3ZG6A

The novel de-long chain fatty acid function of human sirt6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
MNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sirt6 Regulates Tnf-Alpha Secretion Through Hydrolysis of Long-Chain Fatty Acyl Lysine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-6
total genus 98
structure length 294
sequence length 294
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3zg6A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3zg6A01
5FYQA 2NYRA 2Q5QA 4GPEA 4L2IA 3PKJA 4K9NA 4KXQA 4UTXA 1PVDA 2JI8A 1OZGA 2Q5OA 1ZPDA 1XLTC 2VK4A 3CLSD 4X3OA 2IHUA 4TWJA 4JUFA 1OZHA 2JI6A 5DGTA 1M2HA 2EZ8A 3EYAA 4G1CA 4JU9A 4UUAA 1V5GA 2V3WA 1OVMA 1EFVA 4IF6A 4K9KA 4QPZA 4V1CB 1S7GA 2Q29A 4F4UA 1NM5C 1UPCA 2FWNA 4O8ZA 2FRDC 2Q28A 3EY9A 4RMJA 3GLUA 5EJ4A 1YHYA 1HZZC 1YC2A 3E9YA 4K9OA 2JI7A 1T9DA 4JUAA 4ZP1A 3CLTD 5EJ8A 1Q14A 4MPRA 2QQGA 1YI1A 2Q5LA 4X3PA 4IAOA 3FZNA 4JT8A 2FR8C 3GLTA 3U3DA 2AG0A 3IAEA 3U31A 2VK8A 4UU8A 2W93A 4UTVA 2X7JA 1YHZA 2OORC 1M2NA 1MA3A 5BWNA 2EZ4A 5K2OA 1Q6ZA 2BRUC 2DJIA 2JIBA 4Y6OA 4BVFA 4JUDX 3HWWA 4RJIA 3CF4G 4RMGA 3RIGA 1YTLA 3ZGOA 3ZGVA 1PYDA 4BN5A 4V1CA 1QPBA 1V5FA 1SZDA 2H2GA 2A1UA 2AG1A 1YC5A 2EZTA 2H59A 4BN4A 4BUZA 5EJ6A 2OD7A 5EJ9A 3PDHA 4GM0A 5FEMA 4BV3A 3ZG6A 4ZZIA 3D7KA 2OO5C 1PI3A 5BWOA 4IG9A 4D5GA 5K6TA 5K3SA 1M2JA 4I5IA 4Y6LA 1BFDA 4JU8A 5DEIA 4BVHA 4GM4A 4MPPA 2EZUA 4UTZA 4D5EA 3JR3A 3JWPA 4J1TC 2H2FA 2HJHA 2NXWA 5EJAA 2Q27A 4UTNA 1YBHA 1U2DC 1N0HA 2UZ1B 1POWA 3LQ1A 4COKA 1YI0A 4L3OA 1U2GC 1DJLA 2PGOA 2IHTA 1U28C 1JSCA 2WVAA 4J16C 1UPBA 2QQFA 3RIYA 2Q5JA 3FSJX 4C7BA 2WVHA 4TWIA 2C31A 2VJYA 1SZCA 3GLSA 2WVGA 5MF6A 4FEGA 2H4FA 4FZ3A 4MQ5A 4V1CI 1MCZA 4MPJA 4RJJA 1T9CA 4Y6QA 2A1TR 3GLRA 2JI9A 1S5PA 4UUBA 1ICIA 1PNQA 1U31A 2H4JA 4UTRA 4F56A 1Q1AA 4MZXA 5MGNA 1PTJC 1V5EA 2EZ9A 2IHVA 2OD2A 3HWX1 4JSRA 4BVBA 4K9QA 4K9MA 1YNOA 4BVEA 3F6EX 4Q9DA 5K6RA 2PANA 4KGDA 1UPAA 1D4OA 2FN3A 2VK1A 4GM1A 2JLAA 1PT9A 2B4YA 4FVTA 3CLRD 4QELA 3PKIA 1PO7A 4HD8A 4JT9A 3EA4A 4K9PA 1T9AA 1OZFA 1POXA 2FSVC 1PNOA 2UZ1A 3IAFA 3K35A 4FEEA 5MFPA 4KPUA 5EJMA 5IMSA 1T9BA 4RMIA 5EJ7A 5EJ5A 2JLCA 5MFZA 2H2DA 5AHKA 1O96B 4GG1A 4GP9A 4C78A 1Z8NA 4BV2A 2PGNA 2VBFA 5BWLA 2H2IA 1M2KA 2OD9A 4JD5A 4R8MA 1O97D 3F6BX 3FLMA 1J8FA 1Y9DA 4RJKA 4RMHA 1Q17A 2VBIA 3CLUD 3D81A 4UU7A 4JUBA 5D7NA 3OE1A 1M2GA 2VBGA 4BVGA 4K9LA 4JUCA 4QQ8A 1EFPA 2H2HA 1E3TA 2H4HA 3D4BA 4HDAA 5DGDA
chains in the Genus database with same CATH superfamily
4DIOA 2IHBA 5AJUA 1JMYA 1FDOA 4C0HA 1OZGA 4M0CA 3ZH2A 4D4KA 4X3OA 2PZLA 3RFTA 4UNNA 1Z5OA 3SXUB 3AT1A 2RBKA 4JBGA 1MC8A 5P8WA 4HT3B 3ENNA 2XRYA 2NVYL 4L6IA 3K71B 2W48A 3EA0A 2HJSA 1XOIA 1H69A 3T6KA 3GEIA 3GQBA 4EA9A 2FRDC 1TUGA 1A82A 1LCIA 3F90A 3I30X 3WHPA 3TLCA 2VT2A 3MLAA 5JD6A 4W7HA 2V5AA 3WIUA 3CUTA 5E1BA 2BFPA 5KZMB 4QWMA 2QRLA 3KQPA 4ZP1A 4LJLA 2GTIA 3ORYA 1LK0A 1L7RA 1V71A 3CLHA 3OAAD 5EJFA 3GVXA 1JNYA 1WCXA 3HLKA 3OBBA 4YK7A 2NUPB 2GASA 3I9V6 2D1FA 2GFIA 5PNTA 1IHXA 3P2MA 2JB9A 3OJ0A 2P75A 3JVUA 2Q2WA 5DN6A 3C6QA 1GNSA 5AVRA 4N6GA 4L27A 2OVFA 3C3YA 3EAGA 3I9KA 4OOFA 4V0LA 3S0JA 3WGKA 5I7RA 1Z39A 4KPYA 5A0VA 3L6BA 3A6JA 2PJDA 4CI9A 5B7PA 2ZTMA 4KE7A 4F9GA 1EFVB 1IBSA 4R6XA 4JK3A 4DCVA 1B76A 5FWYB 2QNIA 2VP9A 4RK1A 5BWMA 2OY0A 2QUKA 3SHQA 3OF3A 1VB5A 4HWPA 1NVFA 3S8EA 5KWJA 2QX9A 5E8JA 2W6MA 1QS0A 4P3PA 1P80A 1U2GC 2I67A 3PGA1 2EVWX 1CUFA 3JWGA 4KAAA 1V1RB 4D4GA 5AW4A 3CG4A 5JQGB 3VDNB 3ODGA 5BSEA 4XDHA 5LWHA 1GZ3A 1Z0UA 1D2AA 4L4YA 1T2NA 2QUJA 4WQMA 2Q49A 4HEA6 4FB4A 4NMLA 3WOVA 2B5OA 3IT0A 3W8DA 2BJVA 5ICSA 3TXXA 5JPDA 4ZDWA 3H2IA 4HAUA 2ZYUX 1A8PA 1MV8A 3RZTA 1ORIA 4PYOA 5AW9A 2WQ6A 1IUPA 1NNLA 2QIPA 2G1KA 4NBWA 3D6HA 1YL7A 3RIHA 2Z1MA 3T9DA 3UOWA 4HUQA 3HMQA 1V39A 1R1DA 2OHGA 2G71A 3GMDA 3JALA 3T9AA 5LXTA 1DKUA 3LT0A 5DX0A 3DO8A 1J24A 1TZBA 4RL4A 1UC5B 2YZNA 4MB0A 3EVFA 4WE3A 3CBQA 3EOAI 3GTPL 1MXFA 2QP3A 4NJEB 1NX9A 4PE5B 5IAAA 3S28A 1DZ3A 2B8JA 3FJOA 4FDAA 5EJ5A 4UM9D 4UHKA 3A6FA 5DBEX 1ZJZA 5KREA 3HA2A 5JMPA 1IZ8A 1N2HA 3MYRA 4UASA 5KOHA 2M32A 2PBZA 5LLDA 5DFAA 2OV2A 4D43A 4WLVA 3P96A 3W05A 3GF4A 2J9GA 3AETA 5FUVA 5A2GA 1SK9A 4KJXA 2FMTA 1DIRA 1ECJA 3HKBA 3OA0A 3RS8A 3ZHRA 1JHAA 1RM0A 4KRXA 1KJJA 1U2PA 1HX7A 3D4BA 4RVDA 2PKYX 3HBFA 4Q01A 2CFTA 2ODNA 1VPDA 4M0DA 1U3WA 1E3SA 4FNAA 2M6LA 1LX7A 4YMLA 1L3CA 5G0SA 2OE2A 4KR3A 4I6GA 1PDWA 4AR4A 1XAJA 4Y9RA 5M2QA 3T3GA 3EYAA 2GM3A 5CYOA 1DWQA 3R7DA 4JYAB 5JXJA 1YIAA 4MB2A 3DOEA 1UDBA 3ES9A 3H9UA 5CT8A 2D3TA 3L92A 2G6TA 1MAWA 1Z16A 3C3KA 4TS4A 1FX0A 2FLKA 5CW2A 4D2IA 3KWFA 1GU1A 1PE0A 4D79A 2PXAA 1EFUA 4PPNA 1KAQA 1RKQA 3ZVLA 3NDBB 2CL7X 1CF9A 1E1DA 2DBYA 4Q39A 1IY1A 4YH1A 1IBCA 4O2LA 3GRYA 5IKPA 2VUHB 1CJKC 1ZOIA 4EW1A 3OO1A 1YZTA 1GRNA 5FOWA 1F14A 4IDGA 3I32A 3CUUA 4D9KA 4Q4DA 3PA8A 1NX6A 1QE0A 5AI0A 2X1MA 4KR6A 4TT3D 4MV5A 3STVA 4YDQA 3IB6A 1GARA 1YBAA 4M76B 1NP6A 2GPAA 2IXTA 2JCVA 2NZWA 4XQ0A 5F73A 1EFAA 3W90A 3IQHX 1EVEA 3GCDA 4PNPA 4NHOA 1VPEA 1U3FA 3M34A 4A73A 1C3JA 2AQHA 4P9NA 1TZKA 4UM5A 2WD7B 4XKJA 4XUEA 3JQEA 1EG7A 3HLYA 3DE7X 3TPZA 3PGKA 5AKYA 4Q1FA 3LVFO 2VZ9A 4TSRA 3JATB 4I81A 3MJVA 1ODLA 4PWZA 4K6HA 2IJGX 4ZV7A 5ICEA 2Z95A 5LOVF 4JP5A 3SR3A 2BAGA 3IUSA 4EKEA 1Z13A 3DFZA 4E1VA 4N7JA 1J5EB 4JSYA 4O4LB 2GO7A 3DTVA 3R44A 4IQFA 1T0JB 4C3HL 1U28C 3Q2OA 1IU9A 2C84A 2GHIA 2QA5A 4QWWA 5A5FA 2PPTA 1MX3A 4ZC8A 3VU9B 3IPRA 3KSAC 1DKOA 4DBLE 3HO1A 6RXNA 3PFFA 4YJKA 4ZTBA 4XDYA 1PJRA 2ECFA 2H00A 1RKUA 2OFWA 3P9CA 4EENA 2O8EB 4AMVA 4WNAA 1L5RA 3M3YL 4IH1A 4OXYA 3CHYA 2V7XA 1V0JA 4F1JA 3DFMA 3N6VA 4F21A 1D9ZA 3GUUA 4Q7QA 4QUIA 5FUQA 3OF5A 4WDRA 4CM8B 1RYHA 5CRIA 4DC0A 4RV4A 5BN1A 3HA7A 3E6AA 4QM6A 2FKAA 4DYDA 1N1MA 1Y80A 3AR4A 3J7TA 4RQBA 2G06A 1UPAA 3MRSA 4G07A 2XWSA 1MORA 3RYTC 3EA5A 3WWEA 1EFKA 1GEGA 2I54A 3CLRD 3MYYA 5EJEA 5I7WA 2CJFA 1WE2A 3IP6A 2WSMA 2HSWA 4RELA 2V4ZA 1GNPA 5G0VA 4NJEA 1I7PA 5GJCA 5L95A 4IDEA 2NZUG 3UFBA 2QRZA 1C7FA 4H6XA 3DB1A 3HCBA 5IHXA 4WESB 4JXXA 2O0JA 5F1YA 5IBPA 4YLEA 2I99A 1QU3A 2DC1A 2O14A 1NKVA 5CR9A 3FCAA 2O2HA 1P0QA 1M2KA 4H31A 3HB0A 3ANXA 3DCJA 3G5MA 4NRDA 3E70C 4IILA 5AK0A 1CQZA 4YA6A 2XEXA 4CRWB 2HY7A 3PTZA 4IS3A 4UZSA 3D43A 4R05A 4A6XA 4TTJA 1ZXXA 2P4HX 4KQKA 2HXGA 1VPWA 5LXTB 2GZHA 4ZU1X 3A31A 4OQLA 5K3EA 2LBPA 3HCNA 3PKJA 1HWYA 1NV8A 2IUSA 3H4VA 4PAWA 4TS3A 2UYHA 3S1SA 4FD2A 1XEWY 4L74A 1NPDA 2FPGA 1KA9H 2B5VA 1O95A 3NTVA 4HP8A 4RENA 3O1JC 1XRQA 1UZMA 1NTOA 3PLRA 4FKBA 4LYAA 1RRCA 4DCNA 3FKSD 3NASA 3SCZA 3T99A 4EDHA 3VI4B 5CDHA 1BFKA 1ZQ9A 5DXAA 2J3EA 4RIIA 5DWVA 2Y0CA 8RXNA 4KRGA 4Q48A 2ZQYA 3OLCX 3EIUA 5K9ZA 2BI8A 3OTQA 3TB6A 1KQFA 2GEUA 1E0KA 4IKEA 5CCBA 1F7VA 2ONKA 4GAEA 2X0KA 1JAZA 4IY1A 2RH8A 4J8PA 4W9RA 5CXUA 3V8NA 5LQSA 5KPJA 3C8MA 4IV5A 4WZBB 3H2YA 4P0PB 1I5RA 1RJWA 1AQIA 4E08A 1EA7A 2L82A 4UOQA 2BMDA 4OREX 4JWTA 3RWBA 3S2EA 3HJYB 1HUQA 2ZUSA 3NKVA 4Y1RA 3WSWA 5L53A 5H9WA 2Q4BA 4L9RA 1LLFA 4GX5A 1V5FA 2J30A 4QYTA 1HTBA 1RI3A 5E3IA 4B7XA 2RGNC 1I1QB 4HH3C 4D5GA 2BEUA 1JZTA 2AMJA 1NXTA 3OZIA 1G8JA 3KR1A 3B8HA 4ITVA 4CFSA 2V3VA 1NYQA 2WIBA 2QLJA 1IZZA 3EIEA 5KWSA 2IWHA 2YKGA 4QIHA 4WLNA 1Q0SA 1YS6A 4FE4A 5AUPB 4ETNA 2R6DA 1XRNA 3C24A 5AJWA 1I3NA 2ZUTA 3V32A 2CT8A 2PT5A 1P2TA 4CQMD 4P38A 4HLQB 1UDRA 1OI3A 4IUBS 4ETIA 1HDEA 3GRKA 1S4QA 2ZJ0A 3QX8A 1CUYA 4TRNA 2W6JA 4RYLA 3RAEC 2PYDA 3AO0B 4NX2A 1EK6A 3I64A 1CIPA 1MB3A 4AJ2A 4WK6A 1XC7A 1GWNA 1MDFA 1BMTA 5IH7A 2E4UA 4CU2A 5HILA 2WP8J 4M6WA 5C1IA 2J3JA 4F04A 3ZDAA 5EERA 4BVBA 2Z98A 3LBNA 3AUFA 4IJ5A 3DE3X 1DL5A 2IEZA 3QP9A 4HLDA 2NV2B 4G86A 3GEBA 3VVCA 1ODKA 3HG7A 1MIOB 3EVCA 5E6RB 4Z7NB 4J9VA 1COWD 4IHJA 2GRUA 2VF5X 2VAWA 4RD2A 2WDPA 4QPJC 2HV8A 4ZTUB 3T1TA 3TRIA 3A9VA 4K9PA 2WDZA 4JUIA 2RHRA 2BMVA 1ZRHA 2GN9A 3G02A 3I2YX 1DAFA 4R1PA 4HGPA 5HXAA 1K68A 1Q7EA 3JW8A 1PJ3A 1P29A 5DHRA 2OP1A 1NVVQ 2NVUA 2JD0A 1OSNA 4JP3A 5NLLA 4QOJA 3QENA 3VR3D 1NJ1A 1P6QA 4X6XA 3TW0A 2CLMB 4L7QA 2O4CA 4RGBA 4F9FA 3NPAA 3CNHA 5IXYA 5KB3A 3F6BX 3I9FA 3RV3A 3KSRA 1VSTA 1Z33A 2TMGA 3OE1A 3R5KA 1CVLA 1VMDA 1L5GB 2XMDA 2Z5FA 1NMXA 1QX3A 3IUJA 3AFMA 1KYZA 1SXHA 5TSDA 4DMKA 2YHUA 5CLGA 4UTXA 1H2XA 3P9KA 4ENVA 1CJMA 1QVRA 1TT5A 2PYZA 3WAGA 1PJBA 4ZODA 3B51X 2AE2A 5A7GA 1QHYA 2J0SA 1EKXA 4X44A 2P2CA 3Q0EA 4A3ML 1OHHD 2P2ZA 4V38A 1YR7A 1B0UA 2EOAA 1GQRA 1TYCA 5K3DA 2XXAA 5C4IA 1Z15A 1Z34A 3GELA 2XVYA 4FFVA 1ZZGA 1U8EA 3O8LA 4EABA 2X22A 1E99A 1UAAA 1MIOA 1P7VA 3L7KA 3EFBA 3FI0A 3W5BA 1DV2A 2OR3A 3K09A 1R12A 1QPZA 1GUZA 5BWBA 2Y0SP 3HVHA 1ONBA 3IX7A 3PXDA 1W5FA 3INRA 4IYRA 5FFMA 5BV8A 4OIMA 4MGHA 5JALA 1FYVA 4GU5A 2JHFA 1LXCA 1QE5A 4YNBA 3TYXA 4QUEA 1MHTA 3TLGA 4IR7A 5C8DA 3OZCA 1Q0PA 3GOHA 2OAP1 3L0OA 1CLUA 2V7QA 2VTVA 3NNNA 1Y1SA 4N0QA 4ED9A 4DG5A 2JZOA 1W96A 4LHNA 4F6CA 2QB5A 4OBEA 3UK0A 3VSCA 4E6EA 1H66A 3FHOA 3SX0A 3AKCA 1A5TA 4AMZA 2BKVA 2A0WA 4PX5A 1XQYA 1KEEA 3GH3A 2ESRA 2VWHA 4RZHA 1GR0A 3SLKA 1LLDA 5FEMA 1ZGHA 4AMUA 3I12A 5KNBA 2FR8A 2KYRA 2ZYIA 3KHSA 2IYOA 4P8RA 2DG2A 2OPHA 1CPYA 3G2LA 1GG8A 4IPTA 4LJSA 3TTWA 2AN4A 2UUCB 2PX4A 1T4BA 4CI0B 4M37A 4D5EA 4LWOA 1ZAKA 2OV4A 4QXMA 5DBOA 1FYEA 2R6AA 3CRRA 1V35A 1TJ3A 3TZLA 5HM8A 3WYEA 2CR8A 1N0IA 4MO2A 4G2TA 1ZUWA 2I6XA 2PGXA 2NU8B 2WZDA 5KSZA 2BGLA 3ZYZA 1P1FA 1MPXA 2WWGA 3NDRA 4D9GA 4LGMA 4G5FA 2SBTA 2SKEA 2REQB 3LPNA 5IVIA 2QRKA 1QF9A 5C32A 1F8XA 1Q0LA 2ORED 2FDXA 3ADOA 4XSGA 4KO4S 1A9QA 2EJUA 1R0WA 3CWQA 1SA0A 4YUVA 5HRAA 4EZEA 2NGRA 4C1BA 3P9PA 1GZ5A 4P08A 2OSBA 4MW5A 1QO9A 2XT9A 1YVEI 3RWOA 4O4JF 4CYMA 1BX1A 3ZK8A 1KH3A 2QZZA 3B3GA 5AJTA 1M8JA 2AMFA 1NQWA 3TSZA 4EB8A 2Q45A 4ER6A 1LJ8A 4AQ7A 1E2FA 5FPPA 1M74A 1ZOPA 2RI6A 2VR1A 1HORA 4H4CA 2X13A 2VKTA 4OHWA 2ZUBA 2WM9B 4MVJG 1ZHHA 5DTIA 5GVRA 2YQ4A 3OIGA 3VPAA 2R0QC 3TX6A 4CL2A 2J9RA 3L4EA 2I4NA 4YPFA 4OI1A 3MUNA 1QGUB 1E3LA 4FXOA 1BC5A 1HFKA 1WZIA 3BQ9A 4IKOA 4YBRA 1PJCA 3RPEA 4XVCA 4NYJQ 1I6WA 1E9CA 2C2OA 2RGDA 1YB4A 5TEWA 5TRTA 4DDVA 3SSMA 4PCLA 5LOVB 1XTVA 3AR2A 5KUTA 3W9BA 3O3OB 3GA7A 9LDTA 5DGXA 1IM5A 3OZRA 3ND9A 2E5LB 4CM9D 2FDCA 1GZ4A 2A9FA 3CT6A 4NV0A 5D7NA 3DHVA 5BOSA 1E9DA 4S2UA 1S7CA 1USIA 3WLFA 3OE4A 5IJ9B 2C54A 4UBKA 5EJ4A 2ERXA 1M1YB 1R8QA 1GA6A 4RXTA 1OW3B 2XKJE 4QHSA 3CLSD 1JEOA 2H12A 3VTAA 1IXSB 2XNDD 1XRMA 1OX6A 1QOPB 2VAVA 1EA5A 1QLJA 3UB2A 1DBSA 2OCKA 2Q9CA 1OWBA 4MZDA 5H3CA 1RACA 3FYTA 3V97A 2I65A 3VAYA 3DZCA 4JODA 1J4AA 5JZOA 1T9ZA 4ND6A 1K88A 5TVKA 3T5AA 1GRQA 2EFHB 3FNIA 2GFHA 2Q5HA 5F77A 2HMUA 1YHYA 1ZD3A 5IN5A 1XMIA 1Z68A 4Z0NA 3EODA 1DVRA 7REQB 5AI5A 1NOIA 1VTKA 1XTQA 1AGNA 3L43A 1YNSA 1GPDG 1XZAA 3NT2A 2ZB7A 3QYFA 5K6AC 2PGAA 1NIPA 3FGZA 1EBBA 4DTIA 1FFEA 4NPHA 2ZYRA 2O5EA 1ODFA 5AM5A 5BWNA 2FF5A 1E2NA 1V3TA 3D3WB 4MKGA 2Z08A 4AICA 3CNEA 2VL6A 1YR9A 4C6TA 5CM8B 1FFAA 4MW6A 4H0NA 4IIJA 1BCRB 1ISFA 3C5EA 5F23A 3QOXA 3WKEA 1AX9A 1U63A 1EGMB 1U99A 4DIBA 5JNRA 1O2DA 2ZITA 3WDKA 4CN9A 1GRRA 1J22A 1IROA 2RHTA 3PCXA 1IEQA 3SZUA 3TQIA 3PO2L 1KVRA 1U7OA 3SKYA 5HMLA 4OCZA 4IHQA 4OK5A 5J58A 1WMAA 1QR6A 4OQQA 1RHRA 5E7QA 4KPFC 3MTGA 2O3RA 1POWA 1IIBA 2QPTA 3NFPI 4DJ5X 5ALTA 1UC8A 3UUWA 1UBMS 3PXEA 1QZZA 4DQKA 2QV7A 2XUFA 4L4RA 2QAGA 4CKEA 2WTXA 3AQ4A 5HKBA 1C7JA 3GRVA 4GGOA 5FHQA 3UCFA 2F4NA 3U48A 4A8PA 3ER8A 3WLSA 2QJOA 1SKUA 3F8SA 5EJ2A 1RI1A 3DKPA 4N3NA 4KQWA 3ZBTA 5B2FA 4RE5A 4B44A 5HOQA 2CDBA 3OJFA 4S35A 3GTKL 1KY3A 4MTLA 2B4AA 3L0DA 1NUSA 4UTRA 4REQA 4YUYA 1XCMA 3HLTA 1NDUA 4WIAA 1UH5A 3EUWA 3GZNA 2OB2A 4CKWB 4WADA 3PB3A 2NUTA 3RVKA 3HXOA 3M1IA 1ID8A 2IBMA 3PKIA 1I2DA 2BWJA 3HN6A 1BIFA 4PRLA 4XFDA 3VMMA 4FBMA 4LYFA 1U7WA 4F5WA 2WD8A 4CR8A 3LF1A 3DEJA 1KI2A 4IVNA 1GV0A 1SBQA 4NOJA 4ANFA 4ZTZB 1QQ7A 1YR1A 1ZGGA 3OOWA 3RRMA 2AQKA 4KXVA 4XWKA 4XVQA 4LBWA 4BXOA 4MV7A 3D8SA 1KBQA 3DYBA 1FMJA 2X6TA 3LBIA 4BXXL 2EGUA 4QUJA 4C89A 5M29A 2BSQA 1ZC4A 1H8EA 3Q3CA 1DEOA 4D9MA 4DB2A 5I3ZA 3SS9X 3KQWA 1Y7PA 3K1TA 4TQUS 1IULA 4H7JA 2BUBA 1Q50A 1C1XB 2GHTA 5DB4A 4ZD6A 3R40A 4MB6A 1IHDA 3TPCA 3D8UA 4BZWA 5KJFA 2Y1WA 5EEGA 5I7OA 2OZLB 2VWQA 1W7AA 1ISPA 3CVXA 1X77A 2GM4A 1Q7GA 1U9CA 2OKGA 2GK3A 5K6AA 3R0JA 5M5BA 4YR9A 5A62A 3HGTA 3VU3A 4GOMD 3D7MA 4XJSA 5DHQA 2J3LA 2YYYA 3QELA 2OXFA 3WYGA 1XYVA 4X71A 3AHIA 3STUA 3S2DL 4R3UC 3AR9A 3C8HA 4BNLA 1TW2A 2Y1OA 4H7EA 2NXJA 3C7AA 1SC9A 3ILYA 3M8KA 4N6NA 4P58A 3GRUA 3ZE0B 4Q47A 3VPDA 5J47A 5JC8A 3M4JA 1TW3A 2DPXA 4U9UA 1DDIA 1EE1A 4I3HA 4BATA 4ZHQB 1ELOA 2G0NA 1XYGA 2OGUA 4G0YA 3COJA 1G5PA 1FLVA 3IOBA 1E2UA 5PGMA 4H6PA 1Z56C 3N2GA 2V9ZA 1O1YA 1O8CA 3DMHA 3KKNA 3OVMA 3LO8A 4GW3A 4MJ3A 4QREA 1EX7A 2PX0A 3C48A 1RKVA 2HIMA 3VR6D 3W04A 2Q3LA 5TPZA 2WKQA 3T7TA 3ZZNA 4E2XA 1K5HA 2RFKB 1ESEA 3KKLA 4G23A 4IV0A 4HPXB 4MKRA 3HGQA 2G7MC 4MS1B 2E2WA 2B30A 2OKCA 3LUJA 3NW9A 2ACEA 2WKWA 3LUCA 4I3GA 1QP7A 4XWTA 5FUMA 2CD9A 1JQJC 4YRMA 4C03A 3LKVA 1G8PA 2QQEA 1GGMA 5AUQA 1GPWB 3HWRA 4BFUA 3N2LA 1DHTA 3N5KA 4L1KA 2JIQA 1T0HB 2BC9A 2ZCUA 1LZLA 1QP8A 1W5EA 3LC0A 4FHEA 1EGHA 2J67A 1JVBA 2XE4A 5CB8A 3FZYA 4JU8A 2YHIA 3CISA 2KE5A 1TK2A 1WO8A 1XXHE 2FW6A 5FBHA 5BV7A 1M2VB 4PC1A 1I30A 4PQEA 3FWNA 1S8OA 3A58B 1IWPB 4P32A 2GXUA 5HQTA 4DMHA 1N5DA 3VPSA 1WSAA 1M73E 2AF4C 1U81A 3WSTA 4PR0A 2VP6A 2FTKE 1IN4A 4GZMA 1GYRA 3WIBA 4J03A 2VF4X 3RTGA 3T7CA 3KYIB 2ZRNA 3U4HA 4RULA 1IRNA 1E3EA 2J87A 4G0NA 1F2TA 4PPGA 1VCOA 2FWBA 4OFWA 1JP7A 4S1WA 5DU2A 9ATCA 1MCZA 1GFSA 4MV1A 1G3UA 5I7VA 3CVJA 4HH4A 2ZXUA 4CT5A 2FPGB 4GMFA 2QG4A 1L2TA 4BX9A 4LCJA 2IHVA 3AR5A 4FHCA 4BMPB 2HMAA 4B32A 3SZGA 1KGSA 1RYZA 3MD9A 5EIHA 4MUYA 3Q6NA 2VHUA 4ZI7B 3WBBA 4P82A 3T06B 1G4UR 5J5CA 5AW7A 3L0BA 3IOYA 2JVJA 4MRRA 3DO5A 3DOIA 4JR2A 3EEYA 1DXQA 4JCOA 1SCUB 4GL4A 1BSVA 2YWXA 4WVLA 4BLOA 4ZVPA 4KFTA 5DYNA 4EGCB 4AY2A 5JSKA 2UDPA 2I6SA 4XUCA 1C0IA 1KIAA 2F3QA 4YRFA 3WK7A 1V5WA 1IZ9A 4D9IA 1Z8NA 2I2AA 2XQIA 2W2KA 3C87A 2BISA 4BV2A 4OX9Y 1U0EA 4CM9A 3MRXA 2OL4A 3C6YA 1MJGA 4K6OA 4I4TB 3M6LA 2MCFA 4QECA 5LNK1 3PC6A 4DA9A 1Z74A 2IQ5A 1BO6A 1BDHA 2RKOA 3CT4A 5AI6A 4EI7A 5JHHB 4OSEA 2IU4A 4UVDA 2XNDA 3K1JA 4FI3F 1DAPA 3RS9A 3JQPA 3MCWA 2PN1A 1YCHA 5HF6A 3WMWA 4FD3A 2A4KA 2QI9F 3CH4B 3TQRA 3B5EA 5IK2A 3Q5EA 2NTJA 3JQRA 1N25A 3VAZA 2WU4A 4E32A 1SO8A 3QE9Y 1TKRA 5H68A 3DBHB 2UXCB 4ID9A 4UEQA 3MWEA 4JNCA 2QTBA 2DWPA 4GR5A 2NU9B 1JFFA 1JSXA 1Y5LA 2QY9A 1WDTA 3GLHB 3KOZA 4JYMA 1T5BA 2A6PA 3VSDA 4Z9AA 1XQWA 3BC1A 2VZEA 3BTOA 1W0JD 5J2TA 4AHZA 1V8BA 3I6QA 1ZH2A 2BHRA 1BEUB 2VXCA 4ESVA 2QQGA 2C7OA 1ZU5A 4I5GA 4TQ9A 4XOIA 1TC1A 3QK7A 3RZ6A 3F4KA 4OBXA 1ZZEA 2AFIA 3VC7A 3CX6A 4R3WA 2NNWB 4DL9A 1GAXA 4NBTA 4UXHA 1QO0A 2WMNB 1IOVA 4GPAA 1YXMA 3STYA 3KVNA 3FYHA 5HBGA 1MZPA 4M4SA 4I5DA 2ONJA 3PRJA 1RZRA 1FFSA 1I0IA 3G8BA 1Y9EA 3DV0A 2HR5A 2BDEA 3IKLA 3CH6A 2R97A 3PWTA 1TB4A 1SBCA 4G8DA 1W0JA 4D92A 3LQFA 4ID3A 2JI3A 1G5IA 3K1AB 2E2JL 3ZDYB 4F4JA 2H65A 1QG2A 1QIMA 4E5SA 1W35A 5F7OA 5K8VA 2AKAB 2QYSA 1UMKA 4E31A 1NL3A 1U7ZA 3WA7A 1LKMA 3LE8A 4YMTA 2YWJA 4XUDA 3ELYA 2X9LA 3A06A 1VJDA 4TN5A 4EGQA 1G20A 1SHUX 3G5AA 4ARZA 5C4JL 3H0GL 3RSZA 2PL3A 2VSYA 3WHKA 4NNJA 3CF4A 4HTFA 2WJ6A 4F11A 2ZUEA 1P2GA 3LDUA 4IFTA 1RRVA 4A9AA 2XUQA 2FEOA 1V8ZA 3QVWA 1MBZA 1HC7A 5KQRA 3PFNA 4CETA 5DM61 5DRTA 3HOYL 2AGVA 2QVGA 4NMXB 3PEUA 4AG6A 4DV6B 3UTDA 2G4CA 2V5UA 1M0TA 3FMPB 4C4PA 1I9GA 2TS1A 5JJKA 4H35A 3RRJA 3E2MA 4BTEA 1GLVA 1ORVA 5MGNA 2DH6A 2HCTA 2Y92A 3FAZA 1RMYA 3PFKA 4RJ2A 5FA5A 3K9BA 1J2RA 3DC2A 3FSRA 1TADA 3CRW1 4GP6A 2X2EA 2AHOA 3O03A 4YS6A 3ZN2A 1E3DA 1R0CA 3C3EA 3HU3A 3ILSA 3DV0B 5T4BA 1PO7A 3LK6A 2CXPA 1NATA 2W5UA 4DLZA 2A6HD 1VI6A 1E0DA 3EOBI 3TF5A 4QVIA 4DZTA 3KQSA 1AT1A 3UGTA 4DADA 1YA4A 4KR7A 3PIO1 4K6KA 2VNKA 5LVAA 4XTRA 4M99A 1I1HA 4LQ4A 3TRFA 2YVAA 1HO3A 5CJ2A 1SVNA 3R0ZA 4GRDA 1JMVA 2IOFK 3HBJA 3JD2A 3K70B 5CJJA 3EQ7A 3R5FA 4ND7A 4EO4A 2VQDA 3RAJA 4UU7A 4HZIA 3QXGA 4FWIB 1L7EA 1MIHA 1USVA 4QD3A 1HE4A 2RAUA 4JUCA 4CJXA 2B2XA 1FNCA 5HMMA 1MDBA 1U6JA 3ZI7A 5ADHA 5BW8A 3ZCXA 5CXSA 5DNCA 1GAJA 2EL7A 4N47A 3VR2A 2VYCA 3ADBA 5CXXA 5JZVA 4YI3A 3R20A 2JBAB 5CVCA 3GTQL 1DBPA 4BBAA 4DPMA 2J9FA 3OOHA 5FR1A 2GDJA 3RRNA 1HPLA 1PS8A 4J1SA 4G0OA 3GU3A 2NO4A 2CFRA 3LMKA 4ZOAA 5TR9A 4II3A 4D3ZA 5BUZA 4JLUA 5IAGA 1X80A 3V1KA 5K0EA 5GY7A 2WAAA 3MMSA 3RTBA 4TXJA 2AI2A 4URHA 4LQDA 3VDMA 2AEJA 2ECKA 1II8B 2OHXA 1H5QA 3G2QA 5BQPA 1HTWA 2WV7A 2FZCA 4G4SO 4ZEXA 3TX2A 3EAFA 3DNPA 2GBLA 1C3XA 4FYHA 4HBGA 1FDRA 1V7QA 4MULA 1O95C 2I7TA 4PSVA 3VR6A 4KX3A 1KJ8A 1MX1A 2D06A 2VLIA 2X2PA 2P4QA 3JQ9A 3PGLA 4XJTA 5FNVF 3UK7A 3ZQ6A 1LF0A 3ILXA 4N82A 4PO1A 4PC7A 1N5IA 2QIOA 1CX9B 4YXFA 3OCWA 3R5TA 3SSAA 5LWQA 2GSDA 4TKMA 2FPXA 2GJ4A 3D02A 4CFZA 4CEJA 2VT3A 1AJEA 1PZNA 2Q07A 5L8VA 2FOIA 2OCDA 4EF5A 2PQ6A 1NA5A 2CVFA 5KYNA 1UJCA 1V41E 2IY8A 3DGFC 2O0KA 1CQPA 1I14A 3KSUA 4E3ZA 1YDWA 5CH3A 5LA6B 1ULSA 1OILA 4U0KA 5A3RA 4YPVA 3LW8A 1OR8A 3O8QB 2P78A 4OL9A 2I1WA 4RFSB 2NXWA 2XJRA 3IR5A 2OP0A 1BKSB 3MELA 2W22A 5T41A 4ARZB 3NCHA 1PP4A 4BNDB 1SM4A 3CMMA 3H11B 1EVLA 3TM5A 4L3OA 1UPTA 4N3AA 1A9SA 1X80B 2AV6A 4IDQA 1Y4ZA 4LVNA 2VPWA 4Z9BA 3T5TA 2VF2A 3ZHZA 3HU2A 1D1QA 5CGQB 2ZYWX 3ER9A 1JIXA 2FMUA 4DARA 1VG0B 1QFSA 5EEHA 3SP1A 1HEYA 3HTXA 4BE7B 5KCZA 4HTAA 3KT8A 1ANKA 2PX8A 5G3ZA 1H4TA 1P31A 2FFQA 1CR2A 2VATA 3DE4X 3O93A 4YT2A 3U1BA 1DRUA 4MZXA 2NXCA 2ERYA 3LPEB 2JGDA 3MQFA 4QGFA 3ETNA 1GZUA 3W5VA 1K8XB 2VNJA 1ZL0A 1D4OA 4ZO9A 1SCKA 3BJMA 5FDFA 1VKNA 1W1UA 3EIXA 3W8RA 3H18A 1U8YA 4FDMA 4AG3A 1MO3A 1OE0A 3GI1A 3T34A 4DLVA 3SF8B 3GO4A 4Y2QA 1EUDA 4XWYA 5ALIA 1V8FA 3H1GA 3FMVA 3QPBA 5CNKA 3OP1A 3IYLW 1A2KC 1UBHS 1RM3A 1WXWA 4IIDA 2O1WA 4Y18A 1KH2A 1RI5A 4RQUA 1GPH1 1J97A 2H92A 3KVVA 4MKZA 1KTVA 3FCUB 3QI7A 4Q21A 3RS0A 4F2HA 2VQEB 1WDLA 3UF0A 3K73O 4D9EA 3LWDA 2Z6AA 2CMGA 1P2SA 5GP1A 3LPCA 1QHEA 4ZI7F 1D09A 4PANA 1GNQA 4GSYA 1BMDA 4PG7A 1GPUA 1O9BA 1WZUA 4XI9A 5I8ZA 4C7OA 1CJBA 1TQ6A 5D00A 1G63A 1OASA 4NBNA 4P7GA 4TUYA 2W42A 1JXMA 2G72A 4F5ZA 5AI2A 1DC4A 1T1JA 4FT4A 1JL3A 1G9SA 4MA5A 1QDLB 3ZXSA 4N3GA 1SVMA 3JZDA 4TZ0A 1FFXB 2X9NA 4KYUA 4ZVRA 2DPMA 4Q4HA 3IP7A 1QHHB 4QJ5A 1S2ZA 3MJFA 1D2HA 5DI3B 1OU0A 4WFQA 3F5SA 3UHPA 3BWMA 5FA8A 2PUGA 2I9KA 2XXJA 3GMTA 2DP4E 3LGXA 1MF7A 4TZ6A 2QAGB 3COVA 5DLDA 5G4LA 3AKYA 5IF3A 3QTBA 1Q14A 5FNZA 3THWB 2N75A 1CY0A 1ZUNB 1U90A 2BR3A 4U2CA 3BFJA 2XWPA 4JLBA 1WNTA 1U5CA 2HQRA 2W00A 4K3VA 5EIFA 2TMYA 4NOLA 4P2BA 4BFVA 4E33A 1ARZA 1VHDA 2C0PA 3EBPA 4LGCA 5I45A 4A36A 2D8AA 3FETA 1NULA 2FZWA 1FUKA 4CNBA 4YJ2B 1NDQA 1N2IA 3RASA 1E9SA 2HSDA 1OWMA 3KLMX 4RKQA 5L3SB 2QX6A 2PR2A 2DBRA 5EXPA 2C2BA 5IYZA 3AEXA 3FMOB 2JLXA 3IHLA 1JHZA 2FX2A 2E49A 4EY3A 4RY8A 4KR2A 1FDTA 1J8YF 2PWPA 4QTXA 2CYBA 1MOQA 4TUYB 2QN1A 3RAPR 5DEIA 6ABPA 3KR2A 1U4OA 3WHLA 4GBMA 3O9VA 4UBMA 4AKTA 4C6RA 5C7OO 4XCQA 2HJHA 5EESA 4POGA 2IE0A 4MICA 1WKBA 1YA6A 4MUHA 4Q4CA 1WD5A 3DMDA 4HC4A 2QLFA 1WZCA 3FVTA 4MWBA 1EE2A 3FPGA 3FDZB 2Q5JA 4GGPA 4HYYA 4Y8VA 5EZYF 3ENVA 1O03A 3SM9A 1MZVA 1H6CA 3PI7A 4E30A 1QIGA 3OD5A 4GECA 5D3KA 2CNBA 5DTEA 5AJZA 4GVPA 4Y67A 3THWA 2JCSA 2PZ8A 3EXFB 5J5VA 4L78A 3R7WA 1O58A 5B37A 2H48A 2GPJA 3IDQA 3WIDA 3EGVA 4B74A 1CUSA 1FLNA 1FP4B 4HK4A 1R10A 2HLPA 2N1BA 2P9TA 3EIQA 2O57A 5BSWA 2A7XA 3UUFA 1NN0A 1ICEA 3MLBA 1C9YA 1IZYA 1BCSA 2OV1A 1YCDA 2YW2A 3H19A 3R41A 3U40A 2NT4A 3ZLTA 1KI8A 2YXLA 2ZSDA 4I1VA 3PA6A 3BIOA 5K6RA 1G7CA 2F1OA 4FDVA 4BAUA 2PO7A 1S24A 1WPXA 3BRWA 1Y3HA 4U2DA 5KVQA 1JPNA 5JPCA 1Z75A 2HPHA 2D59A 5ECYA 1Y5IA 2J85A 2R00C 3PP8A 3RAGA 4AKSA 2HJWA 3LS2A 4PVCA 4N0MA 1ZKMA 2DBZA 1JA9A 1CJUC 2WHYA 2XDYA 2Y27A 2C92A 3WQSB 1BGWA 1ZL2A 3U6BA 4R1QA 4AL4A 1R4AA 2CKDA 2QT9A 3JYOA 4D8YA 2G04A 1Q83A 3R6WA 4HRAA 3AXTA 5EHNA 2XTAA 4FE3A 4BQSA 4NYIR 4EMSA 3SZMA 4UOZA 3CCBA 3KYYA 1M6VB 4ZI3A 1A1SA 2A8YA 1FTWA 3BKXA 3EIFA 1E5XA 4Z1MA 3R8CA 1P81A 4B6FA 3U56A 4K3UA 4RFLA 4MVWA 4LOAA 4MDHA 4I5FA 1WMFA 2VHVA 4H0FA 3RJTA 4FMCF 1FY2A 1G5QA 1N2OA 5KOYA 3RF7A 2HSGA 2H4ZA 1G2OA 2DLCX 1ECGA 2UVDA 2PUCA 3MWKA 4ZK6A 4ARAA 4DV3B 4XVRA 3VI3B 1SJ9A 2PT7A 3TZKA 1XKQA 2COKA 3L01A 4YR7A 2Z8ZA 2J9YB 1SKMA 3VPXA 1JMKC 2CXUA 1BW9B 4A1OA 1YU6A 5K3BA 5BSKA 3HXMA 1XRPA 1EIWA 2W8BB 3S5JA 1QSGA 2PLAA 5LP6B 4G1FA 1YFKA 4F12A 2FRDA 3DZDA 1SZPA 2XX3A 1TGVA 1IYZA 2H29A 5F4BA 4C30A 5C3EL 4XIJA 2ODBA 1ZNXA 4QDXA 2ON6A 1ORWA 4B35A 4MGZR 3WB1A 4DWOA 4YACA 3BWXA 2XUKA 1ONNA 3T7KA 3WDLA 5IP5A 1M34E 2ECPA 2W6IA 4MCIA 2O2IA 5KYTA 1P0IA 7RXNA 2EIHA 4UU8A 1TI7A 2WY2D 1XF1A 4R69A 2AH5A 2FWIA 2MR6A 3GLFA 1AQYA 3OSZA 4OXRA 4YJ2A 2WB1P 4XR9A 3L9XA 4TZKA 4G56A 3C43A 1QQBA 4ECEA 1VQ1A 3OPYB 4X6YA 1G5HA 1TJPB 1XVAA 5K2ME 1UODA 3JARB 3V4LA 4IX9A 4EB3A 1UR5A 2VRNA 1CULC 1UM9B 4XYEA 5HG0A 2Z1NA 4U2KA 1TIBA 4EYGA 1JEQA 2UZIR 2JCBA 2OLEA 3T9EA 2IW3A 5CU7A 1K92A 4YMVA 1L5OA 3CO5A 2IYRA 3ROEA 2QMHA 2QVXX 3BD8A 2YJ3A 1NBME 5BNIA 4HNHA 4FKZA 1J0BA 3C5WP 3TB4A 1V8PA 4TMXA 1QGZA 2XT6A 3L6RA 5DF1A 3IR7A 5DYWA 1YGYA 3BXXA 4XH9B 2NP7A 2JA2A 5A4KA 4J0EA 5BYBA 1RM4A 5AW2A 3T54A 4F38A 8LDHA 2XGJA 1J23A 5K99A 4MI6A 1QK4A 4XYGA 1Z45A 3J7Z1 1U7XA 3H9BA 1SGWA 2Q99A 3M9LA 3U7FB 3RGWS 4GX1A 5C1DA 1CUXA 4L5YA 4YWMA 4AI0A 3M6XA 3OCVA 4HDKB 1AS3A 1MTZA 2I2WA 5TVGA 4AB1A 3PWZA 2ZCVA 4CEHB 3O74A 2ZTSA 2XNSA 5KNCH 4A93L 4KTVE 3V4PB 2D5AA 3HFJA 4B2YA 3IEUA 3VH4A 3WV4A 1NRWA 1GDHA 4PFJA 2KPOA 2Q0XA 1TD9A 2GEFA 1XFAA 1FQWA 4DABA 4XGNA 1N5KA 1WCIA 1PWXA 1GRVA 4R2HA 1NR5A 3CEJA 2CJXA 4WUVA 1IAQA 4E11A 3V8RA 4PSKA 3D6TB 3BHJA 4C4ZA 4QLAA 4L72A 3Q0IA 1IMOA 5FV4A 4DE5A 3KFLA 4BKPA 1EAYA 4N6OA 1H1LB 1LF5A 5F5NA 4ML3A 2A58A 3Q9UA 4IH4A 1E5VA 1XJ0A 3E61A 3HB5X 4JJ6A 2BIFA 3VQTA 1VG8A 1UBTS 2J7PD 1B8PA 3G0GA 4RMHA 2Q46A 4DSZA 5GZ3A 1AMNA 3EH1A 2I3AA 1FU7A 1BCRA 5A9SA 1K2VN 1K7YA 3PQ4A 4U7HA 4OQ4A 5AOBA 1OI4A 3W2GA 5CXQA 4EBBA 2FP4B 1RWQA 1YJ8A 3GHHA 3LPDA 2ZFUA 5LBUA 5IG2A 1TWHL 2AZMA 4YASA 3TQCA 5H70A 2VOEA 5CFNA 5D85A 5D5HA 4HDKA 5ALXA 4G0UA 3ZV3A 3ONDA 4YFYA 1GTL1 5TPWA 2I3BA 1QKIA 3SC6A 1HZZA 2QW1A 1QS0B 3B60A 5AR1A 1UL1X 2IODA 1DX8A 4N5LA 4M46A 3K70C 1NVXQ 4V3BA 4HSGA 6YASA 4KIWA 1JJBA 1JHDA 1T1GA 3THYB 4F6LA 1ZOOA 3K5PA 3GMSA 2NSYA 1NJ8A 4PGFA 3S70A 3UBTA 4TMKA 3PEWA 4Q3BA 1EM8B 4XXHA 3KQHA 4B46A 4CG3A 4F2PA 3BKWA 4G01B 4L3WA 2GTPA 5EWMB 1GN8A 3KYWA 2LUOA 3UY4A 3HHEA 4DSAA 4ARIA 1KOGA 2WHRA 2PS3A 3K0FA 4ND8A 4AS1A 5E6SB 3ZKWA 2R8OA 3E5HA 3JTEA 2YQ5A 2YHSA 5A7FA 2UYOA 2P9YA 4EX7A 2P3LA 5DCYA 5IC4A 1K8QA 2G09A 3NLLA 4V0SA 2XUDA 4I14A 3JR7A 1J42A 1RFLA 4NFHA 1RPZA 1V3QE 1T6NA 2H1OA 1PN3A 2H3HA 4BN4A 2FU5C 2WYVA 4J0KA 3U39A 1P3JA 3IAM1 4PSUA 5T67A 4EA6A 3OEED 4HVCA 5K0LA 4NCKA 4GR4A 2J3QA 2G9ZA 2BFFB 5TC4A 4HHEA 1WF3A 3GTGL 4R0VA 2FW1A 1RMQA 3CLKA 4X1IB 3B12A 2CHEA 3RBVA 3P0IA 3JCZA 1MW9X 3OMWA 4EHNA 3AP1A 1VHQA 2ZAYA 3ISVA 2VQSA 4FFPA 2UZ1B 1FVOA 4WZBA 3ZE2B 3A10A 3R5JA 4L8LA 1E4EB 2AFHE 4MARA 3HOUL 1M6WA 1SNYA 3AR8A 1WUHS 4JYBA 4Y1RB 4C5CA 1E3JA 1TM5E 5U9CA 2E3JA 1B7GO 1I24A 1MJFA 3E48A 1RLJA 1MHPA 2YXNA 3JD0A 3OIFA 2AYYA 3QKRA 3QOFA 1ISSA 3G59A 3JRXA 1TO2E 4FZ3A 3IALA 4GMGA 4NH0A 5EZSA 5EGSA 3BA6A 4G1UC 1PNRA 2F6RA 3DQQA 4BU0A 3IKTA 2ZM5A 3ZZUA 1R4NA 3G17A 1T91A 2DFTA 4I50F 3UGJA 1M76A 4K9QA 4HWTA 3C6BA 3LK7A 4C0SA 4R2IA 5L7TA 3HZHA 3OUTA 4FX5A 1DELA 4EHJA 1J0XO 1OPRA 3QEOA 4KO3S 4A26A 3BOSA 2J6IA 2MS3A 1Y8AA 2O3UA 3W3AD 1IVSA 1XL0A 5DWDA 1L1EA 3N8KA 1KFCB 3BFKA 1JFTA 7YASA 1A8HA 5AM0A 2IE8A 1TAUA 3SZLA 3FFTA 2YZMA 3RNLA 3W1EA 1NMEA 2QD4A 1G1MA 1IQUA 2CBGA 2WMYA 1N2CA 1N9ZA 3R3VA 3RRYA 5D51S 2GCEA 5BR1A 2Z1DA 4A3GL 1L7XA 1H1LA 3PNPA 1EESA 3T61A 5C53B 3H5TA 5AVYA 4MX8A 4KZKA 1C09A 3UV3A 3RSLA 3BFXA 4TLMB 1JHRA 1XMJA 3ZWNA 2JFOA 4BEBA 1AS2A 4C1NA 1D2GA 1ADYA 1QBKC 2P2DA 4BGIA 3BA1A 1DKMA 1M10A 4TWBA 4ZXPA 4JT8A 5FWXB 3OE7A 3KRTA 1SQ0A 4LZLA 3GJTA 1N92A 3ZV5A 3PDIB 4BDTA 3DAFA 3G2JA 1USKA 5HS6A 3SDSA 1Y81A 1O54A 4GZ3A 4LMPA 5K3FB 3UJAA 5KYKA 4UVGA 4DKJA 4NONA 4WVFA 3ZBPA 2OCAA 2C59A 2I71A 4D3FA 3EGDB 1K6IA 5AQ1A 2EJWA 1WCWA 4XA8A 3CVUA 2JGKA 1R3DA 2AN1A 4ESOA 4RTPA 3BJZA 4UHDA 5A06A 1QHIA 4RADA 2VWPA 3AJ9A 3SHVA 4GOKA 1GL7A 3ZHQA 1JPUA 4KQEA 2A59A 3D7NA 3JWEA 4N3CA 4UEWA 2CXHA 2HV9A 3FHJA 1X7HA 3ACBA 1P75A 3COYA 3F6CA 3EG9B 3GWZA 3DH0A 4MWTA 4RE6A 5ESRA 3RC3A 3ZCUA 4TV9B 3WA6A 1QOQB 121PA 1NPYA 1Q84A 2ZJ7A 2FPLA 3OQ1A 1RYQA 4RD0A 2VUIB 4UZFA 5IDXA 5CVJA 1MJHA 1WVIA 2O06A 5EMLA 3BFVA 2Z3QB 2Z5LA 2ZE8A 4ENWA 2H1WA 4OB7A 1E61A 1QYXA 4XWGA 2WR8A 2CNWD 3MTAA 3QFCA 2H59A 2XT0A 4DMLA 2C4TA 3SR4A 2WUVA 3NWJA 1K98A 4EHBA 1ZI8A 1QC5A 2XMCA 4QYIA 3UWKA 1EWRA 2H6EA 1ZMTA 3U4IA 2PSHA 2P2SA 1JXAA 5SICE 1V6AA 1FCJA 3SOPA 4P1ZA 5LQAA 1M75A 1FBTA 1L9XA 4XJXA 3UMRA 3B9RA 4PLHA 2ZE6A 5E6UA 4CLRA 3VOTA 2J09A 1W4ZA 2W2NA 2LGJA 5C8VA 4JJZA 2BGIA 5K09A 4FXPA 2GNPA 2WHEA 4RZQA 1DUSA 1HQKA 4YDRA 4R68A 5F4ZA 2NO5A 4AY4A 1OXUA 2ZIXA 1ST3A 1Z4LA 3HVJA 1W4BA 5KX5B 1D0IA 1NI4B 2JJ1A 2YTZA 2YY6A 3UMYA 1ZYUA 2PGLA 1BA3A 1JIQA 1XUOA 4PNHA 3AEYA 1VHTA 3CE6A 1BFYA 1L5WA 1TTHA 4GYJA 4MRPA 3K4PA 4QBGB 2LV8A 3GLHE 1CDZA 4PEVA 5CVDA 2KKDA 1I01A 3K92A 4MEBA 1LBEA 2FH5B 1YRBA 1VOTA 3FVWA 1DLJA 2GVZC 3AH8A 2PKRA 3C6XA 4I4NA 5BW5A 1VPTA 1RLIA 4KQFA 4BC0A 5F7JA 4E7OA 2XH8A 3C5VA 4C21A 1QH9A 1YR6A 5HE8A 5B7GA 2NUAB 3NCTA 3Q2IA 2E7ZA 2PRJA 5AK3A 1P91A 3ZZTA 4D8TA 4DDHA 3DOUA 1K8RA 4ZN1B 1P2FA 4G3XA 4U3JA 1T9BA 2PJZA 1PDOA 2AI1A 2ODEA 3A05A 1FNNA 3PVZA 3G2OA 3Q5DA 4MVJE 1UEIA 2CD7A 3P0HA 4NATA 2PE5A 1DXYA 1P7WA 1PJLA 3IEMA 5JEEA 1TKAA 1WX1A 3BJRA 3C98A 1P2DA 4LY6A 4MITA 3MT8A 4DT1B 4DLAA 1DG3A 3I62A 2BKLA 4JLNA 2VH1A 2G5GX 4ZN6A 5JATA 4CG1A 16PKA 1IJEA 3RV4A 4AQDA 1HKHA 2JASA 4FDUA 2IXAA 2NYRA 1YSCA 2QOEA 2WIAA 4GPEA 4PZYA 4R1UA 5ITSA 1NT4A 2BFEB 2XECA 3I28A 1H0HA 3L7AA 4P36A 2C5BA 4V0QA 4MYCA 5D2CA 5TT1A 2J48A 2GJKA 1VIMA 2Z56A 4IEFB 4LRTB 2AE1A 3WGYA 2EERA 1KDZA 2Q0HA 4FHGA 1PTKA 3CRQA 4IJVA 1C3VA 4JBIA 1OX4A 3LXXA 5CB4A 5J2UA 2QRJA 4IWYA 1TEHA 3C5CA 2HB6A 2HWKA 4UW9A 2RGCA 3WMEA 1X8XA 1F6WA 4O1MA 4ZQBA 3AFNA 2IL1A 5A1TA 3G85A 3MJHA 5L7WA 1XZEA 1JF8A 4DGQA 1Y6ZA 5FPQA 2QMYA 5CFOA 2V6BA 4JEHA 1UJ5A 2JZCA 4ZYVA 4MYTA 5J59A 1ESNA 1OLXA 3OZUA 4B48A 1XJQA 1G4HA 2QUIA 5JAQA 3V4RA 1Z6YA 3B1KA 3M9WA 3MW8A 1X19A 2DXIA 1J9EA 4OYHA 2GF0A 4CQNA 4HATA 2IHKA 3MWYW 5ARDA 4Q9JA 1W75A 4NG4A 4E5UA 2QUBA 1E2JA 3AUKA 3UJDA 3WSVA 2J0VA 2QD3A 2Q2OA 2ZG6A 4HR7A 5E9AA 4D02A 3TK1A 1RJFA 5IZCA 1USWA 2OHHA 3MCUA 3EPLA 3RREA 1QG6A 2HKIA 1Q7CA 5BXQC 3Q8KA 5CFRA 4JEUA 2BFEA 1OGYA 2ROQA 3SSNA 2YRFA 2Q8PA 4FE7A 1P0MA 3NYIA 4A0FA 4E1BA 1R5BA 1B2JA 2HDNB 5HNKA 1R0KA 1KDPA 1Q92A 3LXMA 2I6TA 1AZSC 5F9HA 4B4OA 3PYLA 3FUVA 4F2WA 5K0TA 1ZH0A 3A27A 4EPTA 2AVDA 3G88A 4PIVA 4QG7A 1TM1E 4Y1FA 4YT4A 1KI9A 2VBCA 1H3NA 2RIPA 3JRWA 2J5XA 3MGBA 4WNIA 1E6CA 1VI2A 1FQOA 3AKDA 3D3EA 5HE9A 4BNWA 1ZW1A 1SZCA 2GZSA 1ISGA 1I3LA 5JAMA 4ZU6X 4OLBA 2C20A 5JFGA 1RP1A 3B6KA 4QUKA 1CWUA 5HEKA 3EFHA 1ZR2A 3CN7A 1KI7A 1FJGB 2A5YB 3GUHA 4LVUA 5KTRA 1NXVA 3EN0A 1QVZA 4ZZ0A 3AR6A 2AJDA 1Q2XA 1A0OA 2Z43A 2Y1GA 3DMTA 4B82A 3B7PA 3AU9A 1VLHA 1NJSA 3Q7SA 1SCNE 3GEPA 3SXJA 1L4MA 4PFSA 1KDTA 2E5WA 4YV2A 2UVPA 1GU7A 2NM0A 2FAXA 2ZJBA 3IESA 3SHWA 4RH0A 1OWLA 4F97A 3LV8A 3E9MA 3NANA 4UPVA 3AL0C 1H2FA 1XZLA 4IOLA 4M0UA 5BYJA 4OO3A 1QLHA 3EEFA 3S1AB 4FS3A 4KGZA 5DH9A 1XRJA 5MFZA 4Z0HO 2DR2A 1O96B 2FPUA 4GL2A 2IYSA 1WOMA 3K20A 4UEKA 4LSMA 5HF5A 4E5NA 1KYQA 1O87A 4Q66C 3AFGA 1EGAA 2F3UA 5LUAA 1WNFA 5DW3A 5IU6A 4CKBB 1Q17A 3CLUD 3ORHA 4PHTA 2R1ZA 3HO8A 5FCDA 4D4LA 1NG9A 3I01A 3OPYA 1SXPA 3IJPA 1H6DA 3NDJA 1RTKA 3IPCA 4Q02A 5BWCA 1J0AA 1ZXBA 4L2IA 3SBEA 4INPA 1CYEA 1Z07A 2PJUA 4LZPA 1RWVA 1XTZA 2F2TA 4PLPA 2VRCA 5F2OA 4OH7A 3QE2A 2XQGA 3MSCA 4UZEA 3TLKA 2HK6A 1IQ0A 4YUWA 1BKYA 1Z3IX 3SU8A 4MV0A 1NAHA 4QPZA 3V8VA 3WQBA 1H6BA 5F1PA 2ZPAA 1L8OA 1SUDA 4DG8A 4DTCA 3R7NA 3H4MA 3E81A 3D2LA 3TJRA 4L16A 4RZIA 1JEEA 4HN9A 4JBXA 5GOZA 1XQ9A 3EQ9A 1KE1A 1LPOA 2DJ5A 2WNHA 4FQ8A 4HVAA 4TLBA 3PNVA 3FWYA 2FPIB 4IINA 4AXBA 4BQNA 5LQKA 3SFTA 1SU7A 1U6KA 2ZXFA 3L07A 4G81A 4RKWA 2A5FA 2CY0A 4Q1AA 3NHUA 5UKDA 3ZJTA 3AMVA 2YR0A 1TVCA 5ECDA 3B1VA 3CCCA 2HUPA 1G18A 3MJRA 4KKXB 4LV6A 4XB6B 5IJXA 4M87A 1NVWQ 3E9NA 1I6KA 1W0KD 3F7TA 1P7CA 4UATA 3DTVD 2AMLA 3WRXA 5JSUA 3OX1A 4CKBA 1RC8A 3PEEA 3QPUA 5B6JA 2FE1A 1SH7A 2AI3A 5HJ7A 4Z4FA 5EUBA 1T24A 1DVBA 3D0QA 3QVSA 2G80A 1U94A 4EYOA 5G1NA 1D5WA 4PLCA 2AXNA 1LBHA 1FDWA 4Y2XA 3VSEA 1BFDA 3OZ7A 1MA0A 1ZD4A 3X1YA 5ICFA 4CWAA 4RD4A 1VXOA 4PHHA 4ZYTA 5JVDF 4G5QA 1LV8A 1O0BA 2YUTA 2A6ED 4F3TA 2VAMA 3E5MA 3HXPA 2B6NA 1L5HB 2FZEA 1X8KA 1IG0A 2ZS8A 4YCMA 3GEDA 1I94B 3IAHA 4JXKA 4PPQA 3ESXA 1VLZA 3R3WA 4MRVA 4ZQCB 1GKIA 1AUVA 2OVBA 5AXCA 4ZYUA 1QNLA 1UPBA 1XTKA 3G23A 3TKYA 1CNEA 1UOEA 1Z5PA 1FUIA 1I36A 3KXLA 1I4EB 4WXMA 2BMFA 4XAQA 1T1IA 1PT7A 1GA1A 1DEXA 1VCIA 3FHLA 3GPIA 2P27A 4FEGA 4LHEA 4QOEA 3T52A 2HM7A 1MB2A 1NUQA 2FSFA 4GWLA 2YIDA 1K5DA 5GJWC 3ZTWA 1PD0A 4E7PA 5LP1A 3TEFA 2RARA 4YEDA 1WXEA 4HAZA 1Q1AA 3DOJA 1A4XA 4Y0AA 5J9FA 4BP3A 1WCML 1INLA 1U8XX 3WKCA 5K45A 1TWFL 3ETEA 1XD8A 2GN0A 5DNUA 1ZEMA 4NKRA 3A0UA 1YR8A 3I52A 3ITDA 4MQ6A 5EE3A 3ZXUB 1QDEA 3RDPA 5L3QA 3ZE9A 3UUGA 3FR7A 4O63O 4FNMA 3ICOA 2F00A 4IMIB 5IDQA 3TAUA 3JQCA 1KJIA 3N70A 3WGTA 4BPBA 5AK4A 2QVLA 1EE9A 5A04A 1MX9A 1EH5A 1SKYB 4QU8A 5AKIA 5H5JA 1F2TB 2Y6VA 1GU0A 4NDZA 4TXNA 3I34X 1HQCA 1K0FA 5EIBD 4NPCA 1V9CA 2X5XA 5A6VA 2MU1A 5DN9A 1F7UA 1N7GA 2YW9A 1TVKB 3L7NA 3FZQA 2AFVA 1WV1A 3GFVA 3RYFA 3C3CA 1D07A 1LV7A 4RSHA 1RXVA 3W79A 3H3VM 2YJ5A 3WTCA 2A3NA 2H11A 1JDJA 1G5RA 3E23A 3OOYA 2QUAA 2XIQA 3SPXA 3TNFA 1EU1A 1NWHA 2NU6B 2WM2A 2VDUE 4A8TA 2FUNB 5JFOA 1VL2A 3N3BC 4S1NA 2Q5OA 4WW0A 2EHDA 3VHRA 2VUSA 5I8PA 1UFQA 2IH5A 3AUXA 1VA4A 5L3RA 5BVHA 3QY9A 4DR7B 2BFFA 1ZNZA 2O7QA 5KYGA 5H1Sc 2CLFB 2EGGA 1JS1X 4LWPA 3QU9A 1SCJA 1FS6A 4G6ZA 3TOZA 4EG8A 1T6YA 2GKOA 2R6HA 1UKBA 4L9SA 3AF2A 3NBXX 5EQFA 1PGJA 1V25A 5BR4A 4ME3A 1UC4B 4QT4A 4A23A 3A3NA 3MFYA 3VNBA 4N41A 5M7EA 2B99A 2XJUA 5GAGc 3QVDA 2CMDA 3F1LA 3HXLA 1NC1A 4JLJA 1OXTA 3SIRA 4BJ5A 5JZSA 1UMCB 2E1RA 2NLOA 5LMNB 1CHDA 4PNZA 4MSUA 4PGGA 3QU5A 1XKLA 2MSKA 1FX1A 3PFWO 1JG7A 2R8BA 3NRCA 2OZPA 3L0PA 3PGMA 3SXUA 2Z6UA 3PNKA 3PCTA 5DN6D 4Y3UA 3IHKA 3F5QA 5KS2A 3HCCA 2Q4DA 2PRZA 4LRSB 4C4XA 1YZHA 2A5JA 3ITEA 4MCAA 4YRNA 3GZNB 5ALJA 1PYDA 3D5TA 3RABA 2QGZA 5GAHc 4E1AA 3ZYCA 2NYVA 4FONA 3BZWA 1YOVB 3QVGB 4A92A 4UVIA 5F33A 5EIWA 1H1DA 1HYGA 3MMPA 1LY1A 1K8ZB 2ZRHA 5I9MA 2ZPUA 3GJ3A 5TS3A 3ENZA 4M8KA 4YRIA 3MZ0A 4WKPA 5LU9A 3ZLBA 2AOVA 3EUFA 1VE1A 4XCVA 4HWSA 2EW1A 3QE4A 1C4WA 4NP6A 2ZRQA 3F0TA 1K9VF 1TKBA 3E9DA 4KUEA 3UWSA 2JEYA 1HRDA 1AN9A 4BKRA 1C41A 1NBWB 5LUBA 5JT1A 5LJLA 2ZIGA 2ZQ5A 2AUSB 1Q1QA 4C7BA 3JASA 3CKKA 1R9TL 2G4VA 1N6IA 3KJQA 1SC4A 3Q7IA 4UTPA 1T8WA 3LNCA 4C0LA 5GINE 4FGSA 4LJAA 4S05A 1C1DA 3OKPA 3U4QB 4ACBA 2C2HA 3R2JA 4CCYA 1WHSA 1ID1A 2IPLA 2P41A 2G17A 3R6LA 3I42A 4KVFA 4N12A 4PQRA 3LIPA 3WL5A 3F1KA 4PNEA 1QRTA 1KMMA 2CL5A 2Q3FA 3PUVA 3ROPA 4CM1A 2C2WA 2NVBA 1E8DA 4CKYA 2IIVA 1K3TA 2QYTA 1U5BB 4A3IL 1ZGJA 2IDMA 1G20B 4B84A 2N47A 2C5FA 1B3BA 1ZD9A 4DJEC 1KRXA 4V03A 4CCWA 1XT6A 1GCGA 2GBGA 3ZEIA 5BSUA 3K9QO 5GTDA 1VE9A 4JDUA 3ZHVA 1AMUA 3PJFA 3AP2A 1NQOA 4I9FA 2Q1UA 3TR5A 1P6UA 5E7JA 5A71A 5TF4A 5JJCA 2P7HA 1W47A 4JP2A 3ETLA 4I1SA 5TQ2B 1E1KA 1FS5A 1M8FA 2P0YA 2P65A 4QULA 3NVDA 5KVSA 2HXSA 3JYPA 4OF4A 3V46A 3TNLA 3GLFB 2CVPA 3RYFB 4NIMA 3AHDA 3DFUA 3MJCA 4LJ4A 5JUWA 4I9NA 4L0DA 4OGKA 1KJQA 4C3ZA 1SVOA 4RH1A 2CFIA 1Y4AE 2PTHA 1R0FA 2W2MA 3OT1B 5EFOA 1PUXA 1UANA 5AKHA 5JS2A 5L9AA 1XK6A 2OECA 3LA8A 3WYFA 5JNLA 3CX4A 1KF0A 3QI2A 2ZREA 3DAYA 1RXWA 1Y3CE 3QF4B 4KQMA 2XCUA 3Q72A 1IH8A 4HUJA 4KN8A 1LSOA 2NUBA 4DEVA 2PD6A 1KY4A 1PSZA 1QV6A 4C5AA 3KD3A 2BPOA 3FKIL 1OBFO 1X92A 5FOXA 3SJUA 4CUZA 3BMXA 1MH9A 3JYHA 3FRJA 2GZAA 1HZZC 5EKSA 3E9YA 1JQ3A 4Q4AB 3RUHA 3SY8A 2R6FA 4DS3A 1HZJA 4ZVUA 5BQ3A 1V96A 2W4QA 2VUML 1EK2A 1XV5A 4BWFB 5HIIA 1NJ6A 2FLVA 3KAKA 3OWHA 3TL2A 1YRLA 1EB8A 2VT6A 2WTAA 1CT9A 4ISBA 4KXLA 1VIYA 4PRKA 3FFWA 2BUAA 2QRMA 3X44A 4ZDIA 1DCKA 3GN2A 1T3LA 5B2EA 2WPDA 5K2OA 4OB8A 3T7SA 1RXEA 3QVVA 2IS6A 2IYTA 4S1TA 3SQNA 3NIGB 1AIPA 2G1UA 3ZNQA 2DX7A 1KU0A 2G28A 4Y1EA 4W63A 2D0PB 4Y2UA 4EA7A 4JLOA 3H75A 3O8NA 2XOEA 1L1QA 2SKDA 2OGZA 4YCCA 1WCIB 3VR1A 4M53A 4F46A 3ZU4A 5JRJA 3O9ZA 1S2MA 1RRMA 4ZZIA 1ZY2A 2PQMA 1TYAE 4P86A 4DR2B 3PD0A 2CK3D 2A86A 2JNWA 4GM4A 4DFDA 2G07A 2ZWVA 4Z99A 2AD5A 1CJCA 3P4YA 4V0MA 4X1IA 3PR2B 4FN4A 1MAHA 4AC9A 3QJGA 3LUDA 4NU8X 5KC8A 4CV0A 4OK3A 1NLFA 1G291 2NXNA 5CIWA 3TVYA 2WHPA 3OX2A 4RV9A 5EWLB 3VUEA 4KAXA 3GDGA 1L5ZA 3G0IA 1UT5A 4TOIA 4RCVA 3VU0A 4XRGA 5BSHA 4FWTA 2WJAA 1P5FA 2V6FA 1LRJA 3QEKA 4B9EA 4GOOD 4N01A 1XD9A 1E2GA 1DAEA 4KN6A 3V3KA 2QZPA 4RLSA 4MQBA 1WEHA 1DC8A 5FOSA 5CFQA 3QUSA 4AM8A 3OPNA 1RAIA 2FX5A 2DCMA 4NBLA 4FBLA 3W6OA 3WDMA 3TL3A 5FAXA 5KYXA 2F1IA 1NUUA 2FK8A 2PRYA 2ZB4A 3AEQA 4JFAA 3WX0A 2Y0PA 5KMGA 3FUXA 2VDWB 3T15A 1RYFA 2B92A 5B57C 3V42A 2FY8A 5CG2A 2P1DA 2QRNA 3NBUA 3OTOB 3ZVMA 4YMIA 1ZC3A 3A4YA 5IH3A 3GGJA 5AJYA 1E18A 3M33A 4II7A 4P7KA 4R2LA 4RVGA 4DMRA 1A71A 2Z8YM 5HUQA 1RWMA 4RTKA 2X86A 1O6CA 3N0RA 1M8GA 3S8YA 2F9LA 2JK1A 5HKOA 1XCBA 5BNTA 1SVKA 3FVVA 4GZ5A 3VR5D 1SWWA 1A9TA 5JD3A 1NVMB 1ULUA 2ID9A 4H1UA 4HBZA 4M36A 4HRXA 4PC3A 3RW9A 3R24A 3C2QA 2Z2KA 2I8CA 3B53X 3OFVA 3PF9A 4EW2A 2PGNA 5AW6A 4N3BA 4QPPA 5B3LA 5EKUA 3EPPA 3RSQA 4D6YA 2ALJA 4WK4B 1C7IA 3CSDA 5JFTA 2VWGA 4YAFA 4AZ0B 5HF8A 2HMYB 1BS9A 1OAOC 2R5WA 1PVDA 1P3Y1 4J4BA 2OQVA 5HGXA 1R8JA 2IZ7A 3SYMA 3UPTA 2QZ4A 5DIZA 2WFZA 4F0JA 4AP6A 3HJHA 5DNYB 3AIOA 2BOVA 5KYXB 4FMPA 2QE7D 3I6YA 3WLEA 3I04A 3UJ9A 3B48A 3IBSA 1QXSA 1T4GA 4DA0A 4M88A 2BI4A 3PV0A 2Z4SA 1JDBB 4J7AA 5HF9A 4V0ME 3BXFA 5TNXA 4B47A 3D7RA 4ZI2A 1AB5A 1E2LA 4E14A 4AUKA 2PM8A 1L6RA 3L93A 4FGLA 4GBGA 2PSJA 3BERA 3CA8A 3QLTA 3CX3A 3T1NA 5EJ8A 2HRCA 1GADO 2F67A 3B6IA 3QTLA 4YJ3A 5IC5A 1MW8X 1ZRPA 1T4CB 2CYAA 3NVAA 3VR4D 3PYXA 2FQWA 4UM7A 2RJ3A 4EY6A 4CIDA 5KCMA 2MINB 3N76A 1GPLA 3ZE7A 1QQAA 4I9HA 1Q12A 1XRRA 4ZK2A 1YTLA 1A95A 3R8XA 3BWVA 4M7OA 1N78A 3CNLA 4Q3LA 5EC8A 3BS4A 4H17A 4AT1A 4BUZA 4UBLA 3TWOA 1YQ9A 3KP1A 4CDNA 2GYWA 4I1YA 4BIIA 1DJOA 1ZGCA 4I5IA 3BIFA 1D6MA 1Z6XA 2FSPA 3UCEA 1NVEA 1YT5A 3D4NA 4GLFA 5T3YA 4HLUC 5A2QA 3TSYA 3CU5A 1C4XA 1USGA 4KQXA 4EX6A 3DCYA 3WMRA 4EA8A 5DP2A 2A9RA 2FE4A 3WLOA 4U63A 1OFUX 1BGVA 1X74A 4G1BA 2OCPA 3IDSA 3QWBA 3J7Y1 2J0UB 1TMKA 3H3FA 4Q15A 3GFRA 4G5XA 1JR6A 3UNXA 2X3FA 3KPYA 4IDNA 4Q1BA 2ZIXB 2XCLA 3W7AA 5JS1A 421PA 1U3DA 1C1YA 3B3AA 4M1ZA 2XYGA 5ILGA 2E2HL 4Q19A 4V0KA 3ON5A 3WWZA 3AILA 3GLRA 4QNRA 4E12A 3ZWKA 1QYVA 1IBLB 3SEQA 1EX9A 2RB5A 4D4JA 3CWZA 4HNTA 4PX9A 5JCXA 2HQOA 2OCXA 3OOEA 2PY6A 3VUFA 1U7TA 3JQAA 3O73A 1LFAA 1ZM9A 5F3DA 2C94A 5H59A 2J0EA 2WF7A 4INJA 3B2EA 4WKNA 2DETA 2X8WA 3G0OA 3AR3A 4ME6A 2D1RA 4ROTA 4JJ8A 2HK7A 4LNAA 1CERA 2BP7B 4NFYA 4B2PA 5KKAA 2JAWA 2X6QA 5KSPA 1BXRA 2BM1A 5C8XA 2WKPA 3KS9A 3KFVA 3I4FA 1NAIA 2FMFA 5LU8A 5AHKA 3OPYI 3LSTA 1JFRA 3NTOA 2OGTA 4OHXA 2I8LA 1R00A 1M6EX 2AWOA 4RVUA 2AX4A 3GBPA 2OFPA 4JS0A 2ABWA 1PWHA 1J56A 3EUEA 4TRRA 3VGJA 5BORA 1TEXA 3LBFA 1P5ZB 2GCPA 3L6UA 3VNRA 4ZYXA 1JALA 2ZYTX 2JGNA 3WLIA 4UHHA 4NENA 4Q9LA 5JPIA 1FZQA 3LTNC 5IANA 3FGOA 2C1EA 4IHJB 4OFXA 3OTHA 4UHJA 2ZVJA 2VHXA 4ZOLA 4D0GA 4EG4A 1KWGA 5HWSA 3QLEA 3SICE 3ZC3A 1JDUA 3LM8A 2H16A 2HDHA 1FVXA 1TLFA 2JI6A 2DSXA 2YWFA 2I6UA 4NNPA 4Z9YA 1XE3A 4QE3A 1ZM4A 1OCEA 1MRNA 1OXMA 2XGSA 1W94A 1EP3B 1DBQA 1JJ7A 1GJRA 4JR0A 3E22A 2AFRA 2Q29A 3MVEA 4O8ZA 1TEZA 4A03A 3HDYA 3KV3O 2PKCA 2ZANA 3HBMA 4NK4A 1U5AA 2VSXA 3I2IA 1TZ2A 5AVJA 1KK0A 1T8PA 4GP7A 2C95A 4BFXA 4D6PA 5BQXA 3HL0A 5JNWA 3GG2A 4FMCB 4PYRA 2JI7A 4QPDA 1ZU4A 1G3QA 1USUA 2XUHA 3GJSA 5FLKA 4KR9A 2QL5A 1W88B 5CLFA 1XBTA 3KDPA 4D0LB 4V196 2MYNA 4BNTA 2YVQA 2FR8C 4M7PA 1VZGA 3B1ZA 1L5FA 3CUWA 4B73A 3KETA 1GG5A 1YHZA 3RC1A 1HT3A 2H0RA 3E9CA 1KSJA 1Q7RA 1E1RD 1VP3A 3KJXA 3OQIB 4Q4JA 4X8MA 4AYWA 1I50L 1FDSA 3IAXA 3O26A 4R51A 3GJYA 2VEDA 3GGGA 4RTJA 2P6NA 4ZRMA 2KS6A 2VDVE 3FVQA 3UHAA 4LI3X 5AJVB 5IJ0A 4GIBA 3T12A 3OZBA 2NUAA 2A78A 1RXCA 3SQDA 3KTAB 1C50A 1JB1A 4WBNB 2RHJA 2W58A 1QE3A 4ECAA 3Q9SA 3TOXA 1JWAB 2VPZA 4L0QA 3LRPA 2O3JA 3PXBA 4LRUA 1EXNA 3A3YA 4O0MA 4RORA 4D8UA 3DMTC 4ILKA 3E5RA 1Z0FA 2ODTX 3CNBA 1CP2A 5DX1A 2V9CA 1EQAA 2GYUA 1J5XA 2WBLC 3HBAA 3CQ9A 4C4TA 3TCKA 1NW3A 3CSUA 5HKLA 1SCQA 4LBYA 3TUJC 2DRIA 4EKIA 3EXEB 3RB8A 3K16A 2FRXA 3VDXA 1A76A 1VL8A 2GARA 1NFFA 2EP5A 2G1PA 3UAGA 3WLRA 3P2IA 4RWEA 4XE5A 4W9NC 1WXIA 1QX4A 2EJBA 1WG8A 3CEPB 4FCVA 5EFZA 4ZT6A 2HL6A 3HY6A 2ZSJA 3EVBA 4KG7A 4PG5A 5AH0A 2ZJAA 2WNIA 5BOVA 2ZSBA 3PK0A 2SECE 3OQIA 4TRMA 4R5MA 4FK8A 1Z7EA 4E09A 2DF8A 3L05A 1IN1A 4UM9B 3G7SA 4NPAA 2R7AA 1C7EA 2YOGA 2GWHA 3LBAA 1D2MA 5E95A 3RK1A 4BUJA 3GNTA 4DUPA 4F91B 4LY0A 1QIIA 1XQVA 4GRAA 5DWQA 5IKEA 1SUSA 2CCGA 1GUAA 4IRXA 2O1SA 4UMDA 2OC4A 3MPUA 4PZDA 3X1JA 2YFYA 5BT8A 1D2NA 1HURA 3NGLA 1PZHA 1PL0A 3RNOA 2GPYA 5IZCC 1TYDE 2H2DA 4D97A 3SS7X 2QM7A 3FZGA 3GROA 1G8GA 1OFGA 1SA0B 5CVVA 4IL5A 2YV1A 4WASA 3QZUA 5FWYA 5LQMA 1RQPA 3IILA 4OXIA 4QOIA 5DHFA 5IDYA 1PJTA 2NSLA 1OAAA 1WBJB 5DP1A 2C9YA 3H9GA 1FSGA 5KNDH 1UC9A 2AG5A 3WZ2A 3V7FA 1TVEA 2V58A 5BUQA 2A69D 3GJ8A 4HWRA 2YWGA 4XM2A 4MWGA 4P3OA 2NPFA 4LGVA 4EKDA 2H5EA 1UBUS 3MINB 3DAGA 2AOUA 3EDMA 1AV6A 2OFOA 4B34A 2HADA 1G9TA 3AF4A 5IMBA 2P9ZA 2XB9A 5K51A 3L8GA 1OZHA 2YU9L 1PLKA 2AWNA 4JUFA 4M86A 3VXKA 3UK1A 3WLTA 4YMGA 4ZT5A 1CIVA 5ICMA 1IVNA 4NZOA 3T3DA 1SWVA 3WO1A 4IKPA 2IELA 4AJ1A 1TVMA 1XNRB 2HXYA 1BHJA 1JIJA 2IKSA 1NMQA 2VYVD 3EDOA 3MJ4A 3L40A 4HH1A 4ZAFA 3WVNA 3MTEA 5TARA 3F9RA 2JAUA 4Y7CA 2QPOA 5IAJA 4QT0A 3AGPA 3JVDA 4HDRB 3ND8A 2Y1KA 1Z0DA 1TJ5A 4R7GA 5JJ5A 1A2OA 1D2RA 3PFCA 1PEAA 3IV7A 4L5AA 2ZJFA 3DP7A 2CB9A 4UUQA 5SZHB 2D5CA 4A82A 4ER5A 3NDPA 3WYBA 3PEYA 5C8ZA 4I1RA 2J41A 3IUYA 1N1GA 1OKKD 1ZOLA 1SVSA 1P9OA 2AR0A 2AYXA 2V8OA 3DLAA 1WTCA 2I6QA 4LYEA 2O23A 3DE6X 1PR9A 1LTLA 4FHZA 1FMTA 2CLCX 3Q88A 3UT5B 4HJXA 4QGHA 1RWKA 3KC2A 5BW4A 3BL8A 5IJ0B 4CM5A 2BEJA 5DNVA 1JV2B 4RJLA 1WU7A 1JLHA 1ORTA 1QGDA 3KTAA 1QORA 4COOA 5JSZB 5FLXA 2OILA 1P1CA 2C29D 1G2PA 2Q8NA 1DC6A 3GFGA 5U1PA 1NW7A 3EJ6A 1T9OA 2RH9B 3GFOA 3WJ7A 2D4AA 4Q3AA 3T5PA 1BHQ1 1YZGA 1OA1A 2ADOA 1QTRA 3BL6A 4HAXA 4LHWA 2B63L 4YPOA 2V1UA 4MQFA 3CH7A 4YAWA 3VNSA 3H5NA 5IJWA 4DG9A 2DWUA 4RBNA 2NVQL 4IDDA 5ENDA 3K0FB 3LWZA 4ND8B 4WZ6A 1YS2X 1QH8A 5GVSA 1E2IA 3FMIA 4HQNA 2ZJ3A 4R98A 2GF2A 4KPUB 1L1FA 3H6GA 3SQMA 2ZS9A 4A27A 1YS7A 4LRXA 3ZW9A 2JGIA 2ZBRA 1IE3A 3TAXA 4HDRA 2V4MA 1FRZA 2PMKA 2I4LA 4G85A 1KZ9A 3FDJA 4MVJM 3NAMA 5KU7A 1UFRA 2E6KA 2C78A 2F1KA 2MHCA 3TE7A 1K06A 2BGKA 1ICIA 4FFNA 1C5KA 1YB6A 1Y8ZA 2ETVA 1FDVA 4YIHA 5JCJA 1O4WA 3OH8A 2R8ZA 4BFLA 3CR7A 1P9RA 3F2VA 5B4VA 1PZMA 1F5SA 1L9KA 3W5JA 1EP9A 1M2EA 5EE1A 1KZ7B 1YZVA 2Q3HA 4I55F 4TUYF 4WXPA 3GWGA 3PE3A 2H0AA 4FVTA 2EW8A 1WB6A 3DZIA 5AW0A 3ITNA 1DWPA 1UBRS 4C01A 3UMMA 4DV7B 1RQRA 2ZR8A 3KTFA 3PPIA 4UM8B 3OUZA 4CKEB 4Z2YA 3L04A 1V4VA 2AMYA 5SV2A 1KFBB 2X8BA 4JASB 4AWBA 2VDPB 4RJTA 2NADA 1BE1A 5ITVA 3KZKA 1YMUA 4N0PA 1TZCA 2WYOA 1NQUA 2H9IA 2NT3A 4QX6A 4C87A 2BLNA 2ISQA 1UXIA 1QAOA 1D9XA 2B35A 4Y2VA 4TPUA 4RH3A 4U8GA 3GJZA 2HGZA 1QU2A 1ZDMA 3WRYA 1JDPA 5C3UA 1JILA 2AS0A 2KN9A 1KDOA 3TW8A 3LBYA 4BVGA 2ZROA 1LU9A 4EGAA 5K03A 3DZGA 3J81A 4TKVA 2XD4A 3KSMA 2RE8A 5DGDA 3UA3A 3OQOA 5I6DA 1S30A 3FTDA 3ULKA 2TSYB 3U60B 2XMZA 1DIGA 4DEXA 5C4GB 4ARSA 1ZA2A 1P39A 4OMDA 3D3KA 3LNTA 1K97A 2VNHA 4CT0A 1XZHA 1PK9A 2YN4A 6AT1A 5ECGC 4DWWA 3BH0A 1SZJG 3U3ZA 4AHYA 2QYOA 3U44B 3NHKA 4CF4A 5IBQA 1DB3A 3BMNA 2WHPB 4S1VA 5THKA 5T57A 5BO5A 1VYUA 3AEKA 5REQA 1NJFA 5IJZA 2WJHA 3HZOA 3OZGA 1P3DA 1KFJB 2CXNA 3KAPA 2F17A 2C98A 5KC9A 3O2JA 2ZEJA 2QMUA 3AU8A 3K0BA 4UAVA 4G9GA 3TQFA 4FDTA 5TPZD 5I9SA 3KYCA 1RAAA 1PX0A 1A4UA 2JARA 4MRAA 5FEUA 3NC1C 3RU2A 2WT4A 4XIGS 3K9NA 5CA0F 1E9AA 2L0XA 5E2IA 2R7LA 2WUEA 4LHXA 1EVYA 3K0HA 4RS3A 4BBRL 1SZDA 5GQSA 3KKZA 5DBGA 1E94E 2HNAA 5EP1A 3RT9A 5EJ9A 2DLDA 3IO3A 3UAVA 1CLEA 1JFLA 2R3SA 1DWOA 3KQMA 4WAUA 2UXBB 2FHPA 1UKEA 3JV7A 3LSYA 4OD0A 3WICA 5KKCA 3SQOA 5F2NA 4JAFA 3N0WA 4Z9FA 4YAIA 2ZWMA 2HH9A 2P4SA 1RRPA 2VJMB 4G0WA 4DQXA 4ZT2A 5H83A 3T7IA 3WB2A 1WAMA 1YI0A 2QLBA 3PC8C 4DM3A 2QY6A 2C8VA 3DAHA 3F3SA 5LLSA 1M7BA 1GILA 4J16C 4FGZA 4UNPA 4URZR 1E79A 3N39C 4BRWA 1R37A 3GZTB 1W36D 2VL7A 1I13A 3UXYA 1KMHA 2BCJQ 3RTCA 5ALVA 2BEVB 2CC2A 2B6HA 1MLDA 1KYTA 1PT6A 4OHRA 5H9VA 3RIEA 3W5UA 4YX9A 1GGEA 4LISA 5TE9A 3KLBA 3G3EA 4JENA 3HUEA 1KBOA 2WJJA 4CCYB 4FUTA 4I2VA 4DANA 4XM1A 3SLRA 5JLAA 2DPYA 2FA9A 4BO6A 1WUYA 4MDEA 4GKKB 3EBOA 3PEVA 1N2JA 2ZULA 3O2QB 4JQOA 4XDGA 5DRYA 3V8QA 2MWMA 3M4XA 1B8UA 2BGGA 1U0SY 4PZPA 4ENPA 2MDTA 2VZ8A 1VYVA 2IA5A 3Q9NA 1EWVA 3TIVA 3FM9A 2P2NA 2A9OA 2VJAA 5K4GA 2Z9DA 5G53C 3THYA 1QH1B 2ASVA 5IEBA 3K9LA 5C31A 1QG0A 1TZMA 1WEKA 3IAUA 3QUAA 2SCUB 1T4CA 1HLPA 3W2TA 3RUAA 2F1HA 3K4HA 4A7PA 3PC2A 4EY8A 4F6RB 3RFFA 2DFLA 3UN1A 1IONA 1EVKA 4PG4A 5G3YA 1LRKA 3QLVA 4WLFA