3ZG6A

The novel de-long chain fatty acid function of human sirt6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
b'MNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-6
molecule tags Hydrolase/inhibitor
source organism Homo sapiens
publication title Sirt6 Regulates Tnf-Alpha Secretion Through Hydrolysis of Long-Chain Fatty Acyl Lysine
pubmed doi rcsb
total genus 98
structure length 294
sequence length 294
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3zg6A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3zg6A01
1PNQA 1V5GA 3IAEA 4IAOA 4RJJA 4F56A 4F4UA 4K9LA 4K9OA 3FLMA 4IG9A 4C78A 2OD2A 4MPPA 5EJ9A 1M2JA 2EZTA 1T9BA 4RMIA 1OZFA 4UU7A 2FSVC 3GLUA 2VBFA 1V5FA 1U2DC 1M2KA 4JT9A 1O97D 2Q5OA 1YI0A 2H59A 4GM0A 2WVGA 3CLTD 2Q27A 4X3PA 5EJAA 4JT8A 2JLCA 3GLSA 4BVEA 4UTNA 4MQ5A 5EJ5A 2V3WA 1POWA 4GP9A 4QQ8A 5K3SA 4ZZIA 4ZP1A 4V1CA 5EJ4A 2AG0A 1MA3A 5IMSA 2WVHA 2QQGA 2PGNA 2A1UA 2Q29A 2H2FA 1OZHA 1QPBA 1U31A 1J8FA 4FZ3A 2JI6A 2EZ8A 2Q5LA 5MGNA 1OVMA 2JIBA 5EJMA 4HD8A 1YBHA 2NXWA 3K35A 4KPUA 1YHZA 3U3DA 4V1CB 2H4HA 4JUDX 4BV2A 4C7BA 5FYQA 2EZUA 3PKIA 4Y6LA 4D5GA 1T9AA 1EFVA 2JI8A 4UTZA 4TWIA 2H4JA 5D7NA 1M2GA 1UPBA 2OO5C 2PANA 2VK8A 4BVGA 4D5EA 5K2OA 2FRDC 2H2DA 1Q1AA 1PVDA 4JU8A 5FEMA 1PO7A 4GM4A 1U28C 4JU9A 4KGDA 2IHTA 2Q5QA 4JUFA 4MPRA 2DJIA 2VBGA 2VJYA 4K9KA 4JUAA 1M2HA 2A1TR 2UZ1A 3OE1A 1PT9A 4Q9DA 4Y6QA 1N0HA 2VBIA 2WVAA 4K9PA 3FSJX 1Q17A 3F6BX 4COKA 1M2NA 1MCZA 1YNOA 3D81A 3GLRA 4UUBA 3EYAA 2H2GA 2H4FA 4RJIA 1DJLA 1U2GC 4TWJA 1HZZC 3PDHA 1SZCA 2OD7A 3LQ1A 1ICIA 1PYDA 2FN3A 4UU8A 5BWNA 4K9NA 2BRUC 2NYRA 4MPJA 4J16C 5MFZA 4BN5A 4BVFA 5K6TA 1S5PA 3JR3A 2X7JA 4UTRA 2H2HA 1ZPDA 4K9QA 1SZDA 3U31A 4BVBA 1D4OA 4HDAA 4RJKA 4BVHA 2EZ9A 2FWNA 1Q14A 2B4YA 1XLTC 2QQFA 4JD5A 3D7KA 2EZ4A 3ZGVA 4K9MA 4BN4A 5EJ6A 5DGTA 3CLRD 2JLAA 3CF4G 2OORC 3RIYA 2Q5JA 1OZGA 4FVTA 5EJ8A 4BUZA 2H2IA 1S7GA 1POXA 2IHUA 2OD9A 2PGOA 4IF6A 5EJ7A 1NM5C 2C31A 1V5EA 1PTJC 4QPZA 1YHYA 4FEGA 3D4BA 4MZXA 3IAFA 3E9YA 1YI1A 4I5IA 2AG1A 4UUAA 4X3OA 3ZGOA 3JWPA 4UTVA 1PNOA 1Q6ZA 1YC2A 2UZ1B 2W93A 3GLTA 5MF6A 1O96B 2Q28A 2VK4A 5AHKA 3HWX1 4L2IA 2JI7A 2HJHA 5DGDA 4GM1A 2VK1A 1T9CA 5BWOA 1UPAA 5K6RA 4GG1A 4V1CI 1Y9DA 3HWWA 1JSCA 4JUBA 4BV3A 3RIGA 3ZG6A 1PI3A 3CLSD 4G1CA 4L3OA 5MFPA 4R8MA 4GPEA 4J1TC 5BWLA 1BFDA 1UPCA 4O8ZA 4RMJA 5DEIA 3EY9A 4RMGA 3PKJA 3FZNA 1T9DA 2FR8C 3CLUD 3F6EX 2IHVA 4FEEA 4KXQA 1E3TA 4JUCA 1YC5A 1Z8NA 2JI9A 4Y6OA 4RMHA 4JSRA 4QELA 4UTXA 1YTLA 1EFPA 3EA4A
chains in the Genus database with same CATH superfamily
1N8SA 3QG5A 4PO9A 3R7DA 2VPTA 4DSNA 4FR5A 5FFFA 3Q9UA 721PA 4DRZA 1U8CB 4O4HA 5LP1A 1LJUA 1RJEA 2P6NA 1F14A 1G0OA 2LIPA 3TW8A 4I1PA 4JVMA 2XZOA 1CVRA 4DB4A 4EYQA 2Z2KA 4KR2A 3UJPA 2HHCA 3AEQB 3DVAB 4MR8B 1Z7GA 3E3NA 3CWQA 3IQXA 2IY7A 4LE0A 4BNKA 2JLCA 4D0SA 1IWBB 2VRCD 2B9EA 4KPUB 3W8DA 1T3GA 4MINA 4RAOA 1WB6A 1HQYE 1I01A 2WVHA 3M2PA 1K8XB 2Y0PA 4A4DA 2QG6A 1G21A 2WFAA 2BKLA 3L5OA 3GDGA 3NEYA 1E79D 4F5YA 3QKRB 3ZZNA 2H2WA 4F8EA 3QE2A 3TAHA 2E49A 4EGSA 2ZRDA 4PO3X 2JI2A 2J6IA 3OQBA 2X9VA 2RJNA 2QZPA 2QT9A 4I4NA 3K6SB 4NE9A 1V9CA 3LXXA 3S81A 2QRKA 4GMXA 5FLYA 1OPRA 4Y1RA 3R20A 3VAZA 1Q1AA 3BAFA 3HC7A 4JQCA 4MWCA 4QBHA 2O8CA 3QA3E 1XMJA 4UD2A 2F1HA 1TJ5A 4X1OA 3UV6A 2NYUA 4FE7A 1MHTA 1XYYA 4QDJA 1RMYA 3JYPA 2D1QA 3AJ8A 3RS3A 4GX1A 4Z9BA 5K0TA 5K3FB 3CINA 1ZK3A 2JJMA 1DDGA 4JYAB 1I0LA 1PBNA 3KXKA 1CVIA 1YGPA 1VBKA 3JV7A 4L0DA 4BLRA 4QBKA 3LQRA 1ADBA 3RYCA 1NIJA 1E0DA 2X42A 1CVLA 4WTOA 4D44A 3PV0A 3K31A 1UJCA 4X1KB 5KKAA 2R4UA 1WUHS 1SC1A 3V34A 4EQ6B 4V0QA 3WLPA 3I2JA 3PQFA 2D5IA 5JALA 1A50B 1LRKA 1PT5A 2PFKA 3K8YA 4MPJA 3V4VB 3WRXA 1NM5A 1C8KA 1OGJA 1P33A 3E9CA 5J5AA 4AR4A 1CZRA 5C37A 3OZXA 4OLFA 2H18A 3LY9A 1TYAE 4UHEA 5E7IA 5ARCA 3RF7A 1IBRA 4A16A 1MU0A 4ZJYA 1ECPA 4ZC1A 2I4OA 3QE4A 4RVNA 2OD9A 2QTFA 5A9TA 2X0DA 3FOFC 4JLUA 1CUBA 1P45A 2DULA 2GUWA 3HVUA 1HK7A 3DULA 4HQ6A 4Q1CA 5F73A 2WAOA 3R8FA 4K03A 4O3MA 1ID8A 2CUTA 2I9PA 4PYOA 1UKYA 3SJAA 2Y68A 3AVQA 4FWBA 2V7XA 5JMWA 4E2YA 5KJ6A 3GLTA 4OP3A 1YKSA 3ZWXA 3OUTA 2W2LA 3QWHA 1XNJA 5A5DA 2ZUEA 2ECFA 2RH9B 5EYPA 2FN4A 2KI5A 3G0BA 4BNTA 3QI7A 3GXOA 4L6CA 3I04M 3ZH2A 2CCGA 3H2JA 2CXRA 3ZGLA 4FNMA 1SBHA 1XD8A 4UD6A 5D84A 1TM5E 2PAAA 4EJ6A 2B36A 3AU8A 2VSFA 4CKWA 4LIPD 3BXFA 5JUWA 1RI4A 4LRYA 1GPH1 1QUEA 5A5GA 4IMRA 3CLUC 5TMDA 4C76A 3DPSA 3IP9A 2PBLA 2PKQO 3ICQB 1RRKA 3R0VA 3TB6A 2G70A 2PZMA 1ZRHA 3IP1A 3EPHA 3M6XA 3KTOA 3PQCA 5DI3B 1IHPA 2O1WA 2IV7A 1G8PA 1QIDA 2OT3B 3ZJ4A 2B21A 4ITVA 4BX8A 4UPEA 5BSFA 4O4HB 3KYBA 1I5EA 1TGYA 4JROA 5T6BA 4BMDA 1VI2A 2IK8A 3LT4A 2FG5A 3U62A 6AT1A 5IASA 4JJGA 1HDXA 2PUBA 1JHUA 2QL9A 4MS3B 3TRJA 4RSRA 1KY4A 1Q57A 3H1EA 2X19A 4DIMA 4HJRA 1S9DA 4ARVA 3KQKA 1TTHA 2HC9A 1E64A 4R2XA 1MGOA 3N86A 1PFGA 4JMLA 1G18A 4F21A 3JD3A 4D98A 5JAMA 1EXVA 3O90A 3AI2A 2QOEA 2YVQA 3PQ6A 2BI8A 4WZBA 4OJTA 1ETUA 3OY2A 4M37A 4PGFA 1PQYA 2BBTA 3KQTA 4YMHA 1DG9A 3PFBA 1R0WA 4D9BA 1CZNA 4PC1A 5KHLB 3U7JA 1VM6A 1A3CA 3F7NA 3IHTA 3NP9A 4HN4B 2F55A 2E85A 5HZHA 4MVCA 1FQWA 4G89A 4LYGA 4HB2A 1IBCA 4S1TA 2MCFA 5EQDA 4OA8A 4X91A 3VDXA 3IQDB 3ZUPA 3IBTA 2YIVX 3V4LA 2ZDHA 2XYQA 5DHTA 2HW8A 5IABA 2VPXA 1E6LA 4MW9A 2WAXA 4DFDA 1QNLA 1TADA 1BWPA 1J5PA 2ODWA 3Q3HA 2IXDA 4S1PA 3ET4A 2EWMA 2OYCA 1ZH6A 2GA9A 2JAOA 4PX5A 4L73A 5AVSA 3OF3A 2NO7A 1Z5PA 1BGVA 3CPEA 4K9PA 4KO4S 1UBOS 5KDLA 5EE5B 3WZMA 2UYYA 5HUHA 1EVQA 1MCZA 3FCXA 3H2SA 3QLEA 1A8QA 4KK3A 3V4RA 1ONNA 3ZDCA 5ESDA 1FEZA 1U2GC 2LZ0A 4HAVA 4LXTA 4QDTA 1JIKA 4RABA 4Z3OA 3AHCA 4MKRA 5AJHA 1VYVA 1H4QA 4FBGA 1T3HA 3MG9A 3JQ8A 3CHYA 3ETHA 2ZWAA 3SSOA 2Y67A 1CEYA 3V97A 4XIIA 3W3AD 5DN6A 2COKA 2UAGA 3VYSB 1D4OA 4RH1A 2ET6A 1GSOA 2NU6B 4PO1A 3VO9A 1WG8A 5K3FA 3CB4A 1KQOA 1XF9A 1XZNA 2QVGA 3WMRA 1FXSA 1VP9A 3MW8A 4C21A 2ZSJA 1IZ8A 1D2NA 1GG5A 1O57A 2P40A 3BWYA 2NQ2C 4XYEA 4XVQA 4MQ4A 5JASA 4OGLA 3K5PA 4M9CA 3L4SO 4H0CA 5CIQA 3X1ZA 2FMFA 3C3XA 1G6HA 3H5WA 5ALFA 1HY3A 2EG5A 1XMXA 3K32A 1EUCA 1ZGHA 4G09A 4PYLA 1THTA 1DOHA 2R8PA 2AG8A 4RPHA 5H3LA 1JUDA 1D6JA 1QG4A 1ZGGA 2HJGA 2V4UA 2XQFA 3ABQB 3K8ZA 3OH8A 3TIFA 3V6MA 2DLCX 2JC3A 4KB5A 5F23A 3EXHA 1A7UA 2A6HD 5T67A 4R3WA 2QBYB 4FNGA 4ZVRA 4V1CI 3FCCA 4R1OA 2E5LB 3VHLB 3O8OB 4L57A 2JHFA 3O7MA 2GMGA 3GLFB 4ZDJA 1XQXA 3LAWA 4PYRA 5B6IA 4YB8A 1U28A 5JAIA 5CLQA 2FSPA 4ARSA 3FOCA 3KTDA 2E6UX 3TMKA 2O2CA 4YCJA 4B3FX 4D42A 2B2NA 1Z2NX 3C3DA 2VJMA 1B7GO 3CX3A 4LXIA 1NI5A 1ZUIA 2TMYA 2Z58A 1HDEA 2XXAA 1YB7A 5AUOB 2ZOSA 1QE5A 2C9YA 3MOSA 1HI9A 1Q7GA 2A1IA 4HWKA 4LHZA 2PKYX 1F20A 3WLTA 2OC9A 2VPWA 4QUDA 2OD2A 2RCYA 4IEEA 4LMAA 1T6ZA 4JI3B 1BOOA 1EH5A 4NULA 1BRMA 1Z7EA 3N6RA 1GCIA 2KS6A 2V3VA 2C9ZA 2Z3RB 3MILA 4IDPA 1TD1A 2JD1A 4DCSA 4Z7QB 5C4XL 2A35A 3GF4A 4RWZA 4NTZA 3FRJA 3TRFA 1T36B 3ZOZA 4AF8A 3KUXA 2XCSB 1ZI6A 1B13A 2VZ9A 4NBKA 1W5EA 2XI4A 3H75A 1PS8A 1T13A 4HEHA 1H4TA 1KRHA 5IDYA 2IE8A 1KVQA 2V9CA 3WNZA 2PMZP 1BAPA 5CTAA 4YC7A 2D1SA 3A1EA 4PFJA 3IDFA 4I55A 4XDYA 2J1LA 4F3RA 4ZVKA 1NUSA 2DWOA 2JATA 3HCCA 2R93L 3HL0A 2DM6A 4H15A 2O59A 1H9BA 1F9AA 4N6NA 1XLUA 1XHLA 1U9YA 1SKYE 4KXWA 4K6HA 1O03A 3I1FA 4Y6LA 1HGXA 1ZA1A 4KXFB 4DSOA 3HY3A 1J0DA 4MSUA 3EIUA 4NPAA 2ZBRA 1WPXA 4OLHA 3L4BA 3DPUA 3IQEA 3AFHA 1QVZA 1W2GA 1XZQA 1U6JA 3AF0A 3KXIA 1U0GA 4GLOA 5KQGA 3A4YA 2F64A 3RCBA 4Z9XA 2KSQA 3QU2A 4RADA 2Q62A 1ZDMA 3VO2A 2ODPA 3GLFA 4UOZA 5KYUA 3ZDRA 1Y4UA 1QH1A 2AE2A 1BCSA 5C1DA 4KODA 1PEYA 1YKGA 4GOXA 2ISCA 2GNPA 4WZZA 4DV5B 3WLIA 4JGBA 2CNBA 4B8ZA 4LHLA 3ECCA 5E4FA 4X94A 4DY6A 2G08A 3WJ2A 1JQKA 1HMPA 4HFMA 4HB4A 5AVQA 4E14A 5FWNA 1V16B 1JEEA 1ECCA 5CIYA 1VL6A 1NWHA 1XMSA 1X1QA 1BVYF 3N2EA 5LQCA 3FR8A 4JZKA 4AW9A 5IJ9B 3WRYA 4TS4A 1UZNA 3R2JA 4B3CA 1KI6A 4JLKA 5JG7A 1AXEA 3GRZA 4IVPA 4BU0A 4TL9A 3DCYA 4LF6B 1G5PA 2ZG6A 4EH1A 3SVTA 1PFKA 4P0TA 2NT3A 2EFYA 3N2NA 3UMJA 4CFSA 3SSNA 2X8JA 2CNKA 4ITUA 1E2MA 4WT7A 1I33A 1ODKA 4MCAA 2V3BB 3HBLA 2PE5A 1QRRA 2ODTX 4DBLE 3Q88A 3OBIA 4Y2PA 1EWYA 1YUBA 4OQLA 1AHPA 5J63A 4IRUB 2R6ZA 4OHXA 4D9EA 4QBTA 2OAP1 1A9RA 3DLBA 5JO9A 1RRFA 4IJUA 3UJHA 2BYTA 3KNZA 1XPRA 4HL6A 1QQAA 5E7QA 4J9VA 3G0GA 3R5TA 3KU4A 3RIGA 2X3FA 3OC0A 3RROA 4J07A 3ORRA 4XYMA 1AV6A 1U8TA 4QOHA 3PQEA 4EDHA 4UPVA 2IEAA 1XTSA 3ANYB 2B5ID 3GN2A 5JSZB 3L8YA 3B2NA 4ESHA 2Y0DA 4HTFB 2P35A 1R0FA 3FNQA 1T5IA 3JQAD 3NWJA 2DEUA 2V55B 4LXQA 4YO8A 3EXIA 4RK6A 3W7AA 1L3CA 3F7MA 4R51A 4Y2UA 2EP5A 2AOVA 4M0FA 3HJBA 3S6JA 3CNQS 2W4QA 4O2LA 3HOYL 1HLGA 1TLLA 1BMTA 3NYWA 4II2A 5EL0A 3R9KA 2XECA 3FYUA 2JCXA 2EYUA 1T2DA 2KWIA 4E1BA 4YT8A 4JMPA 2WAQP 2OGUA 2HUPA 3ZU5A 3D8RA 1LLFA 2W11A 2WG0A 3A9RA 3WNBA 5CFRA 1J0AA 4AY2A 3IVXA 3ROTA 3MUOA 1OLXB 4D4LA 2FVXA 3RJ9A 3AO0B 2WDPA 2C3PA 2ZI4A 3QW2A 3ZPXA 2CWWA 3HEAA 5A3JA 2HF9A 2X15A 3JZFA 2X9NA 6ADHA 4FZ3A 4KU4A 1OZHA 1UEIA 3EH2A 5L9AA 3S55A 3DF7A 3LOPA 3I39X 1NF8A 3QI2A 4US2R 2GFQA 5K8JB 4EJ2A 3WSWA 2F8SA 5GIPE 4WEQA 5FR2A 2NIPA 1X7HA 4EK9A 3TKLA 1T9AA 4A93L 3OLVA 4RQUA 3B6IA 2NXNA 3FZYA 1E18A 4R3NA 4NCBA 1P74A 2BT4A 3FHOA 3KYYA 2OV4A 5IKMA 1Y6JA 4QECA 3QSGA 4TKVB 5E6SB 4XARA 4L9RA 4R84A 1RKUA 2VJLA 4ZVOA 4X7MA 1ZH2A 3V9AA 5I7UA 5SZIA 1V3UA 4OB6A 3RKRA 3R5FA 2EFJA 4K87A 3GJXC 2EGUA 1QRAA 2I4NA 2RC5A 4F5WA 4HTFA 4OKNA 5CA1A 4JI1B 1R15A 1W73A 3WAKA 1BVUA 4IIJA 3THWA 3PJFA 3OLWA 2I29A 4PZCA 4F2PA 4DR5B 4BJ5A 2YXEA 1GPJA 1ZP6A 3Q8KA 2AR0A 2BMDA 4XM0A 1RRPA 5A7HA 3KSZO 4B3JA 4GGMX 4G9GA 1GYQA 1RHRA 5JRDS 2P9EA 3AKCA 1PJTA 4YHBA 2NZYA 3IEXA 1YRYE 4GPBA 3TVTA 5CD1A 5IFKA 1KEPA 3P8ZA 4ENTA 5FOXA 4DCMA 1LFAA 4F45A 2NZJA 2WHXA 4CV3A 2XT6A 5AIBA 4RKYA 2GN0A 4N5LA 1YQGA 3P9ZA 1U0EA 5LP6A 1IQUA 4Q82A 3ZW7A 4F8JA 4HZUA 4XIGS 3FUUA 1KZ1A 2LV8A 4O08A 3TDNA 1M74A 1USIA 2YHBA 5A0FA 2GM3A 1L7PA 2C7RA 3A44A 1W8DA 4HLUA 3AVUA 3DO6A 1PGPA 2VT2A 2ZT8A 3D4NA 5JNRA 2Z2ZA 4I5FA 2JANA 3UMRA 5DZSA 1W36D 3WVNA 1GUYA 2D5CA 1JHDA 1OV4A 3LDAA 3EF1A 2E1RA 2ZE7A 2ERJA 3KBOA 1R8QA 4Q3CA 4WLOA 1EDOA 3UEOA 3FMGA 3OKAA 2C4KA 3SICE 3PQ3A 3WIVA 5BXQC 4ENVA 5CAEA 2JLUA 1KL7A 1D6SA 1JEOA 2H1SA 3FUVA 4CMBA 4KREA 5H02A 1JYEA 4XUDA 4FKMA 2Z6QA 4QU8A 2OAGA 4CL2A 2DWPA 1Z6ZA 4CU5A 2E18A 3KC2A 2I7DA 1X13A 1RAAA 3T52A 5LD2B 1XZFA 3RF6A 1R00A 4WD3A 2RGEA 5J4YA 4BTEA 3E82A 4K0KB 1GTL1 3L8HA 4RTMA 3FYTA 1H6BA 4IIDA 1W87A 4PWZA 5EFZA 2OO7A 1F5SA 1D3AA 1G7TA 4LY9A 4WFIA 3T1QA 2V6JA 4RL6A 3CUSA 3GAZA 3WK6A 1I51A 4BKQA 4RSMA 3D3NA 5ESRA 1VGVA 3HB7A 3HUUA 1D5WA 1YB2A 3Q1KA 2V3WA 2ZT7A 4ND5A 5DULA 1MAAA 1NE7A 3FCUB 2J5XA 3V7YA 2BMAA 2LW7A 1CIJA 1RWKA 1WCML 3PA6A 4HZUB 5G3YA 2R1TA 2G9UA 4KO2S 3D1VA 4DG8A 2WIKA 1XYGA 1JR6A 1NC3A 2R7LA 3B7GA 3IRVA 1B1CA 3AJEA 3O21A 4S0XA 4GYKA 3RUEA 4PVDA 3EGVA 3KWJA 3T3IA 1J7KA 1XU9A 3DLCA 4C4OA 1EJ2A 1UT8A 3RC2A 4BXOB 1A8UA 1CUIA 1OXMA 2FQYA 5J59A 3TE6A 1H4VB 1G64A 2FLWA 1B8PA 3HUDA 4HT3B 1IPHA 1SBTA 3PFFA 4JJ6A 4KSYA 1CYEA 1Q1QA 1YIOA 2WWXA 4G5HA 4H7FA 5G3ZA 2OQVA 3SZGA 2LGJA 4AECA 2G36A 2CXNA 5DTJA 2OSVA 4LC0A 3RVPA 2C5BA 2WJWA 3EVFA 1SM4A 1TTTA 4N3CA 1PGJA 3ZS9A 4ZCTA 5DW0A 5KTKA 2PGAA 1Z75A 3SIRA 2JBWA 3L7OA 1PU2A 3MQFA 5EKUA 3VU1A 3D7SA 4CEHA 4LMPA 1Y81A 2QMUA 5A6SB 2AFIB 2Y1EA 1I2BA 4RD3A 4FDAA 3I01A 1YF3A 4R7TA 4IX9A 5E3JA 4MLPA 5FXMA 1YK5A 1Y8QA 2BUAA 3GDHA 3ZV3A 3KOXA 5DE3A 2WY2D 1RWXA 3TE7A 2M98A 2I9KA 3TZKA 4LHNA 3PE4A 5AVUA 1E20A 2HV9A 2RBGA 2XDYA 3AC0A 3CWZA 2ATEA 1ZM7A 3JZDA 4JC4A 1U9IC 3H5OA 1WSBA 2PPLA 3MJTA 2ZSHA 2X9QA 4K05A 4NZNA 4IDBA 4MS3A 3EPJA 4X65B 1G2QA 2MYTA 1KEUA 3E7WA 4LF8B 4UUNA 3E1SA 3EUFA 3TLZA 4ASUA 2Z3QB 5EJ6A 1K88A 1HKHA 2FAXA 3QE9Y 2OSBA 4BQFA 5F12A 3KM0A 5JS1A 3MELA 4WGFA 1FU8A 2CSUA 2E5WA 3GUHA 3N6XA 3Q85A 2FPRA 3CR8A 4QVGA 3ZLUA 4B6PA 2MR5A 1PZHA 4B6GA 2ZGVA 3MTAA 1E4EA 1Q1GA 1ESNA 1VSUA 3GUCA 3WRXC 4AKIA 1QKIA 2QAIA 4KO3S 3FHLA 1RNLA 3HYSA 3QMPA 1XRJA 1CG6A 4NECA 2F7SA 4C0SA 4NBUA 1FNDA 3D7RA 4DN6A 4RTNA 2VK4A 2FEKA 4JEMA 3DQZA 3TL3A 1RCTE 2GDJA 3ICCA 1TXGA 1OASA 3U4DA 4WY2A 2QN8A 3PEEA 1SHJA 2G0AA 2NQTA 4YMGA 3LLUA 1FUKA 1NVWQ 2UYQA 4GR5A 4RFSB 3T94A 4YROA 3KVVA 1PW5A 1QXSA 2H4ZA 1TQ2A 3VPSA 3VVLA 5A1TA 3KJFA 2VSXA 1CQZA 1NURA 4NZOA 1K89A 3PXAA 4G8BA 3DOCA 4L4SA 3QVVA 3S1AB 4P5EA 4RTQA 1G20B 3ISTA 2GZAA 5DTMA 5KPJA 3RSGA 2IIVA 1LW7A 2GUGA 1XL1A 1Z62A 2M1ZA 3CZ9A 3KB1A 4RA6A 4ZU6X 4QE3A 3LYLA 5FA5A 5LA6F 5B7GA 4NZ9A 5EE1A 3C7AA 2XUAA 1KEWA 4PFSA 1T1IA 4M49A 2J9RA 4JN6B 1ZN7A 2D5BA 3ZYZA 4LKOA 4AJJA 3QLVA 4H60A 1MPTA 4O0MA 1CHNA 2H3HA 3KB2A 3STVA 3CISA 3RYIB 1YI0A 5BVGB 1GVHA 2H59A 1Z3CA 5CFPA 4FFRA 4KX3A 2LDXA 1AQUA 5HRCA 3HXKA 3FWNA 2XZTA 3T9DA 1FW8A 3O2SB 5TQ2B 2XB6A 1DMRA 3C1UA 1TC1A 5B53A 4E3WA 1GAEO 1Z17A 2ID8A 2KQUA 2VYVD 2JLSA 1Z5WA 2D2EA 3DLTA 1Y34E 1N6IA 3TXXA 2RK3A 2QRHA 1HNNA 1K66A 3HQ4O 2YNMD 1ORDA 4M46A 5B3KA 1AKMA 3P0HA 2JLQA 4LYJA 3S2IA 3VR4A 2NMVA 2JFOA 3SHOA 4Z6KA 3DFFA 2ODBA 3THRA 1DBVO 5FB3A 3RWBA 1YWGO 2Q9BA 1T2EA 3OQIB 2YJ3A 4HDCA 5ISMA 4KNYA 2P9JA 3S28A 4QIWP 2C57A 2Z83A 2VK8A 3GI1A 2XGMA 5AKZA 5EWMA 5G0VA 4LWQA 4U3JA 1CETA 5FPQA 4ZRDA 2R0QC 5EMLA 4MA5A 1U1FA 4NDAA 4XX0A 3VBEA 4OY3A 3ISVA 1IN6A 1TU0A 2VZEA 3MFQA 1NR1A 1XKTA 1UDBA 2ENWA 3OIUA 1A4RA 4QNRA 5F5NA 3TCXB 3OAAA 3WL4A 4BYGA 1OC2A 1YZKA 3EZ7A 4BNVA 4IJQA 1KMMA 4G4JA 3KE9A 3PDHA 4TS1A 3F2VA 2JCBA 3C3CA 2XMPA 4Q1VA 4LX0A 2HMSA 4ZCLA 4DMHA 4MQUA 4ZGWA 1DDIA 1JJBA 2VNAA 5F7JA 2V3CC 1A04A 1LX6A 4M8NE 3W4JA 4D4JA 1L7NA 2WUVA 5BT8A 4JJ7A 2CN1A 2BIFA 2EX1A 2WOOA 1QIIA 3DVRX 3DYVA 2HKIA 1E4OA 4UATA 1XWFA 3DCIA 2RHJA 2HX1A 4UKDA 4CMGA 1AGPA 2R7AA 3E3AA 5EJ8A 5LUAA 5RXNA 2BHTA 1JIJA 4NCKA 2PGOA 3QEJA 1QIGA 3WLQA 1ZBQA 3W1WA 3ER6A 3W9YA 4WA7A 1G5HA 2B61A 4DA6A 3S8EA 4I5IA 4GMHA 2HRCA 4H3KB 3HCEA 5AOVA 5K0GA 2EVWX 5G4LA 1GDDA 1MG5A 4LW8A 1Q3KA 4WXYB 3LNTA 3AINA 5DM1A 1J0BA 3BRQA 4D9KA 5CXQA 3GW8A 1ZCAA 4TTJA 1Z16A 1M34A 3AILA 2XOKA 5JJLA 1W0JD 4QJIA 4AQDA 1VL2A 1FHMA 2HQ1A 4DUYB 1R0IA 1YA4A 2I6GA 3HWWA 3TBHA 4BV3A 3GG9A 3LX6A 1FZQA 4NMWA 3TOSA 2EX4A 4I81A 3ENQA 3QHAA 4LOLA 4MO9A 5TF0A 4ZEVA 1NN3A 4NY1A 1MB4A 1JDPA 3ZZUA 4R4JA 4RZIA 2QZ4A 5FWYB 4FR0A 2B63L 2AF3C 4I7EA 1WM1A 3OU7A 4JA0A 4QL3A 3E9DA 4Q3BA 3CRMA 2ONYA 3DBRB 1EFPA 1DZIA 1W2WB 3AF4A 2GWHA 1TVEA 4UU1A 4KDRA 1TYZA 3ETCA 4TXHA 4XGKA 3TDKA 3Q3IA 2ONCA 1DRWA 2GK6A 2V7PA 5F2EA 2BDUA 1HDCA 2VJOA 3AR9A 4TTAA 5CIWA 3SSMA 4ZQIA 2ZREA 2IXAA 3I9OA 4Y1RB 5T4HA 1SD1A 1GJRA 2IOFA 1OZAA 2OZKA 2AC4A 3GGJA 4B34A 2P9TA 3BA1A 1V3QE 3IYLW 1NW7A 3FJYA 1SU7A 3OJXA 5DX0A 1FF9A 3ZW8A 5DDIP 4IEFB 3CT4A 1VA4A 1XMQB 2NVWA 4GKKB 3WHPA 2HGSA 1OLOA 1PSWA 1N2XA 4WVLA 1I14A 3WTBA 4YAEA 3G8AA 4NMXB 5T7BA 2Z57A 2X5JO 1U2GA 3OZ7A 4OP2A 4HNQA 1WHTA 2GEKA 2FETA 2IDJA 3AEUB 1R6DA 3COSA 3L0CA 4M86A 4FYWA 4OB7A 5DOZA 5JAUA 3P20A 1Q1NA 5IEBA 2UDPA 1L4KA 1Y8RA 1JXMA 2UYOA 5CEFA 1DT3A 4KTTE 1PO7A 5DFAA 4F6RA 1F3LA 5KQLA 1AXGA 4BQEA 2D0OB 4MPRA 3HDYA 4DBLC 3G02A 4EQ6A 2OM2A 4D4KA 5HILA 2RKBA 1NLMA 1SRQA 4PM4A 4EY8A 1KO1A 4UOEA 1X38A 3CH4B 3O2NA 2DSNA 1QWOA 4MKIA 4UHFA 1E1MA 5I3ZA 1Y1QA 4KGVA 1E3IA 4D92A 2EEZA 2IU3A 3U6BA 3B7PA 1JE1A 1GG2A 1KYTA 5BN5A 1ICIA 4EI2A 1W9MA 1AY0A 2RGDA 3B1JA 3C3JA 1TWGL 3UXHA 2FYTA 3Q6MA 4JAFA 2P11A 1JA9A 1W8IA 5FPPA 1EB9A 1C41A 3P0IA 3CNOA 3ORFA 3QF7A 4JB0A 1B23P 3CXRA 3JU3A 2H51A 2XGGA 1Z13A 3IKJA 2XCLA 1ZD3A 3AHEA 3IKMB 2PMDA 3PITA 1AZLA 1TB4A 3N87A 4CQMD 1POXA 4OXNA 1O5OA 2HA2A 2VIIA 2W6OA 3OEHD 4JODA 1UBMS 2IF2A 2QMQA 5AVVA 3RZTA 1EWVA 1QG2A 5DN6D 3F0TA 1AUQA 2CF5A 4YIKA 3HRHA 4G0WA 1WZEA 2QKYA 2IEYA 3HRIA 3CUUA 1JBKA 1BVRA 3QF4B 3GZTB 4X6XA 4YV1A 5B3AA 3EAQA 4GYJA 4XUEA 2PSMC 1IONA 1BQ3A 1HH4A 2IPMA 4V0KA 3AEXA 2CJWB 1C1XA 2O7VA 4KX5A 5CH8A 1KJNA 3EJ6A 4PXAA 2FWAA 3FWHA 5BSTA 3ZXSA 4XWKA 5LLDA 4YCNA 2JFBA 1E6CA 5JBIA 3DFKA 5AQ1A 4P81A 5JI3E 1UT6A 2DETA 1BS1A 3QUQA 1H2WA 2QG4A 3OAAD 3ZDFA 1EM6A 1ZOLA 1E3TA 3K5WA 4P2GA 1Z8NA 1E3LA 1RE0A 2C9MA 1VHJA 3I64A 4JSRA 2BGWA 4N48A 1FZTA 5U1PA 3ZWPA 1FVXA 2EFHB 3FUWA 3K3PA 5F64A 4CV1A 3ZZ0A 4B47A 2VWPA 5JTUA 4CLRA 3ZR4B 2FWMX 4NCHA 1L7BA 2BFEB 5JNWA 4O3FA 1RYTA 1BN6A 1CCWA 2Z98A 2IITA 3CNBA 3HCWA 1ZMRA 2Z4SA 3N75A 1S6YA 4FGJA 4G5YA 5FI5A 5IKOA 4PNHA 2Z95A 1PJ8A 1YJQA 1E4YA 1YVDA 2DQKA 3NHMA 2OE2A 4QO8A 2CFIA 3BH7A 4LNUB 2I2FA 1SHKA 3A6ZA 1WUYA 1GNRA 3F9RA 3GLSA 3ND7A 3LL4A 2FW7A 2JAPA 4M0DA 3ROKA 2RGAA 3CCBA 4D26A 1C0KA 2J9XB 3KL2A 1P4HA 3P2EA 2GYVA 1KI1A 1TJPB 2ZYWX 4CNBA 3AL2A 3Q5GA 4DM4A 4X95A 3UVEA 2OFPA 4JNCA 1T34A 3FCYA 2Q5LA 5SZJA 2BJHA 3IVMA 2QUHA 1E0JA 1NJ5A 2H1VA 3CYFA 3DHEA 1GQYA 3BERA 3EXFA 4LOKA 2VOEA 3UCFA 4YRDA 4XGIA 1JE0A 1CKEA 1YZLA 3LXRA 3Q9LA 5AKIA 1CNMA 4QU9A 4A8PA 4DYDA 3FSEA 4LRSB 1N3BA 3QE3A 4LBWA 3EGWA 4TWIA 3RIHA 5AKKA 3TQFA 4OYYA 3HAXC 1Q6YA 4MUXA 1ADJA 1T4MA 2B8TA 4JJZA 1CE8B 3RVKA 3E7FA 2Z56A 1PZMA 2DJIA 1XZIA 5EXTA 1MRNA 1YIAA 1SVMA 1RXCA 2C2HA 2QYSA 2ZQYA 3QITA 2ABWA 3KWFA 2H29A 5IW8A 3VM6A 1CZHA 3PJDA 2TMKA 1OXSC 5AXDA 3DOHA 3ZY6A 4OHZA 4HNTA 5KVAA 4IWYA 1M2NA 3BWCA 1N5LA 2HREA 1MHPA 2A1TS 1UJ4A 1QHEA 1XNGA 2NO5A 1ZVMA 5LZ5A 4CM8B 1EUDB 5L6MB 2C9DA 5AIAA 4DR1B 4UAJA 3NH6A 3JQGA 8AT1A 1WBBA 1SXGA 3VJLA 5FV4A 2D7DA 2O8CB 5T5QA 4PHHA 1XCLA 3ACCA 1JLHA 4COOA 3I5YA 2F3SA 2IXGA 5M34A 2DPGA 2H4YA 3L8FA 2XKAA 3EW9A 4RGBA 2VP4A 1E1KA 2R6HA 2CDRA 3I9FA 3R5JA 4JYCA 4NOLA 2BFFA 1IC6A 2HLDD 2EARA 1T2AA 2ZVPX 3HRKA 4N5NA 4X92A 5KAPA 4B5LA 1CRPA 4R1LA 2DUNA 1KERA 1WZNA 4DJ5X 1WPQA 1PHPA 4LJ4A 5IF9A 3IEVA 2FZ4A 4UM9D 3HJCA 5K8LA 2C6BA 3KHKA 3NDIA 1TCCA 1ZGBA 3LCMA 1E9CA 4Y1GA 3VR6A 2B3TA 1S89A 1CY4A 2O3TA 4BBPA 3D6HA 3H17A 4A0SA 2G83A 1XRLA 4JA2A 4NYJR 4KSCA 1DV1A 1R0BA 4PLCA 4D9CA 4HDRB 3PLAE 2B35A 3CURA 4WCVA 5C80A 1XQVA 3E5MA 4EWLA 2Z6VA 5LP6C 3ZIAD 4MR7B 1ES9A 5ER6A 3WQSB 3D6FA 4DVGA 1L5HA 4ZTZB 4F4HA 5THXA 4H18A 4ALIA 3PFIA 1FTGA 1NW8A 2QDKA 1FSSA 5CVDA 1M10A 3ZWVA 1QIJA 4EZIA 5I45A 4N7RA 2GASA 3ZVRA 1XZJA 2LIVA 3L0IB 2AOUB 4ZO8A 4KAAA 5IVKA 5FOSA 1F06A 1YQXA 4W1RA 1VGRA 3MJDA 3D3QA 2FP4A 4JBHA 5KUTA 1N78A 1N7IA 1YO6A 3LC2O 4XD7A 3FPSA 4ENPA 3BSSA 2B0CA 2CXQA 5KNDD 1OWNA 3IS3A 2WZCA 4KL8S 1FXWA 4ZOEA 2DHRA 3HXOA 1CS0A 4KGZA 4QNNA 4BP3A 2FSVC 4ER3A 2XMCA 3VR2A 4ECAA 5JJBA 1RWMA 1K63A 4I99A 1A7JA 3KYDB 5FUYA 3TQHA 3VNUA 1WOMA 2H1FA 1AZWA 3DTVD 3EJWA 5M5BA 4RF5A 3S99A 3IB3A 5E6SA 1GQQA 1R3DA 4TT3A 2B3DA 1EVEA 2JDID 4I4TA 8RXNA 4YCDA 3UENA 2GAIA 1FP4A 2OO5A 3OU6A 3WJ1A 5AW8A 3HU2A 4OQEA 2P5YA 1V7CA 2JH8A 3AB3A 4IS3A 1BD4A 1G8JA 1Z33A 2EYQA 3K1AA 3HKEB 1E5TA 1G9TA 1Z3IX 3OUZA 4KI7A 4MKHA 4GR4A 4U7JA 3UMBA 1UBNA 2GYUA 4B35A 1IXSB 1PG5A 2AYXA 3F4BA 5FYQA 3G2KA 1GD1O 3KETA 1V5WA 3IEIA 2O2XA 4L3VA 5FDFA 1GGJA 3UJ3X 3QY9A 4XZ3A 4ZAVA 1L9XA 2QJRA 2VOJA 3W5UA 1P7VA 1GR0A 1GNTA 3OOHA 3QWAA 5AESA 3HS3A 3FCEA 1P0QA 4EI9A 1DAPA 1FRNA 5DN9A 2OILA 2FZWA 3W78A 3DE5X 2WJVA 4B5KA 2GBLA 2G5CA 2QTLA 4AY3A 1HXHA 2PL5A 4E7OA 5ED0A 5DHPA 3G82C 5CG2A 2I1QA 5JPIA 1W2HA 5JCJA 1II0A 3PB3A 3FMIA 3HM2A 1MJNA 2Q1TA 4INOA 2ECPA 5IG2A 5IBCA 3GFRA 2W2LD 3D5EA 3ETEA 4QU0A 3ZY3A 3A6JA 3COWA 1WD5A 4GQBA 3T5DA 3W6UA 3ZKWA 4DXDA 5CHEA 2ASEA 2B0JA 2JZOA 4YP6A 1YJ8A 4CKBA 5LA6B 1S8AA 3LIPA 3RUPA 1NC1A 3R24A 5D5PA 2B25A 5LB2A 3T95A 1E9BA 1ZD4A 2QSZA 3KFXA 3DDOA 3PRYA 4XAQA 4ESEA 1DO2A 3A4VA 3AV3A 1P3JA 1M1YB 3AX6A 1DQZA 2WYUA 1PT7A 1R6VA 4PSDA 2EQBA 2Q5JA 7YASA 2WVJA 3AJRA 5JBQA 2BGGA 2QRLA 3ORQA 4TV8F 1W34A 1VSTA 1VTKA 5AI2A 3IJRA 1DTWB 3KUDA 4I5GA 4PZUA 5DP2A 3VPDA 2IOQA 1NVUQ 2Z6AA 4ILEA 3H83A 4MJXA 3NNDA 1XN4A 3DV0B 3O84A 2IYVA 2E5FA 3LHDA 4YJ2A 3OI7A 4MIYA 2ZSUA 3PUZA 1YULA 5B7QA 1TK2A 1WCYA 2QAGB 2FPXA 3OZGA 4JGGA 3PVSA 3GMTA 3ZZ1A 1XQWA 1D6NA 3KB8A 3WDMA 3ZHVA 2XHEA 4EG6A 1US8B 4AKEA 1FFDA 1B8NA 2EG9A 3VKGA 3I32A 2H31A 3IVCA 5KYVA 3RJ5A 3FFTA 1L5FA 3FNEA 4N7JA 1ZM2A 1Y9DA 3MK31 3DBHB 4URXR 5HK9A 1MOQA 4JOQA 2J9YB 5IAJA 5H83A 4GYYA 3JR7A 3L7AA 5H1Sc 1BFDA 1JHAA 4RMJA 1T26A 1F7UA 4XWOA 3PKJA 2PD6A 3C8DA 4KZKA 2JCSA 1E6KA 3UK1A 4DM3A 3I9V1 4C3VA 2C2BA 2PRIA 2IV2X 2BMVA 4L74A 4G97A 1R50A 2JLBA 3WL8A 1UJ5A 2C5GA 2NO1A 4IXWA 4MR9B 2B92A 2ERYA 2GEFA 3BXXA 4J0CA 4LEIA 1TKCA 2V7GA 3H16A 3O9MA 1FJ2A 2ZRNA 1P1CA 1ZW6A 5GGYA 4OPMA 3AEYA 4MDFA 3CVYA 3KJQA 1H5QA 2JGLA 5E6UB 3MPSA 4B40A 1KAEA 1SQ5A 3C97A 2XTZA 4RHCA 2ZJFA 4Y2GA 5IVIA 1JYFA 1M2VA 1VG8A 2C95A 3F8SA 3KTFA 1OAOA 3LX8A 4PU0A 1ACLA 1CDOA 2PT5A 3TO5A 5BV0A 1V7PC 3GAFA 1RWQA 1SA0A 3ONDA 1EGVB 1TQDA 4J1TA 1QYBA 5IMSA 4RTSA 3NVAA 2POCA 4Q7KA 2CFOA 4L8LA 3L2OB 1I6KA 1TVKA 3EVBA 4HDSA 5BORA 4CKCB 2CGEA 4IV0A 1U2RA 2G5TA 5EQFA 2RGUA 1GHTA 2QVCA 2CFCA 1OW3B 1OV6A 1PJBA 7RXNA 3FAZA 3Q2KA 4G4SO 2UKDA 4G84A 4QRHA 5L3ZA 5K7SA 3CVJA 4MCJA 1C1DB 1LTQA 3B3GA 3D6MA 4FNOA 4I3HA 1BH6A 2EZUA 4AYWA 4AHYA 1EFVA 2FEMA 2IZ5A 3H6HA 1L5VA 3V4PB 4CM9D 5K0JA 2AJTA 3VTKA 3DW3X 3QXCA 1DHRA 1CY6A 4UM9B 5FEMA 2PKQP 1SRRA 3EGXA 5K4AA 4Q5IA 2VQEB 2YOHA 4PGHA 1ID1A 2PVSA 2IPXA 1QFJA 4MIKA 4Q1DA 4XB2A 3ZQ6A 1NUAA 3O74A 4R83A 4ZCIA 3EMKA 4OSEA 2IZ1A 3B2EA 1RFLA 2VDPB 2XTNA 4KE8A 4IHJF 2E82A 1WSAA 3A6KA 3Q2IA 4EF5A 3DWIA 4N8EA 1WLSA 2IX3A 2YWFA 2NV6A 1Z6YA 3AEKA 4H59A 2XWQA 3WZLA 3I23A 3JYNA 5HE9A 1YZNA 1XMOB 3QK7A 5G4KB 3A1DA 5I5EA 3VA7A 1XVVA 1LF5A 4G37A 4Y0NA 1UBUS 5AI0A 1WZUA 2R84A 1EM8B 3QVLA 5D7BA 3VDNB 2D3WA 2XE7A 1EAMA 3M5WA 4C3HL 4IHQA 2CR8A 4J0DA 4PG6A 1TFRA 1N33B 3WKEA 3MCZA 3F3KA 1RPAA 1K8QA 1N9KA 3AEUA 3DUFA 1DIOB 3GDWA 4KUGA 1II8A 4DR3B 3OO1A 1FMCA 4O59O 1CE8A 2OLJA 2PG3A 4Q00A 1DKMA 1D2GA 4C87A 4TRMA 3RT1A 3OZAA 1A72A 5C9ZA 3ZGOA 3MLEA 3HJGA 3R5HA 5C53B 3DTYA 4PQFA 5CFZA 2G5GX 2KLHA 1J5XA 4HQNA 3ZEAA 4ERNA 5MGBA 1KEEB 4WBNF 1U3TA 4EFMA 5KS2A 2LR0A 4JEHA 4Q4CA 1H6CA 1R9MA 2VAPA 3OPYA 3OJ0A 2C20A 4YVFA 1SBCA 1T1SA 4G5QA 5TVGA 3VJMA 4RNCA 3KLNA 3NO4A 1ZINA 2XBLA 5TPWB 4DUPA 3ZDXB 3BWEA 2AX4A 3QXHA 4AK9A 3GBVA 4NZYA 3UMYA 1YRHA 1JMVA 2O2GA 4RMGA 5KMGB 3OFSA 1R4MB 3ULKA 2DPXA 2CVZA 1P1HA 1XTPA 3G8YA 4QXOA 1XD2A 3C3WA 1MAWA 3M34A 4AJ9A 5F5LA 1XXLA 1LNSA 4G0QA 1CQXA 2JHPA 1TAQA 5JI2E 4ICIA 5E4TA 2BCGY 2NO0A 2QB5A 4QICA 1XCMA 5LOVA 2J67A 1NT2A 2XHZA 1WDKA 5BQFA 4PRYA 4IKOA 2JFYA 3OQHA 4LECA 1XNHA 3WE7A 3UQZA 1PDVA 1HQCA 1FP7A 4M9RA 4LFBB 4AF7A 5FL7D 1F8GA 2B1JA 2BFDB 3DE2X 4L7QA 3MUEA 1BMFD 3TZEA 3EVAA 3IUBA 1I3CA 2J3IA 2BUBA 3C6ZA 2PIDA 3GOHA 4YLGA 3DHNA 2Q0HA 2ZIEA 4AJ2A 3W34A 5BV1A 1Q21A 3BREA 1B3BA 3JPYA 4O1MA 1JMKC 2VJQA 2P6MA 1UZUA 1JR4A 2XEXA 3I83A 1BU5A 1ZSYA 3I09A 3ASYA 3DM9B 5KAMA 2R8BA 3AP3A 3KJNA 3HKCB 1YJCA 2XJRA 2P2SA 3INGA 3FW1A 4BGIA 3GL9A 4MDEA 1Y1RA 4D80A 3DMTC 4I6JA 2W22A 4J0QA 4KPYA 3T1HB 1DVRA 4FSHA 1I5RA 1E5LA 4A92A 1HFEL 2I4LA 1XG5A 4QZVA 2H1LA 2GAAA 3DXYA 3HPQA 3IV6A 1FOEB 2O8BB 3K6KA 1IQRA 1MIOA 1SVUA 3VU8A 1JT2A 4ALKA 5JO0A 2Q4TA 3G7NA 1Y0BA 2WIGA 4OQFA 4W4TA 3DAYA 2IYPA 2VS1A 2IGTA 3FOBA 3RRBA 7ADHA 1VIMA 2PT6A 4BY1L 3DV9A 4J7CA 4LG1A 1MZVA 2H8KA 4BLOA 2XE4A 3N76A 5CRIA 2FP3A 4X7BA 3CG0A 4WKNA 5KYXA 1DX8A 1VHQA 3RRZA 1TYEB 3PO2L 1JHXA 3PDIA 5K6TA 4E3ZA 1LSOA 4WZAE 1DIAA 3IP8A 3NBMA 4EENA 4R2IA 2K7FA 2PKEA 4OQQA 3DR5A 2EZ9A 4O2AF 3G23A 4KHZA 1L7MA 1ZGZA 2W8ZA 1W52X 1N0WA 1JG2A 4PCUA 5KHAA 1ZLXA 4LDPA 3IEPA 3T7RA 1O95D 2BI7A 1RLOA 1T9QA 1OR8A 2Q3BA 2YV2A 1XCPA 2XJ9A 1UXKA 2ZYIA 3BXHA 3HCOA 3HR8A 5PNTA 3W90A 4FE4A 5LD2C 1RM3A 2BL4A 2L0ZA 1JN0A 1SD5A 5DSTA 3TLEA 1MB9A 2F3UA 1M2FA 1X42A 2J0EA 4R5MA 3ROEA 5DGHA 2Y1XA 2A86A 4QGAA 1BROA 3QV2A 2APJA 3P32A 4DADA 3V1KA 3TDMA 2W70A 2O9JA 4OH1A 4ZWNA 2ZM5A 4BLVA 1NZDA 3JQQA 2QN2A 5TGTA 2PUAA 1M8FA 2DC1A 1Y8ZA 4B43A 1O0CA 1IVNA 1UM8A 3RUDA 5KX5B 4E12A 1IHDA 1GGNA 3IAS1 4J1TC 3QTLA 2EW2A 4GW3A 3SBEA 1MOSA 1E3WA 1ODTC 1VLJA 3ABSB 1UKBA 1UMDA 2WZBA 3H11A 3H1PA 3TNJA 4Z3KA 1OYWA 2A0FA 4QJ5A 3SJUA 5CVCA 3GCGA 4MW1A 2BHRA 3QOWA 3TYXA 2GK4A 4IYRA 3FYUC 3LVQE 1QFZA 3ZGNA 3OOYA 1VL5A 1LLUA 2GKSA 1JBQA 1ZN2A 5FBWB 4GLFA 3EVDA 1FBTA 3HDVA 3O9VA 4RSHA 4DV6B 4Q01A 1B8VA 2ZP1A 4P7JA 1ZM9A 4GGPA 2PX2A 5EJGA 1VMDA 3WKAA 1HT1E 2RAPA 2YYSA 3JS5A 1T2NA 2EKBA 4R71A 5C5DA 2BMFA 1GTMA 3HP4A 1S2IA 3RTGA 1DP4A 2OCPA 2ZZMA 2WIBA 3K72B 1HG1A 3HOVL 4UDNA 2MINB 2WK1A 1ESCA 1KI4A 2BZ0A 2QD3A 3TOVA 2Y9PB 4C7JA 5LZ2A 3GJ4A 2WB1P 4H6PA 2RBEA 2HCRA 3RRYA 3KZOA 4QOIA 3WWDA 4CGYA 5JZSA 2HV8A 1V37A 1GU1A 1H5NA 1VJTA 3AI7A 3PHHA 5AW3A 2AK2A 2A6ED 1Z38A 2ZRHA 5K0ZA 4X66B 2POQX 1GU7A 2V58A 1ETHA 1BEZA 2WOJA 3W9SA 4ALMA 1J09A 3QEKA 4V3CA 2QD4A 1AQJA 1UPBA 1WS6A 3K0FB 1I1NA 4ZYZA 1RBZA 4BQQA 4YMLA 3FYHA 3KSAC 1OT3A 3A9WA 4XLLA 1PAUA 2BFWA 4ZFNA 1C3EA 1QR2A 2ODEA 1HTWA 2AUMA 2DVMA 1NSTA 1G16A 2GJ8A 2NXCA 2O8NA 3A9CA 3KKMA 4X1YA 2HD4A 3PGVA 1SELA 5NLLA 1IBMB 2X7HA 2GN1A 2VA8A 1A8SA 3KYWA 3KXPA 5AJWA 2NV0A 1PWZA 3NV9A 3GWZA 1L2TA 2PZ8A 4PPNA 4UHKA 1JQ5A 3SXPA 2GVNA 2WABA 1JEYB 3UYKA 2ECOA 3QUAA 4UU0A 1NXOA 2XF2A 4GWKA 4HYYA 4R8RA 3OG9A 5KZMB 1PYDA 2D4HA 3PGMA 5KQRA 4DV1B 4M3NA 5FAXA 4YRZA 4DQ0A 4ZOLA 2ZRKA 1SU4A 2H85A 1OF1A 2FPIB 1AN9A 1VBMA 3T6KA 1RQGA 3U31A 1VPDA 3GFGA 1ZOSA 4PHTA 2WF6A 5LOVB 3VHRA 2XPCA 4B79A 5DHFA 3UC9A 1Z0FA 3ZI4A 3ENKA 3ZCXA 4JJKA 3KS9A 4M83A 4GVLA 4K6OA 4EVSA 4TT8A 2I7CA 2FCRA 1N0UA 3QFCA 4MUEA 1IG3A 4RPGA 4PPFA 2QRPA 4YWJA 3RU9A 4Z54A 4J4BA 4BV8A 5EWLB 3GLIE 4AC9A 1E2NA 2E4XA 3G9TA 3NXSA 3KWMA 1UPTA 5KMGA 1AUVA 3OQOA 2SHKA 4C0HA 5C4IA 5J5VA 5JYEA 2GZ1A 1AB5A 2BKUA 2BM8A 3ESXA 2C82A 3NJ8A 4Z7NB 5EJEA 1PX0A 4M54A 1IEVA 1MAUA 2PMBA 1S3SA 5DYIA 4RIEA 3S2DL 3SXUA 4QDXA 2B82A 1J24A 5EUCA 1IROA 4L2IA 2IUSA 2Z0MA 3DHWC 3HSKA 4CDMA 4DCTA 2DFVA 1KWGA 1CF4A 2FUKA 1SUDA 1WPGA 2C9BA 4TTTS 4JB8A 2EL9A 4CR8A 1USVA 3IUNA 1OMOA 1Z7BA 3ZLBA 5B1YA 1WXQA 4KMMA 1YR7A 4B3MB 4JEIA 2ATCA 1GDHA 4Q03A 5GOZA 4OMFG 3GVIA 3VGPA 1JI3A 1I94B 5LMNB 1VI5A 1JKIA 2AMVA 4KKXB 3H2GA 4MH0R 3PDWA 3A06A 3U6KA 1SD2A 4ACBA 3QLUC 4G25A 1KETA 2QUIA 4US1R 1OUMA 1W4ZA 1KJ9A 3ASVA 3OE4A 4JLOA 3KUCA 3AQ4A 2DBQA 5ECWA 1W5SA 1T2CA 2Z3WA 3W5AA 4IHAA 4REQA 3WYCA 4Q47A 2N0SA 2GZRA 1U7HA 1Y6GA 2DZDA 1GA4A 1WX1A 1ZWKA 4QOJA 1N1EA 4EMBA 4Z4QA 1C50A 1PFQA 2OCIA 3HBJA 4P3PA 4RSGA 5FI0B 5HX7A 3FSGD 3W05A 3B53X 1TJ4A 1W46A 3U7FB 1FLAA 2P78A 2CK3A 1Q0QA 1GIAA 4N39A 2Q5OA 4MGIR 2M6LA 2O8FA 4CKEB 4I0WB 5B4VA 1W4BA 4CBVA 3SAJA 1D8TA 1DBWA 3FPFA 1Z6PA 2IL1A 4IJ5A 4IP0A 1AQLA 4HDMB 4UMEA 5EAIA 3VHQA 4B4KA 4X24A 5K4GA 1XK6A 1Z6XA 2C2WA 2P27A 5KYWA 1EWQA 4JOBA 3GG2A 3HSSA 5AM1A 2GMWA 3CZ5A 3JRNA 3NC4A 4AL4A 4DQXA 3Q3CA 1Z8HA 2JFZA 5FQOA 3AL0C 2I1VB 3DEYX 3G2IA 1AT1A 4B6SA 2VRCA 3U3DA 4G07A 4X54A 1ULSA 5JSYA 2RHLA 3VR4D 1EVLA 2HR5A 1GKLA 2ATVA 2INGX 2WTNA 3QYPA 3BXPA 3O1LA 4K88A 4RMNA 1P5FA 1GLVA 3WA6A 2CUKA 1F2TB 1VJ5A 1R5OA 2O4UX 3CV3A 1YDFA 3GT3A 4HLQB 5DF1A 3TZLA 1VKNA 2Q5QA 2H6EA 3H5NA 3RRXA 5AH0A 3WHLA 5H3HA 4L28A 2PLNA 3ZV7A 1DEXA 3AI3A 4MUIA 3C2QA 3E23A 4Q9DA 2NTYC 4L5IA 1L5ZA 3KO8A 3RT9A 2Y2VA 2Z4TA 1EVKA 2G71A 5HCUA 3NOQA 4UPDA 3DPIA 4RBNA 2XRZA 3IVRA 1I2DA 5JJ5A 2H2GA 5FNVA 2X40A 3FTEA 1LS6A 1SHLA 1UMCA 3PNSA 5B1DA 5EA2A 4HXFB 3O4HA 2BEVA 1JKJA 4TTSA 5CLIA 4DUZB 1L4YA 3NCTA 3GPLA 1HE1C 4K9NA 1XJ5A 1SVNA 3AOGA 1P4AA 2COEA 5EZYA 4EAAA 1PNRA 3WGGA 4YCCA 5IPFA 1DS6A 2VAWA 3MC1A 4HNAA 5IM4A 1PGOA 1KZGB 2B4RO 3AESA 4N82A 4HVAA 4N03A 2DHQA 1NVMB 2ZJ4A 3EGOA 3C6BA 5AM5A 1CZUA 3GH3A 1EHIA 3PIRA 1JDBC 3PQ2A 4XXHA 5ICSA 3EK2A 4G9BA 3NCHA 3U19A 1ZONA 1KBOA 2EKZA 2FMXA 1NRJB 2Q8PA 4TZKA 5JU6A 1L8AA 2YY5A 3OICA 2GTPA 5GAEc 1JEJA 4IGFA 3F8TA 1ZQ9A 3FMPB 1VLVA 2HMTA 3BJMA 5TJHA 3RS8A 3D8HA 4HFRA 1E1YA 1U2ZA 3TQOA 3KQUA 2XZPA 3QE0A 3VNRA 2GVZC 1KC1A 4DA7A 4BCCA 3VR5D 1SMKA 4LSGA 4ZT2A 4A8JC 1TYCA 4G1MB 2DTEA 3H3XA 3I3SR 4JP8A 1Y3FE 1FMTA 2E3JA 3NTLA 3OTGA 1GKIA 2G72A 1HDZA 3DB1A 2NX2A 4M1KA 3QIAA 5E6RA 4CIXA 2M32A 2H17A 2QR3A 3B89A 3EWNA 2AFHB 4BKPA 1AGXA 4MCIA 4BFTA 3CVWA 2OGWA 3P5BA 4CTKA 5IT4A 1PZNA 3ILYA 4NEHB 4TYMA 1QNFA 4ASUD 2BBWA 2E2HL 5FTLA 5M04A 3ZK7A 2SKDA 4BKMA 4ZREA 3IR5A 4NYMQ 1YCDA 4H16A 1HF3A 5FEUA 2XTAA 3J7TA 1NX9A 3TIVA 1PNQA 1QOZA 3DDWA 3G2PA 1ZSNA 4J91A 4RK4A 5JD3A 5MLC3 2ILTA 4IG9A 2MSLA 4P6VF 3HJUA 1PR6A 2GKGA 3HZHA 3KQVA 4UU7A 4XR4A 5EIAA 1UL1X 1ESZA 1MABB 3OX1A 4KAFA 2XDWA 5EHNA 1SKBA 3GD5A 1JAXA 1U3FA 2V0GA 1Y7PA 3TQQA 5F7ZA 4Q9AA 4U5XA 5A3SA 9ATCA 1AU9A 3RHTA 3PF8A 4ZZIA 3ODGA 4UEJA 1JZQA 4HRAA 3V2HA 3C5EA 1SBZA 1V3VA 4MV9A 4HQKA 2X86A 4J2TA 2BISA 2ZRAA 1AHHA 1ORIA 2AW3A 1JTFA 4EHJA 2FPMA 1U0FA 2OHOA 3R3ZA 1QB8A 1SIBE 1KFKB 4FKBA 1JSXA 2O2JA 4KWIA 1FLDA 1YBHA 1Z5VA 1X7DA 4U2GA 4B6EA 3LY5A 1JHRA 3PFCA 3AHJA 4KTVE 3WWLA 4Q4JA 4R9RA 5GPBA 4KN8A 4A8JA 4TQGA 4O2BA 1QYRA 1JU9A 5CDSA 1R6UA 2C03A 4QWMA 3G7SA 3Q7IA 3PUHA 3VVCA 5MN5A 4PW0A 3GTPL 4MWSA 1S24A 1YR8A 1QG0A 2IUEA 3L9XA 4O29A 4RE6A 4TQ9A 5ADHA 4L0CA 1G2PA 2RBKA 2QRVB 4YLYA 2F8MA 4JITA 2B5OA 3DD5A 1RPZA 4AHWA 1PCXA 3IPLA 3NW9A 5D1HA 5JVH1 2QMYA 4B0OA 4MR9A 3M81A 2P6UA 4UHBA 1DRVA 4R2MA 1UP6A 5M3FL 3OX4A 4N47A 1LRLA 1D2CA 2F1OA 2ICAA 3HGMA 4GSKA 3X1JA 5JXWA 1A5AB 1HFKA 4DBZA 4GPZA 1NXQA 1WCXA 3EOAI 3AETB 4LDQA 3PZAA 3B7WA 4R1MA 5AKJA 3F1LA 1ZISA 4WNAA 4I9GA 1XZ8A 2WPNA 3CRW1 4P32A 3S2YA 3UFXA 3LUDA 3KQPA 1P44A 3WQQA 2Q7DA 3DAGA 2BH2A 3BWDD 3FF1A 2X0IA 1BD3A 1KMHA 1NVAA 1O4WA 3UUWA 2Z09A 2WSBA 4L9WA 2IVFA 4HDMA 4GOMD 5IVPA 1IK4A 4QYIA 3NEAA 2JLAA 5JQGA 5B64A 1MQSA 1RBYA 4DREA 4UTOA 5IXSA 2Q4RA 4KDEA 1FRQA 2EHDA 2ZXFA 1F2UA 2YDXA 1SK9A 1DFHA 2XVXA 1DQSA 3BK2A 3D3JA 1R0ZA 5DYGA 3WYAA 4DILA 1GGHA 1KMHB 1DTWA 2GH1A 3LQKA 3M6FA 4J3JA 2QM8A 2QSYA 1ZC3A 3FTPA 1O0BA 2YVLA 4RJ2A 3WYBA 4JI4B 2VYND 2PJDA 3I3OA 3KPJA 3IUQA 4JH0A 3LQFA 4RLHA 1TZBA 5CH5A 5E1OA 1P81A 3DDNA 3HZOA 3N2IA 1XTKA 4TS3A 5FNZA 4CV0A 1FCJA 2N42A 1YL7A 2JK0A 3CLSC 4RZQA 1KWKA 5JH7A 3FLBA 2P1RA 1X80B 1JQBA 2PU7A 3G5AA 1PEKE 3UWKA 1QGOA 1U1GA 4M9XA 1E61A 2PIAA 3UV7A 2NNLD 3HVHA 4G0XA 3SY8A 3PWKA 1KQ3A 2FPGB 2IEDA 4P35A 3EPLA 4P38A 1K6XA 3GVCA 4E70A 1CUVA 1MB0A 4LJ5A 4HKTA 4OA5A 1TLFA 5IP5A 2M6SA 1THGA 3D3KA 3TMAA 4GX5A 2J9GA 1PFWA 2V4ZA 1PNVA 2CY0A 1BCRA 5AM2A 3VSCA 5LJLA 3EVEA 3QOFA 4KIJA 2EXXA 4RZ2A 4TSKA 3O26A 1TECE 2D2VA 4HN9A 4MKXA 5FUWA 5AVTA 3VO8A 3O95A 4MAAA 5EN4A 1H2YA 2F43B 3BRSA 4OQMA 4DCGA 4PAMA 2X4DA 5F76A 2GPBA 1FNNA 1WTCA 2FV8A 1U0HC 1NY5A 1ZUWA 4LJKA 3CX7A 5CDTA 3L05A 5CK4A 2IYXA 2AFIE 1UBKS 2J4CA 1EPUA 1R0LA 3A6LA 1P7YA 5K03A 1Z5NA 5LC1A 1K8RA 3L92A 2OAEA 3PTAA 1JQDA 1IU6A 1US8A 1WZCA 2NQ8A 3KAPA 4O8CA 1NDQA 1XN1A 1GPAA 1X9GA 1JHPA 3VOTA 2W5UA 2IHKA 3I1YA 1U7UA 3OZFA 1ZM4A 3REFA 3W8NA 4MRAA 3DFUA 4U0KA 3W6NA 4DA8A 4FNAA 4DJAA 2CXSA 1UAGA 2B69A 3UMCA 1PTKA 2EF0A 2HEIA 5E1DA 5AVYA 1MA0A 1IPEA 3DOUA 1EJ0A 1GA6A 5FHRA 3UJ7A 1QHYA 3V8EA 1X1BA 3DE3X 1FDUA 2XRMA 2GD6A 2QVBA 2OR3A 2JVJA 2AC7A 2V98A 3NIBA 4KWCA 5DCWA 3TFOA 1CC1S 4JV5B 2NZWA 3EA0A 4EABA 2Q7XA 5IY0A 2NU6A 2Y1GA 1WF6A 3ZJ5A 4Y7NL 1M83A 1OTYA 1DPGA 2ZROA 3BEOA 2VSNA 1FFAA 3ZK8A 4CTMA 3BVPA 2VWQA 2CDCA 1O6CA 1N8NA 2HLNA 3GTJL 2AOTA 2GQ0A 1IIRA 2L2QA 2NSDA 4KW7A 4NU8X 1HE2A 5FORA 4XYGA 4ZVMA 1VB3A 1AZTA 4YMTA 3R0XA 4TSFA 4PBSA 2OBYA 4OX9B 1CERA 4YRJA 3ANNA 3NHKA 4A10A 1C5KA 3ED5A 3ER8A 2J3EA 4MMXB 2AOUA 3UZUA 3PNBA 3PXBA 4AI1A 1K83L 2R87A 5CUQA 2HT6A 3OC6A 4ZT5A 1EG7A 2BSAA 3LXUX 4DJDC 3SWWA 2OCAA 4ABTA 2HA4A 2HMYB 4UQLA 2QK4A 3V7NA 2GEVA 2FSFA 1VQ1A 2WT4A 2XUFA 4L7VA 4RKEA 1KK0A 1VP3A 4NJMB 4ZCPA 4BKOA 4XJTA 2IS1A 5L51A 2AQKA 1NP6A 1OI4A 3CUYA 3LKZA 4OBBA 3GIDA 2X23A 3ZDEA 5L6LB 5C5IA 1NW6A 2AZMA 2LRHA 2OFOA 1G1AA 1LJ8A 2DU8A 3AYZB 3BZBA 4REMA 3WTCA 4B87A 4YAFA 2IU0A 3S2EA 3IOBA 1ACJA 1T5OA 5IN4A 3PWZA 1IXYA 4FLFA 4GMFA 5IDXA 4W99A 5DPMA 5LNK1 4P0PB 3G5UA 5EG5A 1ZM3A 4E6YA 1OLXA 3P9IA 4PSVA 5K0SA 1SQSA 5BUSA 1DCTA 2WG1A 3WGOA 1Y5NA 4KQMA 3F6SA 3E53A 3LQ2A 1J22A 1DRKA 3H65A 4KFRA 5CPBA 5AUQA 3MMZA 1XTVA 3E03A 1LQUA 1DX6A 4HQOA 4TYWA 5ES4B 1U5BB 1VXRA 1Z4QA 4PF1A 4URHA 3I2YX 5FJ8L 4Z1MD 2VZ0A 1MLDA 3KYDA 5I9MA 3WG9A 4C20A 1XC7A 4LZLA 1UPFA 3UGQA 3I5MA 2WAAA 4BB9A 2O14A 2JIPA 1J0CA 3EVNA 4FEYA 3B6MA 4LTMA 3NFYA 2IODA 5EZYB 5A4DA 3QFRA 5A7GA 3V6LA 1QDUA 3BGVA 3W77A 2IKQA 3KV3O 2QMOA 3GDOA 3F3MA 4IGEA 4JKOA 3B60A 4WVFA 4X7PA 4PZZA 3SFTA 2IYQA 3O7WA 1S2DA 5DTIA 4DR7B 1X7GA 5HFNA 1EIZA 4LPSA 4OMDA 5DCUA 4MVJF 5AHOA 5JVDB 3UYLA 3V8VA 3UKJA 2YJ4A 4K2AA 2XRFA 4Z51A 1UMCB 3LHSA 3W5CA 3SMVA 1N3YA 3SDBA 2IDKA 3C8HA 1ZI9A 3PYXA 3CF6R 3M6MD 3RK4A 5JD6A 4DV3B 3BSYA 5KCMA 4Z2YA 5BYBA 2HJSA 4B44A 3A2KA 4PGAA 4XYBA 1G3MA 3NYIA 1PZFA 1Z0DA 2G7ZA 3PT5A 3UANA 3LUKA 4YRTA 2C78A 3KEMA 4WKGA 1I1HA 1TW3A 1PR9A 5AOBA 4X3CA 4JYBA 4RACA 1F4VA 3OTIA 5KSOA 2GSDA 2HA0A 1GNVA 3K0KA 4LX8A 2A9QA 1DOAA 2XUGA 3TM5A 1MZPA 3TF5A 1MO3A 3WBBA 1IJBA 1PZXA 4QD3A 2JCGA 3JALA 1XXHB 3AFGA 1M0SA 1I1QB 4CIYA 1PQ4A 3BFPA 4N0MA 4BBZA 5HWSA 1UKCA 3H3VM 2XMGA 3U1BA 1R9TL 2R4QA 3PRHA 2HF2A 1OWLA 2R751 3LPNA 2B98A 1J9EA 2ID4A 1OAKA 3C3AA 1P31A 2GK3A 4R6WA 4XX1A 1AIPA 1N9GA 2XYRA 3KSBC 4B3SB 4GKJB 1XHFA 3IV9A 2ZJ1A 1GGMA 2QGNA 2VI5A 3OCXA 4FW9A 4KPGA 3MQKB 1GA1A 1OTHA 1PT9A 1TEHA 4N8DA 1OB2A 2FWJA 4DG9A 3PHGA 3ZJVA 4XPIB 5E3IA 3FJOA 2C7QA 4M89A 2G67A 3ORYA 1Z6QA 3EYAA 1E3EA 3QVJA 3BF8A 1VPEA 5FO1A 2ZM6B 4B75A 1JFTA 3RB8A 2VP6A 4DV4B 3AOEA 3GFSA 1E6EA 1U9IA 2PPTA 1ZJ5A 2L42A 1CRQA 4Q3NA 1U0JA 4CM3A 4Z4CA 1HDOA 2DP4E 5E9QA 1HSZA 5HIAA 4HEQA 5CVVA 1MV5A 4NX2A 5ALTA 4AZSA 3JATB 2XVZA 4P08A 3O8DA 4TKUB 5KNDH 4FYKA 4JD5A 4CUKA 5M3BA 1FPQA 2GPTA 3ETGA 3VR5A 2BFMA 2RGGA 1T6BY 1G3UA 5KDOA 2H2IA 2PBZA 4CCWA 2ISQA 4D57A 1S2OA 4OK5A 1ODJA 3FYCA 5JAPA 1Z73A 3MERA 2UXDB 3Q40A 5H3CA 1ORHA 1P0FA 1CJKC 4UBNA 1RZRD 1U02A 4IUCS 2WWRA 4L4ZA 1PNOA 2Q6OA 3VC7A 2ZDGA 3C3EA 2FSSA 1P1BA 4ID9A 3SYTA 3R3XA 4F3NA 4BY7L 2UYGA 5DGIA 5DH9A 2YYAA 5LMZA 5KPDA 1M0EA 5BWOA 4U7GA 4PTLA 1UK8A 2V8OA 1U0LA 1V1RB 1CUAA 3EIQA 3GY0A 3VPHA 4DZTA 4D9GA 2H7CA 2XWJI 4AICA 2MSDB 1ISPA 3HJAA 1M7BA 4E51A 2IU4A 5GAGc 2EDCA 3FIUA 4F97A 1U4OA 2Q6KA 4MLDA 4DHWA 2YQZA 1GUDA 4QQKA 4B09A 1A1VA 1Z4KA 4PLYA 2DH6A 1LI5A 4R01A 2J3JA 4NWIA 5DNCA 2DKNA 2XKJE 3KPVA 4D6YA 3W5BA 2DUWA 2ZJ0A 4QPCA 1K75A 1E59A 1YL6A 2R68A 1E62A 3FDZB 4QJBA 3HR7A 1EJBA 1MP0A 1XAJA 4FINA 1IN4A 4MUGA 1JR3E 3HVKA 4ZTBA 2RD2A 4WZ6A 1ZMTA 4IIGA 2RK4A 1VLLA 4CRWB 1GKKA 1NXXA 1PRYA 1A27A 3BC1A 2V5UA 3GCWA 2B8WA 1A82A 3VR6D 4BNFA 4CMEA 4EKNB 5BN4A 4UDOA 1Z5ZA 4X71A 4FQ7A 4LHSA 1FFEA 3PP8A 2O8DB 1Q16A 3OWHA 3RVOA 4PLHA 2GD0A 2UZ3A 2HCJB 1YNSA 4DARA 5IDQA 1I5OA 2ZUSA 4NFLA 3WAGA 4E5UA 3SKVA 3FZQA 1SO8A 3NDJA 2AYZA 2V97A 4PIVA 2VTBA 3H1GA 4L8FA 1NTOA 2PH3A 5CURA 1CFJA 4PYNA 1QJ4A 4MGEA 1YU9A 4JVLA 1A1SA 1O9GA 1YVRA 2B4KA 2XDQB 3EQ9A 4O4LB 4GXTA 5CG1A 5HVNA 1H1LA 1WETA 4OBEA 1OFVA 1YQEA 4ZN3B 1TMGE 2WMNB 4WACA 1G6OA 1TF2A 4LI0A 4FP9A 4AR5A 2PS1A 4J7UA 1XQ9A 5JWHA 4BFXA 4FFNA 3ZUGA 5DM61 3PC8C 4IO1A 1D7AA 3MWGA 1LKPA 3NETA 5IYDL 5IP7L 3L7DA 1NF9A 2QQ0A 5KNDA 4XD7D 5HKAA 5JH7F 3N3BC 1N7HA 2VL6A 1FS6A 2DSXA 2J4FA 4QVKA 4YAJA 4OEHA 3FZGA 5H9WA 4DWOA 1E60A 2HJRA 5FADA 2DUUA 3FTCA 2FJUA 2HHJA 1IHXA 2CZQA 1YQUA 1G20A 3VNBA 4UNPA 2IZZA 3KR0A 3TSYA 4RO0A 4DKJA 4QULA 1SC3A 2PRSA 4XD2A 1XTUA 5L3SB 1JDSA 3L1HA 1K7YA 4BWVA 4PS0A 1S3FA 2PH7A 2YZNA 4JHLA 1EFCA 4RVFA 5EVJA 3SF8B 4WRRA 1KPHA 3EIXA 4A8HA 3A10A 5LQAA 3CEJA 3GEHA 1ZH8A 2XA2A 2ACWA 2R25B 3A2MA 2DQYA 4LNAA 3QQCE 8ADHA 5CBKA 3CONA 1NGSA 5I9NA 4BB6A 7ABPA 3M1AA 3WP0A 1NXTA 4A91A 5K6AA 3QFTA 5IC5A 1D4AA 4TS9A 2OBXA 1XZHA 5ALUA 3UJDA 2IYWA 1MVOA 1RR6A 3KCNA 2AS0A 3A1CA 4ZXFA 5HQ3B 13PKA 3S7TA 4BO2A 5BW4A 2APOB 4MLZA 3KOUA 2GZ3A 4FIDA 2I3BA 4JX9A 3ZCQA 4BFVA 4C4XA 5FL3A 3LH5A 5HOQA 4D25A 4XVRA 2XBUA 3RSCA 1QO7A 2D1FA 2YL2A 3HYNA 5D85A 1JT9A 3E9YA 1E1QD 3Q10A 5EJ2A 4BGVA 4ZVLA 1A71A 2O52A 4KUEA 5FBVB 2VJPA 1M1XB 3LTEA 3MN1A 4S0ZA 4TXJA 4A3JL 3TIGA 1KSGA 4AX4A 1ZN9A 2G6BA 3PLNA 4KXLA 5B6JA 1PQWA 5K5EA 3VO1A 4UAUA 3KYXA 1X1DA 3EPRA 1NKSA 4BNJA 2Q5CA 3MT7A 4GKVA 4YN3A 5A3RA 4AJIA 2BEJA 1VZHA 4NATA 1OY1A 4NNPA 4EJSC 4FMDB 3FKSA 2IKSA 4I1UA 3QPWA 2D8MA 1UMBB 3NOVA 3R1IA 4WBXC 2FJPA 2LD4A 4WY5A 4CKXA 5C1BA 3JVIA 3HKDA 4QHTA 2DR0A 4LZAA 2Q3DA 2W2TA 3DVAA 4FZJA 4POGA 2AN3A 2BE7A 1EM8A 4DEVA 2HNKA 5A6SA 4C5BA 3KKEA 5JJCA 4D9IA 3RS2A 5JMOA 3OTWA 2A9RA 4CTNA 2ZBPA 1Y1LA 2IPNA 4JR0A 1NQOA 3V1LA 4HEA6 1VJRA 1BGWA 1JLLB 1ULAA 1U2DC 2QN3A 5THKA 3CVVA 4EG7A 2GEJA 5U4XA 3MXOA 2QL7A 3QU9A 4WFQA 4NQZA 3SDZA 1MEOA 3O38A 4BGUA 4XIYA 5A5VA 2B99A 3C70A 2ZETA 4NFYA 5DNVA 3MTEA 2WD7A 1P9WA 5C44L 4AYXA 4COKA 5DLEA 1I7SB 3WK7A 5FUQA 2W8BA 5ANRB 1T4CB 3MWFA 1MEEA 3VH1A 4J1NA 3MJRA 3RREA 2G9QA 1JHVA 4W6ZA 5EJMA 3OX3A 4PN7A 3C3YA 2H08A 3BXZA 2HAEA 4BBJA 4BJHB 5KINB 1UOQA 3ZDZB 1NMXA 5DRYA 3CJTA 1UT5A 2NTJA 2WHPB 2V1XA 3KB6A 3ILSA 3KFVA 5TEWA 4AG5A 3IIIA 4E5YA 1BFKA 1HE3A 2CKMA 1X7YA 2AFVA 3M0EA 2FWRA 1COZA 4E5DA 5ITZA 3C39A 3OKFA 2HSDA 3OQ6A 1IE3A 1IHYA 2Q4DA 2BEUB 1T8TA 4J0HA 4EA7A 4C0JA 4RK7A 2W71A 1PD1A 4PYIA 4DCOA 5LQRA 2YZ2A 1YZUA 4G67A 5EXEA 4TLCA 5IBPA 5DBHX 4ZCMA 3RSHA 3N28A 2ZBVA 1OIWA 4PX3A 1L5OA 1NBAA 1DKOA 3LBNA 4IZHA 1CJCA 4PX2A 2YFKA 5SICE 5TMEA 3ZVLA 2HYIC 1QFSA 3M6WA 3V1MA 2FN3A 5DMXA 3VC1A 1X9HA 3V8BA 3H1AA 1QG6A 3I4LA 4BKRA 4QJ3A 1BG6A 2NU7B 2AN4A 2GPWA 1R4MA 4I2VA 3S1ML 2VYQA 4PTZA 3RGWS 2HWUA 4EJ0A 3N59A 1Q7BA 3OQIA 2Y2UA 4TN1A 3ZXYA 2JI3A 2XJUA 1VXOA 5HM6A 2H5EA 3PIP1 2IRWA 7GPBA 4NONA 2JHGA 1WKCA 1ZNZA 3A04A 2XA1A 1F60A 3FPEA 4HMPA 2HZBA 2P91A 4N7MA 5TR9A 2QVXX 3GFBA 3QEOA 3QPVA 5ESWA 2Z5GA 3NAMA 2CLIB 1I2ZA 1Z45A 2OHHA 2B2XA 2QVLA 4GBGA 1THMA 3JAKB 4GNKA 1JXOA 2A92A 2JZCA 1N2JA 3UFBA 1AA9A 4GO1A 2VJBA 3DC7A 1OFGA 2IYFA 3IBGA 2Q2OA 1B43A 1I80A 1UPAA 3KD3A 2W58A 2GPAA 3OIGA 5BUZA 2UU9B 1LXCA 4TUYA 2L69A 5E9JA 2PQ2A 5CX1B 1QSGA 1NSYA 3MQ2A 4WBSA 4MEJA 2OBFA 1JXAA 3RTBA 4Q18A 9MHTA 2JA2A 1VJCA 4HH4A 1C3OB 4YWHA 1GAJA 3M6IA 3F3SA 4C1BA 4C0XA 2QVZX 1W0JA 1WTAA 4OQ4A 4AR6A 5JARA 1CDDA 3PGLA 3SI7A 4DV0B 1E8NA 3KTAA 3P2OA 2H12A 2P5UA 4Q21A 1FX0A 3PYMA 4HNSA 3GJYA 4MGKR 1CF9A 2E2IL 3NBFA 1B6GA 2A9KA 4DHEA 2J30A 3U49A 4A2WA 5B3LA 4ZRNA 2VWGA 2UUAB 2AHOA 2ZWIA 3K4QA 3UJCA 4EPXA 1AC5A 4QPPA 1XZDA 4EMTA 1WXFA 4G1UC 4Q66C 2PH1A 5ALNA 1KO7A 2JS7A 3H97A 3NBAA 3I1IA 1YBFA 4F3TA 4BNLA 1VJ0A 2YJNA 3ZDQA 5CDHA 3T7IA 1ZVQA 4L5AA 1VZGA 4KVZA 4DA4A 2D0PB 3DE0X 4GPD1 4MMYB 1L8XA 1SVWA 1PQUA 3FMVA 3R3WA 4PBRA 4PN3A 2A0KA 2QTBA 4OYRA 4X90A 1RWNA 3UUEA 5L45A 4G36A 5EHIA 3KYCB 4MQFA 3LYUA 1U2DA 4YMSA 2X9GA 4XQ0A 5FI1B 2TMDA 1K6JA 4ODIA 3ZKWB 2FGJA 4CM4A 5LXTA 4UCXA 2REQA 5TEVA 3UPTA 2A4KA 1YVEI 1F6WA 1N2ZA 1Q0PA 4AMZA 2PX8A 1A9OA 3A28A 2FOIA 3EVGA 4II3A 2DB3A 1N1GA 5HXAA 2VWHA 3D1JA 2ERXA 4BVGA 1H0KA 5FFNA 1Y7IA 5H81A 3RZ6A 1MDFA 3DLAA 4O5AA 4RYLA 5B4TA 5GINE 2ILVA 1ZK4A 2J0UB 2C4HA 2QLMA 3KVNA 4TWAA 2NU8A 4M22A 2H0RA 1RM0A 2ZI7A 4YT2A 1KAGA 1KIAA 2YN2A 3OFKA 4LRUA 4P3XA 4WJKB 4LF7B 3T1VA 4UVEA 3OMLA 1RMTA 4EX6A 1W1WA 4I9FA 3EX7C 1OKKA 1G8SA 5GOTA 4D3FA 2PX5A 1Z6GA 2PRKA 3LE8A 1Y9ZA 5I9TA 4BO0A 5IT0A 3NTVA 3TRIA 4PZAA 1V8OA 2H06A 1NF3A 1O6BA 3N9IA 1CUCA 1OBHA 4BNXA 3TL2A 1ODLA 2ARKA 3F5MA 3PGA1 5JW6A 3DE7X 1Z83A 3X1DA 3DOJA 2Q6IA 3VR4H 1AHIA 1G3RA 1RC1A 2BBOA 3OJCA 3DL0A 1A9ZA 2ZBEA 1EZ1A 1E0KA 1R0KA 4IDCA 4ZOQI 4TYNA 1PFVA 1MO5A 4NAUA 4K9MA 2D6FA 3UAGA 1JKJB 1U4SA 2OVFA 1NQAO 3N8IA 3X0DA 4BEBA 4PY2A 4PNEA 4A15A 3RH0A 4TWBA 4C2M1 1GDTA 2GZDA 3NT4A 4PXYA 3WGIA 5C7OO 4ZQGA 1Y6RA 3FVWA 3AM1A 3S2FA 3HBMA 1RYMA 4MEAA 1X2EA 2XOEA 2XH8A 1G41A 3PHBE 4LZZA 3I4ML 4RXTA 2DXIA 2GCNA 2NUPB 4LZPA 1RJ9B 3RHFA 3C45A 4RQAA 4DQKA 5CM9C 4CLRB 3EZLA 2GHIA 5FPHA 2FP4B 5FTKA 1J7JA 4B85A 2QAJA 2PQ6A 3K05A 4XCQA 2WIDA 3I30X 4KAXA 2C2MA 1BEEA 5LLSA 1QFXA 2SBTA 5JAHA 4AQYB 4BDSA 5C8XA 3KR9A 2Q2NA 3MWYW 3QKTA 5DBIA 2UUBB 3JD4A 1B2JA 2KJQA 3L7MA 2EFDB 4RHUA 1HETA 1X1RA 2FLKA 1FK8A 4AN1A 1LPBB 2HCFA 4FFPA 3MS4A 4JOCA 2R4TA 1KOFA 1BEUB 4LMRA 3U81A 2FDCA 2UXCB 4XH9B 4DEYA 3BQ9A 1A9XA 1NBEA 1YC5A 1A98A 5BSMA 4RZSA 3CUWA 1VMIA 1AF7A 4IUDS 2EP7A 5G40A 3H1BA 2FRXA 2ZYRA 3AY0A 4ZU1X 3UAOA 2J5KA 4YAWA 3P0RA 5CB8A 2F2TA 3JALB 4BX9A 3JVUA 4XE5A 2QLBA 3QMMA 1MO4A 3DDCA 4RX1A 2HQOA 1NHWA 5CCXA 2X1VA 2OLKA 2VRWA 4MXDA 5HFAA 3SQWA 3AF2A 2CYBA 2EGGA 3UH1A 5BRAA 3EBLA 1EU1A 1ND5A 2GXAA 3GEBA 2E4VA 3P7MA 2WSYB 1SOWA 5BYKA 3VZCA 3PR2B 4HCJA 4EBBA 1OBOA 4WXRA 3KYCA 4MQFB 1MENA 2CXUA 1UADA 1P3DA 4GC5A 3NHRA 1KNXA 1Y7HA 2TECE 3E1GA 2QRGA 3B9PA 1XCOA 4QBFA 4WNIA 3R7BA 3DXFA 3FPKA 1Z63A 3FVVA 4M2LA 2Z08A 3WMGA 1EUDA 1RAFA 1QF9A 5ARBA 3W2GA 4DBVO 2DFLA 3L49A 2A2ZA 2X5OA 3P26A 4EMUA 3PJGA 1KZYC 2V96A 2KBEA 1P7WA 1W30A 3MJFA 4JVOA 1RYBA 1ESEA 2XMBA 1ZHHA 2HF8A 1PEAA 3GZNA 4KO1S 5DYYA 4OK6A 4BJ1A 4DCNA 3O4VA 3RC1A 4YAOA 2P7IA 4LV8B 1E6MA 4C89A 1O95C 5AI8A 4EDFA 1HPLA 1QH9A 3PL5A 1WNFA 4RDXA 5LP6F 4IDOA 3KTAB 4QEDA 1N0HA 1XF1A 4BMXA 1NYLA 4F3CA 2DFNA 3LW7A 3L41A 4PSKA 2ZIXA 2IYEA 3UCEA 1FIUA 3OPXA 3O8BA 5ENDA 5KKNB 1VCNA 3ABZA 3GJRA 4U1RA 4GSYA 1KMQA 3SQNA 3ASZA 1SZCA 4Y18A 2PZFA 1OI7A 3WLFA 3GR6A 2Q6VA 3H3JA 1R0SA 4HEA1 4QT4A 4MQBA 4WV3A 2O8FB 2QYHA 1HLFA 1IJEA 5TC4A 3E5RA 3L43A 2DH5A 3RWMB 1I6LA 1VMEA 3CZPA 2C00A 4Y6GB 3OTOB 1F2VA 1I3QL 1KR2A 1T8SA 1TKBA 2DFTA 2DPLA 2G9VA 3IV7A 3JCZA 4KUHA 1TT7A 2UVDA 4TV8B 2JLYA 4OQNA 3WYEA 3HOUL 4BAGA 5I7HA 3TI9A 5DV9A 5CCBA 2AXPA 1C2YA 5DSZA 3AERB 3E22B 1T2VA 4NQRA