3ZG6A

The novel de-long chain fatty acid function of human sirt6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
b'MNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-6
publication title Sirt6 Regulates Tnf-Alpha Secretion Through Hydrolysis of Long-Chain Fatty Acyl Lysine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 98
structure length 294
sequence length 294
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3zg6A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3zg6A01
2WVAA 4KXQA 4X3OA 3EA4A 1Q1AA 1T9BA 5MFPA 1T9CA 2H2GA 4JU9A 4GP9A 1YC5A 3PKJA 2EZTA 2EZ8A 1JSCA 4K9OA 1O97D 3RIGA 2B4YA 2JI8A 4UTZA 1Z8NA 1UPAA 2AG1A 4K9PA 4FZ3A 4QQ8A 1YTLA 2W93A 4BVFA 5EJ8A 1M2GA 4RJKA 4JSRA 4BVEA 4BVHA 3JR3A 1EFVA 4J1TC 3GLUA 2JLCA 2C31A 1UPCA 1M2JA 2H4HA 3D4BA 5MFZA 2VBIA 4F56A 4BUZA 4D5GA 1PNOA 2H2DA 1POXA 2A1TR 4RJIA 5EJ6A 1V5FA 2EZ4A 5FEMA 4UUBA 4F4UA 4GG1A 5EJ7A 3CLRD 2H2FA 4GM1A 4K9LA 3CF4G 4Y6OA 1M2NA 4UU8A 2UZ1B 1UPBA 3JWPA 4KGDA 1PO7A 4L2IA 4JUDX 3FLMA 4J16C 5BWLA 1MA3A 3PDHA 1ICIA 4TWIA 3EYAA 1V5EA 4FEEA 4G1CA 4C78A 2EZ9A 4IAOA 4JUAA 4IF6A 3IAFA 1DJLA 4HD8A 5DGDA 4MZXA 4KPUA 4BVBA 2H2IA 2VK4A 3ZGOA 3IAEA 2X7JA 1EFPA 1D4OA 1PI3A 4BN5A 2OD2A 3PKIA 3CLUD 4BN4A 2Q29A 1Q14A 5EJ9A 2VBFA 4D5EA 1U31A 1S7GA 1SZCA 5DEIA 2PGNA 1Q6ZA 2OD7A 1BFDA 1YBHA 1PT9A 5IMSA 2OD9A 5EJMA 3FSJX 2VJYA 1Q17A 2JLAA 2QQGA 4ZP1A 2JI6A 4GM4A 2H59A 5EJAA 3U31A 5K6TA 2FRDC 4JUBA 4V1CI 2PANA 4Y6QA 4C7BA 1U2DC 3CLTD 4FVTA 4K9KA 4UTXA 2UZ1A 4JUFA 2DJIA 4V1CB 1YI1A 4Y6LA 2QQFA 3CLSD 2OORC 2FSVC 1NM5C 5K3SA 2V3WA 1V5GA 4JT9A 4O8ZA 4MPPA 3OE1A 1OVMA 1Y9DA 4ZZIA 5MF6A 1T9AA 1T9DA 2BRUC 2JIBA 3K35A 4HDAA 2NYRA 5EJ5A 1J8FA 4UUAA 1YHZA 4QELA 2Q27A 4MPRA 2OO5C 4RMGA 3ZGVA 1QPBA 4RMHA 4BV2A 2VK1A 4I5IA 2HJHA 1PTJC 3FZNA 1YC2A 2WVHA 5EJ4A 1SZDA 4UTNA 5K2OA 1YNOA 4UTVA 3HWWA 2H4FA 4IG9A 1ZPDA 4MQ5A 2Q5QA 1YI0A 4COKA 2FR8C 1OZFA 4MPJA 3HWX1 4K9NA 4V1CA 3GLRA 2EZUA 1OZGA 1PVDA 2H4JA 4K9QA 2JI7A 2VK8A 4RJJA 4TWJA 4K9MA 3LQ1A 1M2KA 4X3PA 1E3TA 5MGNA 3F6BX 2H2HA 1YHYA 2VBGA 4RMJA 4L3OA 3D81A 4R8MA 2FN3A 2JI9A 4JUCA 4RMIA 1HZZC 2IHVA 4JD5A 2IHUA 4UU7A 2Q28A 1M2HA 3U3DA 2AG0A 2WVGA 1O96B 2IHTA 1U28C 4QPZA 3D7KA 4UTRA 1MCZA 4JT8A 1N0HA 1POWA 4Q9DA 4GM0A 3GLTA 5BWOA 2Q5OA 3ZG6A 4JU8A 2Q5LA 4FEGA 5BWNA 5D7NA 5DGTA 4GPEA 5K6RA 3EY9A 3F6EX 1XLTC 1S5PA 5FYQA 3RIYA 5AHKA 2FWNA 1U2GC 2A1UA 2NXWA 2Q5JA 3E9YA 4BVGA 3GLSA 1OZHA 1PYDA 1PNQA 2PGOA 4BV3A
chains in the Genus database with same CATH superfamily
4FNAA 1TC2A 4OXIA 2EL7A 2HTFA 1TUBB 3AILA 4I50B 5C4JL 4C14A 3C2QA 1JDTA 4YRFA 3TLGB 1ODFA 1T1JA 3UV3A 1B14A 1KHHA 4FDVA 1S24A 4B79A 1NYLA 2IYYA 2Y2VA 4X62B 2GM3A 1PJTA 3CO0S 1QHXA 2X9NA 3RVOA 3GHHA 4CM4A 3UXMA 3FTPA 4IDPA 2J30A 3PGJA 1Z73A 2E6KA 1P3DA 3EVNA 4J7AA 3JQ6A 2QKYA 1C7ZA 1J97A 1YC5A 1XROA 4FFBB 4OMUA 3TGWA 3TQFA 3PKJA 5J1SB 1OLXA 4NPAA 3LLSA 4B35A 3UPDA 3KTDA 7YASA 2IEAA 5KOHA 2R6AA 4P38A 5GJWC 2WIGA 1I2CA 2XGMA 3IKVA 4UAJA 4D9EA 3MF4A 3FUXA 3UICA 1KMHB 2EP8A 3JYOA 5TPZD 4RFVA 3V8MA 5HGXA 4CIYA 4YWHA 1LDNA 1XRJA 1GUFA 1VIMA 1QCCA 4O1MA 3S2UA 1LTHR 3A9RA 2QMYA 3NTXA 2VXCA 4WVLA 1JHDA 3WZMA 3HJHA 3BGSA 2D4AA 2YZ7A 1RRGA 4LOHA 4K9PA 1WE2A 3A3OA 1K5DA 2FE4A 2VYNA 4ENUA 4EA6A 3KOYA 3MPSA 5K2MA 2WWRA 4FR5A 1M2GA 4MUMA 4L4SA 5JAUA 3JQGA 1XKTA 3AUKA 1TYZA 2DQ4A 4J29A 5HFAA 2BGNA 4D3ZA 1EFLA 1FS5A 1R10A 5E4YA 5KTOA 3GT3A 3N86A 5CDYA 3PC7A 1Y8ZA 2AJ8A 3W4KA 5A0VA 1KP3A 5EIOA 5CB4A 3JZAA 1XUOA 1Y6GA 2G6TA 1YZNA 5GAJA 1NVGA 4HDNB 4BWGA 2DQYA 1Q1EA 2BEVA 1BS2A 5EIBC 2JGAA 2SKDA 1E3SA 2AFRA 1JIUA 1USIA 1UOPA 1NKTA 1ZRNA 2AOUA 2OP0A 1T5OA 3EVTA 1JNXX 3KG2A 4K26A 2QE6A 4WEOA 4ER6A 4RTOA 3PVCA 4C21A 4IDDA 4IIUA 3AKCA 4KXNA 1CY7A 1CY0A 4FS3A 4Q3DA 1NXEA 4XPIB 5F1YA 2XT9A 2IX3A 2CMGA 1WKCA 2HWYA 2N46A 3IXQA 4IQ0A 1HTWA 1TWAL 1RFGE 1XZGA 3O4IA 4D4JA 1QGOA 3W6ZA 2D2XA 3WDSA 1P4JA 2C3YA 1IDOA 4R54A 4NNOA 5JSZB 2VJCA 3CN7A 4AI2A 3WLEA 2NZUG 2ST1A 1O9GA 1N33B 1N9GA 3DOIA 1YRAA 4EKYA 3COJA 4ZDWA 3SS7X 2AXPA 4KQJA 1V37A 3IV6A 2V7EA 1TE2A 3VJMA 1UBJS 3VVCA 1M8KA 2VP5A 4ZD6A 3RVJA 3VO8A 1PZEA 3NTUA 4G6BA 2WTEA 3LP5A 2NQ8A 4O08A 3MTIA 4C3UA 4YRSA 1I7DA 4IUYA 3U81A 3RNLA 1YL7A 4PLHA 1BRFA 5I45A 3GLIA 3T5CA 5F33A 4GM1A 1C4OA 1D2MA 4RSMA 5G41A 4LV8B 5G40A 1E3DA 1YZFA 3HL0A 4QX6A 2R7ZL 4WY8A 4NU5A 1OFUA 4DA6A 1M2NA 4I5FA 3LCCA 3ZDXB 2IBSA 3NBUA 1HDIA 3K9WA 3O8OA 4IIXA 1UP4A 1U6IA 2P2GA 2FRVA 3GJ5A 1KIFA 3VR3A 3B6JA 1QCZA 1RHUA 4AK9A 5HRCA 5E9WA 2ATCA 3CISA 1RFLA 1HQYE 3AXTA 2GPWA 4EG8A 1MA3A 1OI4A 2JLBA 4RSGA 4IO0A 3VR4D 5BNTA 1FQKA 3VYTB 4KLNA 1QP7A 3D8BA 3RFFA 1PJZA 4F1JA 5JPDA 4RLFA 2OILA 1Z0KA 3T6KA 3MGAA 3LK7A 1UDWA 4TLCA 2AN4A 1TQ2A 1B2LA 3NANA 1JDBB 2A92A 4L0CA 3ZZMA 3MHTA 3UGKA 1QFZA 3JARA 4J1SA 2P1DA 1NV9A 2VRWA 3GUHA 3HN2A 4C78A 4GFDA 1LDGA 1XQWA 2VP0A 3JU3A 1SEVA 3P9SA 4NNPA 3UOAB 3V1YA 1PT8A 2O8EA 5A5GA 1K08A 1MNQA 5ALKA 3CW9A 1YSCA 2EKLA 2VDUE 4Q7LA 5CGZA 2FZ4A 3GAMA 3W5IA 4XASA 3LA8A 1YUZA 1MQSA 1KSGA 4KPUA 4BVBA 4EX7A 1L4UA 2J0UB 3ZGZA 4O1HA 2NP6A 4CKCA 5JH7F 1E61A 1GKUB 5ALDA 2VF4X 1LCIA 1VL8A 1PG0A 2WKQA 1EFPA 3QSGA 4EMSA 3LVQE 1KDYA 2ARKA 3FPLA 3NASA 5E1DA 4UZEA 3GBPA 3T3PB 3VVMA 3KB1A 2X1MA 6RXNA 2FWRA 2O23A 4TWAA 2NYDA 3VBCA 3SLKA 3PQ6A 4MV8A 4PN7A 4AMYA 5KWSA 2E21A 5EJ9A 3UJ8A 1M76A 3BSFA 1PS8A 2BWJA 4YX9A 1QG4A 2VBFA 1YMUA 2ZUFA 1TRHA 1QYBA 4ZFNA 3COWA 2KKDA 2P4SA 1FHMA 1FVOA 1KAOA 1PR3A 1NLUA 1S7GA 4J49A 1GITA 1XNJA 5T6MA 3SFVA 3EIHA 1L8AA 4GBGA 5DSXA 3CZAA 1UXIA 1UXKA 1VYUA 5KNLA 8MHTA 2XECA 3NRJA 2I03A 1G2PA 3T7IA 1ZHOA 3CLUC 4CODB 3QFCA 1FJXA 2L0XA 5EJMA 5BQFA 1TJ5A 4M83A 4Z9BA 3HABA 4MHTA 3WC4A 4AS3A 4KITB 3AY0A 3H87A 3HR8A 2C58A 3LA6A 3RVQA 1PV1A 4HZGA 4CTJA 3QVDA 2OE2A 1XNRB 1G20E 1MPTA 1PW5A 5LZ8A 4E1VA 3FFAA 4R0NA 4E5NA 1P8JA 3CJTA 3EPLA 3CNHA 2ORVA 1W52X 3L6EA 5JZSA 4M55A 3ZLJA 1GVHA 1G20B 3ADKA 1OWCA 3NYRA 2XYVA 4PX5A 1GD1O 1PR1A 4ZCMA 1FS6A 2FSFA 2K2WA 2E4XA 3HFJA 5DISB 1LBHA 1H5UA 5DYNA 3TM4A 2HCFA 5I7FA 1DC4A 3D8TA 1VCIA 2VTDA 2YQ5A 4MR7A 5LA6B 2CCGA 2OY0A 3QYAA 5LOVF 1QFYA 4HB2A 2HLDA 3G5UA 1UKCA 3C7TA 1K5PA 3SP1A 4IVQA 2GO1A 1KDRA 3CW8X 3VX3A 1OILA 2ZVJA 3ZDEA 2GA8A 4Q9JA 2Z09A 3N74A 1YUMA 2G09A 4M8LA 4MUKA 4DIMA 5KDDA 2QGZA 4R9VA 1DAGA 3NHJA 4DV6B 3R23A 5EHNA 1A4UA 2J6CA 2H8KA 2YHSA 2QMOA 2WWFA 5AHXA 1M72A 2FPIB 3L7JA 4MDHA 3KK0A 3KYCB 2Y77A 2J3LA 2QVLA 1V16B 4MRVA 3SQLA 1CY8A 4JIGA 1Q1QA 1NQXA 4ZU1X 1WCV1 1RI2A 1BE0A 1NM5C 2YN2A 3RGWS 4LJRA 4FFVA 3KXPA 4JWKA 3TXYA 3Q6NA 4LTDA 3EQ9A 3RE1A 3KYYA 1PR6A 1RKVA 4L7VA 3FZEA 4V0ME 4ARZA 1V4NA 2FVXA 4LF5B 4HFJA 1IBCA 1BW9B 1H4SA 4G09A 1E6WA 3VJKA 3VZPA 2G0NA 1LDYA 4EHJA 5AW8A 5H8WA 2RJ3A 3HJWB 3KUKA 2L2QA 3IAS6 1UP6A 3OZUA 1JJVA 3EF3A 2BFMA 2PMZP 5T4HA 1E2JA 1QUEA 3U4QB 4RHTA 1XYYA 4OIMA 1OXXK 1MQAA 3ZR4B 1VB5A 1IRIA 1E5VA 1P7ZA 4UU0A 1VHQA 3GFBA 4ERNA 4MRAA 3ZHSA 3QWHA 4KN5A 2ZYVX 1E1CB 5C8YA 3LWPB 3NH9A 4P32A 3BZUA 1OXSC 4R9UC 3TD2A 1E9SA 2G04A 1MC4A 3AX6A 3PNVA 4GMDA 3KZ1E 5SY4A 4DPLA 1T4CB 2YFHA 3F3KA 2VL7A 3AYXB 2Z6AA 1MO3A 3FYCA 2C2XA 3DP9A 2VHTA 2GASA 1DKMA 4JBNA 3QVJA 2Z43A 3LPCA 3K9LA 2WW8A 5CHEA 1VL1A 3LQKA 2I1QA 2IDKA 3B51X 1R9JA 1XFDA 4WLVA 3WNDA 1RWWA 4YR9A 4CLRA 2P41A 3O8CA 3OCYA 3ROMA 4TVMA 3Q9NA 1KDTA 4IUDS 2FGJA 4HX5A 4Q5IA 5IM5A 3DMTA 2PSEA 3I8OA 2HLNA 2Q5HA 4LZJA 1KJQA 1P0FA 4L72A 1WCWA 5JJCA 5JQGF 4G2NA 4A0RA 1E4YA 1X9GA 4BV2A 5DHAA 3W2IA 4OQQA 1VI2A 1YACA 2BEUB 3I2FA 3O3CA 5CCEA 1XAGA 5KDOA 1E7RA 4C0KA 3AIMA 2BE9A 3JD4A 1HDOA 1MC1A 1N92A 2B6NA 2EX1A 4MR8B 5DMHA 3TEFA 2XBMA 1MJFA 2RAVA 3O8LA 2GLTA 2HU5A 2P90A 5C5EA 1XZEA 3BHMA 3O4RA 5EERA 3ZXSA 4BAGA 3T5BA 3Q85A 3RHZA 1HI9A 1XIVA 2ZRMA 3V1TC 4KODA 2Q62A 2X1HA 1FQWA 1ZD9A 2AQIA 1SZDA 3QUAA 5AHRA 4GLOA 4M0UA 4PBSA 3R3WA 5ELXA 5FX2A 2RGYA 5IXJA 3W5UA 4EQ6B 1A2KC 4CMIB 1E3MA 4LKOA 3M3DA 2ZSFA 4MW0A 1MEOA 1ST2A 4KTVE 5FUBA 5AHWA 1F5NA 3OT5A 3SF0A 4OX9B 421PA 3KKEA 1RADA 3FOCA 1JQ3A 1B1AA 2GK7A 2DEUA 4AROA 2YOGA 1RTTA 4Z4GA 2V7TA 1R18A 4LFCB 5IYZB 3EX7C 3AR6A 1GFWA 2INGX 2MHCA 2O3UA 1O8BA 4GECA 3HCCA 3H2GA 3LXRA 4PYIA 4C5CA 2CLKB 4Q3LA 3EVAA 4COKA 1XA4A 1N0WA 3KFVA 2DSTA 1IJBA 1D2AA 1IU9A 1Z6TA 3BQNB 3T5GA 3RJTA 5KX5A 1K6EA 3L1HA 3RKUA 5DNYB 2H5IA 3OFSA 4ISBA 3UAYA 4ACAA 2DFVA 4ZQHA 1SIOA 3G13A 3T3MB 4LVNA 3PA6A 5BRNA 1Y1WL 5BYKA 4BIMA 4HQNA 2XDQB 3E9RA 4WA7A 1N2EA 1YIAA 3QOYA 3KU1A 3PIIA 2GWRA 3ZLBA 1CF4A 3L93A 2IH4A 1MJNA 2QTGA 3DVSX 3DWGA 2DP4E 3MZ0A 4MDEA 2LR0A 3UHPA 1E32A 5E4TA 2B8EA 3EISA 3HCAA 1YUXA 1DP4A 4CMAA 5AKLA 4AY6A 4PY2A 5D51S 3BCUA 1UJ2A 3ZDCA 4HN2A 3FGOA 2XJ4A 3AF6A 2O8BB 1G8JA 1E3TA 2OWDA 3S5UA 4H3KB 1BMTA 6GPBA 5K0GA 5ISMA 1PGNA 4IXMA 1ID8A 3TL3A 1NUUA 1SQ5A 2A0KA 3IR6A 1F4LA 4JJEA 2A5FA 6Q21A 1FCJA 3DXFA 1XGKA 1CJMA 1Z28A 5FPSA 1A9ZA 5LYJB 3W5DA 1NW6A 1UQUA 2ZSBA 3D81A 4Q4LA 4ER0A 4ZJZA 3RHSA 1NXGA 3IUNA 1WXEA 3HNOA 3O8NA 4R8MA 1J6UA 3TZKA 3RIEA 1B76A 4JUCA 4EWLA 1DU4A 3H11B 4YJ2B 5FBKA 5CA1B 4JLKA 1Z17A 1SUEA 1HSOA 3H2YA 8RXNA 1V8ZA 3FR7A 4JAEA 3JWIA 5BR4A 3HM9A 2TMGA 3ABOB 4RETA 4W5JA 5JRDS 2YJGA 3P9IA 4GXTA 1N1GA 4GPBA 4H77A 4IHJB 4NV1A 2Q28A 1DCFA 3VR6D 5ER9A 3Q5EA 4W63A 4QJIA 1VYVA 3PK0A 1T1SA 2E4ZA 2JVIA 2PD3A 3GMIA 3ZC3A 3AB8A 4I4LA 5KQRA 2R2GA 3A25A 4UPEA 4KR3A 4A36A 2GTIA 2X5JO 2GS9A 2IU4A 1XWIA 1SA0A 1JDJA 4F93B 2H65A 3FBTA 4QXPA 3VRHA 2CXPA 2XXJA 5L40A 4BLUA 4PXSA 2Z5VA 1ODJA 2VWQA 4AKGA 3K8OE 5BWOA 3ELYA 4TN5A 5J4HA 4FD2A 2JFOA 1NMYA 2WIAA 3GFGA 3R5HA 4FDLA 4BKOA 1VKNA 1H4QA 4HMQA 3WLHA 3NNNA 5KQSA 3THWA 2PBLA 1QGUA 2E2WA 1FP1D 2JFBA 3KOXA 4ZCTA 3QM1A 3EGWA 5LXTF 3FG9A 2JLVA 1J99A 1B3RA 1GN8A 1YCFA 2Z08A 3EBPA 3G88A 3MPOA 3TIGA 1TLFA 4TS3A 3VNBA 3CMMA 2D0IA 1IRXA 1QXSA 3RRNA 4E2XA 1CRLA 2OSBA 2V0NA 3BHNA 2HHHB 4L3WA 4S2EA 3NAMA 3VYVA 2E82A 1K8QA 4PZ0A 4ZMBA 4YV0A 1NJFA 2OXCA 1XLTC 3DNFA 2G67A 1M6WA 4QDTA 5FYQA 1M2OB 4RJ2A 3AQIA 1X80B 1UOOA 2IYUA 5HCIA 2P27A 4XB2A 2RHGB 4H7EA 3OE7D 3H9UA 3UYKA 2JFXA 1L4HA 2H3EA 2PH7A 4QNNA 2BUAA 7ADHA 1B71A 4AKIA 3GK3A 3H9CA 1ZGJA 4FU0A 1HE5A 3S2FA 1BH6A 1SAYA 5AOBA 2Q8NA 3GTQL 5J59A 3RYIA 3ZGYA 4Q3BA 3IQGX 3Q6MA 2YWGA 1XD9A 5TX7A 3NGMA 2HM7A 5AKGA 3TW8B 4LISA 4C7JA 3V1NA 3QOXA 5K8TA 1O95A 1YDEA 1N3BA 1SC1A 1W49A 4R1QA 3TOCA 3WSTA 1BXRA 1XX6A 4R8LA 4PANA 5F5NA 3RFUA 3ECCA 2ACKA 1DBPA 4OHZA 5C81A 3L5OA 4QARA 3MGBA 5B1SA 1ZGZA 4M0MA 1NW9B 1AGRA 1Z15A 5IJ9B 2AN1A 1CJUC 5D5HA 2KPOA 1G6Q1 3TIIA 2RJOA 4DDMA 1DCKA 1D1TA 1DDGA 3RS7A 4W5OA 1XWFA 4E94A 3AJ9A 3NC4A 4FJ0A 4JC4A 4K0KB 1VSUA 1OC2A 1UQTA 4BKMA 4P92A 4JLAA 2O6HA 3B3QA 2ICAA 1SKQA 3HOWL 3BFVA 4YRJA 2H08A 3C6XA 2QSZA 2HBRA 2QWXA 3DEYX 2G9UA 3QHAA 1YBMA 3PC8C 4XX0A 3T1OA 4YT5A 1E98A 2KYRA 2P7HA 5BN4A 2H2AA 3DBHA 1FYFA 1YGPA 2G1JA 2JH9A 2X8JA 5T4BA 4A0FA 2D62A 2EZ8A 2ATIA 1Z33A 2E4AA 2R7KA 3GRKA 4K8RB 4WADA 1NDQA 2M6OA 1MGPA 2R1ZA 5PGMA 4CKWB 4X8HA 3PEYA 5JS1A 3N2GA 1F48A 4IINA 1NZJA 5JTTA 4KNYA 3L77A 1CUFA 1TKAA 4KXXA 2D5IA 1LPPA 5EQDA 4WKCA 4X71A 4K28A 1I14A 3FDZA 4QU8A 4PCUA 1EWQA 4NDNE 1Z08A 3P71T 3JD0A 2BGIA 4WOBA 3D7RA 1A88A 1EI9A 1HE8B 1ZL0A 1OJLA 1XD2B 4GXRA 4KTTE 3KQTA 3O3OB 3T9FA 1EVYA 4LZNA 5AM1A 2CJWA 3FLAA 3RQIA 1CKEA 1VE6A 2MSKA 2D0DA 3FYHA 1TCUA 1ECPA 4DQKA 4QJ3A 3UA4A 2VJNA 4BVEA 3R6LA 5BNZA 5CVTA 2HPAA 3AVQA 2WRZA 4HN9A 2JA8L 3EFOA 3OZRA 1JXMA 2W6JD 2QSJA 4RXTA 2VHZA 1R74A 4AAYA 1GRNA 2X4IA 5TIIA 2BVNA 3QF4B 1JT2A 2GB4A 2W2OA 4DCCA 3U0VA 1M2JA 2OEPA 1E77A 1SPBS 1WUJS 2VF2A 3IUSA 2AKEA 1E1DA 4KR7A 4D4MA 5MFZA 1G8FA 4OI2A 2E6UX 5DRYA 1X9HA 4JCOA 4IZ6A 4N7BA 5GZ6A 2ZJ6A 2ZIAA 3DAYA 3N58A 1WXHA 1RWXA 4HRXA 2IU3A 1QV7A 2EFYA 3FUWA 4OQLA 3X1MA 3TLCA 1X8LA 2C5SA 2CLOB 3FF4A 4O5AA 1DTWB 5HTKA 3SEZA 4DWVA 2VJDA 3M1LA 4ZI7B 2PSHA 1ZDMA 1YD7A 4DLSA 2PRIA 3GJQA 2AA3A 3M49A 4B3HA 4F84A 3EFHA 4E5SA 1JDSA 1US8A 4F8YA 1EZ1A 4IXNA 1RC1A 3KEFA 3DMPA 2FKNA 1ZEMA 2ZSIA 2JRCA 3C16C 4JP8A 3N2KB 3IOMA 2WSLA 5HKLA 1XQ9A 4C4RA 3G9ZA 4JGIA 3C6KA 4YCNA 4DKJA 1OJ7A 3HHPA 1B2JA 3TF5A 3H1BA 3L3BA 1T0IA 2CLDX 3DW3X 1JEQB 4HFNA 4M38A 5TPWB 1P0QA 1XK7A 5LU9A 4KVAA 4QECA 1JH9A 2WU0A 2R8YA 1HMPA 3VKUA 4RKYA 1QKIA 2G1UA 4RTKA 2WSBA 3BTOA 1HGXA 4QUGA 1JHXA 4RY0A 3GEHA 1YBFA 1I36A 2O0HA 2ZT7A 3PFBA 3ZCVA 7RXNA 4MYDA 1VGQA 2Q2WA 3P9XA 1YAJA 4JA2A 4QOEA 4TVKA 2H4XA 3B6MA 1FUEA 5DM60 3LCJA 5L7TA 2ORED 4YMTA 3HPRA 1E6UA 3ZY4A 5BWLA 3QI7A 3RUAA 3UKOA 5TGDA 4E30A 4CL3A 4GVXA 3KCNA 2C0CA 4TWIA 2OV4A 3GJ4A 1PFGA 3P5SA 2VUML 5JCZA 1EK2A 3EY4A 1QRAA 1MJGA 1OAOA 5AI5A 2W6PA 3GNSA 1OH5A 3LKBA 3E7FA 1YQUA 2HHAA 3QMWA 4LJSA 4G1CA 5GJCA 3L6RA 3I1JA 4I19A 3UMRA 5IU6A 4N3CA 1H2EA 2JG3A 2Q7OE 2DGDA 4LZLA 3EEIA 4GNRA 3LD9A 1XPOA 4DR7B 2EY4E 4IZHA 3RCBA 1XV5A 3K1TA 3LL4A 4FZVA 4HD8A 3SGLA 5KTNA 3U4MA 4ZHQA 1YUNA 4P86A 3QX8A 4QAJA 1OY1A 2NO4A 3L7OA 4JEMA 5EESA 3WGYA 5IHXA 5KO2A 1TU4A 3IPLA 5NULA 1U5AA 3DKIA 4RANA 2B3TA 2XX3A 1U7DA 3PXCX 4G0VA 1JEJA 3WLTA 3RYFB 2GPBA 1TFRA 2ZIZA 2IF0A 5FI5A 1PLKA 3CO5A 3UJ6A 2PUEA 3OHMA 1WRBA 4M9XA 2RI6A 4MP8A 3K0FB 2OD2A 3RSFA 2LCQA 3O31A 3NKLA 1ENYA 4M1TA 5ED4A 1PGOA 4NK5A 5EG5A 4O2AB 2OGSA 5ADVA 5KPJA 3PL5A 1YB6A 4KJXA 4E6YA 2W6QA 5GOZA 1E6KA 4RTPA 3KVOA 1YOVA 1P4SA 4MGIR 4OSEA 4FCTA 1EDEA 4GWKA 4TRNA 4U3JB 1KQPA 4L0DA 3TSZA 1QYDA 1NF2A 3QLVA 4MROA 5FYDA 3ZD6A 1UBGA 2Q1YA 3L1JA 2EKPA 1JZTA 2D2IA 2PQ2A 2YJ6A 4C1BA 3V7YA 5LZ7A 2QTMA 3AEKA 1HKUA 4GKKB 2Y1FA 4E7PA 2AJCA 4DZTA 2ZULA 2FMUA 3KYVA 5TMDA 5GIPE 4MHOA 3DWIA 3GUVA 3HMKA 1ONNA 1OPXA 1L0BA 5IC6A 4KLZA 4XCXA 3SKVA 3Q1KA 2JI6A 5CVCA 5JS6A 1I7QB 5JVDF 1MU0A 3JZFA 2JGFA 2OKCA 4KDRA 3ZDBA 4L0MA 4C4XA 1BMFD 2A0FA 2W2PA 1U3VA 3GLHE 5IJAA 4ZC1A 1JFFA 2Q45A 3NEJA 4BN0A 4N4AA 4RHUA 5EL0A 1REQB 2BHNA 4CFYA 1MAHA 3GLHB 3PI6A 3PNOA 3DF9A 1IHOA 3LWVB 1BVYF 4JJZA 4XDZA 1LY1A 3DR3A 1B15A 1LLDA 5CX1B 3HEMA 1WXGA 4EUKA 4Q21A 1YA6A 4IJQA 1F1JA 1QS0B 3S15L 3WNZA 2SECE 4C0LA 2QAGA 1X42A 5H68A 2NM0A 2PE5A 2YMMA 4K2HA 1QVZA 4A3JL 2C4NA 2ZWVA 4J0KA 4MITA 4TL8A 4EHLA 2DC1A 5LIRA 5FBWB 3O4FA 1M7BA 2HV8A 5F5XA 4K9KA 4S0XA 1XVVA 3FOBA 3BSSA 3QZUA 4BUCA 5FL3A 1EUCB 4Q16A 1FVHA 4OA8A 1LQ2A 4D2IA 3A2MA 3UJCA 1G16A 3TNJA 5LZ2A 1Z36A 3HB9A 4KGXA 2PIAA 5IAOA 2I99A 1YB2A 2J0SA 1FX1A 3HXPA 1DKQA 5EKTA 2X8WA 5C1IA 5AK3A 2JCXA 2QLBA 5H4HA 1YFKA 1QRDA 2D1TA 3KZOA 4MUBA 4YEDA 3WA6A 4EYEA 2I2AA 3OIVA 4CL2A 4M60A 5GZ1A 3Q40A 2TMDA 5KU7A 3MSUA 4K6HA 5TARA 4P4LA 3OLWA 2DJ5A 4N8EA 2WY2D 4YMLA 4R9RA 4YYZA 1L4FA 1SU6A 3D54D 1EX6A 2YV4A 1KY4A 4IR7A 2ZSKA 2JIZD 4MQFB 1WB4A 5D86A 4EHHA 1U3WA 4OMDA 2C88A 4PINA 5IRCD 1V8FA 3HYNA 3CG4A 2V7QD 4HF7A 5AK6A 4B81A 3G0HA 3WL4A 4WN9B 4HVTA 1ZN9A 5EMHA 1YFZA 1L6IA 2II6A 2OUIA 4H3HB 3AM1A 2J6BA 3FCYA 4G0XA 3FMPB 1ZOSA 2FRDA 2PX3A 1RLMA 1RAEA 4XSVA 1J33A 5T64A 2AC7A 4EP1A 1CV2A 1DQZA 1QYRA 2Q3LA 3S68A 3LI2A 3I6BA 1RYDA 4G81A 1ESDA 2OK7A 3SQOA 4WNAB 1X87A 1W6RA 4HP8A 2G5PA 3NT2A 1A9SA 2QRUA 1MOQA 3GPCA 2QSYA 5A4FS 2FMXA 4BE4A 1OQAA 4KL8S 5LNK6 2CV0A 1E58A 2DWCA 3LBIA 5HF6A 3W1WA 3ZK9A 4ZDKA 1JG6A 4Q05A 1E8DA 5REQA 3TB4A 3QXHA 2OCPA 2FMHA 1I7PA 3D0QA 2ZCJA 1NXQA 3TD6A 2I9PA 1WW8A 3OECA 4M7OA 4LF9B 5U4XA 3MILA 5FQNA 1NXSA 5K8UA 2O3RA 2WICA 2WPDD 4XQEA 3A6HA 2XNCA 3TAHA 4EZBA 2BTEA 2BEWB 2PT7A 2FSVA 4CPDA 4KFTA 1AHHA 4N5DA 5C34B 3CZMA 3EGOA 3DDWA 4ILKA 3ISTA 3KKQA 3FZNA 4XX1A 3B5JA 2X0RA 1CQIA 3ET5A 3WLOA 1Z7YA 3HU2A 2RGNA 5LZ5A 1E9AA 1PFQA 2Q5EA 2XKBA 3R5JA 4HFMA 1UK8A 4RD3A 3QOFA 2LKDA 1KI8A 2OAGA 2XVMA 1YRWA 4XIFA 4UTNA 1XQ1A 2H85A 3DZKA 3IULA 4IXTA 4WK2B 3ZE9A 2D5BA 3FCUB 1GCUA 4QGAA 3UWOA 3B38A 3OQIB 5DU2A 1QTRA 2F00A 4BLQA 2Y0SP 3OOWA 1Y0BA 4RAOA 3SE7A 1Z26A 5C53B 2I22A 2YL2A 2V98A 4F60A 3GA0A 2MDTA 3BJRA 3ZWKA 5IDQA 3B82A 2E55A 5JXIA 2C8LA 3UT5A 4UTVA 2D13A 3EZ6A 5HS6A 1L5VA 1EQAA 1C1XA 4LW8A 1X7ZA 4M2LA 2EJVA 1ZH2A 1YQTA 4RH3A 3S5JA 3U60B 3EVEA 3BB4A 3QYFA 1ZPDA 3FYUA 1FTYA 5J5VA 1M0WA 4D8YA 3BF8A 1LPAB 3R3YA 3E3OA 3G1UA 1KO8A 3VTKA 4YRQA 1ULBA 2K87A 4B9AA 2VDWA 3WK8A 1U0JA 1RVV1 2J46A 3AM5A 3HWX1 3RG8A 5D3KA 1L5HA 4LHZA 5TDHA 2H1LA 4P2BA 3QKTA 3FOWA 4IIJF 1AKUA 2QENA 3RZTA 4XI9A 1WD7A 1IXYA 3FMVA 2HXGA 2VDQB 3VVBA 3L7YA 3NDPA 4EGFA 1QONA 5TMPA 4B76A 1F2UB 2B20A 4D9KA 1OLUA 2F6RA 2ZJOA 4WJLA 2HIGA 4NV3A 1JJAA 3W90A 4ZI2A 3UAWA 3WDMA 2Q1UA 4A10A 3VKHA 3CF6R 3E53A 1V0JA 3OVMA 4BY9E 1ZNZA 1ZNWA 5LQSA 3EDCA 1M2KA 5EIAA 3P8BA 3KQQA 5CFPA 3OX2A 4PLGA 3MLAA 3KT0A 4PRLA 4EQ6A 2BGJA 5AVVA 2MYNA 4FE7A 4BYMA 2I91A 3IHKA 3F6BX 3E8XA 1C4WA 4JXJA 5EMNA 3SCZA 2ET6A 4ALKA 1PYOA 1Z5OA 3TLYA 3DJFA 1PEYA 5D1HA 4RTMA 3DCNA 4XIJA 1DC3A 4NK4A 2HD4A 1QK5A 4CIBA 3DPSA 2R5FA 1RM0A 1FTGA 5L9AA 1GXSA 1ZUIA 5LLDA 5IM4A 1B6TA 2WU1A 1C8VB 2FYTA 3ZE0B 3D4LA 2IU6A 2C4HA 1FYEA 3R0IA 5HE8A 3UFXB 4D3SA 3IEVA 2H7CA 1CLEA 3PJFA 5JDCC 5BN3B 3L1UA 1YT5A 4OF4A 3LC1O 4DLRA 4EYKA 4HDCA 4R2KA 2IYPA 3GARA 3AR2A 4DY4A 5FTJA 1Y5RA 1FMTA 4P80A 1EFRD 1ECLA 1ZWKA 4J2TA 1M54A 3TRFA 4JXXA 4XM1A 1FTQA 2OK8A 1N0HA 1APBA 2ZREA 3P8ZA 4PO9A 1W2GA 1XSEA 1EFKA 3GXBA 3CC8A 3K15A 5HOEA 3FE2A 1SHZA 3STWA 4YRRA 3BWMA 3ZG6A 2G88A 3AIOA 4HTAA 4ZVQA 3ZUGA 1HZJA 4Y8VA 3FDIA 1RZRA 3BXPA 1SXJD 2B1JA 2PL3A 2QRNA 4O4HB 4UASA 3SK0A 3K53A 3ZJ4A 4YMVA 2PUVA 3G2HA 1PQYA 1OU4A 4HGYA 2R6HA 3U80A 4Q4AA 5EGSA 1E5QA 3EWIA 4JKOA 3RS5A 2VYND 3UO8B 1TU0A 4LK3A 5BSFA 1YL5A 2XUDA 3IVAA 2OQVA 2NOAA 2DQKA 1U8UA 2C5HA 1ORWA 1MQ9A 2B5ID 1T2AA 1YA8A 2EBFX 2XT0A 3FCEA 2EEPA 4PYOA 4PYQA 4AN0A 3V97A 4E32A 2NV2B 4M99A 2A59A 3B36A 3CLRC 2ZIXA 2C2KA 1XLWA 3OIGA 4IKPA 4NMMA 4QC2A 4XXBB 3TRKA 3VYSB 3N9IA 4X66B 1SC4A 1NAIA 3PSAA 3Q41A 2NTYC 2Q8QA 3E3MA 1O4VA 4PIMA 2XCTB 4BLWA 3UAOA 2J08A 2ID4A 3UBMA 5DX0A 5HUHA 3AHDA 1OI7A 1Q0SA 1F14A 1VPVA 1XKQA 2ZRKA 4IDAA 1N2CE 4WNIA 3K7EA 1EUDB 1SY7A 1XYGA 2A4KA 2YZKA 3I0NA 4MVJF 5HGJA 2O5EA 1EM6A 4XJXA 1FU7A 1Q50A 5IVIA 1N2CB 1ULZA 1YDMA 2HKIA 3ESYA 3I9V6 3LTEA 5T8KA 1NLMA 4RVOA 4JBWA 3KYDA 5EVJA 3MB5A 2OV1A 4Z7OB 5E7JA 4KMRA 5BQ3A 5J23A 2Z5FA 3PXUA 4B3TB 4AI6A 3ZNPA 1SELA 2VT2A 2XJPA 1Q1ZA 2FXVA 3BD8A 4UNQA 3UA3A 1RXWA 2BGWA 3AKZA 1MH1A 3LZDA 4AZ0A 2VUIB 3O2JA 2R751 1T5TA 1HURA 3N0RA 4UUPA 3VTFA 1RYZA 4LJ4A 4LYEA 4BFCA 1Z4QA 4QFDA 1IU5A 1K8XB 4HLNA 4GDMA 4WK6A 3O21A 4OHKA 3KCQA 4BKPA 4V38A 3WYGA 4Y18A 3IERA 3AUYA 4M49A 3BEOA 5EKDA 3TLAA 2NU7B 5FOVA 2CLSA 3B1JA 3E8SA 3PUXA 5K6AA 3TLEA 4EBFA 4ZQCB 3TR0A 2W8ZA 4EO9A 1TT5A 2GAJA 4WKOA 3CRNA 1E7SA 3PE4A 1IXKA 2E37A 3R20A 2X15A 3IDZA 4M1KA 4DNPA 2GM4A 4WMLA 4WV3A 4XWWA 4DLLA 3RR2A 1I30A 1E92A 3S27A 1FMFA 5J1TB 1PJ8A 4RENA 3HOVL 1PUXA 4N0PA 3RVNA 2BDEA 3C6QA 3OTIA 4ZTBA 5EXEA 1DRJA 3CPJB 1UM8A 5B30A 1OLSB 1PT6A 4PQEA 5K20A 1DXOA 4BVAA 4IJVA 3VH1A 1CNFA 3VZCA 5I9LA 3MCTA 2DUNA 3EWAA 2GF2A 3QXXA 3V5NA 3DEIA 1SOAA 3H2ZA 3F7MA 4NP6A 4WCFC 2LZ0A 3F9CA 1X94A 4UM9D 2CLCX 4X97A 4C4SA 2RI1A 3VKGA 3IELA 2AMYA 1DRWA 2LDBA 3RARA 1GAQA 5IAKA 4DJ5X 2KMLA 4WINA 1E2QA 1W88B 3ZTTA 1R27A 3DDOA 2HBYA 3LCRA 3S2IA 1ZU4A 4BNDB 2XXAB 2BI8A 2OHXA 4MUFA 4QQKA 2PPVA 2D1FA 5HF5A 5B1HA 5TMEA 4EITA 1CERA 1XTRA 5K7SA 1PWZA 3CUVA 1NR7A 4O63O 3N0XA 4MQUA 3Q1LA 4BMXA 2ZSJA 4AZ3B 3NGXA 2NACA 5KTTA 5CK5A 1DRVA 3DE3X 2DFPA 1NBOA 4DCUA 4EYQA 1BROA 5ALLA 1FLAA 2PO7A 3DEFA 2XVXA 3FDFA 4Q48A 1U9ZA 1SCIA 3KJZA 1SG0A 4PR0A 3GMTA 4I55F 1WEKA 3DZ8A 1R6AA 3NORA 4ODIA 3KOZA 4W9NC 2XDWA 4R2LA 3C5CA 3IPAA 2XB9A 4X7PA 4EW2A 5EYPA 1DMSA 4IQ8A 4DXAA 1SMKA 1C7IA 3UWMA 4H7IA 3WRWA 1ZH0A 4MQEA 1UIMA 1CQJB 1FY2A 1I6WA 1BCRB 1NRIA 1UDRA 2WFZA 2XW6A 2ZROA 3DD5A 3E4DA 4QBFA 4X44A 5ALEA 4ITRC 3UK1A 3TIXB 2WYWA 3PPYA 3RZDL 1ZD1A 2A9KA 5FFMA 2YH2A 3NWOA 1SHUX 4K9LA 2HHLA 2QV7A 3CSDA 1IN8A 3ZE7A 1MF7A 5JV5A 3GUCA 3WE7A 2PXAA 4A3FL 1D6NA 4WPGA 4P3YA 2CVFA 1SGWA 5FI0B 3USES 1R0HA 3BULA 4DV2B 4B6SA 3QU4A 1ODLA 4V3CA 4I3HA 1NVAA 4I5EA 4C4YA 2WQ7A 5HP4A 1FZTA 3B8EA 2QBYB 4CGZA 4YJ3A 3HXLA 4X92A 2DFLA 2BDTA 2DR3A 5F2EA 3FNEA 3RVMA 2PUGA 1F7UA 3IIMA 4IHQA 2PRSA 1A2BA 2ZEJA 3WNBA 3RC3A 1TUBA 3IP6A 3A4VA 2XZPA 4GD3Q 3FAKA 4GZ6A 4I50A 1Y4SA 1Y6QA 1L5FA 1ATIA 4WECA 5FI3A 3FOEC 3PUKA 1N78A 3M8KA 3BUSA 2ZAIA 2ZWIA 2HLDD 4BCBA 4OYHA 1VDZA 3TD9A 4DWOA 2J5KA 3FSGA 3PR1A 3FCXA 4Z0TA 4FFBA 2W58A 4FOOA 3P2YA 4KWHA 1FQJA 5AHOA 2HCRA 5AI6A 3UMYA 1ODHA 3RTDA 2VOJA 1UF9A 1RI5A 2VH1A 3RVDA 1MJHA 2B8WA 2HIHA 2AQCA 1TMKA 1DZ3A 3D9QX 3TCXB 1II0A 1R9GA 2R00C 1T3ZA 1UPUA 3GBSA 4XAQA 4KKXB 5SZJA 3C3JA 3WWEA 4DIUA 4JOSA 1PNRA 4IRMA 3SC3A 3WGNA 1SCKA 5EE5B 2EWVA 2WBLC 3EC2A 4JOCA 3ESQA 3SBXA 1S96A 1VP9A 5BR8B 1XMVA 4K9FA 1BEUB 4WERA 4MUEA 3CEAA 2AZMA 3X44A 3LBYA 3RFXA 3DV2A 2P8JA 2PUDA 4IDOA 1PX2A 2GZRA 3WB2A 4EKGA 3RU9A 2IHNA 3K1AB 1Z5VA 3EDMA 2DULA 1OR8A 3PIDA 4HDNA 3LCUA 5EWLA 3MWDB 3BGWA 1IWPB 4BP8A 2QL0A 3K8QA 2GBPA 3FPSA 3NHUA 3OPNA 4ZU6X 2GBLC 4DZRA 5JU6A 5IKOA 1KDVA 4FGSA 4OU5A 2ZIVB 3DNPA 3K2BA 1K83L 4LMPA 2O54A 4P34A 3R6GA 1H66A 4I9NA 5L4SA 2G0TA 1JEAA 5CDHA 2XCQA 2PYZA 1FDWA 3KSAC 1CBUA 2WV7A 2Y76A 1R3DA 4ZAXA 2CXOA 3TJMA 5JSZA 3BAZA 4PTYA 3GDHA 4CIWA 5M5BA 2OV3A 4I9GA 2X5NA 4BAZA 1J7JA 1RWKA 4H3VA 5EJAA 1FOEB 2FDRA 3TIVA 3QKWA 1GR0A 3OBBA 4JCCA 1MENA 4ZT2A 1ZM3A 4FP9A 1CQPA 1U98A 3DTVB 1H2ZA 1IAVA 1OHHD 1TJNA 3KKLA 3NHZA 4MWDA 4A82A 4V1CI 2V8BA 5I4CA 2V7XA 5G2OA 3L79A 2J3KA 1U94A 4YCLA 2ZE6A 3DMGA 4R7GA 5EIWA 2ORIA 1MG0A 2XQKA 4UNRA 4ZGGA 1KJWA 4NPHA 2HK7A 1VLQA 5G4LA 3LUDA 4EFNA 2WI8A 4QUBA 3SJUA 5K01A 3BREA 2GN1A 3UMGA 2X8LA 5CEEA 1NLYA 1L7MA 5KIAA 2K7FA 3QNMA 4KFSA 4FSXA 4PLWA 4AJEA 5B6JA 5JRJA 1E9BA 3W4IA 2Y0CA 3EZLA 3WI7A 4TPUA 1EXNA 3DUFB 3H5RA 3RYHB 1DDIA 4DLYA 4G5HA 4DXDA 3MXTA 2BHTA 2WZDA 2R84A 2WSSA 5DBHX 2B7BA 2O3QA 4U2EA 4Z9AA 1IOWA 1VLHA 3GELA 1AMNA 4WOJA 3VNAA 3W1EA 4AJLA 3OX4A 1VGVA 2PKXA 3ETDA 4FDAA 4QRHA 1ELOA 1MB9A 1OAKA 4O0MA 5K8VA 4L02A 4HNQA 1PV4A 1SMUA 1KOFA 1XZFA 4W8OA 4MUGA 2W2XA 4IJMA 3T7CA 4GI7A 1D6SA 4H0NA 4MYRA 4C5AA 4URXR 4NESA 4FYPA 4MPPA 5FR2A 5ESDA 1M1NA 4KIJA 4BGVA 4B40A 1WB5A 3COYA 4YBRA 3TQIA 2H63A 1XTTA 2NXCA 4H2DA 1BA2A 4C07A 4AR3A 1OWOA 5AJVB 3CHYA 4RACA 3T4PA 2FZWA 4FMCB 1SXQA 3P27A 1ZVQA 2ZE7A 4FOLA 3LY9A 4OQFA 3KPWA 2XYGA 2EX0A 2J0UA 3K7AL 1X0VA 1WUIS 3TQQA 3FOZA 1VB3A 3ZGLA 2JIBA 1DQPA 3ORSA 4MCJA 2MTBA 3PRKE 5DW0A 4LY3A 3Q8KA 1QHNA 1KS9A 4K8OA 4LCBA 4TPKA 1CZUA 4RQAA 5SY9A 3UGQA 1CF9A 3EOZA 3H0CA 4AO7A 3L6OO 3B20A 1M66A 2ACEA 2IHZA 2LRHA 2IA5A 2Q4OA 1FMJA 4QSMA 3RB8A 3UXHA 4G0YA 1KRHA 4JJFA 4DR3B 2ZITA 2QX7A 3ZXXA 4HQRA 4U6SA 2PUAA 13PKA 1E0KA 1T9KA 1IY8A 3CNQS 2JA5L 1K6MA 5JZVA 4RMGA 1XMXA 1X8XA 5H0IA 1KWKA 1G55A 1T6XA 3C39A 3JYPA 2VCHA 3CSUA 4P7KA 2FKAA 4RMHA 5D2CA 2DBQA 3K72B 4A3IL 1JQBA 5DBGA 1TM2A 4ZKDA 5IT4A 3FPAA 4H15A 1NW3A 4LOKA 2D54A 5AJWA 5G0VA 5M5XL 3F0TA 5KYXB 1UBLS 4PX2A 4RQUA 2C4WA 4GF5A 2Y0PA 4RZHA 3C3WA 5FTWA 4BX8A 4KPEC 4K6GA 3EAGA 4B85A 2EFHB 1HKHA 1DKLA 2JL1A 3LMKA 2XE8A 1H7VA 1CIPA 4WCFB 1R0YA 1T0PA 5AK4A 3DLPX 4OHOA 2IIQA 1ZK2A 1RQ7A 2P9EA 1YJAA 3I05A 5EWJB 3TI7A 1I94B 1JN0A 2C9MA 4YHBA 5C4IA 1R4NB 5K2OA 1PJSA 1G20A 1JAXA 3LQYA 1TYDE 1FRVA 2JD1A 4LJ5A 3DKKA 3D6NB 3JD3A 4HAXA 1T6ZA 4L8GA 2WB1P 4Q7MB 2ERJA 4MNTA 3ZV3A 1OROA 2NLOA 1A72A 2VT7A 3OEYA 4IKOA 3M5DA 4WBXC 2HJSA 1BFUA 4IO1A 2OFXA 2LP4Y 2J9FB 3DHEA 3LPEB 3QW2A 3EXEA 4XQ0A 5ECYA 3BTSA 3S55A 2WA2A 1YE5A 4K40A 2DKNA 3FTCA 1DC8A 1H0SA 3K30A 4A7PA 4KE6A 5AUPB 3EXHA 3O2SB 4XR9A 2NYVA 3QSYA 4AJ2A 1GTMA 2HZBA 1VOTA 5D7BA 2WFAA 4X95A 3T9EA 1KERA 2WYOA 1XVTA 1WSDA 3I1YA 1Q15A 4F46A 1DXYA 5UKDA 1M73E 4YWMA 3AM3A 1E64A 1TVCA 1ONBA 2ZR0A 4RD6A 3SEFA 3U7FB 4Q1AA 5DTJA 3MBIA 5L7WA 4A3KL 4J07A 4LDJA 1J39A 3KYCA 3HCRA 1Q12A 4QBGB 4YUYA 1V16A 1AS3A 1DUSA 1N3YA 5B1YA 4AR6A 1BCSB 1P2BA 2I6QA 4AMBA 2VK8A 4D3XA 4P54A 2YY7A 4F21A 1NFQA 3L0YA 4TWJA 3VV3A 2FA9A 4K6OA 4RIIA 5H83A 5FH9A 4K9MA 3PRHA 2IELA 4PAMA 3QYPA 3NHRA 4R31A 3W6OA 1BW9A 3LXUX 1XZJA 3OPMA 4OKSA 4KIWA 4E33A 1T10A 4V0MA 1ORDA 1GZ6A 4GX1A 2EATA 1SK9A 3GFRA 1PJRA 2NPOA 1VXOA 3T35A 4A8JA 3R6WA 3CU5A 1WXXA 1O95D 1YHYA 3EXAA 4DLTA 4RMJA 4L3OA 5EZSA 3FB1A 1D2GA 1Z4OA 4XGKA 1JYBA 2I55A 1VLZA 3I4LA 2X86A 1E1CA 3C5HA 4PSCA 1YR1A 2YZGA 3OJ0A 4REQA 4PC3A 1T9OA 1VCXA 4U6QA 3I6MA 4B31A 9LDBA 3RAEC 1QQ6A 5FA5A 5THKA 3WA7A 3HMQA 4HRVA 4IFTA 7REQB 1HZZC 1NF3A 2ZUUA 5F7JA 3RWBA 3LWOB 1AM4D 2P35A 2PS0A 3KEOA 1ENOA 2JGLA 3EUAA 5AW2A 4IIYA 4I9UA 4HBGA 4HLDA 2O2CA 3BJIC 2HUPA 3DONA 3RBAA 1X77A 1DAKA 1N7JA 1Y1QA 5A7GA 2JLUA 3BRSA 2IIPA 3ZWVA 1Q57A 4J1QA 4TYYA 4RXNA 2C98A 3FM9A 5JEDA 1KI1A 2WUEA 1QDEA 3KUXA 4KXYA 3PDWA 2Q3FA 1GAWA 3C8HA 4EJSC 4OJQA 2C8KA 4TTJA 4V0LA 1AG9A 4CQLB 5ERGB 4ABTA 2BEUA 5RXNA 1L1RA 2VRCA 3A32A 2YYYA 3DS8A 2A1IA 3IESA 1UM9B 3OLZA 4F92B 1YV1A 1U8AA 4MR8A 4AX4A 1BGXT 3V4LA 1E2MA 4TMYA 1ITZA 1KIMA 2I0FA 2A4MA 2KSQA 1RU3A 1XPUA 3I58A 1LDMA 1OI3A 3EY9A 3AL3A 4PLYA 3HB7A 1J2YA 4TV9A 3A27A 1I2DA 1FFYA 1TD1A 3AY7A 5AT1A 3RS9A 4BMSA 2VDVE 3A1WA 1W30A 2N0SA 2VTEA 3UAXA 3V8VA 4EHKA 5A2GA 2NP7A 2EIXA 2J07A 4L4RA 4Q02A 2XKKA 2UXCB 2MJLA 1HY3A 4JNKA 1MVNA 4Y2SA 3NHSA 1W0KA 1E89A 1RTKA 4P0PB 5C7IO 4OB8A 3JWEA 2GESA 5IYZA 5FBQB 4QM7A 4FC6A 3E3NA 1W35A 4IMJB 4N5MA 3E3LA 3VPDA 2FWIA 3I2IA 3TLZA 4P7FA 1KQ3A 1WAMA 2Y1WA 2QN7A 2ZIUB 1QKJA 2ZK7A 4M8IA 4QXQA 4Z6KA 1EAYA 3WK5A 3DMRA 3VHLB 1GU0A 3R3VA 1M2VB 4JKIA 3ZE1B 2IX9A 3JWHA 4Z9FA 1VCMA 4NYJR 1AHPA 4YRIA 4HDSB 5B36A 4FXPA 4IMIB 3KJIA 3QWIA 1QO0A 5D3MB 5DNDA 1HPLA 2FW1A 3HO8A 5L3QB 1KYYA 3PFNA 2XDQA 4ZKEA 5LWQA 3ENNA 2XLBA 2OA0A 4NRDA 1ABBA 4FONA 1C0PA 1E3EA 1P17A 2IODA 2WWHA 3MWEB 4QFMA 4KOEC 3S1LA 3UMFA 1KI6B 2Z3VA 3VPBE 4PZUA 2C8VA 4WGGA 1T2DA 1Z47A 4FWTA 1TKBA 2PAAA 4Z8YA 3N05A 3QF7A 4OB6A 2HA7A 1E1LA 1PCXA 1Y9ZA 5I9TA 4H6VA 3D5EA 4MAAA 3ZYCA 4LRQA 3F4KA 3CR3C 1PJCA 1R6TA 1O97D 3UB2A 2MWMA 4KK3A 4NZNA 1JBQA 1NASA 2ZXEA 3L8CA 5EP3A 3ZI4A 2AVDA 2J59A 2OHVA 3AVOA 4P3NA 2E85A 2KW5A 3O84A 2VAXA 4HBZA 5LYJA 3AOEC 4P22A 3GVCA 1EXDA 3I09A 3CYFA 1M83A 1RXUA 4AZTA 2QZ4A 3UK6A 1LI4A 5CA1A 1KOJA 3N2LA 2CVOA 5I7EA 3H8WA 1J1ZA 1ZMTA 2WSYB 2EFEB 2EW8A 4IRXA 4QQ8A 4WZAE 5J47A 2IE0A 1Y6ZA 2C0PA 5CFRA 3H16A 2C0QA 1XZQA 1Z4LA 1H9BA 4IHJA 5H82A 3MJ4A 1R5BA 3LUKA 3RRYA 5AVTA 3WAKA 4GMFA 2R9VA 3CSSA 1U02A 3ZIDA 4EKNB 3PLAE 4HB4A 2ZUDA 4Z7JA 1BVUA 2XSZA 1A50B 3E8MA 4RCZA 5A9SA 5LMNB 3FWZA 1D2HA 3D02A 4K3UA 5C18A 5G1NA 3QVLA 4CUJA 1X7DA 3PGKA 1WM1A 2Q21A 4UBNA 1VPWA 2J7KA 4IY1A 4MLZA 4DMMA 1FFSA 1ILWA 1WMAA 2AEEA 2RDMA 3ANNA 3TNFA 5EA2A 4CETA 3WLPA 3HSKA 3AV3A 3OUTA 4DUGD 1MZVA 1H1LB 3CRQA 1OI2A 5ULLA 3FWPA 4YFYA 1B4DA 2BSQA 1ZITA 3D6AA 1E2HA 1X15A 2GFIA 3UZUA 4BMPB 2LCFA 5HJ2A 3BGOS 1IUOA 1L4YA 3AR4A 3GGSA 3OLCX 4G5XA 1HDYA 1YS9A 2PJUA 3U7JA 3P2EA 4RVSA 5T6BA 4L5CA 1GRRA 4Y0VA 3N0WA 1T8YA 2IKSA 4RJLA 1Z68A 3L82B 5F51A 2XWSA 1TNDA 1XQXA 4O0LA 4ZCRA 4ACBA 1KKMA 3U44A 1R5NA 2NVYL 4NG4A 2VNAA 1RPJA 4KQEA 2G0AA 2P67A 2NYAA 3KUCA 4A3CL 2UYYA 1M2OA 3LKVA 4ZVPA 3KQHA 1X80A 1KPGA 1W4CA 4U63A 4XD2A 4QOGA 2EZ4A 3ELBA 3R7BA 4I1IA 1W1UA 1Z4MA 3IRVA 2B30A 2ZUTA 3X1JA 4F4UA 3NALA 4LGYA 2H92A 4RQBA 3IE0A 1VDMA 4HGRA 4JLWA 3A1CA 4DG5A 1L8XA 3QA9A 2BSXA 1I6LA 4Y6OA 3CEPB 2AQ8A 4RDHA 3S6JA 3ZYZA 2OBLA 3DV9A 2ZDHA 4GUDA 3TW8A 5B58T 2X3YA 1S7CA 1FX0B 4I4TB 1Z6YA 2FW9A 1I6KA 4OHPA 1ZXLA 4D8VA 3V6LA 5IK2A 4HDKB 4UMDA 1UJ5A 1TF7A 1T2CA 4J43A 5BVGB 3B1VA 4OJYA 1HSZA 3KEQA 3M2PA 4MRMA 2OCDA 1V47A 1IM8A 5FEUA 3SX0A 3HR7A 3QKRB 4L27A 1U0GA 4FDTA 1WHSB 5IJ9A 2PX2A 3KPUA 1TCVA 3STYA 3W8EA 2OBXA 3M4NA 3KYJB 5IJXA 2ZRLA 5JNSA 1YB7A 3AP2A 1LVGA 2P2DA 4PAWA 2W9XA 5DOZA 3V48A 2P6PA 3G1WA 4H18A 4YAFA 3W8DA 3V4RA 3RSCA 4KRGA 3QE9Y 4Z9YA 3GMSA 3IEUA 3K6RA 4MV7A 2AFVA 4TS1A 1BXGB 2D4HA 2R6GA 3CCFA 4N40A 3THSA 1ZN8A 4KRXA 1PK8A 3GAZA 1PS9A 1VJCA 1KI9A 3GRCA 2OYCA 3ZZ1A 2H2IA 2I3BA 1H6BA 2HRZA 1VCOA 2QTCA 3A2NA 4J76A 4KV7A 3A6KA 3TR5A 2W2KA 1M8PA 3GJ8A 1U2TA 3BJMA 3CZQA 2C4MA 3KZKA 3W5JA 1NM5A 3G0OA 4QTZA 4AN4A 2PX8A 1ONSA 3E9EA 3PL1A 5KAPA 1QB8A 1EXMA 2NO6A 2O20A 4L95C 3BKXA 2ZKLA 4BX0A 2HK9A 2Z83A 4IIJB 4M1OA 1JJFA 5CEFA 1RBMA 2ZDQA 4XB1A 3KLNA 2JA7L 3RS0A 1XD2A 3SM9A 2IVFA 4EJFA 2YRXA 2R1TB 3I64A 3TG8A 4V2IA 4ZN1B 1FFXB 2ZJ7A 3MVEA 3NCTA 3M6MD 2BISA 1WY5A 3R24A 4M7WA 4MS3B 1PT5A 4C30A 1DFHA 4D5EA 2FWBA 2V9ZA 3IQHX 5DEIA 1YKGA 2IV7A 5BUZA 4MB0A 1ML4A 4OK3A 4A5OA 4C04A 2H5LA 1Y3FE 1EG7A 1JNYA 2RGXA 3PD1A 5DRTA 1SXPA 2FLKA 4LQDA 9GPBA 4OATA 2BKXA 1YS2X 1K98A 3KIPA 3PX3A 1H2XA 4BX3A 3HDQA 3NHFA 3PR2B 3OTGA 1EGAA 3WSWA 1KGSA 2JCGA 1B0UA 1LS6A 2F1IA 4MKZA 5CDSA 1X92A 1W34A 2V54A 3N0TA 4AKSA 5F1OA 1VHTA 1KGDA 2TYSB 3A3PA 2EBHX 1GU7A 1B0AA 4Y0AA 3KPYA 1XEAA 2YICA 1VE7A 1R66A 3HP1A 2TS1A 2BFEB 1DTWA 2ORWA 2VP6A 4GM4A 4ZAVA 1AN9A 3NRBA 4RUKA 2CEAA 3E0QA 2PNFA 3U31A 2OFOA 2QMUA 2RCNA 4DCSA 1AQIA 2CLFB 1UEJA 2WIBA 2VP3A 4QOJA 1CZHA 1KSHA 4Y9TA 4EJSB 4JUBA 2JPDA 3KSMA 3RIMA 2G9ZA 2R68A 2ZUWA 3K6SB 2XQGA 1NHGA 5HK8A 3M34A 2WJZB 2C5LA 2L17A 1JEQA 1XMOB 4BO8A 2OCYC 4Z0HO 5TPWA 1M7GA 4ZVVA 3ZNNA 2R8PA 1QFJA 4XD7D 3AJDA 3PKZA 3MJDA 3BWDD 3U48A 6REQB 1QQBA 1U0LA 2HLHA 4FVTA 5BSKA 3KV3O 4PZPA 1A4XA 1DAEA 2FX5A 3DVAA 5CT9A 5DB4A 4TL7A 4KLAA 4PG8A 3KOUA 5JC1A 3B3JA 3WISA 2JGEA 3AR9A 2ACVA 3D64A 1XDWA 3NI2A 4FSHA 4NDAA 2FLWA 1NVVR 3IMEA 1BJTA 1R6BX 3HVIA 3KQOA 4AJKA 3LT2A 4CEJA 1JLLB 2YWEA 1KZ9A 1LNQA 1MGOA 2H9YA 2ZIGA 3P2JA 1BX1A 2OORC 1XEWY 1UMKA 3M6UA 5KYWB 2E89A 2PZKA 2HHJA 3TZEA 2ZRGA 2LPMA 3RHFA 3QE4A 4TL6A 4BGDA 2GPYA 3UUEA 1ESNA 3VPCA 5IBPA 3QVWA 1K0UA 3C8MA 1P4GA 2Q2NA 1SXIA 4LYDA 1P2VA 3VSEA 1D5CA 4AJIA 1SC9A 2JKZA 1R8SA 3O82A 2ZDGA 4JLBA 1QGZA 3B5IA 3PYLA 2ZTSA 5EAIA 1F6WA 5F7XA 1MH9A 1E60A 2FTKE 4EA9A 5CLJA 4WHMA 8ADHA 5IN4A 1UBSB 1MO2A 1RCUA 2GOYA 4CMJA 2GWHA 4DR1B 4BO7A 2Q9AA 1QX4A 1YL6A 2IYXA 1V4VA 2VHQA 3QBJA 2JFFA 4QAQA 3S44A 4RX1A 3EFEA 3EGXB 4FX2A 4WT7A 3ZLUA 5JATA 2Q46A 2YCBA 5TF0A 4KI0A 4MVJE 1TQ6A 3HYSA 5HR5A 4ZDIA 1ZSNA 4JI5B 3C24A 4RY9A 1BG6A 2CK3A 3ESCA 4I4NA 1W5AA 3AFOA 3VDMA 3G2PA 5F23A 3ZOKA 2RB4A 3B3FA 1COWA 2WTMA 4M9ZA 1IU6A 3Q12A 3OAAA 4MA5A 2OB2A 4O2AA 3JSXA 3O1HB 4U2GA 1U8CB 1WLSA 3DD1A 5ENZA 4AZSA 3T5DA 1M1UA 3C6MA 5KVSA 3Q7RA 3K31A 2A5YB 3I9JA 3RPEA 5JS8A 4E5DA 4LBYA 1KEUA 2B9EA 3CNNA 4CCYA 1IZ7A 4TQUS 4OEHA 4GBMA 4IOJA 3LW7A 4U3JA 4ZO4A 1RJ9A 1LW6E 3SEAA 1ISHA 2E5FA 4BYGA 5CR9A 2HLPA 2A30A 4KB5A 5FPHA 1OUMA 1L4BA 3SHWA 4MKRA 4N7MA 2VHVA 1Y48E 4CLXA 3U56A 1PTJC 3AY6A 2MINB 3D5TA 1LKOA 1JPVA 3AJAA 3D0KA 3V32A 3C1UA 1N5OX 2QPAA 4DRYA 2QP3A 3GRZA 3K0EA 3LBAA 2PGXA 2R7AA 1PR5A 1J1IA 2OENG 4EECA 1EZ4A 2IPLA 2RB5A 2WVHA 4PLFA 3WKEA 4YAGA 1ZVKA 3RANA 3N6RA 4EMTA 3SZRA 1R5OA 1A8HA 3HA5A 4B4DA 5KNBD 1ULAA 2CB0A 5CD9A 4KQKA 1JQ5A 3O9MA 4I9HA 4WOKA 5J40A 1TWFL 1M1YE 4P8RA 4WZBE 2O8FB 3HI6A 1O58A 2VDPB 1B3BA 2NSDA 3AI7A 4JVSB 1MRZA 1NI4B 1BQ9A 1QWSA 1M1YB 2I6SA 3GLHA 4MW4A 2P79A 4QFBA 4WZBB 5E2AA 1T1GA 2D8AA 2G17A 2PZ8A 3ONEA 4U2KA 5D00A 4YMGA 1ECGA 3ANLA 5BMVB 4C3OB 5CX1A 5LWHA 3E9ZA 4ALMA 3ZY6A 1QS0A 5CM9C 3BBLA 4AT1A 2B6HA 2B1IA 2ISCA 4C6TB 2WZCA 5AW1A 1P6QA 1J1UA 2PCJA 2PL5A 4A3LL 2QXUA 3HS3A 1RJFA 5KWVA 2ZSAA 1OZFA 4UQLA 2Q4DA 4NU0A 1CUAA 1WEHA 1X2BA 2C2ZA 3JVVA 1R12A 1YS4A 3UAVA 1A7UA 1U1DA 1EUCA 1XLTA 2NSYA 4JA0A 4HWTA 3GTGL 1TK9A 4TV8A 2D6FA 1HLFA 3HWRA 5EE0A 5BUCA 3DT9A 4B3DA 4AQDA 2BKAA 4RKEA 1TA9A 1PVDA 2H4JA 1JYFA 1J8MF 2B8NA 1NQWA 1TMGE 2BTQB 2H4WA 3F6YA 1V9LA 1E62A 3GRRA 4H31A 4LPSA 5EXSA 5CYGA 4NE9A 2PGJA 3IURA 1T8UA 2Z30A 3PT9A 3FB4A 1ISPA 2RKBA 1KL7A 4MW7A 3HKDB 4DUPA 1BVRA 4D9HA 4ARUA 3ERCA 1BTOA 1IUKA 1TX4B 1UL1X 4GYJA 3R9IA 1GYQA 1O54A 1SVUA 1X7XB 3NTLA 2CSXA 5J2TF 4HPJB 5F9MA 1XLVA 2W2LA 3UXYA 5KHAA 2NVXL 2EGHA 4M0LA 2ZRNA 3UMMA 2BE5D 1CS0A 1TZBA 2X58A 3A4TA 1GQYA 4IPTA 3LLVA 4LHSA 4RNDB 1C8BA 2CHGA 3F8SA 2AZXA 4KPYA 1SC3A 1TVMA 4IUCS 4RHXA 1M75A 1D1QA 1SR8A 3RUIA 3L1VA 2VAVA 1I4EB 4XWYA 3OUZA 2IYEA 4R1OA 2ONJA 1N2XA 2FP4A 4O4LF 4LTMA 1XAHA 4V0KA 2YBEA 2NTNA 3H8SA 1XZNA 4PCVA 1KRXA 1QV9A 2NZJA 1G4HA 1KK1A 1OV4A 2Z2XA 3GGGA 1KFEB 4RMIA 5EQJB 4ZXPA 5TQ2B 1CTQA 4J0HA 4E1AA 1RYMA 1L1QA 2I7VA 2O05A 3WWOA 2HV9A 2Q4TA 3PC8A 1R8XA 2O07A 1G8GA 1QFSA 3QVGB 4FGWA 3U49A 3OFKA 1KYXA 4BBPA 4JI0B 5HKBA 4RZ2A 5GOTA 1TCBA 4B3IA 4RZXA 5ALXA 3PX7A 1ESEA 1MCZA 3VU9B 2JGDB 2R25B 4L76A 2G1KA 6CHYA 3PEUA 3MTJA 2AG5A 3SN6A 4AWBA 2GZAA 4P7JA 1PT7A 3HN7A 1XAJA 3S70A 1JEDA 4YRAA 2ZYAA 4MWGA 2V7GA 5AVKA 3AU9A 3CQZL 3AKEA 2ZYWX 4I8XA 4B3RB 5FR1A 1LI5A 1G18A 1HFEL 4EGSA 4CIAA 4FQ7A 3M9LA 1RLJA 3HJUA 4KE9A 1TA0A 1ISIA 5IKXA 2AFIB 4RPGA 3EHDA 2XV1A 1QU3A 4OQDA 1GFSA 1VPEA 3NTOA 1QG6A 1BU5A 3BXXA 4M22A 1E2PA 1E2NA 2PA3A 1WG8A 4YDSA 4MV0A 5EY5B 3G1TA 1GKKA 5AI0A 2WWVD 2VH5R 5HVNA 2UUBB 2HSGA 3IPRA 1IJFA 2PRZA 1EWKA 4GPEA 4OGLA 5DNCA 1IZZA 4Y2HA 3KETA 5AKIA 3MJRA 1WF6A 4QNMA 4Y6SA 2GFHA 2XUPA 4MQ4A 1H3NA 3DOJA 3HXKA 1BFYA 4DVGA 5B4VA 5IDXA 3CS3A 2IQ5A 4HR7A 3Q3GE 4G4SP 4AJ4A 2EC5A 4P4GA 3HSSA 1SXJC 4QEKA 4Q9AA 2GYWA 3X43A 3TQOA 3O8QB 4RXMA 1C3OA 4X3CA 3TFOA 1TUGA 3TZLA 1T8PA 2QVZX 1WS6A 3VH2A 1O6CA 1G38A 4QWWA 3V9PA 1QLWA 1QYVA 4Z7QB 4CM8B 1IROA 1WZUA 2NPIA 2X4GA 1TYAE 4YMSA 2YNMD 1DUIA 5IJWA 1DCTA 5FUYA 1IK4A 2XMPA 1UJMA 3KDSE 1A76A 4JITA 4HWOA 4JLSA 3CR8A 5HJ5A 2EF1A 2L82A 4MKFA 3H9QA 4PQRA 1TJ3A 5JNVA 5JG7A 5CG2A 2OPBA 4OREX 2ENUA 1XQYA 5AI2A 4RLSA 3ZCXA 1UJ4A 4EB6A 3EQ7A 1M5TA 1S3SA 1SZJG 2ZPAA 1UWKA 4C2AA 4Z51A 5JYDA 4B6JA 1H0KA 2W37A 2VDRB 3DAOA 1JLKA 2C9OA 2OB1A 2QW8A 2GBGA 4HQKA 2I6UA 4NOJA 2VN8A 2XMGA 1WCIB 2AT1A 4OI0A 4HB0A 4I36A 4ZN6A 3OEEA 1XI2A 3LBHA 1BA3A 1FRQA 2O2JA 3L1IA 1KJ9A 4H7HA 1JYEA 2GR9A 5KTPA 2DFDA 3TL6A 5JASA 2A86A 4KC0A 2FSHA 3HOUL 1WKBA 1QZZA 2VHJA 1JAYA 3S40A 2O1EA 1TRKA 1OASA 2G4VA 4L5BA 3UJPA 3GNLA 3URKA 2J3DA 3EMBA 3PGVA 3T95A 1JKFA 4C7OB 4BO6A 5KNCA 2O8CB 1RDVA 3ZK7A 6AT1A 3F1LA 3QW4B 5CH5A 3L4EA 3ICCA 3G9QA 5FAXA 4LYAA 2DUWA 2V0EA 1RABA 1QOQB 1DJNA 2ERXA 2WD8A 4JT4A 5JSKA 4DNFA 4EUFA 1DT5A 4UOQA 5ALHA 4Y2TA 2XH8A 1LK5A 4UNPA 4QKQA 3QRWA 2O4CA 2VDOB 3B2NA 4Z4FA 2F8LA 1YTLA 3UFXA 1EDDA 2FK8A 4HH4A 4HEA1 4WZZA 4QLBA 5CPFA 1Y6FA 2GMGA 5KWJA 2Q9BA 3H5WA 5C4XL 5DI3A 5DYIA 2HT6A 1U0FA 5GADc 4A6PA 5BN3A 8ABPA 3VH3A 5IVPA 1BE1A 2PMDA 2WFLB 5IAEA 1WR8A 3KEGA 3RTEA 4INAA 3IFSA 5JT1A 4P4NA 1QHHB 3JALB 1NNLA 3HCWA 1G9XA 3QFRA 4Q9NA 3PJGA 2EKZA 2H4HA 1PFKA 1GQOA 3DQPA 4PC7A 4JEIA 2O59A 3OIFA 4DYHA 1NMZA 1PSDA 2CSUA 3CWZA 3NAZA 1Z92B 3P0JA 4J7CA 4JP2A 2IW1A 4W9RA 4UVDA 1BS1A 4LYFA 1FK8A 2PAFA 4M8KA 4Y52L 4O3MA 3G0DA 3EH2A 4XKJA 2C5GA 2QTAA 2GTPA 3DCIA 3MPUA 4O4HA 3ZWCA 2IRWA 4G4JA 1N6LA 3COPA 2PFKA 4J94A 2CNLA 4U0JA 5A9TA 2GZDA 3RSZA 5K3EA 1KSFX 1ENZA 3G9UA 4ZN3B 3OQOA 1YRYE 3KHUA 3F2VA 3T3OA 2OBBA 3INYA 4UEKA 2IEYA 1H3EA 3QUQA 2WAXA 3ZVLA 1G8MA 1BWRA 1U9IC 2CXHA 2Y71A 3CF0A 3EXG1 4TQAA 2IOQA 3IAM1 1K7YA 2DPLA 2XPCA 3LC0A 4IDBA 4RJIA 3U7QA 3FCSB 5EJ6A 3CNEA 4O33A 1VM6A 3VMMA 4CGYA 1F4VA 3BWYA 1NMSA 4PRKA 2CE2X 4BCCA 4Q39A 4B6OA 3QX9A 4P31A 4ZOLF 1CFJA 3QEKA 3YASA 4XWGA 4PPYA 3ENWA 1HMYA 3AF1A 1QR6A 1Q1GA 3KR1A 1Y5LA 3GLGE 4XVUA 4TRRA 2IEIA 3TBFA 2IYVA 2JEOA 3MA0A 1Y9EA 4ZO8A 1X1CA 4R69A 3OF5A 2ZSDA 3GLGB 1ZC4A 4QJ4A 4YUZA 3GEDA 1AD2A 1JMYA 1PR0A 3R3XA 2YVAA 1N2CA 2ZAOA 3NV9A 1NJ5A 4IVRA 4Q3OA 5L45A 3R41A 2XADA 3RI3A 3P2KA 2QHXA 3X2SA 1L9KA 2WSMA 4PFKA 4BNWA 2M2IA 4ETWA 1F1BA 4IFEA 3AVPA 3PE3A 5F64A 1SKAA 1JR4A 4XVHA 1QH1B 2C9BA 1TGVA 1C9YA 1TA4A 2CNBA 2OGUA 3D3EA 4ZZ2A 4DDKA 2WUWE 4TTSA 1EVJA 2GHRA 4WAUA 1WP4A 1HNXB 3ICQB 3PWSA 5EI5A 3RAJA 2IZOA 4MZXA 3C5EA 4XEHA 4BB5A 1W0JA 4GZ3A 4KPGA 3GCDA 2IH5A 1MVLA 3STTA 2JZCA 2NU7A 1I01A 2VSQA 2YHAA 3E9CA 3C1AA 3V1LA 1IOLA 3HVKA 3RBZA 2IT1A 4LZZA 4AFNA 1B13A 1K4KA 1V11B 5G0UA 5K99A 2WSSD 4BNKA 4D96A 3WNVA 4CF4A 2FUNB 4LRSB 3HZOA 4O4IF 3ZWAA 4B3GA 5HMMA 1GRCA 2X0NA 4KIUA 1VKOA 4BMVA 1ZRHA 3KKOA 1N6NA 3CZ4A 3Q2IA 2CMHA 2B4KA 1SFOL 4L8WB 1Y3BE 2F9LA 1ZIYA 2WG0A 2ZB2A 3OFNA 2GAOA 3ETJA 1TIKA 1WDWB 1U3DA 3PQ8A 4LWZA 5FO0A 4EELA 1QRSA 1NXPA 2V7VA 1DNPA 1NC1A 2XJUA 2W6IA 2WM8A 4MLCA 2O3JA 2WUGA 4LHVA 3AFNA 1K7FB 4ZREA 3SLGA 4JI6B 4F1WA 1OTXA 4PLTA 1JP7A 3VR5H 3HOXL 3L7LA 1YFJA 3OQMA 5IWCA 4KGVA 5M29A 3CVOA 2P62A 1NUTA 4TXLA 2Q6IA 3TZBA 4BQEA 4A3BL 1W88A 2W6ZA 3H4VA 4GPTA 3TUJC 3ZHUA 3HUUA 1YK5A 3KQPA 4AJHA 2QUAA 2AYJA 3TDKA 4BNDA 5K0NA 1T1IA 5BQXA 2XXAA 1NYRA 4NEGA 1T34A 3IMGA 2XF2A 4MDFA 2QLMA 4UZSA 3V00A 5C9ZA 1TVKB 1Q17A 4AZ3A 2WJPA 4V0QA 1VSVA 2HJRA 3OURA 3WQHA 1L7EA 4F72A 4ZZ3A 4W5TA 3CRVA 5EHXA 4M53A 4ZP1A 4DA4A 4D1YA 1GG5A 1JU9A 2DBVO 3QELB 2R93L 4F91B 1RQNA 3N0VA 3BL5A 3W8FA 3W5AA 4DSUA 4QUIA 5A6SB 1W73A 2LKCA 3GRUA 1XP5A 2YWDA 3IBCA 3A06A 3I04M 3EVDA 4LHYA 1Z4JA 3MWLA 2PZFA 1E2DA 1DB3A 1BCRA 1NJ1A 4CM4B 3E03A 1RYQA 1U90A 2Q5FA 5AIAA 3U40A 5JNUA 2VZ0A 4CCWA 5JIBA 5KU1A 1RWNA 1QOPB 4OHFA 4R2IA 3CLTD 4D99A 5GMOA 4N5IX 1KJJA 2YXBA 2E4UA 3G85A 5GJVC 3V2UA 8LDHA 3OQBA 3BSYA 1T5LA 3PHCA 1JI3A 5F1PA 1IN1A 5F35A 2FFQA 1SXJE 2DJIA 2X19A 1G3RA 5JYBA 1FDSA 3N87A 3KELA 5LSAA 2FEMA 1KSJA 1YB4A 3CUKA 5TRTA 3VAZA 3LGXA 1NXTA 2O57A 1G3IA 5EEHA 4O4JB 4EVQA 2QBYA 4KX5A 1YI1A 2GN6A 4GZMA 4BHTA 1SXJB 2IPOA 4HV4A 4QOHA 3F71A 1GR1A 3I4NL 1MX1A 1RXEA 2AK2A 2B21A 2PEYA 3BMQB 5K2ME 3EVGA 3L6DA 4TN1A 5EHGA 2X41A 1BSVA 3O8BA 3ZY3A 3HBFA 5HM8A 4R01A 3ETEA 1VECA 4YROA 2JGRA 3JVIA 1T2EA 2K5UA 3OOHA 4GH5A 4ROTA 5F73A 5AKKA 1OBVA 3BK7A 1IBLB 1I5EA 1X3LA 4JT9A 4O8ZA 5B53A 4YR7A 4GQIA 2YFKA 1Q20A 1Z45A 3TQHA 3PE6A 3WMXA 1S1MA 3IT1A 3L8YA 2OOSA 4XA8A 4B6EA 4EO4A 2Q6TA 2Z4TA 5LQNA 2ZR9A 3G3EA 2I8CA 2PSFA 4L16A 5DNUA 1N36B 1J2JA 2WR8A 1XZKA 2VK2A 3QBEA 2I4MA 2QZZA 3TAXA 2WD7B 4UBOA 4CTKA 4ZO9A 4Y6GB 4PZCA 2JGKA 4MPTA 3WX0A 3GJZA 1LSOA 3AM4A 1T25A 4DLPA 4I46A 2IS4A 3K3PA 5JZMA 3LK6A 1KETA 3ITKA 1RBYA 2RHHA 1G7SA 3HV2A 4O2RA 1V35A 1Z4KA 5LB2A 2B2XA 3DFFA 5HCNA 1CP3A 3V3KA 3M1IA 2FOIA 3B5EA 4NBUA 4XEUA 1BJRE 2BMDA 2OV6A 121PA 2GZ2A 3IQXA 4NZYA 3ROZA 3UCFA 4D6XA 1E1RA 2IXEA 4MMYB 5AD1A 4KO2S 4UUAA 3TVYA 2C92A 1EP9A 2JGJA 4IVNA 1ZP6A 1HYBA 2DBRA 2ZT5A 3WQRA 2CV2A 1UBMS 2EX4A 5ALPA 2QD2A 4OU4A 3AG6A 5EJ5A 4NX2A 2XBLA 5DHTA 4TRMA 3ASZA 4DARA 2GUWA 1LLQA 4UDOA 3JD2A 3RJMA 3GLIE 3MMXA 3DVQX 5A1JA 4AIIA 1SMWA 4K3VA 4B9EA 2VQEB 1DC7A 3GEGA 4KAXA 3LHIA 3K1AA 3WGVA 2TSYB 3GLIB 2I87A 3MWDA 3UW3A 2LE0A 1GCAA 3OCXA 2GK6A 1V48A 4U6NA 5ITWA 2JLWA 1G0OA 2P9ZA 3WO1A 3ND5A 3PUZA 2XGJA 4TYPA 4TKUA 3AB3A 4Q03A 4UXIA 2M1XA 4WXHA 3Q0TA 2GEDA 4XXHA 2VDNB 4JB8A 2NVBA 3ETLA 3ZQ4A 3SICE 5EJ4A 5LDHA 3UATA 1XRQA 2GSDA 3D1JA 3N8HA 1PK9A 4N03A 1EVIA 4PCLA 1NKVA 5AVXA 1D1SA 1RZUA 2J4FA 3L5KA 2A1UB 3I52A 4NJMB 3N7UA 4HH1A 1ZISA 3UC5A 2PH3A 1F5SA 2YINC 4HXEB 1LQUA 5ITVA 4WCDA 1ZI9A 1I1QB 1V96A 2J48A 3T9BA 3WIDA 3F78A 1C9KA 3JARB 3S7TA 3HWWA 3WFZA 2HU7A 2H4FA 4Y6PA 3EZNA 3C4QA 1BHQ1 4LRXA 1UWLA 1OREA 1ECFA 1RRVA 5EINC 3AERA 3E05A 3IXLA 4KXFB 4UM9B 2V7UA 4EUNA 1R0KA 2O8EB 3WLLA 2AHOA 2AJBA 2CMFA 4H9GA 4DEYA 2VRCD 2J67A 4OHBA 5M7EA 5IT0A 5CIQA 1SUIA 1NR5A 3OLXA 4U8GA 2J3QA 3KKZA 3PTAA 4CKYA 1MB4A 3MT0A 1WBJB 4MICA 5G53C 3U9SA 2IYZA 2FW8A 2ZWOA 3DUFA 3EIEA 1EK6A 2ZRDA 3RYHA 4DMGA 5EE3A 4CKCB 1U63A 3IDAA 2Z6UA 3RDPA 5DZSA 3R7FA 1R88A 3HY4A 1EFPB 2RH4A 4W1SA 1Q7CA 4AKTA 3DE6X 5LXTA 1GG9A 3B08B 1L6RA 1R6DA 3WGOA 4RK0A 3DHYA 1AJEA 2G5TA 3HDHA 3RSSA 3CCCA 2VXBA 1XEWX 2E18A 4Z2YA 3UMVA 1FRFS 4KJZA 4FHGA 1O57A 4X8LA 3VSCA 2QVYX 1V8BA 3P0HA 4CTOA 1ODKA 3LQ1A 4EHNA 4PZ9A 1R6VA 2CHFA 1G8HA 3T8YA 1RXSA 2M4VA 3TKLA 2P9YA 1BEEA 2Q3EA 1GZ7A 1S4MA 4WFIA 2IPNA 2HGSA 3SDBA 2QRLA 4LOAA 2JA6L 4FFSA 4HX9A 4JDPA 4ZT7A 4LC0A 1GM5A 3E15A 2PG3A 4PZDA 2VBGA 1CADA 3PWKA 4TXMA 4M76B 1RMYA 2FG6C 3BIJA 3DT6A 3E6AA 2XVZA 1HEYA 1ZR2A 2UVPB 1MT0A 3O6VA 1PJLA 3ROPA 10MHA 2LGJA 2Z6QA 4NNJA 1NUSA 1EZZA 3TXAA 1ISMA 1Q91A 1Y6RA 3FRHA 3KAJA 1M74A 3HNRA 1T2FA 2GZSA 3AGPA 2B1RA 2NNLD 3PRYA 2ZRBA 2RH5A 3Q2OA 4AKHA 4JD5A 4UU7A 2HJGA 1AY0A 1NYTA 4J7UA 1B2RA 4MCAA 4Q3KA 1CHNA 3BT7A 2BMJA 4V0RA 3HU5A 3P32A 3OETA 2XLCA 3I6IA 1O95C 2DPGA 3L0PA 4DMHA 4F1KA 1JJ7A 3CUYA 3L04A 2HSJA 3PWTA 2F4NA 4MV4A 3WG9A 2FHSA 4KAFA 2P77A 2DHDA 4C0WA 1V95A 3HKEB 4DLUA 4X0EA 2QJOA 3CGWA 4IDHA 3DKRA 1R9TL 4JQOA 4BFSA 5H3LA 1TYEB 3UGTA 1T0HB 4EG0A 5HZKA 1ENPA 1RBQA 2RK4A 1LF5A 1AF4A 2WJIA 2AK3A 4PNZA 3B78A 3Q5DA 3LGSA 3TZQA 5AUNB 1E9DA 4J0IA 5KYXA 2RFLA 2BFNA 2W6MA 4L8FA 4N7RA 1Y1KE 2JBWA 3VDXA 4TS9A 5H16A 2JIMA 5JNLA 1U1EA 2ATEA 3D4NA 2RMKA 5T3UA 3GJYA 4QRDA 1K4YA 1NP6A 1BFKA 4TMFA 5TPZA 1A9TA 3NR2A 4WI1A 2XB2A 2PDAA 3PGA1 5BT8A 2AEJA 4NY1A 4RA9B 3MLEA 4IIFA 4P93A 1R4NA 2X9VA 4WNYA 5GV7A 4DNQA 3KLOA 2RGBA 4IGKA 2HL6A 2HA0A 1H42A 4LE2A 4DL9A 1NQAO 2YYZA 2E1RA 3A4NA 1BMDA 1NF9A 2OLEA 2XHEA 4B3JA 5F1KA 4EPRA 3QQPA 3OCCA 1VHLA 1RYBA 3M3YL 2PR2A 5E4FA 2X14A 1PQWA 5AXCA 2H0RA 3SKXA 4BE9A 5KZMB 4TM7A 3D1LA 1BQEA 1OZHA 2J9FA 1Q0HA 1NXVA 1MP0A 1QTNA 4KWIA 5SY6A 1PLJA 3D2LA 3ZCUA 4D41A 2HFJA 4YJGA 3WP0A 3AEUA 4BQRA 2J5BA 2W4QA 3E9QA 4OX9Y 2BMFA 4NMHA 1PNQA 4I1UA 4K6CA 1A97A 3GZNB 4G0NA 2VT6A 4O02B 3ZDZB 4YWJA 4PN3A 2PFSA 4U7DA 2DETA 3M6WA 3PD0A 1MO6A 4W9NA 2Z95A 3WQQA 5JCPA 1UJ6A 221PA 3JZDA 3KDPA 5BYAA 1THGA 5C8YB 1GGNA 1N5DA 1WF3A 2DUMA 3KVRA 2ECOA 4E09A 3MGKA 3F7TA