35A 2B6NA 2QXTA 2IV3A 4QG3A 5E4FA 2H85A 2WTEA 1AJEA 4UAGA 3P2MA 3SOZA 1ISSA 1W4AA 4MTLA 2BH2A 1C3VA 3RS5A 5J58A 2PUEA 5EJMA 2ZBEA 4IX1A 2H9YA 3ITEA 1I10A 4PVCA 3S2DL 2CYBA 3I01A 4QDZA 3UJCA 1PL7A 2ERSA 2G4VA 3AR3A 2Z83A 3QXGA 4PM4A 1UEIA 3I58A 3ADOA 3A4LA 3WMXA 5ICSA 4BGUA 1U9IA 2C9ZA 2QK4A 3GEMA 3PK0A 1MDBA 1U7HA 3NWOA 4LJSA 3RAEC 1A27A 2YQ5A 1YJQA 3DBIA 1BIFA 1E5TA 3FSRA 4XIGS 3S1NL 2IA5A 1KYVA 1UFQA 3GC6A 2PD3A 4HXEB 1I36A 4KKXB 3ZX4A 4ZRNA 2DCUA 3VPHA 1N4AA 1AOXA 1C1YA 1YB7A 2Q6TA 2JATA 4AJNA 2FP3A 2PD4A 1N8SA 4X93A 3SNKA 3K6SB 4DSOA 2O8BA 2EDAA 2WIFA 4TQAA 3WDKA 2YJZA 3HUUA 4TMXA 4HNTA 2QT9A 1CUVA 3LF1A 4KW7A 1GOTA 4IDPA 3WLIA 2YOGA 2ZWIA 1QG2A 1FMTA 4P9NA 3KYDA 2XRZA 1AS2A 1RYEA 4FHEA 3U09A 3MAJA 4OTZA 2AKEA 4QDJA 1GRNA 3GNLA 1X7HA 3L7BA 3UB3A 3GFBA 4A0GA 3OO0A 1P73A 4YJGB 5DSXA 3U7RA 2X7XA 3F4LA 5KO2A 4UHCA 5EA2A 4J4HA 4NECA 3PKZA 3ZGNA 3OCVA 4WN3A 1YQQA 2D59A 1TLTA 3IP6A 1KYYA 4Q9LA 4X20A 5JSHA 4JZKA 3GLTA 3GNSA 4G09A 5E1BA 3HL0A 1E8DA 2JLSA 2C99A 1GUBA 1YR3A 1D2EA 1M2HA 4KRXA 2CJFA 3R6TA 4YUAA 1QTRA 3HLKA 3ROMA 4ACBA 2FUCA 2H1FA 2WJYA 3M6FA 1WV1A 4JVLA 2HVYC 3R0ZA 3DTVB 4TTQA 1WW3A 1EIWA 4UEKA 4R2XA 3CX6A 3DAOA 2GCIA 2XVYA 4UCWA 1PR1A 4DC0A 3D7KA 3AESA 4FNAA 1T35A 3DE6X 3NORA 4WXHA 4KXFB 2UUOA 2VDOB 4BLTA 3I72A 3TEMA 1IJBA 1J39A 4N54A 3OEHD 2ZSFA 1A9OA 3HL4A 3TINA 2QPAA 5L7YA 3SZ3A 3U39A 4LHEA 4DWVA 1W85B 2P79A 1WEKA 3DAHA 3R5TA 2Z09A 1EEHA 1CDDA 4HAYA 4Z6KA 3U4CA 3GT3A 1M2EA 2WLSA 4NBKA 1OC4A 3CH4B 5EERA 3V42A 5K7SA 1F0YA 2YHBA 1NSTA 2X77A 3IMFA 1W4RA 3TIIA 5DN6A 1BA3A 1XA4A 4JUDX 3L43A 5IAKA 2HQRA 3L7OA 2VRCD 3OIFA 1Y6RA 3GJ4A 2B0CA 3KV3O 1Z4KA 3P0EA 1FTYA 4GRAA 4OXYA 4OQ4A 4P82A 1MUUA 4TMFA 4UASA 4ZU1X 1PL0A 2PXHA 2W6IA 1AHIA 5HMLA 3E8MA 2JFNA 3W7AA 4L4YA 5ICGA 1RRVA 4CEIB 4NZ9A 3LWRB 1K4YA 1JQKA 1XA0A 1IEVA 3LUJA 4ZQGA 4ZVPA 1YBMA 2PV7A 3K6SA 1PS0A 3FGNA 3T0IA 1EHIA 3HI6A 4B5KA 2AUMA 4HSGA 2ZREA 3ZTTA 5DNUA 3QF7A 1Q5PA 1E3QA 4RK7A 3ZKWA 3QH4A 1GCAA 1ZCZA 1M8JA 4MWZA 4R9UC 5T8KA 4YJGA 3S2UA 1C5KA 3CLTD 4MDHA 5AI9A 3OM8A 3HJFA 3ZC3A 2HJSA 1J0AA 2G8NA 2WJAA 2WWIA 4Z7NB 1MVNA 1UIMA 1SBNE 2JAXA 3DCJA 1VL8A 5LMNB 3E61A 4DOMA 1D2NA 3JQGB 3MWYW 2AG0A 5DNYB 2PWYA 2PKCA 3Q1LA 2J3IA 3HUDA 1VLMA 2AX4A 3W2EA 3WIEA 5JBNA 3QENA 1YS2X 1T10A 3RVJA 3UMYA 3RVSA 2Z98A 4FW8A 4X3CA 3DTVA 4BKRA 4BLPA 3N2KB 4B74A 3EZYA 1XFDA 5F1YA 2C4NA 1K8ZB 1ODIA 2ZJBA 1HLPA 2RC6A 1CEXA 1H3FA 3IOEA 3PGLA 4CCYA 1J07A 2VHJA 3ZIAD 2XCIA 4EHBA 1MOQA 4QRHA 4CHTA 3EJWA 4LQLA 4PGFA 4R9NA 1D1SA 3PVZA 1O94C 3OZSA 3RODA 1WSDA 1Q7RA 3EASA 5AW9A 5K51A 1NW5A 2ZJ5A 3QXJA 5LZ5A 1SVIA 3TZ6A 5KYVA 3RV4A 2P4EA 3EZLA 4KMRA 1QZXA 3PLAE 2VCEA 2IHKA 3BSYA 5HCNA 4DGQA 6ADHA 5LN1A 4PYJA 1U0EA 3UYKA 3VNQA 3D9QX 1G8AA 3Q7IA 1SHLA 1A69A 4LRYA 4Q34A 1JIKA 3CZCA 4OQMA 1DXYA 2XBLA 2C1XA 3HP1A 3G2LA 4Q4JB 4RXTA 2ZIXB 2B1IA 1VXOA 2G1AA 2CMGA 4J49A 3ET4A 4RZUA 4PYMA 4W7SA 3IEKA 2I7TA 2G4CA 2VWGA 4BP1A 3PUZA 3N6RA 5F51A 3W2HA 4BE7B 3DONA 2FWNA 2PQ6A 2SBTA 3PS9A 3CX3A 1TKBA 5U4XA 4D9IA 5ICMA 4MMYB 4B71A 4YY3B 5KTTA 3VC7A 1UKZA 3W90A 4I66A 1MXFA 3ZDEA 1IJFA 5DCUA 5HQ3A 3U2QA 1DJLA 2OVFA 2O2JA 3KJQA 3N2IA 3AL2A 3B13B 3MT8A 3ZWNA 3OE7A 1CUZA 3EX7C 3L6BA 5EI5A 2PLWA 4AI3A 3EPRA 1I9GA 5EJAA 2ZOSA 3DP9A 4ASUD 3ET5A 2EC5A 4RLQA 3LFHA 5JISA 3ZE6A 3V2UA 5EP2A 1CBUA 2NPFA 3LNLA 3WGTA 4A7PA 4DLVA 1N5RA 2OWDA 5JYEA 1U3UA 3HR8A 3EVCA 2GJSA 4CKBB 5H83A 2GSDA 3B89A 3ITDA 1U81A 4LPKA 3RAPR 1YS9A 1UMDB 1YKGA 2Q1TA 3AI1A 2VSOA 3DTTA 4ESOA 2JIQA 1TT5B 3OKFA 5DI3A 5HE9A 1PZXA 4F4DA 4DUYB 2BTQA 3CZ4A 1TTHA 1XF1A 2V4ZA 3EULA 2VRBA 3G2PA 3VZSA 3H1TA 1T0JB 3FPJA 4PNEA 4BFWA 1NM5C 3NG1A 1M34A 2FWRA 3TRDA 2A9JA 1G20B 3EC7A 4UVEA 1WA5A 2PT7A 3FFBA 3V4OA 2IXDA 1TO6A 1XJ5A 1Q2UA 2QHXA 3BFXA 3IUSA 3CZ5A 4FE3A 1FUKA 3WKEA 4KQ2A 1L7OA 1VIVA 1IC6A 2CKAA 1MIOA 2O6HA 3DO8A 3R77A 3VR2A 1D4ZA 4Q4JA 3TE6A 5HX7A 1O5TA 1BE0A 2PT9A 4L76A 4IM7A 3HLYA 3UTCA 5FWAA 4EAAA 2VL7A 1U2PA 2Z6VA 5CURA 4IHKA 1G6HA 5IARA 2PSHA 4C0JA 2O2DA 2XKAA 3A9SA 4EGCB 1G8SA 1FSFA 2P9ZA 2P7IA 1PR2A 4LY3A 3NHSA 3MBKA 4GOND 4H7FA 4BV2A 2N47A 2BBOA 1ZVMA 4EMBA 1MA0A 2HNKA 3M6XA 2BMDA 3R76A 1OX5A 4QGHA 2IKSA 1RLMA 1J33A 3HABA 5KWIA 4JJEA 4ZYUA 1W25A 3C85A 5H59A 2HGZA 1EFKA 1Z22A 3FJOA 3EQ7A 4PN7A 4NRDA 5DEIA 2VJNA 1HC7A 2IYEA 2NO4A 3LOQA 1LX6A 4A3KL 5F7XA 1DKPA 1FYEA 4JAEA 1DOZA 1BKDR 1KY5A 2FEKA 4RKEA 2R62A 5T4FA 4CFSA 3BWEA 4PSDA 3HOUL 4HH1A 3QOXA 3AZQA 5ICFA 4CR6A 4GL2A 2VTKA 5B1YA 2H3EA 3DKRA 3QIVA 2B36A 1PJTA 2WSSD 5I8PA 2CXRA 5DYTA 3L4JA 1PDWA 1QV9A 1L3IA 2B4KA 2DPGA 2J0EA 4N9QA 1PK7A 3KL4A 1N2IA 1IONA 4UW9A 2HJHA 2OXRA 4FLMA 4EOGA 1VHWA 2C7QA 1TAUA 2JJMA 4EHKA 4TTTS 2WMYA 4MA0A 1UJCA 3A9WA 5T6MA 4AMBA 4CTNA 5M29A 1GQSA 3H2IA 3IUQA 1H7VA 1YD7A 1BD3A 1F4LA 1CQJB 2CBXA 4EHJA 1E6LA 3EDCA 3SC2B 3F9IA 3QHQA 5DWQA 3CKLA 3MCWA 4N5NA 4BDTA 3OZDA 3VH2A 1IVYA 2BI4A 4L6AA 1HDCA 4U7HA 1FDVA 2ZIAA 3AIOA 1LNZA 2VHWA 4H2DA 3LBNA 4G0QA 3I04A 1HMYA 1N8TA 3DPSA 1C30B 3E53A 3H18A 5CXXA 4KVAA 5DP1A 1PLKA 2VA8A 3B82A 4N01A 4DG8A 1Y1RA 1WG8A 4YJ3A 1CUYA 4R2JA 3EEOA 3VAZA 5HUJA 2JLZA 5B7NA 4DMKA 4XD7D 3ZQUA 2JGKA 3UMJA 4OQFA 3VJMA 1ITZA 2P91A 3AEYA 3B6MA 2XMDA 2JARA 3AR8A 3VU0A 4W8OA 4B76A 2PS9A 3EF3A 2H5LA 4G4SO 4GZ3A 3F5DA 4JP5A 1BCSB 1HDYA 3WSWA 5IYDL 3P2EA 2PWZA 3AK4A 1YGPA 3NTRA 3WV5A 1K0FA 1BWSA 2TYSB 3CZQA 1A3CA 3M70A 2PGJA 2V7QA 3AOGA 3H2JA 5BYJA 1D1TA 4HZGA 4UE6A 4CE6A 5B5SA 2AC4A 1XHFA 1C7IA 1AKQA 1KKMA 3O93A 3WLSA 4R1UA 3NTUA 4EY6A 1UQTA 3TQFA 1AQUA 2IYNA 4CU2A 2N42A 1K7FB 1ZRMA 3MRTA 1I33A 4Q15A 3RS0A 5ADHA 3EQ9A 4DMMA 3RTBA 3R1IA 3NAQA 5L4LA 2FY8A 2WVHA 1T8PA 2ID8A 1ISPA 7MDHA 4HLUC 1P0MA 2Q6OA 4L3OA 5LD2B 3RS8A 3GEDA 1XMVA 1ZICA 2WWTA 4RENA 3STTA 1FFWA 4H7DA 6PFKA 4R7GA 3UICA 1GTSA 2ZZMA 2QI9C 2PKXA 4TWZA 4A1FA 1TEHA 1EFUA 3D3JA 3K4PA 3O74A 4FFOA 4J1NA 4RZ3A 4BB5A 3H2YA 1SWWA 3S8EA 5K4AA 3TZEA 4TL8A 4O2AB 3JQRA 3UKJA 5BORA 5B64A 4RTPA 1MX3A 3CXUA 5F1KA 3S99A 1CQJA 4HNAB 1C81A 4K0RA 5HJ5A 3HSSA 4AS1A 3E2MA 1IM2A 2EZ8A 3SC2A 3TO5A 2P3OA 2A88A 5DNWA 3ICWA 3WYDA 5EJ9A 1XIVA 1E0DA 1E64A 3IIEA 3T7SA 3T94A 1KEEB 3PC6A 4QD3A 1EEXB 2POCA 5AXDA 2IODA 4ALKA 4X95A 2P40A 1GPBA 3F3SA 4B44A 4F11A 1XAIA 5FOUA 2HHJA 2E5FA 3AHJA 4F7DA 1C30A 3U4MA 2YFQA 2P67A 4WAUA 1W9MA 1RAHA 5A1TA 1Q20A 4L8WB 4WLUA 2YMPA 3D7LA 4YJKA 2AQ8A 2ATIA 5LQRA 3A1VA 1M0WA 1H2FA 3T1HB 2OUIA 3QWBA 2QTGA 3U9SA 4AMGA 3THXA 3AIIA 1TZJA 2FW9A 4QA9A 2WP8J 3CNLA 4CCAA 4WIAA 5M7EA 1JPUA 1TFRA 1XD2A 5JYBA 4NE7A 2ZYHA 3H3JA 3AHDA 3FF1A 3NVDA 2P30A 4MRMA 4EZBA 1QLHA 4I50A 3PCTA 1RS0A 1YV9A 2ID7A 2QGFA 4WCVA 2C7RA 3CEPB 1Y8QB 4MKFA 2AMYA 5HDBB 4P80A 3L4BA 2RGYA 1GLVA 3U49A 3A1EA 3CBGA 2HB6A 1N2BA 1RQLA 1M2KA 2IYZA 3AQIA 3P9PA 5AM1A 3WGHA 3BCSA 3OIWA 2YYYA 1V3QE 1ZSYA 2J0UB 2ZATA 4L95C 3MYRA 3AJAA 4PLWA 2R0QC 1HDIA 2YN2A 3OX3A 3KHSA 1LC3A 2H4JA 5DGHA 1C7QA 3AY3A 3EMDA 4L5BA 1KEVA 1GCUA 2ZUTA 1JQEA 1XP5A 4KLNA 3ICVA 3WRVA 5DHAA 1KDTA 2JFWA 3DLHA 5JH7A 5JNTA 4ZHQF 4J94A 4YYZA 2XIQA 4AO6A 1SBYA 1P5ZB 3B52X 1WU8A 2R1TB 3L46A 2R79A 3RH0A 3SJBA 4HNAA 3ASZA 2R1VB 4PINA 5DSZA 4Z0PA 4B73A 3QQPA 4Z4IA 3CCCA 1PNOA 4KXXA 2PMWB 4EA8A 4KQCA 3LS2A 4R3WA 4MV0A 1K1EA 2LR0A 4HNSA 4CYMA 3TMYA 1PT9A 1B43A 5AKLA 4HDSB 3ZVMA 2WU3A 4DQKA 4G0WA 1Z8HA 4IIXA 5HRCA 2YWHA 3GOQA 4TT3D 1UK9A 4JLDA 2RIRA 5KCZA 2RAVA 2X3YA 4HWPA 2Y1CA 5D3QA 2GARA 2IYAA 4HX9A 1UDCA 3THYA 3AL0C 3GT0A 3SX0A 1DQPA 1MD9A 2VNSA 1N75A 3EFOB 4JNKA 4ZT3A 1S2GA 2QIOA 1TUIA 4D02A 1OQAA 5KYWA 2GPJA 5E7QA 3FGPA 1PLLA 3QVOA 1N5KA 3TFOA 2WJJA 3BZUA 1J0XO 2VIIA 1OZAA 4NMMA 2DJIA 4Q7EA 4LZAA 2B94A 1JLRA 4RJTA 3REGA 5BN5A 5AI4A 1S3IA 3LGXA 4EGSA 4EB0A 3R7DA 1FB5A 3VPBE 1Y4DE 2RAFA 4M55A 4TQGA 2ZB3A 3A6FA 3ZCUA 5ERGB 1Y82A 3WWYA 1TU3A 5E2BA 4EKGA 3QE3A 1C50A 4HD8A 5CFRA 3H65A 3DMFA 1SXJC 1RWWA 1NRXA 1LI5A 3PT5A 4UCXA 2QZ9A 3FNQA 1QUFA 1BC5A 3R9KA 4DEVA 4I5IA 2ZUEA 2AMJA 5BRAA 2AUNA 5IP5A 2Y05A 4LX8A 1NIJA 4NARA 1QGAA 1BYIA 1XTTA 2XF2A 1VYUA 2VSXA 2QN8A 3HBMA 2YTZA 5K3FA 3RLIA 2E4UA 2Q5FA 3PC8A 4GRDA 4RW0A 3WFJA 1T3HA 2XW6A 1Y34E 3DDSA 5IWCA 1VPWA 4DLPA 4BBRL 1X1RA 4LDAA 3RUDA 3QVTA 4Z53A 1P1RA 4MW5A 1HZJA 3OQ1A 4MI9A 1IPFA 1T3LA 3GN1A 3ZTWA 3AHCA 1A8QA 2VDNB 2R1TA 1NATA 4HDOB 3BXPA 4IUYA 2D3TA 2OLKA 4KIFA 2HF7A 4BV3A 5EUBA 1JP7A 2AOTA 2YCBA 1SGWA 1V45E 5AN9H 3NYIA 2WKWA 5C81A 2OFXA 3MCVA 5ENVA 5J2UF 3R2JA 3MJTA 4G5SA 1JQ3A 2IIQA 1TWFL 2A9FA 3EAFA 4YJFB 2A9QA 1U7UA 1TJYA 4ZQCB 4DQDA 3KPUA 4DQLA 4YHBA 1YBAA 3L93A 2XSZA 5LBIA 1X9GA 4KBFA 3T61A 1SKMA 3ZZTA 1Z0FA 3K92A 4K05A 1S3FA 2G9UA 4OF4A 4GE3A 3HXMA 3HPRA 1LKZA 1V8BA 1B73A 2MS3A 2FF7A 5FHQA 4E2FA 3Q3GE 5L3VA 1DDGA 2MR6A 3EFOA 4M8KA 2AXPA 1FQKA 5DTEA 4BXOA 2BUBA 4MPJA 3V6LA 2QTMA 3STXA 5KSWB 1ZVKA 4BJ1A 1XJ0A 3VU1A 4ZEMA 3GP8A 4AZ0A 3GMDA 4RGVA 5FD8A 1R0BA 3QI7A 1K75A 1RYMA 2XJVA 1GY8A 2J30A 2NNLD 1IMOA 2O3QA 3CRVA 3OJCA 1E4VA 1BKSB 2P9FA 1UJNA 3IQXA 3O21A 5LBUA 3R9IA 9ABPA 2WF6A 3EGEA 1S2IA 1UKAA 3LWQB 3UXHA 2JD1A 3DAPA 3KQPA 1QK5A 3OTWA 4DMFA 1SU7A 2VK4A 3IT2A 1GQ2A 4EF5A 3AHHA 1RYYA 1RNLA 2C7VA 1QF6A 3KJHA 4HQRA 1JLLB 4QYWA 2C83A 1FDWA 3MWJA 4M0DA 4PAGA 4XGKA 5ESDA 2P6RA 1JA0A 1NKTA 3PQFA 2HK7A 2FPRA 1ADGA 5DYWA 3ZWBA 1SKYB 5AJUA 3JVVA 4WGFA 4Z86A 2W70A 2AZ4A 2WU1A 3PUVA 1T0HB 2C57A 1W29A 2FWIA 2B3DA 4G2NA 4KR2A 2IE0A 4R6XA 4MIYA 4ZYVA 5B12A 3DYBA 2B1JA 2G83A 4YALA 2GBLA 3OZWA 3SBXA 3CUSA 4JI7B 2AV6A 1J9ZA 1T1RA 4X92A 3S2HL 1J2YA 1Z74A 1C80A 1J23A 2MJLA 3H2GA 1PYGA 3ONWA 3FWKA 3KXDA 3BOSA 1NU6A 3N8NA 1QB7A 1X1SA 2FRDA 2IE8A 3GA0A 3OCWA 3NWPA 3WWZA 2BDTA 5IZCC 4RTMA 2JIZD 3EXFB 1JFVA 2F1HA 3HBLA 1VI6A 2WDPA 5IHPA 1JSZA 1WMAA 3PDHA 2QUAA 1H2XA 1DP4A 3GV0A 3HMQA 3B1FA 2QL7A 4IHJA 4B8WA 4YDQA 1L8LA 3LUPA 1XZPA 2AEMA 1ZMOA 2PVCA 4R4JA 1DIGA 3B36A 3FI9A 3U7JA 1U0GA 4L75A 3DUFB 4MW2A 2CF6A 2JFPA 3Q4GA 5FWXB 3C16C 3Q0TA 4P0QB 1ULBA 2ORWA 3I32A 2PD6A 4QOEA 5DX1A 4L4ZA 1PR9A 2AN4A 3UANA 4WQMA 4BPBA 4OB8A 1D4FA 1LBIA 6REQB 1CNFA 4XX1A 4Y2GA 4IWNA 2BRUA 4RFSB 5AKIA 5I7RA 3RVMA 2HCBA 3EH1A 4F3CA 1XSEA 4MS3A 3TAHA 3K9CA 4ZAVA 4BZXA 4QJ4A 4BTEA 1YL6A 3M1AA 1OW3B 3B12A 4NATA 5KAMA 5CVTA 4NOJA 5EFOA 3VKHA 5B3LA 4DBVO 2Z8YM 4LJ6A 4LJ7A 1V9LA 3U16A 3IA7A 3SR4A 5JRDS 4A8JB 1A5SB 1WDMA 3QNUA 3AONB 5BQOA 4HQLA 1H93A 5JVH1 3HYLA 4WKBA 4YROA 4YAIA 2ZBVA 3F46A 3AVUA 5KOJA 4HN4B 1X1TA 4L57A 4US1R 2JC3A 3N8HA 1FFGA 1W5TA 5F4ZA 1BWRA 3DEIA 4Y2QA 5J5VA 3TDMA 4OGGA 2P4HX 3ZY5A 1UODA 2PK3A 4LJLA 1F20A 4QG7A 1JR3E 1IBCA 3CISA 1S2ZA 2OBFA 1DTWA 2VUML 1KBQA 5EWMB 1Q0SA 3OWXA 1NX9A 4OYRA 2ATVA 3F73A 1NF2A 4LF7B 4M9CA 5RXNA 1RBQA 1HQKA 3COPA 2IU3A 1RI3A 4HATA 1AY0A 4Y2VA 1D0SA 2IHUA 1C3EA 2YJTD 5H1YA 1IK6A 1E2MA 3VYVA 3DE5X 1O95C 3CR7A 2P7HA 4L5CA 3WZMA 4LDZA 4QEZA 2VYVA 3EXFA 2OHJA 2V03A 3PQ4A 5BXQC 1Y7IA 4HS9A 4IFBA 1HNXB 2F8TA 3VA7A 4RO0A 5IYZB 3VR5D 2IYYA 1T6BY 1O6BA 4NDZA 3IAEA 4JBYA 2ZYGA 3TRHA 1TRHA 4IEEA 4LZOA 2HMTA 3DUFA 3PVCA 1E4OA 3KU4A 5FA8A 3T41A 2FEMA 3NOXA 1AQJA 4P08A 5AI3A 4Z9AA 4DV6B 1MW8X 2IX3A 4O1MA 4X8MA 4DCSA 1Z35A 3HN7A 2HYDA 3FVRA 1QO7A 2B61A 4TV9A 5C4MA 1A9YA 1TO1E 2ZJ6A 1SC3A 1SZPA 1RD4A 2QJFA 4FDUA 4LV5B 1Y37A 3ND5A 1W6RA 4QRIA 4A92A 4C03A 4V0LA 4D4KA 2RDMA 4LBVA 1ZK1A 5DBEX 2A0XA 2B0JA 3UGQA 1UBKS 2FN4A 2G0NA 4QWWA 2A92A 3HKBB 4CMCA 1DVBA 4EW3A 2GBPA 2APJA 4XSVA 2J0VA 2CBZA 4AZSA 1E96A 4TWBA 1YFKA 5H02A 4BNDB 4GKAA 2HZBA 2EBFX 2XB6A 2XDYA 4YB8A 5IVPA 2PUGA 3QBJA 3GRUA 4M21A 1V6CA 1P9WA 4UBNA 1DINA 1XTQA 1XQWA 3B6ZA 3PF8A 4LZWA 3PSAA 1DADA 2OR3A 1GNVA 3DH0A 5JADA 4QLBA 1ICIA 1ESCA 2R92L 4I9UA 4UUOA 4WVLA 5LQAA 2YMLA 3NDJA 3Q10A 2IP2A 2W8BA 2JGAA 3HKDA 3A2LA 4JQYA 3K7EA 4K87A 4MI1A 4R8VA 4IIJB 5CX1B 2QNRA 2RG7A 3BD9A 2NUPB 2OFPA 4O4IA 1KRWA 1FP1D 4DUPA 5DCWA 2W2QA 4L5JA 2M6LA 3AFGA 3RSQA 3PZBA 1L5ZA 1SHZA 2EP8A 2AFIE 2VOEA 1J2TA 1P9LA 3WGYA 2P5YA 2EZUA 2MYTA 1ND6A 4N82A 4C2AA 2XVZA 4OHRA 2VPXA 2F9LA 3IE2A 4RVHA 1JEJA 1PW7A 4LWOA 3ITKA 2JI3A 4ZPJA 1CZOA 3FCUB 5AW4A 1QG6A 4Z9FA 3EIFA 4WBSA 1CAAA 1RKUA 4YJ2B 5E9JA 3DNMA 1QQ6A 3KYWA 1RI5A 1JPJA 3LXUX 1GU0A 5F4BA 5IYZA 5IDYA 1ZG3A 1AQNA 5KKCA 4N5DA 2VK8A 4L0DA 4UEQA 1XKXA 1W0KD 2QG9A 2VAWA 4MDYA 4O08A 3D54D 5H8WA 4EVQA 3MGAA 2W0SA 1LH0A 4D0GA 5G40A 1JB1A 3X1MA 1XDGA 2YQ4A 5AJWA 4LF6B 4OHYA 4DLLA 2IZ6A 4HVLA 2KPOA 4I1UA 5KWJA 2GBFA 3IBSA 3SM9A 4EKYA 3PKJA 4M46A 4RC9A 4YRGA 3ZOZA 2NM0A 4ESEA 2BHNA 2KLHA 5LQNA 5FRDA 2JFXA 2QQGA 2EZ4A 2IYWA 1Q3HA 3KEFA 3KYVA 1T5LA 2GCEA 4UXHA 3T5PA 3OA0A 3HSYA 4DUZB 1XZCA 3WWOA 4BKQA 4P81A 3I5YA 4A73A 1M8KA 2TRSB 1TF7A 2J6HA 4FHCA 4P7KA 3IR6A 1U2GC 3FOEC 1CR4A 1T1EA 1TPZA 3T35A 1DQSA 5ALXA 4DCTA 5H4GA 5LR6A 1Z8DA 3IKVA 2OORA 4J4TA 1NMZA 4RHYA 4BV8A 4INAA 3SE0A 1BXGA 1RWPA 2VPWA 3D8SA 4G1CA 4ZVLA 1P9NA 1T36B 2AS0A 1E7YA 4HRAA 3Q0EA 1FYXA 1G4AE 1YFZA 3V97A 3VGPA 5BNWA 4IIJA 4JJ6A 1RRCA 2IUSA 2HSJA 2O3UA 3EYAA 1QYRA 1YK4A 4UMEA 1G5TA 3SC4A 4AZ3A 1E1NA 1HBJA 3AFMA 3ZPXA 1CIJA 3QVSA 4E3ZA 2FN8A 4UOEA 4WZAA 3W5CA 3D7RA 1NJ5A 1YFJA 3KJXA 4JC4A 1Z6XA 3KYYA 3V9AA 1J2UA 4M6WB 1GL3A 1UK8A 1VKOA 3WOHA 1SU4A 2V7WA 3AFOA 3GCZA 4KQMA 3FHTA 3SIWA 1EA7A 1YJBA 1IVNA 2IXEA 4I99A 1FFYA 2WKSA 4E11A 4S2EA 1DBVO 1G18A 1ZCAA 1EZZA 3ADBA 2I22A 1V71A 3FCYA 3T7DA 8LDHA 4BP3A 4YJ2A 1KNQA 2HWKA 2V9ZA 4UJ5A 3RQSA 1DX9A 1NRWA 1N3YA 1ZGCA 5E7JA 5IPFA 3PZAA 3ZWCA 2W98A 3V4ZA 1EFHA 4WJLA 1QO0A 1FQOA 3EEQA 3FPEA 4EECA 3ESYA 1Y1VL 4NL4H 3NBZC 4BLWA 3GFVA 3ZGVA 2ERJA 2JI6A 4ME6A 1GG5A 2PCJA 4RZIA 4URFA 1TTTA 3IXQA 5A3JA 1FS4A 5E7MA 4JNCA 4YFYA 3K0HA 4FIDA 4DADA 3JD0A 1O8CA 3K9HA 2XE7A 4LIPD 4OHPA 2PN1A 2HREA 5D3MB 2W2KB 4YIKA 4K9SA 4NAVA 2PCLA 5DNAA 3VM6A 2B69A 2O5VA 2VI5A 1R4MA 4OHFA 4TTRA 4ZOLF 2GFIA 3MWDA 3ELYA 4R40A 4YAGA 4BRSA 1BOOA 4JU9A 3PE6A 4G1EB 4CUKA 2XNHA 3DBOB 1Z5VA 5EHQA 4BOYA 5CX4A 1K7EB 1R50A 3Q3HA 1ZOPA 2X6QA 3B6IA 4AY5A 3WA7A 2DYKA 3MSUA 1NJSA 3Q7QA 2R9VA 2VCYA 3ZCPA 5I51A 2UU9B 1J9GA 2HRDA 3IQZA 4X45A 3DA8A 3GRPA 1Y6ZA 3L40A 4YR9A 3AUYA 1ISHA 2YFYA 2GPYA 3GPBA 1IOVA 2PSFA 2ZAMA 3I9KA 3PEUA 1PX0A 1DAIA 3DMTA 3S15L 3OURA 4NCNA 1T36A 1I13A 1NUQA 2O3TA 2R8XA 3K70C 5HM6A 2X19A 4ZQFA 1VQ1A 2FZ5A 2JH8A 4OHKA 1QNFA 1E9FA 2CNWA 3K5HA 3I1FA 4MUJA 3V4PB 4CL3A 4PG8A 4F93B 3HGTA 1UCFA 3L7KA 4LQ4A 1H6CA 3PHBE 3U62A 4U8GA 2CXUA 2WB1P 1ZK0A 3LXMA 4OK3A 4M6WA 5CPFA 4AUKA 1RC8A 2CXHA 4AVYA 2NNWB 1CHNA 3GBPA 4IJQA 4U7TB 2HQSA 2NO1A 3YASA 3VVCA 1H2HA 3VHRA 2B3TA 1LTLA 2QTCA 1BHQ1 2FFAA 2VPZA 3RDPA 4ER3A 2IXBA 5B6PA 5CFPA 2QSZA 4AMVA 1TEXA 1W4LA 1MCZA 3IDFA 3EVFA 4D3FA 2HRRA 4ES6A 1HFJA 1ORDA 3LQRA 1LPOA 3C98A 2ACKA 3RUHA 4BMYA 2HBQA 1U7WA 5KREA 1PZNA 2ZWMA 2E37A 1FLVA 4XYBA 3UC9A 3N75A 3SIPA 1FYVA 5C5EA 2ESRA 5A1JA 5AVXA 4DYVA 1JPVA 4TVSA 2I91A 5GOZA 4XVCA 2X42A 3M34A 3D6FA 4FTWA 3EUFA 4LMBA 4YDHB 5JAZA 5KWSA 1BWQA 2QA5A 2ZE5A 1TTPB 3IQDB 4KV7A 5GM2A 5CJJA 1ECJA 4GOLD 1KOFA 4F6RB 3TSYA 1VLQA 3GR6A 5TT1A 3TLGB 1TVMA 2O2SA 4CXMA 3RRYA 3ZHXA 4BGVA 1AMNA 1KSJA 1M1NA 1OA1A 2HJVA 2IF2A 2G1KA 9LDTA 3OLQA 4BMVA 1OYOA 4C7KA 1U7PA 4DNXA 1WJGA 3CPJB 3GEPA 3GFOA 3BMOA 2JJYA 2KLBA 1DXHA 1E1QD 5JQGF 5HZKA 5LQSA 1WM1A 5TPZD 2GZSA 3T54A 4D7AA 3MUNA 1WETA 1NMSA 1TU0A 2R93L 4MGKR 2BFCB 1IK4A 2E4AA 3MJDA 4XGQA 2P2YA 3NHPA 4I9GA 2G67A 2HXYA 4HEA1 1DRKA 1JMKC 4UBLA 2GVNA 1NVUQ 1UBUS 3FNFA 3KYBA 1JTFA 2R97A 3AR7A 2YHIB 1JEDA 4LFAB 1BD4A 5FPTA 3WGOA 4EPTA 4QFBA 4DQUA 1KXJA 1X77A 4FS8A 1Q3TA 2YHSA 3NI2A 2C2ZA 1US8B 1JQJC 4DLKA 4KQXA 3MHTA 3ANYB 2WE7A 2ZWVA 4RGBA 4BN5A 3PEWA 3JZIA 2APOB 1LLUA 2RDVA 1DPGA 1RMQA 4GZLA 1YAHA 3V1TC 5BW5A 1JW9B 1LVHA 3C7KA 3O8BA 4QATA 3GQBB 4WV3A 1HQCA 4MJLA 3BAFA 4NU5A 2XX3A 2P0YA 2R751 1Y3CE 2BZ1A 4UU8A 2D13A 4C30A 3GTKL 1AT1A 1JDPA 2FX5A 3N6VA 4PX3A 1Q15A 4BX9A 3EZ7A 3ZHQA 3QXSA 1KK0A 1T0BA 3LT4A 1IZ9A 2R00A 3BX1A 4H16A 4Y6QA 1VLHA 2R4TA 5F76A 3OZUA 2OV2A 1O6CA 2DHRA 1RWDA 3IJEB 3QLVA 5KSZA 1WZIA 3V4VB 4MYRA 2QMHA 1Z4LA 5H68A 4PG4A 3O8QA 1U2TA 1GG8A 5HS4A 1L8QA 2H7YA 2OQ2A 5CB4A 1SVMA 5BNFA 4B85A 4A3GL 4DY4A 4P93A 2AJTA 4TLMB 1B6SA 2PR2A 2EVWX 4QRDA 4F6RA 4DIKA 4DKJA 3VU8A 5AQ1A 2XUGA 2PGNA 3NIWA 3TLGA 2BFPA 2KSQA 2P9QA 4I8DA 5DHQA 1EFAA 4KWCA 1SUPA 1Q0PA 2G1JA 2PXXA 3IV9A 2XR1A 3D5QA 3LDFA 3MJRA 4K5QA 3DM5A 2FUNB 4LAFA 3T7TA 1VGVA 5EP3A 1DC5A 1N4DA 4C88A 3JPWA 2X8BA 2GT1A 2YVAA 2H16A 4J7AA 3ENVA 3TJZA 2VDJA 2ZSEA 3KUXA 2NUAB 1P3JA 4POGA 1IUPA 2GTPA 2VPIA 3HB5X 3ANXA 1MJGA 4K9NA 5EWJB 1P0PA 2BFCA 3FRIA 3VVLA 1W0JA 5SZJA 3IESA 3G6WA 4CIVA 4XPIA 5K6RA 4XQCA 1UFOA 1SUIA 1JG1A 1JDTA 4KQWA 3KZVA 3WK5A 2ZBRA 4PX5A 1V7CA 3I4FA 3I9FA 1G19A 2P9JA 2G7MC 3C87A 3VDNB 1FNMA 4POOA 4MCJA 1EA5A 2AOXA 2ZUVA 3FFTA 4OMFG 3DEKA 4PQYA 4A2PA 1UKEA 1TCBA 3HNRA 1P1BA 2WHQA 5EKTA 1YB6A 2OV4A 4IICA 5DSTA 4BNUA 1XQYA 2E82A 2W22A 4JC5A 1JYSA 1ZUNB 4EY5A 1JHDA 3GQBA 4MB6A 2GD6A 5E38A 4I4NA 4RZSA 1A88A 4CG0A 3RO7A 1QJ4A 4M0KA 4XTRA 1TQ2A 5F2KA 5KNDD 3HKCB 1GRRA 4JGBA 5AI0A 3CVXA 5G3YA 3S2SA 3RBAA 3DJFA 1AVTA 1X13A 3L0IB 1HSZA 2H4YA 1QHYA 3AJEA 4Q03A 4MO9A 1H2BA 4K6MA 2F3PA 1AB5A 1GVNB 1QXSA 2VDMB 2I4LA 4UMDA 4XQ9A 4RE6A 5H7XA 5HM8A 2V3VA 2YVLA 2FK7A 3GJ6A 1CETA 5A05A 4BO8A 2PUWA 1BJTA 2R44A 5CVCA 5AM4A 3ZE9A 1H4TA 4HT3B 4JV5B 2XMCA 2NYUA 2OD7A 3GJYA 5ETJA 1GDTA 1UWKA 1RQNA 3EDQA 2NXNA 2R2GA 2REOA 2XYHA 1TWHL 3AC0A 2GN2A 4WZBA 3HVHA 1PFQA 2LP4Y 1Q84A 4TS4A 1XMOB 2JKZA 1B1CA 3B1JA 3KKOA 1DQNA 4GGPA 1G5FA 3T5DA 4BFXA 3DOHA 4R1SA 5EWJA 1Y5NA 1QYVA 3LJKA 5EOVA 1MZPA 2Y4OA 3DWIA 1LEHA 2O06A 3KD2A 2WABA 4OYLA 2B35A 4KGDA 1KDYA 5KYUB 4CMJA 4NH4A 4RJLA 1LW7A 4B83A 3E3LA 3Q7SA 3HCFA 2QRHA 2H9IA 2AN9A 3RWBA 4RXUA 4N5LA 4EX7A 1F0PA 2J4CA 1LNSA 4OGLA 3LDUA 3DDUA 1X7YB 3CF6R 4J1TA 3L0DA 3DBHB 4PF1A 3ZDQA 4ARUA 3CLUD 4DDTA 1JDVA 3OU6A 1ZXXA 3N2NA 4OQNA 1NXVA 2DX7A 3W06A 1RKXA 5FYDA 4BRWA 4BTVA 1RFLA 2NVOA 2WKQA 2X4GA 2P2GA 4Q00A 1ZUNA 1YRQA 2QI9F 2XOKA 3I3OA 2BHRA 3B5JA 1PCXA 2DE0X 3T12A 4AUEA 4TWAA 5KQGA 4BWGA 1FHHA 2HGSA 2BHSA 5C8YA 1RAAA 1JJ7A 4X1YB 5DHSA 1K88A 1YOVB 2DFDA 3I5UA 3UW1A 2NUBA 3OZRA 3TWOA 4F4IA 3TDNA 4E5YA 4D6XA 1ZHHA 4LA4A 4ALNA 1ZBDA 2VTBB 1JXAA 1NQ5A 2YFKA 3DBLB 3GVPA 2I1LA 2QTRA 2IHNA 1U31A 3ASYA 3O4JA 1U80A 4FFDA 4FYMA 4QQRA 2O8CA 5AKHA 3EIWA 1WZUA 2FJPA 3LUAA 5AMXA 4F4CA 3ZE2B 1ID8A 1X80B 2O07A 2AEJA 4RADA 2DBVO 5AD1A 2A3NA 3IVRA 1NYLA 4E5PA 1VE1A 4PLFA 1G0NA 2VNHA 1OFUA 2PLNA 2ZAGA 3DZFA 4HH0A 5HA5A 5U1PA 2OYCA 5T3YA 1Y3FE 4EUNA 2QRZA 3H2KA 3KLPX 4C6TB 2SICE 1KO7A 5G0VA 3KB8A 1EQAA 3L41A 4MGHA 2X86A 4E09A 2RBKA 2V9PA 2JZCA 3TD6A 3HRIA 3EVDA 1X42A 2GYYA 3R9WA 1KZ9A 1A5TA 2XOXA 5K9ZA 3Q0IA 2B8JA 2Y99A 1GZVA 4WOJA 4UD2A 4BB9A 4UM9D 3HXTA 3WBJA 5AICA 3LT1A 1U3TA 4QOSA 4G84A 1AZWA 4X60A 1SCNE 4EZEA 1XRJA 1X2BA 1OILA 2PX6A 1K92A 3WYAA 4BFYA 3O7MA 1TA9A 3L5KA 5FBQB 3O8RA 4A03A 1X7YA 4AJKA 4LRSB 3CSSA 3WRXC 5H1Sc 3GX1A 1R4AA 3SIXA 3TLMA 1ZN2A 5KNLA 2E3JA 4UCQA 2QPTA 2I4TA 4JDPA 2JNWA 2QTVA 1C1DB 1U8FO 3HYCA 3NU1A 4EYOA 4PGAA 3UCXA 3RASA 1UWVA 3FDZA 2OO7A 4EBBA 3RGGA 3ICQB 3PJGA 3WLFA 1JZSA 4HUQA 4X1YA 3GVCA 2AWOA 1BVRA 3TKAA 5L3ZA 1YOVA 4HTFB 4ZVMA 4WNCA 4AYXA 5BOVA 2X4DA 8MHTA 2PUTA 1Z5GA 3D0QA 2GZ1A 2F1OA 5A06A 3EVGA 4F5ZA 2VTBA 1RZRA 1ECFA 3GTML 3K2BA 3LBAA 4RDHA 4X8HA 4Y9TA 3TS1A 4JENA 1CY7A 1YCFA 3FNHA 5TGTA 3JYHA 3K1JA 2UZ0A 2WJ6A 2X0FA 1UM8A 2YJ5A 2F9MA 3U26A 1CJBA 1EP2B 1X80A 5B2FA 2NVYL 1GGMA 3DOIA 2ZBFA 1MO6A 3KX2A 5SZHB 4JOBA 2ACEA 1U9CA 1VRWA 1JNYA 1K7XB 2C77A 2YASA 1R0KA 4MV1A 3ZHCA 3ZWDA 3GPLA 4MHTA 4OJNA 3OQHA 5JZOA 2W11A 3Q7TA 2J4DA 3IVAA 1SD5A 4TRNA 1SKQA 2JJ2A 1IL0A 3S1LA 4CM8B 2XUAA 5IG2A 4OMCA 1KSFX 2YH2A 4I3FA 3BJIC 2PZJA 1PEKE 3I0NA 2GK7A 3FWPA 4D5EA 1VJ5A 5AW5A 3QKIA 3UGKA 4EJSC 4OQYA 4M76B 1HR0B 3KZ1E 3ZU4A 3WYNA 4YRBA 2P3LA 2HT6A 5JTTA 2O20A 1A8PA 3HXOA 1EUYA 1UJ6A 1PKXA 4O02B 5EZSA 1ZX1A 2XJ9A 1MF7A 4G1BA 1C29B 4K3UA 4RY9A 5AR1A 2XCRB 5FTLA 4Q21A 3UENA 1QRSA 3HCBA 3BK1A 1HUQA 4G0OA 2D7CA 3C3MA 3WADA 3TLYA 3ER6A 1VJTA 2FEOA 3ANSA 3TQOA 4EWLA 1D6NA 1PVOA 1JUDA 3BULA 2JI9A 3R3YA 1T1GA 4N76A 2GETA 5DIFA 2IQIA 4HVCA 1ODJA 3GJRA 3OMWA 4JGIA 1MABB 4BNTA 1GHTA 2YL2A 3OJEA 2WT8A 5AHWA 3H8WA 4QBFA 4E21A 1E1DA 1WDLA 3EGXB 3U4IA 3W04A 1LF0A 4CJXA 9ATCA 4L3WA 3SLKA 4RD1A 3TZQA 2ZIEA 3IQWA 4ND4A 2MDTA 4GF5A 4L74A 5J59A 3ZV3A 5FR2A 3SYKA 2GF2A 4EQ6B 4MLPA 1I4OA 3NBXX 2O2CA 1M75A 3N8GA 4MR7B 1WIWA 2OHGA 3I6MA 5LB4A 1JG6A 1OBVA 2BFEB 2QMYA 1CCWA 3M1LA 4N6OA 4RANA 2AMVA 1U0TA 4HO1X 3M49A 1I3CA 2UVQA 4URZR 4EARA 1RRGA 4XYMA 1LVUA 2QROA 2PUVA 1P7ZA 3QNWA 3MINB 5MGBA 1OBHA 5G0WA 3S44A 1RCTE 3EIOA 4J90A 1T9CA 4RTOA 4LOHA 5JY6A 3RZTA 3PB3A 1W5BA 2ZSUA 2NQTA 3DT6A 3NJ4A 1P8AA 3PLRA 4MVJG 4PX9A 5ALDA 4MINA 4CM8A 1VLLA 1II8A 3CUTA 4Y2UA 5BW6B 4MUFA 3A32A 5CP8A 4BEJA 5KYGA 1O7JA 2GWHA 1MG5A 1VMEA 3F47A 4AYTA 4EYEA 3OQJA 2CLMB 4FJ0A 5DN6D 2NG1A 3MOGA 4G0UA 1TMGE 3EBPA 3LPDA 2ZPTX 4JROA 5BV0A 2OBBA 1LA2A 2W6ID 2XOEA 5JBIA 2J1LA 4G24A 4R8LA 2LCQA 4I1PA 3Q3IA 4MR9B 1AS0A 1Q1BA 1ST3A 2HU7A 3PRJA 4Y9RA 2WD9A 4FN5A 2NYVA 4M3NA 5KNBH 3S81A 3VU3A 3SSAA 4EYKA 2Q46A 5K2ME 2H5JA 3ESDA 4DIOA 5EIEA 2DKFA 2AW5A 2A68D 2Q8QA 2VTDA 1DEHA 2AI2A 2YS7A 3AHFA 4MW7A 2AT1A 3GLQA 3WSVA 3K0BA 4MQEA 1Y3AA 1ZI6A 2VP0A 2WSBA 3SYNA 2QQ0A 2ZYWX 4ISCA 1L9XA 3JS5A 3M6LA 3U9TA 3W2IA 5E4TA 2FETA 4DJEC 3ZWYA 5E8RA 1QGZA 4IZHA 1ZI9A 2C84A 3W4KA 4E7PA 3QFHA 5CNJA 2WNSA 3E9CA 1NJGA 2O5EA 1OSNA 1U8XX 2AZMA 2JGLA 4KSCA 2IZ0A 1XK6A 2Q3DA 3RU9A 3P4XA 3PQ6A 3GLKA 3S1SA 1K2WA 2YHUA 1S2DA 4UD6A 3UWDA 4KEAA 1I0ZA 2GLTA 1RJGA 2F3SA 1L4GA 3O0DA 4EQ6A 4TV8F 3IA2A 2W9XA 3KOZA 2G9QA 3KZKA 1VKNA 3OLWA 4MR7A 5JPCA 2AH5A 3CF4G 4F6CA 4DANA 4KO4S 3EARA 3ZD8A 5EZ6B 3M3YL 1G9TA 5JCXA 3DTVD 3KVNA 3W79A 4YV2A 2G08A 3CLTC 3F1KA 3FTNA 2EX1A 3D59A 4QIWP 5F52A 2OTCA 4A91A 2QOEA 4GVLA 5A4JA 1X7DA 3MA0A 1ZISA 2VAPA 1I4WA 3PDIB 3Q6IA 3P45A 3VQTA 5COAA 2XB2A 1YDFA 1JIVA 3CN9A 4ZU3A 3GW8A 3LY7A 2Q9BA 2GZRA 2XMGA 2YYZA 4LUCA 4Y1RA 1QB8A 1Y5IA 4ZOCA 3PXXA 3NM4A 1E1RD 4FEYA 1OHHA 3VR3D 2QSJA 2Z6UA 3B6JA 3GFQA 3G8YA 1HNZB 2Z2YA 1L7PA 2P2ZA 4KI0A 1NBOA 1IZYA 1DAPA 3MMXA 5KNCH 2Y1GA 5FJ8L 3ONEA 2AFVA 2A1UA 4P84A 4Q66C 1Y8RA 1IBKB 5MLC3 1N0HA 4GVXA 4MR9A 4PCLA 3EG5A 3RC2A 3Q2OA 4NK5A 2K7FA 3JR7A 1O5IA 1RTTA 2QUIA 3SS2A 3A6PC 2XWBF 2C2OA 2HLDA 2Q5QA 3V7UA 5BWMA 5LM3A 3R3WA 1ZO8A 1U0OC 4C22A 3H8VA 1DRWA 3VSEA 1NBMA 1HETA 3BDAA 3HOXL 2C2YA 4D79A 5AW7A 4D74A 1X7WA 4GI7A 1XQ6A 3RRMA 2X2OA 2VKQA 4ZXFA 1PGJA 1F8XA 1XXHE 4JJIA 4B3IA 3S5JA 4GDFA 1SBQA 3N59A 3AV0B 3G5AA 4DLRA 2CJXA 4G9GA 3HRKA 1HG0A 1A4IA 1S89A 1Z7BA 2WV7A 2D8AA 4I0WB 5FQOA 4E07A 1BKYA 1GZ6A 2BELA 2WV9A 5CA1F 3CE6A 2H0RA 3NKVA 4I1VA 5EHGA 5HRAA 1Z34A 2R6HA 2IVFA 1VJRA 2KE5A 4RAQA 5DHRA 5ESRA 1RHJA 3UKOA 3X1JA 4AZTA 3CNQS 2A30A 2EGGA 4AHXA 1Z5PA 2ZZKA 3GPIA 1HI9A 3NVMB 1SPBS 3OLVA 2BSXA 2G6BA 3PQ2A 5IAGA 4NV1A 4DNFA 4ENVA 4NQRA 4ICIA 4NYMQ 4BLOA 3U44A 1N0WA 1D2AA 1NYRA 3C3DA 2H31A 3HNPA 3K1ZA 4OREX 3R75A 1DUSA 2ZRIA 3W1WA 2CSXA 3OZFA 4V1CI 3GU3A 4INZA 3WLLA 5CFOA 3J7TA 4Y2JA 5FBHA 4AYBP 1AC5A 1O8BA 1V11B 1DEAA 3PDIA 4TKUA 3T3DA 3WICA 1PRYA 2RGXA 4BC1A 3DXZA 4YCLA 2IDJA 2Z95A 4QDOA 3DWEX 3DPIA 3JASA 4AJLA 5IULC 3ZWVA 4UHKA 1FPQA 3R3XA 4OP2A 3AMVA 5DLQC 3PTLA 1DG1G 4DCCA 2IOFK 4FYVA 1W6UA 1YZ3A 2EEPA 4MKXA 1GAWA 1QCVA 2D74A 4BQFA 4CT4B 2RKBA 2CWWA 2RCYA 4JKYA 3ICEA 4I36A 3H8JA 3MM4A 3VZRA 2MT9A 4YMTA 3TMKA 4ZIRB 2P69A 1QH8B 1QDLB 4WA8A 1G3QA 3VR2D 1OTYA 4NC9A 3D8TA 1OJ7A 2EFEB 4E0BA 1FXUA 2WG2A 2IY8A 2O54A 1L8OA 2B37A 2PQMA 4N40A 2AL7A 1X94A 3ZUPA 1FW8A 2C94A 3AEQB 3DQQA 1QOQB 1TIBA 2V1XA 4GLFA 1PQPA 1BSVA 3OT4A 1Y1KE 3H6GA 3HRHA 1GSAA 1N6HA 4CM3A 4CIBA 3F49S 1PR5A 5DYGA 4Y6SA 1GAEO 1LWOA 2NXJA 4QBIA 3K0CC 5AT1A 4C1BA 3BQ9A 3G2JA 4GBMA 1NUSA 2W5UA 4PRKA 1DAFA 1KE1A 2V6MA 2VQFB 2D1YA 2GYUA 1NDUA 3R9XA 1GL7A 2WI8A 1MB9A 4QFCA 3PA8A 5CU7A 4V1CA 5C7IO 3COVA 3G7UA 3LFUA 1D7AA 1RBMA 5CD1A 4C4YA 3DEJA 3SXJA 3QX8A 1WPRA 4XWKA 1ZWKA 3K09A 4JYZA 5IP9L 1ZITA 5D00A 4W6QA 1B16A 2BZGA 4IXNA 2DMRA 5JLAA 3ETDA 2CHEA 1P6QA 1KDOA 3R5SA 3HVKA 1N25A 4WECA 1AKMA 1RWVA 1R5NA 2BDEA 3QUTA 4Y0AA 5DBHX 2A9KA 2JAHA 2QLMA 4BNFA 2GASA 3FMOB 1ZJ5A 4G23A 5BPHA 4Z4QA 2OG2A 1QIJA 1E63A 2WFAA 4XR4A 1DUIA 1ZL2A 4C14A 4BX3A 1EWTA 4LC1A 1X38A 3OCJA 1U3GA 4FD3A 1AU9A 3N7AA 4Z8XA 1DIRA 1MRZA 2E1PA 2IYFA 2Q5HA 4WY5A 1Z7WA 1X7ZB 1JWAB 3U4QB 4URXR 2V7VA 3ZY4A 1BH6A 2PRZA 2GVDC 1N1DA 2GKGA 5EYPB 1V3UA 3BSSA 4EUSA 1WCYA 5JAQA 4HF7A 1NRIA 1XF9A 3BXGA 5AI5A 1BXRB 2X0EA 1DV2A 4XIJA 5HZMA 1FE8A 3QLUA 4FBLA 2YZGA 3AG5A 3FB4A 4NKRA 1CYEA 1F0NA 5B1SA 3FOFC 5JLJA 4CMKA 2ECFA 1OI2A 4ZIRA 1QH8A 2WUFA 3BPSA 4FZ3A 4MAFA 3G88A 2VXBA 1T5BA 1REQB 4FMDF 4EQZA 5EUMA